Sample records for airbus model a330-200
-
77 FR 37797 - Airworthiness Directives; Airbus Airplanes
2012-06-25
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... Airbus Model A330-200 series airplanes; Airbus Model A330-200 Freighter series airplanes; Airbus Model A330-300 series airplanes; Airbus Model A340-200 series airplanes; and Airbus Model A340-300 series...
-
76 FR 13075 - Airworthiness Directives; Airbus Model A330-243F Airplanes
2011-03-10
... Airworthiness Directives; Airbus Model A330-243F Airplanes AGENCY: Federal Aviation Administration (FAA... recent in-service event the flight crew of a Trent 700 powered A330 aircraft [[Page 13076
-
78 FR 21227 - Airworthiness Directives; Airbus Airplanes
2013-04-10
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... Airbus Model A330-200, A330-200 Freighter, A330-300, A340-200, and A340-300 series airplanes; and Model... that, due to similar design, the enhanced MLG bogie pivot pin (Airbus modification 54500) could also be...
-
78 FR 32347 - Airworthiness Directives; Airbus Airplanes
2013-05-30
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... Airbus Model A330-200 Freighter, A330-200, A330-300, A340-200, A340- 300, A340-500, and A340-600 series... following service information: Airbus Mandatory Service Bulletin A330-56-3009, Revision 02, including...
-
78 FR 53640 - Airworthiness Directives; Airbus Airplanes
2013-08-30
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... Airbus Model A330-200 Freighter series airplanes; Model A330-200 and - 300 series airplanes, and Model... of the forward or aft cargo door. To address this condition, Airbus issued four separate Alert...
-
77 FR 65799 - Airworthiness Directives; Airbus Airplanes
2012-10-31
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... Airbus Model A330-200 freighter series airplanes, Model A330-200 and - 300 series airplanes, and Model... [Amended] 0 2. The FAA amends Sec. 39.13 by adding the following new AD: 2012-21-20 Airbus: Amendment 39...
-
78 FR 47537 - Airworthiness Directives; Airbus Airplanes
2013-08-06
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... all Airbus Model A330-200 and -300 series airplanes, and Model A340-200 and -300 series airplanes. AD... by application of Airbus modification 49590/Service Bulletin (SB) A330-27-3085 [or SB A340-27-4089...
-
78 FR 27015 - Airworthiness Directives; Airbus Airplanes
2013-05-09
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... Airbus Model A330-200 and A330-300 series airplanes, and Model A340-200 and A340-300 series airplanes... seal on a solenoid. This AD requires, depending on airplane configuration, modifying three flight...
-
78 FR 17071 - Airworthiness Directives; Airbus Airplanes
2013-03-20
... Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of Transportation (DOT). ACTION: Final rule. SUMMARY: We are adopting a new airworthiness directive (AD) for certain Airbus Model A330-200, -300, and -200 Freighter series airplanes; and all Airbus Model A340-200 and -300 series...
-
78 FR 60798 - Airworthiness Directives; Airbus Airplanes
2013-10-02
...-0363; Directorate Identifier 2013-NM-031-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes... directive (AD) for all Airbus Model A330-200, -300 and -200 Freighter series airplanes, and Model A340-200... information identified in this proposed AD, contact Airbus SAS--Airworthiness Office--EAL, 1 Rond Point...
-
77 FR 66760 - Airworthiness Directives; Airbus Airplanes
2012-11-07
...-1162; Directorate Identifier 2012-NM-002-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes...: We propose to adopt a new airworthiness directive (AD) for all Airbus Model A330-200 Freighter, A330... information identified in this proposed AD, contact Airbus SAS--Airworthiness Office--EAL, 1 Rond Point...
-
78 FR 29261 - Airworthiness Directives; Airbus Airplanes
2013-05-20
...-0424; Directorate Identifier 2013-NM-014-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes...: We propose to adopt a new airworthiness directive (AD) for all Airbus Model A330-200 Freighter, A330... this proposed AD, contact Airbus SAS, Airworthiness Office--EAL, 1 Rond Point Maurice Bellonte, 31707...
-
77 FR 51729 - Airworthiness Directives; Airbus Airplanes
2012-08-27
...-0810; Directorate Identifier 2011-NM-195-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes...: We propose to adopt a new airworthiness directive (AD) for certain Airbus Model A330-200, A330-300... identified in this proposed AD, contact Airbus SAS--Airworthiness Office--EAL, 1 Rond Point Maurice Bellonte...
-
77 FR 19071 - Airworthiness Directives; Airbus Airplanes
2012-03-30
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... directive (AD) for certain Airbus Model A330-200, A330-300, A340-500, and A340-600 series airplanes. This AD...: During structural part assembly in Airbus production line, some nuts Part Number (P/N) ASNA2531-4 were...
-
78 FR 78694 - Airworthiness Directives; Airbus Airplanes
2013-12-27
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... all Airbus Model A330-200 and -300 series airplanes, and Model A340-200 and -300 series airplanes. AD... certain check valves in the [[Page 78695
-
78 FR 37498 - Airworthiness Directives; Airbus Airplanes
2013-06-21
...-0463; Directorate Identifier 2012-NM-165-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes...: We propose to adopt a new airworthiness directive (AD) for certain Airbus Model A330-200, -200... holidays. For service information identified in this proposed AD, contact Airbus SAS--Airworthiness Office...
-
78 FR 25902 - Airworthiness Directives; Airbus Airplanes
2013-05-03
...-0363; Directorate Identifier 2013-NM-031-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes...: We propose to adopt a new airworthiness directive (AD) for all Airbus Model A330-200, -300 and -200... Friday, except Federal holidays. For service information identified in this proposed AD, contact Airbus...
-
77 FR 15644 - Airworthiness Directives; Airbus Airplanes
2012-03-16
...-0192; Directorate Identifier 2011-NM-225-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes...: We propose to adopt a new airworthiness directive (AD) for certain Airbus Model A330-200 and -200... information identified in this proposed AD, contact Airbus SAS--Airworthiness Office--EAL, 1 Rond Point...
-
77 FR 65146 - Airworthiness Directives; Airbus Airplanes
2012-10-25
...-1106; Directorate Identifier 2012-NM-084-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes...: We propose to adopt a new airworthiness directive (AD) for all Airbus Model A330-200 Freighter, -200..., contact Airbus SAS--Airworthiness Office--EAL, 1 Rond Point Maurice Bellonte, 31707 Blagnac Cedex, France...
-
78 FR 31386 - Airworthiness Directives; Airbus Airplanes
2013-05-24
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of...) for all Airbus Model A330-200 and -300 series airplanes; and Model A340-200, -300, -500, and -600 series airplanes. That AD currently requires a one-time detailed inspection of both main landing gear...
-
77 FR 76228 - Airworthiness Directives; Airbus Airplanes
2012-12-27
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... Airbus Model A330-300 series airplanes and Model A340-200 and -300 series airplanes. This AD was prompted... operational test. This [EASA] AD also requires reporting operational test results to Airbus. You may obtain...
-
78 FR 53635 - Airworthiness Directives; Airbus Airplanes
2013-08-30
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Final rule. SUMMARY: We are adopting a new airworthiness directive (AD) for certain Airbus Model A330-200 and... Sec. 39.13 by adding the following new airworthiness directive (AD): 2013-17-03 Airbus: Amendment 39...
-
78 FR 52405 - Airworthiness Directives; Airbus Airplanes
2013-08-23
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... Airbus Model A330-300, A340-200, and A340-300 series airplanes. This AD was prompted by a determination... Airbus: Amendment 39-17549. Docket No. FAA-2013-0335; Directorate Identifier 2012-NM-187-AD. [[Page 52407...
-
78 FR 29666 - Airworthiness Directives; Airbus Airplanes
2013-05-21
...-0422; Directorate Identifier 2012-NM-097-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes...: We propose to adopt a new airworthiness directive (AD) for certain Airbus Model A330-200 and -300... information identified in this proposed AD, contact Airbus SAS--Airworthiness Office--EAL, 1 Rond Point...
-
77 FR 75825 - Airworthiness Directives; Airbus Airplanes
2012-12-26
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... Airbus Model A330-200 and -300 series airplanes. This AD was prompted by a report of a prematurely... [Amended] 0 2. The FAA amends Sec. 39.13 by adding the following new AD: 2012-25-12 Airbus: Amendment 39...
-
78 FR 46306 - Airworthiness Directives; Airbus Airplanes
2013-07-31
...-0632; Directorate Identifier 2013-NM-045-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes...: We propose to adopt a new airworthiness directive (AD) for all Airbus Model A330-200 and -300 series... identified in this proposed AD, contact Airbus SAS, Airworthiness Office--EAL, 1 Rond Point Maurice Bellonte...
-
78 FR 65187 - Airworthiness Directives; Airbus Airplanes
2013-10-31
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... Airbus Model A330-300 series airplanes and Model A340-200 and -300 series airplanes. This AD was prompted..., and possibly resulting in loss of control of the airplane. DATES: This AD becomes effective December 5...
-
78 FR 46543 - Airworthiness Directives; Airbus Airplanes
2013-08-01
...-0665; Directorate Identifier 2012-NM-082-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes...: We propose to adopt a new airworthiness directive (AD) for all Airbus Model A330-300 series airplanes and Model A340-200 and -300 series airplanes. This proposed AD was prompted by reports of corrosion...
-
78 FR 69594 - Airworthiness Directives; Airbus Airplanes
2013-11-20
...-0972; Directorate Identifier 2002-NM-009-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes... airworthiness directive (AD) for all Airbus Model A330 series airplanes. The NPRM would have required... rulemaking (NPRM) for a new AD for all Airbus Model A330 series airplanes. The NPRM, FAA Docket No. FAA-2013...
-
Reliability analysis of Airbus A-330 computer flight management system
Fajmut, Metod
2010-01-01
Diploma thesis deals with digitized, computerized flight control system »Fly-by-wire« and security aspects of the computer system of an aircraft Airbus A330. As for space and military aircraft structures is also in commercial airplanes, much of the financial contribution devoted to reliability. Conventional aircraft control systems have, and some are still, to rely on mechanical and hydraulic connections between the controls on aircraft operated by the pilot and control surfaces. But newer a...
-
78 FR 78294 - Airworthiness Directives; Airbus Airplanes
2013-12-26
...-1031; Directorate Identifier 2013-NM-155-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes... Freighter, and A330-300 series airplanes; and Model A340-200, A340-300, A340-500, and A340-600 series airplanes. This proposed AD was prompted by the failure of the generator control unit-constant speed motor...
-
78 FR 68352 - Airworthiness Directives; Airbus Airplanes
2013-11-14
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... Airbus Model A330-223F, -223, -321, -322, and -323 airplanes. This AD was prompted by fatigue load... this AD, contact Airbus SAS, Airworthiness Office--EAL, 1 Rond Point Maurice Bellonte, 31707 Blagnac...
-
78 FR 18925 - Airworthiness Directives; Airbus Airplanes
2013-03-28
...-0212; Directorate Identifier 2012-NM-116-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes...: We propose to adopt a new airworthiness directive (AD) for all Airbus Model A330-223F, -223, -321...., Monday through Friday, except Federal holidays. For Airbus service information identified in this...
-
78 FR 60667 - Airworthiness Directives; Airbus Airplanes
2013-10-02
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... all Airbus Model A318, A319, A320, and A321 series airplanes. AD 2012- 26-51 required revising the...''), to correct an unsafe condition for the specified products. The MCAI states: Recently, an Airbus A330...
-
77 FR 26998 - Airworthiness Directives; Airbus Airplanes
2012-05-08
...-0428; Directorate Identifier 2011-NM-078-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes...: We propose to adopt a new airworthiness directive (AD) for all Airbus Model A330-243, -243F, -342..., between 9 a.m. and 5 p.m., Monday through Friday, except Federal holidays. For Airbus service information...
-
78 FR 26716 - Airworthiness Directives; Airbus Airplanes
2013-05-08
...) of this AD. (1) Within 1,000 flight cycles since the embodiment of Airbus Service Bulletin A330-29-3101 or A340-29-4078 but no earlier than 700 flight cycles after the embodiment of Airbus Service...
-
78 FR 71992 - Airworthiness Directives; Airbus Airplanes
2013-12-02
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... certain Airbus Model A318-100 and A319-100 series airplanes, A320-111 airplanes, A320-200 series airplanes... identified in this AD, contact Airbus, Airworthiness Office--EIAS, 1 Rond Point Maurice Bellonte, 31707...
-
78 FR 79292 - Airworthiness Directives; Airbus Airplanes
2013-12-30
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... directive (AD) 2011-24-09 which applied to certain Airbus Model A340-200 and A340-300 series airplanes. AD... AD, contact Airbus SAS-- Airworthiness Office--EAL, 1 Rond Point Maurice Bellonte, 31707 Blagnac...
-
78 FR 66861 - Airworthiness Directives; Airbus Airplanes
2013-11-07
...-0834; Directorate Identifier 2012-NM-045-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes... 2004-11-08, AD 2004-13-25, AD 2004-18-14, AD 2008-06-07, and AD 2012-04-07 that apply to certain Airbus... Airbus Model A340-200, -300, -500, and -600 series airplanes from the applicability. We are proposing...
-
78 FR 28159 - Airworthiness Directives; Airbus Airplanes
2013-05-14
...-0418; Directorate Identifier 2012-NM-200-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes...: We propose to adopt a new airworthiness directive (AD) for certain Airbus Model A300 series airplanes; Model A300 B4-600, B4-600R, and F4-600R series airplanes, and Model A300 C4-605R Variant F airplanes...
-
77 FR 39186 - Airworthiness Directives; Airbus Airplanes
2012-07-02
...: We propose to adopt a new airworthiness directive (AD) for all Airbus Model A318, A319, A320, and... identified in this proposed AD, contact Airbus, Airworthiness Office--EAS, 1 Rond Point Maurice Bellonte... 200, Suite 400, College Park, Georgia 30337; telephone 678-228-8153; fax 404-599-0041; email techpubs...
-
76 FR 24351 - Airworthiness Directives; Airbus Model A340-200 and -300 Series Airplanes
2011-05-02
.... Register in the future. Differences Between the AD and the MCAI or Service Information We have reviewed the... described in Airbus A340 Airworthiness Limitations Items Document Ref: AI/SE-M4/95A.0051/97, Issue 10, dated...
-
77 FR 67263 - Airworthiness Directives; Airbus Airplanes
2012-11-09
... to correct an unsafe condition for the specified products. The MCAI states: During shop visit... first installed on an airplane: Before further flight, do the actions in Figure A-FBBAA-Sheet 03, Flow... Figure A-FBBAA-Sheet 02, Flow Chart, of Airbus Mandatory Service Bulletin A330-71-3025, excluding...
-
78 FR 22432 - Airworthiness Directives; Airbus Airplanes
2013-04-16
... electrical rudder], through Airbus Service Bulletin (SB) A330-27-3176, --software standard P12A/M21A on FCPC.... Since we issued that AD, we have determined that new software standards for the flight control primary.... This proposed AD would require that operators modify or replace all three FCPCs with new software...
-
78 FR 41280 - Airworthiness Directives; Airbus Airplanes
2013-07-10
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... Airbus Model A319-112, -113, and -132 airplanes; Model A320-211, -212, -214, -231, and -232 airplanes... A319 aeroplane on which Airbus modification (mod.) 22058 had been embodied in production. Airbus mod...
-
2010-02-23
... Airworthiness Directives; Airbus Model A310-203, -221, -222 Airplanes; and Model A300 F4-605R and -622R...-222 airplanes, all serial numbers. (2) Airbus Model A300 F4-605R and A300 F4-622R airplanes, all...
-
7 CFR 330.200 - Movement of plant pests regulated; permits required.
2010-01-01
... 7 Agriculture 5 2010-01-01 2010-01-01 false Movement of plant pests regulated; permits required... AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE FEDERAL PLANT PEST REGULATIONS; GENERAL; PLANT PESTS; SOIL, STONE, AND QUARRY PRODUCTS; GARBAGE Movement of Plant Pests § 330.200 Movement of...
-
77 FR 42952 - Airworthiness Directives; Airbus Airplanes
2012-07-23
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... Airbus Model A318-112 and -121 airplanes; Model A319-111, -112, -115, - 132, and -133 airplanes; Model... MCAI states: During structural part assembly in Airbus production line, some nuts Part Number (P/N...
-
77 FR 64701 - Airworthiness Directives; Airbus Airplanes
2012-10-23
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... Airbus Model A300 series airplanes; Model A310 series airplanes; and Model A300 B4-600, B4-600R, and F4... that the AD be effective after Airbus completes certifying the improved design for the fuel pump half...
-
78 FR 9787 - Airworthiness Directives; Airbus Airplanes
2013-02-12
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... Airbus Model A300 B4-600, B4-600R, and F4-600R series airplanes, and Model A300 C4-605R Variant F airplanes (collectively called Model A300- 600 series airplanes); and Airbus [[Page 9788
-
78 FR 70003 - Airworthiness Directives; Airbus Airplanes
2013-11-22
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of proposed rulemaking (NPRM). SUMMARY: We propose to adopt a new airworthiness directive (AD) for all Airbus Model A300 series airplanes; Airbus Model A300 B4-600, B4-600R, and F4-600R series airplanes, and Model...
-
2013-12-17
...-0899; Notice No. 25-13-15-SC] Special Conditions: Airbus, Model A350-900 Series Airplane; Control... of proposed special conditions. SUMMARY: This action proposes special conditions for the Airbus Model..., data, or views. The most helpful comments reference a specific portion of the proposed special...
-
75 FR 39863 - Airworthiness Directives; Airbus Model A310 Series Airplanes
2010-07-13
... condition as: Analysis performed in the frame of the Extended Service Goal has led Airbus to modify the... performed in the frame of the Extended Service Goal has led Airbus to modify the inspection programme...) states: Analysis performed in the frame of the Extended Service Goal has led Airbus to modify the...
-
77 FR 19059 - Airworthiness Directives; Airbus Airplanes
2012-03-30
... Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of Transportation (DOT... all Airbus Model A340-500 and Model -600 series airplanes. This AD requires performing repetitive high... Airbus has issued Mandatory Service Bulletin A340-57-5029, including Appendices 01 and 02, dated February...
-
77 FR 73343 - Airworthiness Directives; Airbus Airplanes
2012-12-10
...-1224; Directorate Identifier 2012-NM-112-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes...: We propose to adopt a new airworthiness directive (AD) for all Airbus Model A300 B4-600, B4-600R, and... holidays. For Airbus service information identified in this proposed AD, contact Airbus SAS-EAW...
-
78 FR 52414 - Airworthiness Directives; Airbus Airplanes
2013-08-23
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... Airbus Model A320-214, -232 and -233 airplanes; and Model A321-211, - 213, and -231 airplanes. This AD... Service Information Airbus requested that we revise the NPRM (77 FR 63270, October 16, 2012) to reflect...
-
77 FR 24137 - Airworthiness Directives; Airbus Airplanes
2012-04-23
... Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Final rule... Register. That AD applies to all Airbus Model A300 B4-600, B4-600R, and F4-600R series airplanes, Model... Airbus Model A300 B4-600, B4- 600R, and F4-600R series airplanes, Model A300 C4-605R Variant F airplanes...
-
77 FR 40485 - Airworthiness Directives; Airbus Airplanes
2012-07-10
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... (AD) for all Airbus Model A300 series airplanes; all Model A300 B4-600, B4-600R, and F4-600R series... new AD: 2012-13-06 Airbus: Amendment 39-17108. Docket No. FAA-2012-0040; Directorate Identifier 2011...
-
78 FR 9581 - Airworthiness Directives; Airbus Airplanes
2013-02-11
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... Airbus Model A300 B4-600, B4-600R, and F4-600R series airplanes, and Model A300 C4-605R Variant F...-03-11 Airbus: Amendment 39-17346. Docket No. FAA-2012-1002; Directorate Identifier 2012-NM-052-AD. (a...
-
77 FR 16430 - Airworthiness Directives; Airbus Airplanes
2012-03-21
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... Airbus Model A300 B4-600, B4-600R, and F4-600R series airplanes, and Model C4-605R Variant F airplanes.../N A5231007000600. This [EASA] AD has been corrected to make clear that the use of Airbus SB A310...
-
78 FR 15874 - Airworthiness Directives; Airbus Airplanes
2013-03-13
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... Airbus Model A300 B4-600, B4-600R, and F4-600R series airplanes, and Model A300 C4-605R Variant F... ground threat avoidance, an Airbus A310 aeroplane experienced an uncommanded slide back of the co-pilot...
-
77 FR 75833 - Airworthiness Directives; Airbus Airplanes
2012-12-26
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of...) for certain Airbus Model A300 B4-2C, B4-103, and B4-203 airplanes; and Model A300 B4-601, B4-603, B4... accordance with Airbus SB A300-57-6053 (Mod. 10453). Therefore and pending completion of the full analysis...
-
77 FR 51717 - Airworthiness Directives; Airbus Airplanes
2012-08-27
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of... applies to certain Airbus Model A300 B4-2C, B4-103, and B4- 203 airplanes; and Model A300 B4-601, B4-603... information identified in this proposed AD, contact Airbus SAS--EAW (Airworthiness Office), 1 Rond Point...
-
77 FR 26937 - Airworthiness Directives; Airbus Airplanes
2012-05-08
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of...) for certain Airbus Model A300 B2-1C, B2K-3C, B2-203, B4-2C, B4-103, and B4-203 airplanes; and Model... Airbus Service Bulletins (SB) A300-57-0235 and A300-57-6088 * * *. Subsequently, new cases of cracks were...
-
78 FR 51058 - Airworthiness Directives; Airbus Airplanes
2013-08-20
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... certain Airbus Model A319 and A320 series airplanes. AD 2004-13-06 required repetitive detailed... and to allow extension of the interval between two consecutive inspections, Airbus validated an Eddy...
-
77 FR 7523 - Airworthiness Directives; Airbus Airplanes
2012-02-13
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... directive (AD) for all Airbus Model A340-600 series airplanes. This AD requires modifying the fire.... Relevant Service Information Airbus has issued Mandatory Service Bulletin A340-26-5020, including Appendix...
-
77 FR 73340 - Airworthiness Directives; Airbus Airplanes
2012-12-10
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), DOT. ACTION... earlier proposed airworthiness directive (AD) for all Airbus Model A318, A319, A320, and A321 series..., contact Airbus, Airworthiness Office--EAS, 1 Rond Point Maurice Bellonte, 31707 Blagnac Cedex, France...
-
78 FR 21230 - Airworthiness Directives; Airbus Airplanes
2013-04-10
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... Airbus Model A318, A319, and A320 series airplanes. This AD was prompted by fuel system reviews conducted..., Airbus developed a modification which includes installing Ground Fault Interrupters (GFI) into the centre...
-
78 FR 23105 - Airworthiness Directives; Airbus Airplanes
2013-04-18
... Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of Transportation (DOT). ACTION: Final rule. SUMMARY: We are adopting a new airworthiness directive (AD) for certain Airbus Model... Agency] has received a report via Airbus and Messier-Bugatti-Dowty Ltd, from a Maintenance repair...
-
77 FR 19067 - Airworthiness Directives; Airbus Airplanes
2012-03-30
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... directive (AD) for certain Airbus Model A321-131, -211, -212, and -231 airplanes. This AD requires a.... Relevant Service Information Airbus has issued Mandatory Service Bulletin A320-57-1120, Revision 01...
-
77 FR 12989 - Airworthiness Directives; Airbus Airplanes
2012-03-05
... Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of Transportation (DOT). ACTION: Final rule. SUMMARY: We are adopting a new airworthiness directive (AD) for certain Airbus Model.... Airbus carried out an investigation, demonstrating that the life limit of retraction brackets must be...
-
78 FR 54377 - Airworthiness Directives; Airbus Airplanes
2013-09-04
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... Airbus Model A318, A319, A320, and A321 series airplanes. This AD was prompted by reports that certain... accordance with the Accomplishment Instructions of Airbus Service Bulletin A320-27- 1214, including Appendix...
-
78 FR 64162 - Airworthiness Directives; Airbus Airplanes
2013-10-28
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... Airbus Model A318, A319, A320, and A321 series airplanes. This AD was prompted by a determination that...., Washington, DC. For service information identified in this AD, contact Airbus, Airworthiness Office--EIAS, 1...
-
77 FR 19065 - Airworthiness Directives; Airbus Airplanes
2012-03-30
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... directive (AD) for all Airbus Model A340-600 series airplanes. This AD requires a detailed inspection for.... Relevant Service Information Airbus has issued All Operators Telex A340-25A5191, dated January 18, 2011...
-
77 FR 65808 - Airworthiness Directives; Airbus Airplanes
2012-10-31
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... Airbus Model A320-214 and -232 airplanes. This AD was prompted by reports that medium-head fasteners were... installation of upper panels on Frame 35 in Airbus A320 final assembly line. Investigations revealed that...
-
77 FR 26996 - Airworthiness Directives; Airbus Airplanes
2012-05-08
...-0427; Directorate Identifier 2011-NM-202-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes...: We propose to adopt a new airworthiness directive (AD) for certain Airbus Model A320-214 and-232... Friday, except Federal holidays. For service information identified in this proposed AD, contact Airbus...
-
78 FR 39190 - Airworthiness Directives; Airbus Airplanes
2013-07-01
...-0543; Directorate Identifier 2012-NM-202-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes...: We propose to adopt a new airworthiness directive (AD) for all Airbus Model A318, A319, A320, and... Friday, except Federal holidays. For service information identified in this proposed AD, contact Airbus...
-
76 FR 72350 - Airworthiness Directives; Airbus Airplanes
2011-11-23
...-1253; Directorate Identifier 2011-NM-079-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes...: We propose to adopt a new airworthiness directive (AD) for certain Airbus Model A319, A320, and A321... Friday, except Federal holidays. For service information identified in this proposed AD, contact Airbus...
-
78 FR 32345 - Airworthiness Directives; Airbus Airplanes
2013-05-30
... Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of Transportation (DOT). ACTION: Final rule. SUMMARY: We are adopting a new airworthiness directive (AD) for all Airbus Model A300... FedEx requested that copies of Airbus Service Bulletin A300-53- 6170, dated May 16, 2011, be provided...
-
78 FR 14029 - Airworthiness Directives; Airbus Airplanes
2013-03-04
...-0096; Directorate Identifier 2012-NM-143-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes...: We propose to adopt a new airworthiness directive (AD) for certain Airbus Model A318-112, A319-111... Airbus, Airworthiness Office--EAS, 1 Rond Point Maurice Bellonte, 31707 Blagnac Cedex, France; telephone...
-
77 FR 66762 - Airworthiness Directives; Airbus Airplanes
2012-11-07
...-1159; Directorate Identifier 2012-NM-028-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes...: We propose to adopt a new airworthiness directive (AD) for certain Airbus Model A310-203, -204, -222... information identified in this proposed AD, contact Airbus SAS--EAW (Airworthiness Office), 1 Rond Point...
-
78 FR 79333 - Airworthiness Directives; Airbus Airplanes
2013-12-30
...-1066; Directorate Identifier 2013-NM-021-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes...: We propose to supersede airworthiness directive (AD) 2000-12- 12, for certain Airbus Model A300, A300... this proposed AD, contact Airbus SAS, Airworthiness Office--EAW, 1 Rond Point Maurice Bellonte, 31707...
-
78 FR 14647 - Airworthiness Directives; Airbus Airplanes
2013-03-07
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... (AD) for certain Airbus Model A310-204, -222, -304, -322, and -324 airplanes. This AD was prompted by... the Airbus A310 Airworthiness Limitation Section (ALS) Part 1 and bolts must be replaced at or before...
-
77 FR 16492 - Airworthiness Directives; Airbus Airplanes
2012-03-21
...-0291; Directorate Identifier 2011-NM-168-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes...: We propose to adopt a new airworthiness directive (AD) for certain Airbus Model A318-112, and -121... identified in this proposed AD, contact Airbus, Airworthiness Office--EAS, 1 Rond Point Maurice Bellonte...
-
78 FR 64156 - Airworthiness Directives; Airbus Airplanes
2013-10-28
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... directive (AD) for all Airbus Model A340-211 -212, -213, -311, -312, -313, -541, and -642 airplanes. This AD... information identified in this AD, contact Airbus SAS, Airworthiness Office--EAL, 1 Rond Point Maurice...
-
78 FR 19085 - Airworthiness Directives; Airbus Airplanes
2013-03-29
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... Airbus Model A318, A319, A320, and A321 series airplanes. This AD was prompted by reports of oil residue... (MCAI) states: During Airbus Final Assembly Line flight tests, AoA [angle of attack] data from two...
-
77 FR 60325 - Airworthiness Directives; Airbus Airplanes
2012-10-03
...-1253; Directorate Identifier 2011-NM-079-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes... directive (AD) that would supersede an existing AD for certain Airbus Model A318, A319, A320, and A321... Friday, except Federal holidays. For service information identified in this proposed AD, contact Airbus...
-
77 FR 64765 - Airworthiness Directives; Airbus Airplanes
2012-10-23
...-1105; Directorate Identifier 2012-NM-137-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes...: We propose to adopt a new airworthiness directive (AD) for all Airbus Model A318, A319, and A320... identified in this proposed AD, contact Airbus, Airworthiness Office--EAS, 1 Rond Point Maurice Bellonte...
-
77 FR 11793 - Airworthiness Directives; Airbus Airplanes
2012-02-28
...-0185; Directorate Identifier 2011-NM-001-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes...: We propose to adopt a new airworthiness directive (AD) for certain Airbus Model A300 B4-103, B4-203... Friday, except Federal holidays. For service information identified in this proposed AD, contact Airbus...
-
78 FR 71996 - Airworthiness Directives; Airbus Airplanes
2013-12-02
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... Airbus Model A318-112, A319-111, A319-112, A319-115, A319-132, and A319-133 airplanes. This AD was... developing this AD. We have considered the comments received. Request To Refer to Revised EASA AD Airbus...
-
77 FR 57003 - Airworthiness Directives; Airbus Airplanes
2012-09-17
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... Airbus Model A318, A319, and A320 series airplanes. This AD was prompted by a report of a torn out.... The FAA amends Sec. 39.13 by adding the following new AD: 2012-18-12 Airbus: Amendment 39-17189...
-
76 FR 69168 - Airworthiness Directives; Airbus Airplanes
2011-11-08
...-1225; Directorate Identifier 2010-NM-269-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes...: We propose to adopt a new airworthiness directive (AD) for certain Airbus Model A300 B4-2C, B4-103..., contact Airbus SAS-EAW (Airworthiness Office), 1 Rond Point Maurice Bellonte, 31707 Blagnac Cedex, France...
-
76 FR 62673 - Airworthiness Directives; Airbus Airplanes
2011-10-11
...-1066; Directorate Identifier 2011-NM-050-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes...: We propose to adopt a new airworthiness directive (AD), for certain Airbus Model A300 B2-1C, B2K-3C... Friday, except Federal holidays. For service information identified in this proposed AD, contact Airbus...
-
76 FR 68671 - Airworthiness Directives; Airbus Airplanes
2011-11-07
...-1170; Directorate Identifier 2010-NM-264-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes...: We propose to adopt a new airworthiness directive (AD) for all Airbus Model A300 B4-600, B4-600R, and... Friday, except Federal holidays. For Airbus service information identified in this proposed AD, contact...
-
78 FR 78705 - Airworthiness Directives; Airbus Airplanes
2013-12-27
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... all Airbus Model A318 series airplanes, Model A319 series airplanes, Model A320 series airplanes, and Model A321 series airplanes. AD 2010- 24-07 required repetitive inspections of the 80VU rack lower...
-
75 FR 57880 - Airworthiness Directives; Airbus Model A310 Series Airplanes
2010-09-23
... docket. Relevant Service Information Airbus has issued Mandatory Service Bulletin A310-27-2099, Revision... Service Bulletin A310-27-2099, dated February 17, 2006; or Airbus Mandatory Service Bulletin A310-27-2099...- 2099, Revision 01, dated March 21, 2008. Note 1: For the purposes of this AD, a detailed inspection is...
-
77 FR 59149 - Airworthiness Directives; Airbus Airplanes
2012-09-26
...-1002; Directorate Identifier 2012-NM-052-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes...: We propose to adopt a new airworthiness directive (AD) for certain Airbus Model A300 B4-600, B4-600R...: Airbus: Docket No. FAA-2012-1002; Directorate Identifier 2012-NM- 052-AD. (a) Comments Due Date We must...
-
78 FR 37437 - Airworthiness Directives; Airbus Airplanes
2013-06-21
... Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of Transportation (DOT... Airbus Model A318, A319, A320, and A321 series airplanes. That AD currently requires one-time and... affected by AOT A320-55-1039 and Airbus SB A320-55-1035, A320-55- 1036 and A320-55-1037 which were not...
-
77 FR 66772 - Airworthiness Directives; Airbus Airplanes
2012-11-07
...-1158; Directorate Identifier 2011-NM-232-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes...: We propose to supersede an existing airworthiness directive (AD) that applies to all Airbus Model... that AD, Airbus has revised certain ALI documents, which require more restrictive maintenance...
-
77 FR 37829 - Airworthiness Directives; Airbus Airplanes
2012-06-25
...-0671; Directorate Identifier 2011-NM-096-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes...: We propose to supersede an existing airworthiness directive (AD) that applies to certain Airbus Model... this proposed AD, contact Airbus SAS--Airworthiness Office--EAL, 1 Rond Point Maurice Bellonte, 31707...
-
78 FR 9341 - Airworthiness Directives; Airbus Airplanes
2013-02-08
...-0088; Directorate Identifier 2011-NM-233-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes...: We propose to supersede an existing airworthiness directive (AD) that applies to all Airbus Model... this proposed AD, contact Airbus, Airworthiness Office--EAS, 1 Rond Point Maurice Bellonte, 31707...
-
78 FR 70207 - Airworthiness Directives; Airbus Airplanes
2013-11-25
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... Airbus Model A300 series airplanes; Model A300 B4-600, B4-600R, and F4- 600R series airplanes; and Model A300 C4-605R Variant F airplanes (collectively called Model A300-600 series airplanes). This AD was...
-
78 FR 68347 - Airworthiness Directives; Airbus Airplanes
2013-11-14
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of...-200, A340- 300, A340-500, and A340-600 series airplanes. AD 2009-04-07 required revising the airplane... reference unit (ADIRU) from providing erroneous data to other airplane systems. AD 2011-02-09 required...
-
78 FR 7261 - Airworthiness Directives; Airbus Airplanes
2013-02-01
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... Airbus Model A310-203 airplanes. This AD was prompted by a report of an analysis that demonstrated a...-116, Transport Airplane Directorate, FAA, 1601 Lind Avenue SW., Renton, WA 98057-3356; telephone (425...
-
78 FR 49915 - Airworthiness Directives; Airbus Airplanes
2013-08-16
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of..., for certain Airbus Model A310 series airplanes. AD 2004-15-07 required repetitive inspections for..., International Branch, ANM-116, Transport Airplane Directorate, FAA, 1601 Lind Avenue SW., Renton, WA 98057-3356...
-
78 FR 65173 - Airworthiness Directives; Airbus Airplanes
2013-10-31
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... Airbus Model A318, A319, A320, and A321 series airplanes. This AD was prompted by a determination that... Airplane Directorate, 1601 Lind Avenue SW., Renton, WA. For information on the availability of this...
-
2010-12-30
...-CN, dated September 20, 2010, to cancel EASA AD 2010-0083, dated May 3, 2010, for the specified products. EASA AD 2010-0083-CN states: It has been assessed that multiple NRV [non return valve] failures... not have a significant economic impact, positive or negative, on a substantial number of small...
-
2011-06-10
... products listed above. Since we issued AD 2009-18-19, EASA issued Airworthiness Directive 2010-0083-CN.... EASA AD 2010-0083-CN states: It has been assessed that multiple NRV [non-return valve] failures in..., positive or negative, on a substantial number of small entities under the criteria of the Regulatory...
-
2011-03-10
... Airworthiness Directives; EUROCOPTER FRANCE Model SA330F, SA330G, and SA330J Helicopters AGENCY: Federal... system and the pedals rocking forward. After investigation, it was determined that the Loctite bond on the ``tall pilot'' stop nut was damaged, most likely due to aging of the adhesive. The nut came loose...
-
2011-05-11
... Airworthiness Directives; Airbus Model A300 B4-600, B4-600R, and F4-600R Series Airplanes, and Model C4-605R... applies to all Airbus Model A300 B4-601, B4-603, B4- 620, B4-622, B4-605R, B4-622R, F4-605R, F4-622R, and...
-
2011-09-23
... Airworthiness Directives; Airbus Model A300 B4-600, B4-600R, and F4-600R Series Airplanes, and Model C4-605R... to Airbus Model A300 B4-601, B4-603, B4-620, B4-622, B4-605R, B4-622R, F4-605R, F4-622R, and C4-605R...
-
77 FR 49386 - Airworthiness Directives; Airbus Airplanes
2012-08-16
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of proposed rulemaking (NPRM). SUMMARY: We propose to adopt a new airworthiness directive (AD) for all Airbus..., except Federal holidays. For Airbus service information identified in this proposed AD, contact Airbus...
-
78 FR 76572 - Airworthiness Directives; Airbus Airplanes
2013-12-18
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of proposed rulemaking (NPRM). SUMMARY: We propose to adopt a new airworthiness directive (AD) for all Airbus..., except Federal holidays. For Airbus service information identified in this proposed AD, contact Airbus...
-
Energy efficiency improvements in air traffic: The case of Airbus A320 in Spain
International Nuclear Information System (INIS)
Cansino, José M.; Román, Rocío
2017-01-01
Structural improvements in aircraft design, seeking to improve energy efficiency, can significantly reduce greenhouse gas emissions (GHG) by reducing reduced fuel consumption. This research reviews improvements with the introduction of a structural component known as 'winglet;' these are positioned at the top of the aircraft wing, and increased Airbus Group A320 sales. Data used are taken from air traffic in Spain for the 2010–2014 period with projections being made for 2020. The results show that winglets reduce CO_2 equivalent emissions associated with Spain's air transport for the 2015–2020 period between 66.29 and 59.56 Gg. depending on the scenario considered in 2020. - Highlights: • Spanish air traffic is considered a key-GHG emission sector. • The aviation industry has drastically reduced its emissions. • To what extent could improved model to reduce fuel consumption and polluting emissions? • A320 Neo, A330 Neo and A380 Neo models are in the process of industrialisation. • Objectives fixed by Air Transport Action Group for 2020 are relevant.
-
77 FR 65812 - Airworthiness Directives; Airbus Airplanes
2012-10-31
... airplanes; and Model A340-200 and -300 series airplanes. This AD was prompted by reports of ram air turbine... before delivery from production, an A330 aeroplane experienced a RAT [ram air turbine] pump failure, as a result of which, the green hydraulic system could not be fully pressurized. Investigations concluded that...
-
2013-12-17
... the comment (or signing the comment for an association, business, labor union, etc.). DOT's complete... design feature: The digital systems architecture for the Airbus Model A350-900 series airplanes is composed of several connected networks. This proposed network architecture is used for a diverse set of...
-
78 FR 1723 - Airworthiness Directives; Airbus Airplanes
2013-01-09
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Final rule; request for comments. SUMMARY: We are adopting a new airworthiness directive (AD) for all Airbus... Friday, except Federal holidays. For service information identified in this AD, contact Airbus...
-
75 FR 35 - Special Conditions: Airbus Model A318-112 Airplane (S/N 3886); Certification of a Cooktop
2010-01-04
... Recommended Practice 85, Rev. E, article titled, ``Air Conditioning Systems for Subsonic Airplanes,'' August 1...; Special Conditions No. 25-398-SC] Special Conditions: Airbus Model A318-112 Airplane (S/N 3886... airplane, as modified by Bizjet, a Lufthansa Technik Company, will have a novel or unusual design feature...
-
76 FR 78524 - Airworthiness Directives; Airbus Airplanes
2011-12-19
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of Transportation (DOT). ACTION: Final rule. SUMMARY: We are adopting a new airworthiness directive (AD) for Airbus... an aeroplane from the Airbus production line, a fault message was triggered on FDU1 [fire detection...
-
77 FR 15636 - Airworthiness Directives; Airbus Airplanes
2012-03-16
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of proposed rulemaking (NPRM). SUMMARY: We propose to adopt a new airworthiness directive (AD) for all Airbus... identified in this proposed AD, contact Airbus, Airworthiness Office--EAS, 1 Rond Point Maurice Bellonte...
-
2010-05-21
... Airworthiness Directives; Airbus Model A300 Series Airplanes; Model A300 B4-600, B4-600R, F4-600R Series..., B4-622, B4- 605R, B4-622R, F4-605R, F4-622R, and C4-605R Variant F airplanes; and Model A310-203...
-
78 FR 59295 - Airworthiness Directives; Airbus Airplanes
2013-09-26
...-0829; Directorate Identifier 2013-NM-085-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes...: We propose to supersede airworthiness directive (AD) 2010-23- 12, which applies to certain Airbus... through Friday, except Federal holidays. For Airbus service information identified in this proposed AD...
-
78 FR 51117 - Airworthiness Directives; Airbus Airplanes
2013-08-20
...-0698; Directorate Identifier 2012-NM-136-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes...: We propose to supersede airworthiness directive (AD) 2006-06- 14, that applies to certain Airbus... information identified in this proposed AD, contact Airbus, Airworthiness Office--EAS, 1 Rond Point Maurice...
-
78 FR 64159 - Airworthiness Directives; Airbus Airplanes
2013-10-28
... Airworthiness Directives; Airbus Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... Airbus SAS-- EAW (Airworthiness Office), 1 Rond Point Maurice Bellonte, 31707 Blagnac Cedex, France; telephone +33 5 61 93 36 96; fax +33 5 61 93 44 51; email [email protected]airbus.com ; Internet http...
-
77 FR 66764 - Airworthiness Directives; Airbus Airplanes
2012-11-07
...-1160; Directorate Identifier 2012-NM-096-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes... Friday, except Federal holidays. For service information identified in this proposed AD, contact Airbus... +33 5 61 93 36 96; fax +33 5 61 93 45 80; email [email protected]airbus.com ; Internet http...
-
Computer aided design around the A300 Airbus
Audy, J J
1982-01-01
More than thirteen years after the launching of the first AIRBUS development a survey of CAD/CAM introduction and operation at AEROSPATIALE, Aircraft Division was conducted. The results of this survey are described. Initially, a short description of AEROSPATIALE Aircraft Division is given and the state of CAD/CAM expertise in the factory before the Airbus project is outlined. Next, the author describes the implementation of CAE in the structural, aerodynamic and electrical fields in response to the growing success of the various Airbus programs and in front of an everyday tougher competition. After a description of the present situation and a first estimate of CAE benefits, special attention is devoted to the difficulties encountered with both hardware and software used in the systems involved. To conclude the author defines the respective roles of the system buyer and vendor in the CAD/CAM field.
-
78 FR 28152 - Airworthiness Directives; Airbus Airplanes
2013-05-14
...-0416; Directorate Identifier 2012-NM-144-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes... A318-111 and -112 airplanes, Model A319 series airplanes, Model A320 series airplanes, and Model A321 series airplanes. The existing AD currently requires repetitive inspections of the 80VU rack lower...
-
Protection against wing icing for Airbus A300 and A310
Woelfer, G.
1981-01-01
To improve economy of operation, it is now planned to modify the anti-icing system used on the A300 Airbus wing. Thus, for the A310 Airbus, the deicing system will be applied to only half the wing length. Other essential modifications are a substantial simplification of the warm-air system and discontinuation of the use of a double wall in slats.
-
2011-06-22
... pieces unit with 3 welds (old design) as pictured in Appendix 1 of this [EASA] AD. The welding process of... pre-modification 02447.. Blue and Green. A300 airplanes post-modification 02447. Blue. A300-600 airplanes Blue. A310 airplanes Green. Table 2--Applicable service information Airbus mandatory service...
-
75 FR 50856 - Airworthiness Directives; Airbus Model A380-800 Series Airplanes
2010-08-18
... it in the AD docket. List of Subjects in 14 CFR Part 39 Air transportation, Aircraft, Aviation safety... DEPARTMENT OF TRANSPORTATION Federal Aviation Administration 14 CFR Part 39 [Docket No. FAA-2010... been found on the Droop Nose (DN) 1 master sidestay bracket on the inboard leading edge of an Airbus...
-
2011-08-05
... Airworthiness Directives; Airbus Model A300 B4-600, A300 B4-600R, and A300 F4-600R Series Airplanes, and Model..., B4-622R, F4-605R, F4-622R, and C4-605R Variant F airplanes; and Model A310-203, -204, -221, -222...
-
2011-05-04
... Airworthiness Directives; Airbus Model A300 B4-600, A300 B4-600R, and A300 F4-600R Series Airplanes, and Model...-605R, B4-622R, F4-605R, F4-622R, and C4-605R Variant F airplanes; and Model A310-203, -204, -221, -222...
-
78 FR 78285 - Airworthiness Directives; Airbus Airplanes
2013-12-26
...-1064; Directorate Identifier 2012-NM-101-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes... A300 B4-605R and B4-622R airplanes; Model A300 F4-605R airplanes; and Model A300 C4-605R Variant F airplanes. AD 2005-23-08 required repetitive inspections to detect cracks of certain attachment holes...
-
2010-12-10
... Airworthiness Directives; Airbus Model A300 B4-600, B4-600R, and F4-600R Series Airplanes, and Model C4-605R... airplanes; Model A300 B4-605R and B4-622R airplanes; Model A300 F4-605R and F4-622R airplanes; Model A300 C4...
-
78 FR 40069 - Airworthiness Directives; Airbus Airplanes
2013-07-03
...-0539; Directorate Identifier 2012-NM-145-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes... B4-600 and Model A300 B4-600R series airplanes. That AD currently requires repetitive inspections to... information at the FAA, Transport Airplane Directorate, 1601 Lind Avenue SW., Renton, WA. For information on...
-
77 FR 6023 - Airworthiness Directives; Airbus Airplanes
2012-02-07
...-0038; Directorate Identifier 2011-NM-209-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes... airplanes and Model A310-203, -204, - 221, and -222 airplanes. This proposed AD was prompted by a report of... explosion and consequent loss of the airplane. DATES: We must receive comments on this proposed AD by March...
-
2011-07-18
... Airworthiness Directives; Airbus Model A300 B4-600, B4-600R, and F4-600R Series Airplanes, and Model A300 C4... A300 B4-605R and B4-622R airplanes, Model A300 F4-605R and F4-622R airplanes, and Model A300 C4- [[Page...
-
2011-07-06
... Airworthiness Directives; Airbus Model A300 B4-600, B4-600R, and F4-600R Series Airplanes, and Model C4-605R... B4-605R and B4-622R airplanes; Model A300 F4-605R and F4-622R airplanes; Model A300 C4-605R Variant F...
-
Airbus windshear warning and guidance system
Bonafe, J. L.
1990-01-01
From its first designed airplane, Airbus considered mandatory a help in the crew's decision-making process to initiate an escape maneuver and help to successfully realize it. All the Airbus airplanes designed since 1975 included an alpha-floor function and a speed reference control law imbedded in the speed reference system (SRS) box for A 300 and FAC and FCC for A 310, A300/600 and the A 320. Alpha-Floor function takes into account the airplane energy situation considering angle of attack and observed longitudinal situation in order to apply immediately the full power without any pilot action. Speed reference managers control airspeed and/or ground speed in order to survive a maximum in shear situation. In order to comply with the new FAA regulation: Aerospatiale and Airbus developed more efficient systems. A comparison between 1975 and a newly developed system is given. It is explained how the new system improves the situation.
-
2013-04-09
... are no seats, at least one means must be provided to cover anticipated turbulence (e.g., sufficient... intervening cargo compartment wall, the following applies: (a) Any wall of the module (container) forming part...
-
2011-01-13
... the rudder. The loss of the rudder leads to degradation of the handling qualities and reduces the..., may degrade the structural integrity of the rudder. The loss of the rudder leads to degradation of the... carbon fiber reinforced plastic rudders having part numbers and serial numbers listed in Table 1 of this...
-
2011-04-21
... structural integrity of the rudder. The loss of the rudder leads to degradation of the handling qualities and... degradation of the handling qualities and reduces the controllability of the aeroplane. EASA AD 2009-0156... manufacturer serial numbers; certificated in any category; equipped with carbon fiber reinforced plastic...
-
Zur aktuellen deutschen Förderung der Airbus-Industrie
Maennig, Wolfgang; Hölzer, Katharina
1999-01-01
Das Projekt „Airbus" war lange Zeit aufgrund der hohen Subventionierung umstritten. Die Kritik hat sich gelegt, weil inzwischen meist angenommen wird, daß die Airbus-Industrie keine substantielle staatliche Förderung mehr erfährt. Wie umfangreich ist die staatliche Förderung aber tatsächlich?
-
2011-01-05
... Airworthiness Directives; Airbus Model A300 B4-600, B4-600R, and F4-600R Series Airplanes, and Model C4-605R...-622, B4-605R, B4-622R, F4-605R, F4-622R, and C4-605R Variant F airplanes, certificated in any category...
-
78 FR 76248 - Special Conditions: Airbus, Model A350-900 Series Airplane; Side Stick Controller
2013-12-17
... one hand. The applicable airworthiness regulations do not contain adequate or appropriate safety standards for this design feature. These proposed special conditions contain the additional safety standards...-hand operation by wrist and not by arms. Discussion Special conditions for Airbus side stick...
-
2011-05-02
... specified products. The MCAI states: Airbus, in the frame of the Extended Service Goal (ESG) exercise, has...) states: Airbus, in the frame of the Extended Service Goal (ESG) exercise, has demonstrated by post... aviation product. The MCAI describes the unsafe condition as: Airbus, in the frame of the Extended Service...
-
2011-05-13
... Jersey Avenue, SE., Washington, DC. FOR FURTHER INFORMATION CONTACT: Dan Rodina, Aerospace Engineer... the required inspections that will ensure the continued damage tolerance of the affected structure... corroded structure detected during any inspection done in accordance with the Airbus A300 Airworthiness...
-
The First European Parabolic Flight Campaign with the Airbus A310 ZERO-G
Pletser, Vladimir; Rouquette, Sebastien; Friedrich, Ulrike; Clervoy, Jean-Francois; Gharib, Thierry; Gai, Frederic; Mora, Christophe
2016-12-01
Aircraft parabolic flights repetitively provide up to 23 seconds of reduced gravity during ballistic flight manoeuvres. Parabolic flights are used to conduct short microgravity investigations in Physical and Life Sciences and in Technology, to test instrumentation prior to space flights and to train astronauts before a space mission. The use of parabolic flights is complementary to other microgravity carriers (drop towers, sounding rockets), and preparatory to manned space missions on board the International Space Station and other manned spacecraft, such as Shenzhou and the future Chinese Space Station. After 17 years of using the Airbus A300 ZERO-G, the French company Novespace, a subsidiary of the ' Centre National d'Etudes Spatiales' (CNES, French Space Agency), based in Bordeaux, France, purchased a new aircraft, an Airbus A310, to perform parabolic flights for microgravity research in Europe. Since April 2015, the European Space Agency (ESA), CNES and the ` Deutsches Zentrum für Luft- und Raumfahrt e.V.' (DLR, the German Aerospace Center) use this new aircraft, the Airbus A310 ZERO-G, for research experiments in microgravity. The first campaign was a Cooperative campaign shared by the three agencies, followed by respectively a CNES, an ESA and a DLR campaign. This paper presents the new Airbus A310 ZERO-G and its main characteristics and interfaces for scientific experiments. The experiments conducted during the first European campaign are presented.
-
2013-12-17
..., and accommodates side-by-side placement of LD-3 containers in the cargo compartment. The basic Airbus... availability of this excess maneuver capacity in case of extreme emergency such as upset recoveries or... factor must not be less than: (a) 2.5g for the EFCS normal state with the high lift devices retracted up...
-
2011-04-06
... B4-600, B4-600R, and F4-600R Series Airplanes, and Model C4-605R Variant F Airplanes (Collectively... July 20, 2005; have been performed in service. (2) Airbus Model A300 B4-605R, B4-622R, F4-605R, and F4... C4-600R, and A300 F4-600R series airplanes (fitted with a trim tank), all serial numbers, except...
-
2010-10-01
... Airworthiness Directives; Airbus Model A300 B4-600, B4-600R, and F4-600R Series Airplanes, and Model A300 C4...; Model A300 B4-601, B4- 603, B4-620, B4-622, B4-605R, B4-622R, F4-605R, F4-622R, and C4-605R Variant F...-- Dated-- A300 series airplanes......... A300-32A0447..... April 22, 2004. A300 B4-600, B4-600R, and F4...
-
New Space at Airbus Defence & Space to facilitate science missions
Boithias, Helene; Benchetrit, Thierry
2016-10-01
In addition to Airbus legacy activities, where Airbus satellites usually enable challenging science missions such as Venus Express, Mars Express, Rosetta with an historic landing on a comet, Bepi Colombo mission to Mercury and JUICE to orbit around Jupiter moon Ganymede, Swarm studying the Earth magnetic field, Goce to measure the Earth gravitational field and Cryosat to monitor the Earth polar ice, Airbus is now developing a new approach to facilitate next generation missions.After more than 25 years of collaboration with the scientists on space missions, Airbus has demonstrated its capacity to implement highly demanding missions implying a deep understanding of the science mission requirements and their intrinsic constraints such as- a very fierce competition between the scientific communities,- the pursuit of high maturity for the science instrument in order to be selected,- the very strict institutional budget limiting the number of operational missions.As a matter of fact, the combination of these constraints may lead to the cancellation of valuable missions.Based on that and inspired by the New Space trend, Airbus is developing an highly accessible concept called HYPE.The objective of HYPE is to make access to Space much more simple, affordable and efficient.With a standardized approach, the scientist books only the capacities he needs among the resources available on-board, as the HYPE satellites can host a large range of payloads from 1kg up to 60kg.At prices significantly more affordable than those of comparable dedicated satellite, HYPE is by far a very cost-efficient way of bringing science missions to life.After the launch, the scientist enjoys a plug-and-play access to two-way communications with his instrument through a secure high-speed portal available online 24/7.Everything else is taken care of by Airbus: launch services and the associated risk, reliable power supply, setting up and operating the communication channels, respect of space law
-
2010-12-01
... require repetitive inspections and, as terminating action, the embodiment of Airbus Service Bulletins (SB... terminating action, the embodiment of Airbus Service Bulletins (SB) A300-57-0235 and A300-57-6088...
-
Goupil, Ph.; Puyou, G.
2013-12-01
This paper presents a high-fidelity generic twin engine civil aircraft model developed by Airbus for advanced flight control system research. The main features of this benchmark are described to make the reader aware of the model complexity and representativeness. It is a complete representation including the nonlinear rigid-body aircraft model with a full set of control surfaces, actuator models, sensor models, flight control laws (FCL), and pilot inputs. Two applications of this benchmark in the framework of European projects are presented: FCL clearance using optimization and advanced fault detection and diagnosis (FDD).
-
Airbus Boeingu vastu / tõlk. Kaie Ilves
2006-01-01
Saksamaa ja Prantsusmaa ühisettetvõtte Airbus A350 tüüpi pikamaalennuki ehitusfaasi peatamine on vallandanud juhatuses diskussiooni, kas lennukiehitus peaks saama riigilt finantstoetust, et suuta konkureerida oma USA rivaali Boeinguga võrdselt positsioonilt
-
Ergonomic work analysis of airbus pilots job in Brazil.
Monteiro, Tathiana Passeri; Marques, Diego Cesar; Barbosa, Victor Gonçalves; Uatanabe, Priscila
2012-01-01
This article is the result of a case study of ergonomic work analysis carried out in a Brazilian airline company, focused on the safety of the activity of Airbus pilots from the company's national lines. The study was divided in three parts, each one with different approach. First step is how critical situations such as accidents and incidents are dealt with during flight. Then it comes to discuss about adversities found in the working place, the airbus cockpit, and the development of risk map. Last but not least, the study focused in how the irregular working journey compromises the biological clock of the pilots end may cause social issues.
-
International Nuclear Information System (INIS)
Jewell, P.R.; Hollis, J.M.; Lovas, F.J.; Snyder, L.E.
1989-01-01
A continuous spectral line survey of the Orion A position from 330.5 to 360.1 GHz was carried out. This survey covers nearly the entire 870 micron atmospheric window accessible from ground-based observations. Approximately 160 distinct spectral features composed of about 180 lines were detected, 29 of which could not be readily identified. In addition, Orion A from 200.7 to 202.3 GHz and from 203.7 to 205.3 GHz and 42 distinct new spectral lines were detected, including four that are unidentified at present. These data sets are the first thorough survey results in these spectral regions. The new interstellar lines in the survey bands are tabulated and displayed graphically. Moreover, the data are being made available to the Astronomical Data Center at the Goddard Space Flight Center for distribution by request to the astronomical community. 14 refs
-
78 FR 8054 - Airworthiness Directives; Airbus Airplanes
2013-02-05
...-1321; Directorate Identifier 2011-NM-147-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes... A310 series airplanes. The existing AD currently requires repetitive inspections for fatigue cracking... information at the FAA, Transport Airplane Directorate, 1601 Lind Avenue SW., Renton, WA. For information on...
-
78 FR 40074 - Airworthiness Directives; Airbus Airplanes
2013-07-03
...-0465; Directorate Identifier 2012-NM-085-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes... series airplanes. This proposed AD was prompted by a determination that oxygen generators installed on a... information at the FAA, Transport Airplane Directorate, 1601 Lind Avenue SW., Renton, WA. For information on...
-
78 FR 40057 - Airworthiness Directives; Airbus Airplanes
2013-07-03
...-0467; Directorate Identifier 2013-NM-023-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes... A321 series airplanes. This proposed AD was prompted by reports of certain sliding windows that were... from safely evacuating the airplane during an emergency. DATES: We must receive comments on this...
-
76 FR 61555 - Airworthiness Directives; Airbus Airplanes
2011-10-05
... pieces unit welded, instead of 4 pieces unit with 3 welds (old design) as pictured in Appendix 1 of this... pre-modification 02447. Blue and Green. A300 airplanes post-modification 02447 Blue. A300-600 airplanes Blue. A310 airplanes Green. Table 2--Applicable Service Information Airbus Mandatory Service...
-
77 FR 29207 - Airworthiness Directives; Airbus Airplanes
2012-05-17
... number 2. In addition, Airbus foresees a potential safety hazard for mechanics if seals are installed... provide an acceptable level of safety. We have not changed the AD in this regard. Explanation of... responsibilities among the various levels of government. For the reasons discussed above, I certify that this...
-
77 FR 25930 - Airworthiness Directives; Airbus Airplanes
2012-05-02
...-2098, dated July 22, 2011; and Mandatory Service Bulletin A310-57-2099, dated July 22, 2011. The... A310-57-2099, dated July 22, 2011. (ii) If no cracking is found during the inspection required by... accordance with Accomplishment Instructions of Airbus Mandatory Service Bulletin A310-57-2099, dated July 22...
-
78 FR 69318 - Airworthiness Directives; Rockwell Collins, Inc. Transponders
2013-11-19
... We invite you to send any written relevant data, views, or arguments about this proposal. Send your... with the transponders that could lead to increased pilot and air traffic controller workload as well as..., certificated in any category: (i) Airbus Models A319, A320, A330, A340; and (ii) Boeing Models B777, B747, MD...
-
77 FR 17327 - Airworthiness Directives; Airbus Airplanes
2012-03-26
... DEPARTMENT OF TRANSPORTATION Federal Aviation Administration 14 CFR Part 39 [Docket No. FAA-2011-1087; Directorate Identifier 2011-NM-032-AD; Amendment 39-16967; AD 2012-04-11] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes Correction In rule document 2012-5859 appearing on pages 14679-14681...
-
77 FR 46935 - Airworthiness Directives; Airbus Airplanes
2012-08-07
... Instructions of Airbus Mandatory Service Bulletin A310-57-2099, dated July 22, 2011. (ii) If no cracking is... Service Bulletin A310-57-2099, dated July 22, 2011. (h) Bolt Replacement at Slat 2 Track 4 and Track 7... Mandatory Service Bulletin A310-57-2099, dated July 22, 2011. (l) Material Incorporated by Reference (1) The...
-
2010-10-01
... time during which fuel tanks are exposed to flammable conditions is one of these criteria. The other... flammable fuel vapors, could result in fuel tank explosions and consequent loss of the airplane. [[Page... information and, in general, agree with their substance. But we might have found it necessary to use different...
-
An economic and financial review of Airbus Indsutrie
1990-09-04
This report was prepared for the International Trade Administration of the U.S. Department of Commerce (DOC). It examines the economics of Airbus Industre (AI) civil transport programs and the potential effects of AI's presence on both the market for...
-
78 FR 46536 - Airworthiness Directives; Airbus Airplanes
2013-08-01
...-0668; Directorate Identifier 2013-NM-017-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes... B4-600R series airplanes. This proposed AD was prompted by reports of cracks found in the bottom wing... at the FAA, Transport Airplane Directorate, 1601 Lind Avenue SW., Renton, WA. For information on the...
-
2010-01-01
... 7 Agriculture 5 2010-01-01 2010-01-01 false Costs. 330.107 Section 330.107 Agriculture Regulations...; GARBAGE General Provisions § 330.107 Costs. All costs (including those incurred under § 330.106 of this... usual places of duty shall be furnished without cost to the person requesting the services, unless a...
-
2010-01-01
... Employees § 330.1204 Selection. (a) If two or more individuals apply for a vacancy and the hiring agency... agency (under appropriate selection procedures, then: (3) Current or former Federal employees displaced... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Selection. 330.1204 Section 330.1204...
-
Weight reductions for the airbus A380; postbuckling of the A380 VTP skin panels
Kroese, R.
2014-01-01
The skin panels of the Vertical Tail Plane (VTP) are the largest single piece composite components assembled on the Airbus A380. By allowing postbuckling to these skin panels might result in severe weight reductions for the VTP of the A380. The goal of the study is to give an indication of possible
-
2010-01-01
... 7 Agriculture 13 2010-01-01 2009-01-01 true Monitoring. 1940.330 Section 1940.330 Agriculture... REGULATIONS (CONTINUED) GENERAL Environmental Program § 1940.330 Monitoring. (a) FmHA or its successor agency... monitoring of approved projects will ensure that those measures which were identified in the preapproval...
-
5 CFR 330.206 - Job consideration.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Job consideration. 330.206 Section 330..., SELECTION, AND PLACEMENT (GENERAL) Reemployment Priority List (RPL) § 330.206 Job consideration. (a)(1) An eligible employee under § 330.203 is entitled to consideration for positions in the commuting area for...
-
2010-10-01
... residual inventory of unused supplies exceeding $5,000 in total aggregate fair market value upon... 45 Public Welfare 4 2010-10-01 2010-10-01 false Supplies. 2541.330 Section 2541.330 Public Welfare..., Property and Subawards § 2541.330 Supplies. (a) Title. Title to supplies acquired under a grant or subgrant...
-
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false [Reserved] 330.610 Section 330.610 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT, SELECTION, AND... Employees § 330.610 [Reserved] ...
-
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false [Reserved] 330.603 Section 330.603 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT, SELECTION, AND... Employees § 330.603 [Reserved] ...
-
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false [Reserved] 330.710 Section 330.710 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT, SELECTION, AND PLACEMENT (GENERAL) Interagency Career Transition Assistance Plan for Displaced Employees § 330.710...
-
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false [Reserved] 330.702 Section 330.702 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT, SELECTION, AND PLACEMENT (GENERAL) Interagency Career Transition Assistance Plan for Displaced Employees § 330.702...
-
2011-05-03
... include vacuum loss and elasticity laminate checker inspections for damage including de-bonding between... exist or develop on other products of the same type design. Differences Between This AD and the MCAI or... elasticity laminate checker inspection on the trailing edge area (Area 2) for damage including de-bonding...
-
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Oversight. 330.611 Section 330.611 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT, SELECTION, AND... Employees § 330.611 Oversight. OPM provides advice and assistance to agencies in implementing their Career...
-
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Monitoring. 91.330 Section 91.330 Housing and Urban Development Office of the Secretary, Department of Housing and Urban Development... Consolidated Plan § 91.330 Monitoring. The consolidated plan must describe the standards and procedures that...
-
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Investors. 330.35 Section 330.35... SECURITIES § 330.35 Investors. Association guaranteed multiclass securities may not be suitable investments for all investors. No investor should purchase securities of any class unless the investor understands...
-
78 FR 77611 - Special Conditions: Airbus, A350-900 Series Airplane; High Speed Protection System
2013-12-24
... initiated three seconds after operation of the high speed warning system by application of a load of 1.5g (0...-1001; Notice No. 25-13-35-SC] Special Conditions: Airbus, A350-900 Series Airplane; High Speed...-speed protection system. The applicable airworthiness regulations do not contain adequate or appropriate...
-
12 CFR 330.3 - General principles.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false General principles. 330.3 Section 330.3 Banks and Banking FEDERAL DEPOSIT INSURANCE CORPORATION REGULATIONS AND STATEMENTS OF GENERAL POLICY DEPOSIT INSURANCE COVERAGE § 330.3 General principles. (a) Ownership rights and capacities. The insurance coverage...
-
Airbus A320 NEO Base Maintenance Concept SAS Operations
Dafgård, Oscar
2017-01-01
Detta arbete har utförts tillsammans med SAS, för att undersöka om ett base maintenance koncept med ett intervall på 36 månader skulle vara mer kostnadseffektivt än 24 månader för deras nya Airbus A320 NEO flotta. SAS, precis som alla andra flygbolag utnyttjar sina flygplan på sina egna och specifika vis. Eftersom inga flygbolag opererar på samma sätt kan inte heller underhållet skötas på samma sätt för en specifik flygplanstyp. Underhållsprogrammet behövde därför ses över för att optimeras g...
-
7 CFR 330.208 - Courtesy permits.
2010-01-01
... 7 Agriculture 5 2010-01-01 2010-01-01 false Courtesy permits. 330.208 Section 330.208 Agriculture... PRODUCTS; GARBAGE Movement of Plant Pests § 330.208 Courtesy permits. The Deputy Administrator may issue... subject to regulation under the Plant Protection Actor any other act, as a courtesy to facilitate movement...
-
5 CFR 330.402 - Direct recruitment.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Direct recruitment. 330.402 Section 330.402 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT, SELECTION, AND PLACEMENT (GENERAL) Positions Restricted to Preference Eligibles § 330.402 Direct recruitment...
-
2012-12-19
...-1207; Notice No. 25-12-09-SC] Special Conditions: Airbus, A350-900 Series Airplane; Flight Envelope... or unusual design features associated with flight envelope protection in icing and non- icing..., during failure conditions (which are not shown to be extremely improbable), the requirements of Title 14...
-
Passivation Strategies on Board Airbus ds Leo Pcdus
Directory of Open Access Journals (Sweden)
Lapeña Emilio
2017-01-01
This paper deals with the different strategies followed in the Airbus DS LEO PCDUs regarding the implementation of the passivation function in several LEO missions with different architectures (DET and MPPT solar array power conditioning. In the selection of the solution implemented in the frame of every mission, a key driver is the degree of advance in the test performed over flight representative battery modules regarding their safe behavior when deeply depleted after a long period in orbit with the passivation applied over the spacecraft.
-
2010-07-01
... § 330.7 Funding. (a) Section 330.3(c) sets forth the maximum authorized funds for law enforcement contracting in FY 1978 and FY 1979. The Division funding levels for FY 1978 are based on information as... Parks, Forests, and Public Property CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY REGULATION OF LAW...
-
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Selection. 330.1105 Section 330.1105 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT, SELECTION, AND PLACEMENT (GENERAL) Federal Employment Priority Consideration Program for Displaced Employees of the...
-
2011-11-28
... Model 737-100, -200, -300, -400, and -500 series airplanes, a one-time detailed inspection is added to... Information Initial Compliance Time (i) For all Model 737-100, -200, -200C, -300, -400, and -500 series... by paragraph (r) of this AD. If any fastener is missing, before further flight, repair using a method...
-
20 CFR 330.3 - Daily rate of compensation.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Daily rate of compensation. 330.3 Section 330.3 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD UNEMPLOYMENT INSURANCE ACT DETERMINATION OF DAILY BENEFIT RATES § 330.3 Daily rate of compensation. (a) Definition. An...
-
7 CFR 330.402 - Garbage generated in Hawaii.
2010-01-01
... 7 Agriculture 5 2010-01-01 2010-01-01 false Garbage generated in Hawaii. 330.402 Section 330.402... QUARRY PRODUCTS; GARBAGE Garbage § 330.402 Garbage generated in Hawaii. (a) Applicability. This section... to interstate movement from Hawaii, and includes used paper, discarded cans and bottles, and food...
-
Spiller, Olaf
1991-01-01
The provisions applied to the Airbus A340 wing wiring against lightning indirect effects are presented. The construction and installation of the wiring's shielding systems are described, and the analysis and tests performed to determine the effectiveness of the measures taken are discussed. A first evaluation of the results of the theoretical analysis together with the provisional results of tests indicate a sufficient safety margin between required and achieved protection levels.
-
7 CFR 330.210a - Administrative instructions listing approved packing materials for plant pests.
2010-01-01
... materials for plant pests. 330.210a Section 330.210a Agriculture Regulations of the Department of... PEST REGULATIONS; GENERAL; PLANT PESTS; SOIL, STONE, AND QUARRY PRODUCTS; GARBAGE Movement of Plant Pests § 330.210a Administrative instructions listing approved packing materials for plant pests. (a) The...
-
Pletser, Vladimir; Rouquette, Sebastien; Friedrich, Ulrike; Clervoy, Jean-Francois; Gharib, Thierry; Gai, Frederic; Mora, Christophe
2015-09-01
Aircraft parabolic flights repetitively provide up to 23 s of reduced gravity during ballistic flight manoeuvres. Parabolic flights are used to conduct short microgravity investigations in Physical and Life Sciences and in Technology, to test instrumentation prior to space flights and to train astronauts before a space mission. The use of parabolic flights is complementary to other microgravity carriers (drop towers, sounding rockets), and preparatory to manned space missions on board the International Space Station and other manned spacecraft, such as Shenzhou and the Chinese Space Station CSS. The European Space Agency (ESA), the 'Centre National d'Etudes Spatiales' (CNES, French Space Agency) and the 'Deutsches Zentrum für Luft- und Raumfahrt e.V.' (DLR, the German Aerospace Centre) have used the Airbus A300 ZERO-G for research experiments in microgravity, and at Moon and Mars gravity levels, from 1997 until October 2014. The French company Novespace, a subsidiary of CNES, based in Bordeaux, France, is in charge of the organisation of Airbus A300 ZERO-G flights. A total of 104 parabolic flight campaigns have been organised by ESA, CNES and DLR since 1997, including 38 ESA, 34 CNES and 23 DLR microgravity campaigns, two Joint European ESA-CNES-DLR Partial-g Parabolic Flight Campaigns, and seven ESA Student campaigns. After 17 years of good and loyal services, this European workhorse for microgravity research in parabolic flights has been retired. The successor aircraft, the Airbus A310 ZERO-G, is being prepared for a first ESA-CNES-DLR cooperative campaign in Spring 2015. This paper looks back over 17 years of microgravity research in parabolic flights with the A300 ZERO-G, and introduces the new A310 ZERO-G that will be used from 2015 onwards.
-
48 CFR 53.301-330 - Architect-Engineer Qualifications.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Architect-Engineer Qualifications. 53.301-330 Section 53.301-330 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION (CONTINUED) CLAUSES AND FORMS FORMS Illustrations of Forms 53.301-330 Architect-Engineer...
-
5 CFR 330.401 - Competitive examination.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Competitive examination. 330.401 Section 330.401 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT... examination. In each entrance examination for the positions of custodian, elevator operator, guard, and...
-
24 CFR 330.10 - Eligible collateral.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Eligible collateral. 330.10 Section... SECURITIES § 330.10 Eligible collateral. The Association, in its discretion, shall determine what collateral is eligible for inclusion in the Multiclass Securities program. Eligible collateral may include GNMA...
-
Indriyanto, Reza Relen; Wandebori, Harimukti; Astuti, Novika Candra
2013-01-01
PT Dirgantara Indonesia (PT DI) is one of the aircraft manufacturing companies in Indonesia. The tight of competition in aerospace industry needs to improve its performance to gain niche market. Therefore, Ministry State of Own Enterprises has instructed PT Perusahaan Pengelola Aset (PT PPA) and PT DI to restructure and revitalize company with supported by Airbus Military as a strategic alliance partner, in order to increase the performance of production capacity, aircraft sales, and financia...
-
21 CFR 330.5 - Drug categories.
2010-04-01
... 21 Food and Drugs 5 2010-04-01 2010-04-01 false Drug categories. 330.5 Section 330.5 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS FOR HUMAN...) Stimulants. (r) Antitussives. (s) Allergy treatment products. (t) Cold remedies. (u) Antirheumatic products...
-
Do we need an Airbus of the nuclear industry?
International Nuclear Information System (INIS)
Freed, J.; Allen, T.; Nordhaus, T.; Lovering, J.
2017-01-01
Facing cheap fossil energies and more and more available renewable energies, nuclear energy has to reinvent itself to recover competitiveness. Small reactors, able to be built quickly and to ensure economies of scale, might be the next technological breakthrough. The need for change and innovation is so strong in the nuclear sector that it may imply the creation of an international consortium similar to the Airbus partnership that could merge reactor manufacturers and gather all their technological and financial means towards a unique goal reinventing the manufacturing of reactors to adapt it to small reactors. (A.C.)
-
2010-07-01
... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Fiscal agents. 330.9 Section 330.9 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE.... Federal Reserve Bank of Kansas City, 925 Grand Avenue, Kansas City, MO 64198 Dallas, San Francisco, Kansas...
-
44 CFR 330.3 - Delegation of authority.
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Delegation of authority. 330... OF HOMELAND SECURITY PREPAREDNESS POLICY GUIDANCE AND DELEGATION OF AUTHORITIES FOR USE OF PRIORITIES... DEFENSE PRODUCTION ACT OF 1950, AS AMENDED (DMO-13) § 330.3 Delegation of authority. (a) The functions of...
-
5 CFR 330.706 - Notification of displaced employees.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Notification of displaced employees. 330... RECRUITMENT, SELECTION, AND PLACEMENT (GENERAL) Interagency Career Transition Assistance Plan for Displaced Employees § 330.706 Notification of displaced employees. (a) In addition to meeting the requirements of...
-
EAS experiment on board the Airbus A380
International Nuclear Information System (INIS)
Capdevielle, J.N.; Cohen, F.; Jedrzejczak, K.; Szabelska, B.; Szabelski, J.; Wibig, T.
2006-01-01
We consider taking the opportunity of about 10,000 hours of test flights of the Airbus A380, and to install in the passenger area detectors for high energy cosmic ray events. The altitude of 10 km (250 g/cm 2 ) presents the opportunity to measure EAS originating from heavy primaries to energies exceeding 10 7 GeV, and also the proton component beyond the energy of the knee arriving without interaction. At the flight altitude iron originated EAS are well developed and by registering their lateral distribution in the 70 meters long cabin it will be possible to distinguish them from proton originated EAS. The hadron component of EAS (registered as number of secondary hadrons produced in the detector) would help in discrimination and energy estimation. On the other hand, the detection of high energy protons (without EAS) would enable us to measure the high energy proton spectrum. The proton energy would be estimated via hadron multiplicity in single interactions inside the detector. We propose to use about 60 modules of 0.5 m 2 of active detectors with scintillators to detect E-M component and a carbon target with lead layer to detect the hadronic component via neutron registrations
-
21 CFR 330.2 - Pregnancy-nursing warning.
2010-04-01
... 21 Food and Drugs 5 2010-04-01 2010-04-01 false Pregnancy-nursing warning. 330.2 Section 330.2 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS FOR HUMAN USE OVER-THE-COUNTER (OTC) HUMAN DRUGS WHICH ARE GENERALLY RECOGNIZED AS SAFE AND EFFECTIVE...
-
5 CFR 330.503 - Assessment of compliance with competitive principles.
2010-01-01
... principles. 330.503 Section 330.503 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT, SELECTION, AND PLACEMENT (GENERAL) Restrictions To Protect Competitive Principles § 330.503 Assessment of compliance with competitive principles. As one factor in assessing an agency's...
-
5 CFR 330.607 - Notification of surplus and displaced employees.
2010-01-01
... employees. 330.607 Section 330.607 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT, SELECTION, AND PLACEMENT (GENERAL) Agency Career Transition Assistance Plans (CTAP) for Local Surplus and Displaced Employees § 330.607 Notification of surplus and displaced employees...
-
2010-01-01
...) Agency means an Executive Department, a Government corporation, and an independent establishment as cited... order of selection in § 330.705(a) in filling vacancies in the Federal Government with candidates from...
-
40 CFR 408.330 - Applicability; description of the abalone processing subcategory.
2010-07-01
... abalone processing subcategory. 408.330 Section 408.330 Protection of Environment ENVIRONMENTAL PROTECTION... CATEGORY Abalone Processing Subcategory § 408.330 Applicability; description of the abalone processing... abalone in the contiguous states. ...
-
Energy transition. Who will board the energy Airbus?
International Nuclear Information System (INIS)
Moragues, Manuel
2014-01-01
As the French President called for the creation of a French-German company dedicated to energy transition, inspired by the Airbus project which emerged to share the design and development costs of a specific product (a large capacity aircraft), this article comments the possibility of applying such a strategy between the main French and German actors like Siemens, RWE, Alstom, EDF. Such an idea has already its reality as some French and German are cooperating in different projects: offshore wind energy consortium, research and development in photovoltaic, smart grids, energy storage, and so on. Some of these projects are evoked and commented, for example one which has emerged just after the President's speech: the project of a giant factory of solar arrays proposed by the CEA and the Fraunhofer Institute. One major need is also evoked, the harmonization at the regulation stage
-
7 CFR 330.102 - Basis for certain regulations.
2010-01-01
... of the Plant Protection Act, the Secretary may prohibit or restrict the importation, entry... 7 Agriculture 5 2010-01-01 2010-01-01 false Basis for certain regulations. 330.102 Section 330.102 Agriculture Regulations of the Department of Agriculture (Continued) ANIMAL AND PLANT HEALTH INSPECTION...
-
76 FR 18038 - Airworthiness Directives; Airbus Model A340-200 and -300 Series Airplanes
2011-04-01
... as being a combined failure of the thrust reverser pivoting door primary lock and actuator..., this AD requires installation of a new modified primary lock and a new modified actuator on the 10... requirements.'' Under that section, Congress charges the FAA with promoting safe flight of civil aircraft in...
-
21 CFR 330.11 - NDA deviations from applicable monograph.
2010-04-01
... 21 Food and Drugs 5 2010-04-01 2010-04-01 false NDA deviations from applicable monograph. 330.11... EFFECTIVE AND NOT MISBRANDED Administrative Procedures § 330.11 NDA deviations from applicable monograph. A new drug application requesting approval of an OTC drug deviating in any respect from a monograph that...
-
2010-01-01
... Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT, SELECTION, AND... Employees § 330.601 Purpose. (a) This subpart implements the President's memorandum of September 12, 1995, to establish agency Career Transition Assistance Plans for Federal employees during a period of...
-
2010-01-01
... Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT, SELECTION, AND PLACEMENT (GENERAL) Interagency Career Transition Assistance Plan for Displaced Employees § 330.703... employee means: (1) A current career or career-conditional competitive service employee, in tenure group 1...
-
2010-01-01
... Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT, SELECTION, AND PLACEMENT (GENERAL) Interagency Career Transition Assistance Plan for Displaced Employees § 330.701 Purpose... interagency career transition assistance program for Federal employees during a period of severe Federal...
-
41 CFR 102-34.330 - What is the Federal Fleet Report?
2010-07-01
... Fleet Report? 102-34.330 Section 102-34.330 Public Contracts and Property Management Federal Property... MANAGEMENT Federal Fleet Report § 102-34.330 What is the Federal Fleet Report? The Federal Fleet Report (FFR..., in evaluating the effectiveness of the operation and management of individual fleets to determine...
-
42 CFR 436.330 - Coverage for certain aliens.
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false Coverage for certain aliens. 436.330 Section 436... Coverage of the Medically Needy § 436.330 Coverage for certain aliens. If an agency provides Medicaid to... condition, as defined in § 440.255(c) of this chapter to those aliens described in § 436.406(c) of this...
-
49 CFR 236.330 - Locking dog of switch-and-lock movement.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Locking dog of switch-and-lock movement. 236.330 Section 236.330 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD... Rules and Instructions § 236.330 Locking dog of switch-and-lock movement. Locking dog of switch-and-lock...
-
2010-01-01
... Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT, SELECTION, AND PLACEMENT (GENERAL) Interagency Career Transition Assistance Plan for Displaced Employees § 330.704 Eligibility. (a) To be eligible for the special selection priority, an individual must meet all of the...
-
2010-01-01
... Employees § 330.605 Eligibility. (a) To be eligible for the special selection priority, an individual must... selection priority when there are no eligible surplus and displaced agency employees within the local...) Eligibility for special selection priority begins on the date the agency issues the employee a reduction in...
-
An Airbus arrives at KSC with third MPLM
2001-01-01
An Airbus '''Beluga''' air cargo plane, The Super Transporter, arrives at KSC's Shuttle Landing Facility from the factory of Alenia Aerospazio in Turin, Italy. Its cargo is the Italian Space Agency's Multi-Purpose Logistics Module Donatello, the third of three for the International Space Station. The module will be transported to the Space Station Processing Facility for processing. Among the activities for the payload test team are integrated electrical tests with other Station elements in the SSPF, leak tests, electrical and software compatibility tests with the Space Shuttle (using the Cargo Integrated Test equipment) and an Interface Verification Test once the module is installed in the Space Shuttle's payload bay at the launch pad. The most significant mechanical task to be performed on Donatello in the SSPF is the installation and outfitting of the racks for carrying the various experiments and cargo.
-
31 CFR 500.330 - Person within the United States.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Person within the United States. 500.330 Section 500.330 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued..., corporation, or other organization, wheresoever organized or doing business, which is owned or controlled by...
-
2010-01-01
... Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT, SELECTION, AND PLACEMENT (GENERAL) Interagency Career Transition Assistance Plan for Displaced Employees § 330.711... Displaced Employees and may conduct reviews of agency activity at any time. ...
-
2010-01-01
... conditions set forth in § 330.605(a). (e) Local commuting area means the geographic area that usually... directed reassignment outside of the local commuting area. Such employee may exercise selection priority... ranking factors cannot be so restrictive that they run counter to the goal of placing displaced employees...
-
2010-01-01
... Employees § 330.1203 Eligibility. (a) In order to be eligible for special selection priority, an eligible...) Eligibility for special selection priority as an eligible displaced employee of the former Panama Canal Zone...) Eligibility for special selection priority as an eligible displaced employee of the former Panama Canal Zone...
-
Energy Technology Data Exchange (ETDEWEB)
Vogel, C.; Drubay, B. [CEA Centre d`Etudes de Saclay, 91 - Gif-sur-Yvette (France). Dept. de Mecanique et de Technologie; Cailletaud, G. [Ecole Nationale Superieure des Mines, 75 - Paris (France); Mottot, M. [CEA Centre d`Etudes de Saclay, 91 - Gif-sur-Yvette (France). Direction des Technologies Avancees
1994-12-31
A damage model for anticipating zirconium {alpha} test-piece rupture under cyclic solicitations at 200 degree Celsius is presented. The article is divided into three parts : an experimental approach, the damage model presentation and the application of this model. (O.L.). 10 refs., 7 figs., 4 tabs.
-
2010-07-01
....330 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) POLLUTION... be conducted in accordance with the Oil Companies International Marine Forum Ship to Ship Transfer Guide (Petroleum), Second Edition, 1988, to the maximum extent practicable. (c) Helicopter operations...
-
77 FR 40830 - Airworthiness Directives; Airbus Airplanes
2012-07-11
... proposed AD was prompted by reports of ram air turbine (RAT) pump failure. This proposed AD would require..., an A330 aeroplane experienced a RAT [ram air turbine] pump failure, as a result of which, the green hydraulic system could not be fully pressurized. Investigations concluded that this malfunction was due to...
-
miR-330 regulates the proliferation of colorectal cancer cells by targeting Cdc42
Energy Technology Data Exchange (ETDEWEB)
Li, Yuefeng [The Affiliated Hospital of Jiangsu University, Zhenjiang, Jiangsu 212001 (China); Zhu, Xiaolan; Xu, Wenlin [The Fourth Affiliated Hospital of Jiangsu University, Zhenjiang, Jiangsu 212001 (China); Wang, Dongqing [The Affiliated Hospital of Jiangsu University, Zhenjiang, Jiangsu 212001 (China); Yan, Jinchuan, E-mail: jiangdalyf2009@126.com [The Affiliated Hospital of Jiangsu University, Zhenjiang, Jiangsu 212001 (China)
2013-02-15
Highlights: ► miR-330 was inversely correlated with Cdc42 in colorectal cancer cells. ► Elevated miR-330 suppressed cell proliferation in vivo and in vitro. ► Elevated miR-330 mimicked the effect of Cdc42 knockdown. ► Restoration of Cdc42 could partially attenuate the effects of miR-330. -- Abstract: MicroRNAs are small non-coding RNA molecules that play important roles in the multistep process of colorectal carcinoma (CRC) development. However, the miRNA–mRNA regulatory network is far from being fully understood. The objective of this study was to investigate the expression and the biological roles of miR-330 in colorectal cancer cells. Cdc42, one of the best characterized members of the Rho GTPase family, was found to be up-regulated in several types of human tumors including CRC and has been implicated in cancer initiation and progression. In the present study, we identified miR-330, as a potential regulator of Cdc42, was found to be inversely correlated with Cdc42 expression in colorectal cancer cell lines. Ectopic expression of miR-330 down-regulated Cdc42 expression at both protein and mRNA level, mimicked the effect of Cdc42 knockdown in inhibiting proliferation, inducing G1 cell cycle arrest and apoptosis of the colorectal cancer cells, whereas restoration of Cdc42 could partially attenuate the effects of miR-330. In addition, elevated expression of miR-330 could suppress the immediate downstream effectors of Cdc42 and inhibit the growth of colorectal cancer cells in vivo. To sum up, our results establish a role of miR-330 in negatively regulating Cdc42 expression and colorectal cancer cell proliferation. They suggest that manipulating the expression level of Cdc42 by miR-330 has the potential to influence colorectal cancer progression.
-
miR-330 regulates the proliferation of colorectal cancer cells by targeting Cdc42
International Nuclear Information System (INIS)
Li, Yuefeng; Zhu, Xiaolan; Xu, Wenlin; Wang, Dongqing; Yan, Jinchuan
2013-01-01
Highlights: ► miR-330 was inversely correlated with Cdc42 in colorectal cancer cells. ► Elevated miR-330 suppressed cell proliferation in vivo and in vitro. ► Elevated miR-330 mimicked the effect of Cdc42 knockdown. ► Restoration of Cdc42 could partially attenuate the effects of miR-330. -- Abstract: MicroRNAs are small non-coding RNA molecules that play important roles in the multistep process of colorectal carcinoma (CRC) development. However, the miRNA–mRNA regulatory network is far from being fully understood. The objective of this study was to investigate the expression and the biological roles of miR-330 in colorectal cancer cells. Cdc42, one of the best characterized members of the Rho GTPase family, was found to be up-regulated in several types of human tumors including CRC and has been implicated in cancer initiation and progression. In the present study, we identified miR-330, as a potential regulator of Cdc42, was found to be inversely correlated with Cdc42 expression in colorectal cancer cell lines. Ectopic expression of miR-330 down-regulated Cdc42 expression at both protein and mRNA level, mimicked the effect of Cdc42 knockdown in inhibiting proliferation, inducing G1 cell cycle arrest and apoptosis of the colorectal cancer cells, whereas restoration of Cdc42 could partially attenuate the effects of miR-330. In addition, elevated expression of miR-330 could suppress the immediate downstream effectors of Cdc42 and inhibit the growth of colorectal cancer cells in vivo. To sum up, our results establish a role of miR-330 in negatively regulating Cdc42 expression and colorectal cancer cell proliferation. They suggest that manipulating the expression level of Cdc42 by miR-330 has the potential to influence colorectal cancer progression
-
20 CFR 408.330 - How long will your application remain in effect?
2010-04-01
... effect? 408.330 Section 408.330 Employees' Benefits SOCIAL SECURITY ADMINISTRATION SPECIAL BENEFITS FOR CERTAIN WORLD WAR II VETERANS Filing Applications Filing Your Application § 408.330 How long will your application remain in effect? Your application for SVB will remain in effect from the date it is filed until...
-
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB330 (Link to dictyBase) - G22107 DDB0216429 Contig-U02054-1...ary VF (Link to library) Clone ID VFB330 (Link to dictyBase) Atlas ID - NBRP ID G22107 dictyBase ID DDB02164...29 Link to Contig Contig-U02054-1 | Contig-U16357-1 Original site URL http://dict...d Amino Acid sequence *k*k*NKMKLDPKALRYLSKDDFRTLVAVEMGMKNHELVPVSLICTIANLKYGGTKKSIQ TLHKFKLLFHDGRNYDGYKLTYLGY...LRYLSKDDFRTLVAVEMGMKNHELVPVSLICTIANLKYGGTKKSIQ TLHKFKLLFHDGRNYDGYKLTYLGYDFLALKTLVSRGVCSYVGNQIGVGKESDIYIVAND
-
40 CFR 1042.330 - Selling engines from an engine family with a suspended certificate of conformity.
2010-07-01
... with a suspended certificate of conformity. 1042.330 Section 1042.330 Protection of Environment... engines from an engine family with a suspended certificate of conformity. You may sell engines that you produce after we suspend the engine family's certificate of conformity under § 1042.315 only if one of the...
-
7 CFR 1210.330 - Policy and objective.
2010-01-01
... research, development, advertising, and promotion in order to: (a) Strengthen watermelons' competitive... PROMOTION PLAN Watermelon Research and Promotion Plan Research and Promotion § 1210.330 Policy and objective...
-
5 CFR 330.504 - Special restrictions after appointment under Part-time Direct Hire Program.
2010-01-01
... under Part-time Direct Hire Program. 330.504 Section 330.504 Administrative Personnel OFFICE OF... To Protect Competitive Principles § 330.504 Special restrictions after appointment under Part-time Direct Hire Program. (a) A person hired under the Part-time Direct Hire Program may not be changed to...
-
40 CFR 421.330 - Applicability: Description of the primary zirconium and hafnium subcategory.
2010-07-01
... primary zirconium and hafnium subcategory. 421.330 Section 421.330 Protection of Environment ENVIRONMENTAL... CATEGORY Primary Zirconium and Hafnium Subcategory § 421.330 Applicability: Description of the primary zirconium and hafnium subcategory. The provisions of this subpart are applicable to discharges resulting...
-
2010-01-01
... Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT, SELECTION, AND... Employees § 330.1201 Purpose. This subpart implements Section 1232 of Public Law 96-70 (the Panama Canal Act of 1979) and provides eligible displaced employees of the former Panama Canal Zone with interagency...
-
7 CFR 330.202 - Consideration of applications for permits to move plant pests.
2010-01-01
... plant pests. 330.202 Section 330.202 Agriculture Regulations of the Department of Agriculture (Continued) ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE FEDERAL PLANT PEST REGULATIONS; GENERAL; PLANT PESTS; SOIL, STONE, AND QUARRY PRODUCTS; GARBAGE Movement of Plant Pests § 330.202...
-
2010-01-01
... Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT, SELECTION, AND... Employees § 330.602 Agency plans. (a) Each agency will establish a Career Transition Assistance Plan (CTAP) to actively assist its surplus and displaced employees. A copy of the final plan and any additional...
-
75 FR 26881 - Airworthiness Directives; Airbus Model A340-200 and A340-300 Series Airplanes
2010-05-13
...;Prices of new books are listed in the first FEDERAL REGISTER issue of each #0;week. #0; #0; #0; #0;#0... the incorporation by reference of a certain publication listed in this AD. We must receive comments on... the overall regulatory, economic, environmental, and energy aspects of this AD. We will consider all...
-
20 CFR 405.330 - Prehearing conferences.
2010-04-01
... INITIAL DISABILITY CLAIMS Administrative Law Judge Hearing § 405.330 Prehearing conferences. (a)(1) The administrative law judge, on his or her own initiative or at your request, may decide to conduct a prehearing... claim. A prehearing conference normally will be held by telephone, unless the administrative law judge...
-
7 CFR 330.212 - Movement of plant pests by baggage.
2010-01-01
... 7 Agriculture 5 2010-01-01 2010-01-01 false Movement of plant pests by baggage. 330.212 Section... INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE FEDERAL PLANT PEST REGULATIONS; GENERAL; PLANT PESTS; SOIL, STONE, AND QUARRY PRODUCTS; GARBAGE Movement of Plant Pests § 330.212 Movement of plant pests by baggage...
-
Gatuzz, E.; Garcia, J.; Mendoza, C.; Kallman, Timothy R.; Witthoeft, Michael C.; Lohfink, A.; Bautista, M. A.; Palmeri, P.; Quinet, P.
2013-01-01
In the published version of this paper, there are some minor inaccuracies in the absorption-line wavelengths listed in Table 4 as a result of a faulty reduction procedure of the Obs6615 spectrum. The shifts have been detected in a comparison with the wavelengths listed for this spectrum in the Chandra Transmission Grating Catalog and Archive (TGCat8). They are due to incorrect centroid positions of the zero-order image in both reductions as determined by the tgdetect utility which, when disentangled, yield the improved line positions of the amended Table 4 given below. It must also be pointed out that other quantitative findings of the original paper: 1. Table 5, p. 9: the column density (NH), ionization parameter, oxygen abundance of the warmabs model and the normalization and photon index of the power-law model; 2. Table 6, p. 9: the hydrogen column density of the warmabs fit; 3. Table 7, p. 9: the present oxygen equivalent widths of XTE J1817-330; and 4. Table 8, p. 10: the present oxygen column densities of XTE J1817-330 derived from both the curve of growth and warmabs model fit have been revised in the new light and are, within the estimated uncertainty ranges, in good accord with the new rendering.
-
Erata, Ferhat; Gardent, Claire; Gyawali, Bikash; Shimorina, Anastasia; Lussaud, Yvan; Tekinerdogan, Bedir; Kardas, Geylani; Monceaux, Anne
2017-01-01
The ModelWriter platform provides a generic framework for automated traceability analysis. In this paper, we demonstrate how this framework can be used to trace the consistency and completeness of technical documents that consist of a set of System Installation Design Principles used by Airbus to
-
Dynamic model for the control system simulation and design of a 200 MW nuclear heating reactor
International Nuclear Information System (INIS)
Zhang Yuai; Liu Longzhi; Ma Changwen
1999-01-01
The author develops a nonlinear dynamic model used in a wide range control system simulation for a 200 MW Nuclear Heating Reactor (NHR-200). Besides a one-point neutron kinetics equation and temperature feedback based on the lumped fuel and coolant temperature, which are the usual methods used in modeling of PWR, two other factors are also considered in order to suit the wide range operation. The first consideration is the natural circulation in the primary loop because it affects the heat transfer coefficients in the core and in the primary heat exchanger (PHE). The second consideration is the flow rate variation in the secondary loop which leads to some nonlinear properties. The simulation results show that the model is accurate enough for control system simulation. Some model reduction basis can be obtained through the dynamic analysis
-
Fatal Prion Disease in a Mouse Model of Genetic E200K Creutzfeldt-Jakob Disease
Friedman-Levi, Yael; Meiner, Zeev; Canello, Tamar; Frid, Kati; Kovacs, Gabor G.; Budka, Herbert; Avrahami, Dana; Gabizon, Ruth
2011-01-01
Genetic prion diseases are late onset fatal neurodegenerative disorders linked to pathogenic mutations in the prion protein-encoding gene, PRNP. The most prevalent of these is the substitution of Glutamate for Lysine at codon 200 (E200K), causing genetic Creutzfeldt-Jakob disease (gCJD) in several clusters, including Jews of Libyan origin. Investigating the pathogenesis of genetic CJD, as well as developing prophylactic treatments for young asymptomatic carriers of this and other PrP mutations, may well depend upon the availability of appropriate animal models in which long term treatments can be evaluated for efficacy and toxicity. Here we present the first effective mouse model for E200KCJD, which expresses chimeric mouse/human (TgMHu2M) E199KPrP on both a null and a wt PrP background, as is the case for heterozygous patients and carriers. Mice from both lines suffered from distinct neurological symptoms as early as 5–6 month of age and deteriorated to death several months thereafter. Histopathological examination of the brain and spinal cord revealed early gliosis and age-related intraneuronal deposition of disease-associated PrP similarly to human E200K gCJD. Concomitantly we detected aggregated, proteinase K resistant, truncated and oxidized PrP forms on immunoblots. Inoculation of brain extracts from TgMHu2ME199K mice readily induced, the first time for any mutant prion transgenic model, a distinct fatal prion disease in wt mice. We believe that these mice may serve as an ideal platform for the investigation of the pathogenesis of genetic prion disease and thus for the monitoring of anti-prion treatments. PMID:22072968
-
Fatal prion disease in a mouse model of genetic E200K Creutzfeldt-Jakob disease.
Directory of Open Access Journals (Sweden)
Yael Friedman-Levi
2011-11-01
Full Text Available Genetic prion diseases are late onset fatal neurodegenerative disorders linked to pathogenic mutations in the prion protein-encoding gene, PRNP. The most prevalent of these is the substitution of Glutamate for Lysine at codon 200 (E200K, causing genetic Creutzfeldt-Jakob disease (gCJD in several clusters, including Jews of Libyan origin. Investigating the pathogenesis of genetic CJD, as well as developing prophylactic treatments for young asymptomatic carriers of this and other PrP mutations, may well depend upon the availability of appropriate animal models in which long term treatments can be evaluated for efficacy and toxicity. Here we present the first effective mouse model for E200KCJD, which expresses chimeric mouse/human (TgMHu2M E199KPrP on both a null and a wt PrP background, as is the case for heterozygous patients and carriers. Mice from both lines suffered from distinct neurological symptoms as early as 5-6 month of age and deteriorated to death several months thereafter. Histopathological examination of the brain and spinal cord revealed early gliosis and age-related intraneuronal deposition of disease-associated PrP similarly to human E200K gCJD. Concomitantly we detected aggregated, proteinase K resistant, truncated and oxidized PrP forms on immunoblots. Inoculation of brain extracts from TgMHu2ME199K mice readily induced, the first time for any mutant prion transgenic model, a distinct fatal prion disease in wt mice. We believe that these mice may serve as an ideal platform for the investigation of the pathogenesis of genetic prion disease and thus for the monitoring of anti-prion treatments.
-
2011-05-11
..., 2008. (A) If cracking is found and the radius of the rework is less than 20.0 mm (0.787 inch), before... paragraph (g)(6) of this AD. (B) If cracking is found and the radius of the rework is 20.0 mm (0.787 inch... information do not specify a corrective action if cracking is found and the radius of the rework is 20.0 mm (0...
-
46 CFR 120.330 - Distribution panels and switchboards.
2010-10-01
... INSTALLATION Power Sources and Distribution Systems § 120.330 Distribution panels and switchboards. (a) Each... vessel's wiring, must not have electrically unshielded or uninsulated surfaces. (k) Switchboards and...
-
Identification of megalin/gp330 as a receptor for lipoprotein(a) in vitro
DEFF Research Database (Denmark)
Niemeier, A; Willnow, T; Dieplinger, H
1999-01-01
for both LRP and megalin/gp330 were compared with regard to their ability to bind, internalize, and degrade dioctadecyltetramethylindocarbocyanine perchlorate (DiI)-fluorescence-labeled Lp(a) as well as equimolar amounts of 125I-labeled Lp(a) and LDL. Uptake and degradation of radiolabeled Lp...
-
5 CFR 330.707 - Reporting vacancies to OPM.
2010-01-01
... RECRUITMENT, SELECTION, AND PLACEMENT (GENERAL) Interagency Career Transition Assistance Plan for Displaced Employees § 330.707 Reporting vacancies to OPM. (a) Agencies are required to report all competitive service...
-
7 CFR 330.201 - Applications for permits to move plant pests.
2010-01-01
... 7 Agriculture 5 2010-01-01 2010-01-01 false Applications for permits to move plant pests. 330.201... HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE FEDERAL PLANT PEST REGULATIONS; GENERAL; PLANT PESTS; SOIL, STONE, AND QUARRY PRODUCTS; GARBAGE Movement of Plant Pests § 330.201 Applications for permits to...
-
5 CFR 330.708 - Application and selection.
2010-01-01
... RECRUITMENT, SELECTION, AND PLACEMENT (GENERAL) Interagency Career Transition Assistance Plan for Displaced Employees § 330.708 Application and selection. (a) Application. (1) To receive this special selection priority, eligible employees must apply directly to agencies for specific vacancies in the local commuting...
-
2010-07-01
... contract. (c) Name of projects covered under each contract. (d) Number of man-hours of increased law... Engineers assessment of the effects of the contract law enforcement program and recommendation. ... 330.8 Parks, Forests, and Public Property CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY REGULATION OF LAW...
-
49 CFR 172.330 - Tank cars and multi-unit tank car tanks.
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Tank cars and multi-unit tank car tanks. 172.330..., TRAINING REQUIREMENTS, AND SECURITY PLANS Marking § 172.330 Tank cars and multi-unit tank car tanks. (a... material— (1) In a tank car unless the following conditions are met: (i) The tank car must be marked on...
-
Directory of Open Access Journals (Sweden)
Zhenxin Zheng
2018-03-01
Full Text Available Background/Aims: Growing evidence has shown that miR-330-3p is closely related to the biological behavior of cancer, including proliferation, metastasis, and prognosis. However, there have been no reports on miR-330-3p expression and function in osteosarcoma. Methods: Expression of miR-330-3p in osteosarcoma tissues and cell lines was examined by quantitative PCR. Effects of miR-330-3p on osteosarcoma cell proliferation were investigated in vitro with the Cell Counting Kit-8 colorimetric assay. Targets of miR-330-3p were identified by dual-luciferase reporter assay. Results: The results showed that expression of miR-330 decreased in osteosarcoma tissues and cell lines. Prognosis of patients with high miR-330-3p expression was much better than that of those with low expression (P=0.001, and multivariate analysis suggested that miR-330-3p is an independent prognostic factor for osteosarcoma. In addition, miR-330-3p overexpression significantly inhibited the growth of MG-63 and U2OS osteosarcoma cells. Dual-luciferase reporter assay demonstrated that Bmi-1 was a direct target gene of miR-330-3p, and in a recovery experiment, miR-330-3p suppressed osteosarcoma cell proliferation by directly targeting Bmi-1. Conclusion: Our results suggest that miR-330-3p acts as a tumor suppressor by regulating Bmi-1 expression in osteosarcoma. Thus, miR-330-3p may represent a novel therapeutic target for the treatment of osteosarcoma.
-
Association of -330 interleukin-2 gene polymorphism with oral cancer.
Singh, Prithvi Kumar; Kumar, Vijay; Ahmad, Mohammad Kaleem; Gupta, Rajni; Mahdi, Abbas Ali; Jain, Amita; Bogra, Jaishri; Chandra, Girish
2017-12-01
Cytokines play an important role in the development of cancer. Several single-nucleotide polymorphisms (SNPs) of cytokine genes have been reported to be associated with the development and severity of inflammatory diseases and cancer predisposition. This study was undertaken to evaluate a possible association of interleukin 2 (IL-2) (- 330A>C) gene polymorphisms with the susceptibility to oral cancer. The SNP in IL-2 (-330A>C) gene was genotyped in 300 oral cancer patients and in similar number of healthy volunteers by polymerase chain reaction (PCR)-restriction fragment length polymorphism and the association of the gene with the disease was evaluated. IL-2 (-330A>C) gene polymorphism was significantly associated with oral cancer whereas it was neither associated with clinicopathological status nor with cancer pain. The AC heterozygous genotype was significantly associated with oral cancer patients as compared to controls [odds ratio (OR): 3.0; confidence interval (CI): 2.14-4.20; Poral cancer (OR: 1.80; CI: 1.39-2.33; PC) gene polymorphism was also associated with oral cancer in tobacco smokers and chewers. Our results showed that oral cancer patients had significantly higher frequency of AA genotype but significantly lower frequency of AC genotype and C allele compared to controls. The IL-2 AC genotype and C allele of IL-2 (-330A>C) gene polymorphisms could be potential protective factors and might reduce the risk of oral cancer in Indian population.
-
LENUS (Irish Health Repository)
Bibby, Becky A S
2015-01-01
Oesophageal adenocarcinoma (OAC) is the sixth most common cause of cancer deaths worldwide, and the 5-year survival rate for patients diagnosed with the disease is approximately 17%. The standard of care for locally advanced disease is neoadjuvant chemotherapy or, more commonly, combined neoadjuvant chemoradiation therapy (neo-CRT) prior to surgery. Unfortunately, ~60-70% of patients will fail to respond to neo-CRT. Therefore, the identification of biomarkers indicative of patient response to treatment has significant clinical implications in the stratification of patient treatment. Furthermore, understanding the molecular mechanisms underpinning tumour response and resistance to neo-CRT will contribute towards the identification of novel therapeutic targets for enhancing OAC sensitivity to CRT. MicroRNAs (miRNA\\/miR) function to regulate gene and protein expression and play a causal role in cancer development and progression. MiRNAs have also been identified as modulators of key cellular pathways associated with resistance to CRT. Here, to identify miRNAs associated with resistance to CRT, pre-treatment diagnostic biopsy specimens from patients with OAC were analysed using miRNA-profiling arrays. In pre-treatment biopsies miR-330-5p was the most downregulated miRNA in patients who subsequently failed to respond to neo-CRT. The role of miR-330 as a potential modulator of tumour response and sensitivity to CRT in OAC was further investigated in vitro. Through vector-based overexpression the E2F1\\/p-AKT survival pathway, as previously described, was confirmed as a target of miR-330 regulation. However, miR-330-mediated alterations to the E2F1\\/p-AKT pathway were insufficient to significantly alter cellular sensitivity to chemotherapy (cisplatin and 5-flurouracil). In contrast, silencing of miR-330-5p enhanced, albeit subtly, cellular resistance to clinically relevant doses of radiation. This study highlights the need for further investigation into the potential of
-
2011-04-12
...; Information Collection; Architect-Engineer Qualifications (SF 330) AGENCIES: Department of Defense (DOD... approve an extension of a currently approved information collection requirement for the Architect-Engineer... Standard Form 330, Part I is used by all Executive agencies to obtain information from architect-engineer...
-
5 CFR 330.608 - Application and selection.
2010-01-01
... Surplus and Displaced Employees § 330.608 Application and selection. (a) Application. (1) To receive this special selection priority, an eligible employee must apply for a specific agency vacancy in the same... identifying the employee as being in a surplus organization or occupation. (b) Selection. An agency may decide...
-
12 CFR 563b.330 - How do I price my conversion shares?
2010-01-01
... FROM MUTUAL TO STOCK FORM Standard Conversions Offers and Sales of Stock § 563b.330 How do I price my conversion shares? (a) You must sell your conversion shares at a uniform price per share and at a total price... 12 Banks and Banking 5 2010-01-01 2010-01-01 false How do I price my conversion shares? 563b.330...
-
24 CFR 203.330 - Definition of delinquency and requirement for notice of delinquency to HUD.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Definition of delinquency and requirement for notice of delinquency to HUD. 203.330 Section 203.330 Housing and Urban Development... and Obligations Default Under Mortgage § 203.330 Definition of delinquency and requirement for notice...
-
Fernando, R; Vanezis, P
1998-06-01
A Thai Airbus, carrying 99 passengers and 14 crew members, traveling from Bangkok to Kathmandu, hit a mountain and crashed several minutes before landing. There were no survivors. Recovered human remains, none of which was easily identifiable, varied in size from a small piece of muscle to mutilated bodies. Of the 97 fragments, only 15 were sufficiently intact (albeit, only partially) to be designated as "bodies." Of the fragments and "bodies," only 11 were positively identified. Causes of death, although all traumatic, could not be stated accurately due to the degree of disintegration. Identification of human remains in these circumstances is a major problem for the pathologist.
-
Alterations in CD200-CD200R1 System during EAE Already Manifest at Presymptomatic Stages
Directory of Open Access Journals (Sweden)
Tony Valente
2017-05-01
Full Text Available In the brain of patients with multiple sclerosis, activated microglia/macrophages appear in active lesions and in normal appearing white matter. However, whether they play a beneficial or a detrimental role in the development of the pathology remains a controversial issue. The production of pro-inflammatory molecules by chronically activated microglial cells is suggested to contribute to the progression of neurodegenerative processes in neurological disease. In the healthy brain, neurons control glial activation through several inhibitory mechanisms, such as the CD200-CD200R1 interaction. Therefore, we studied whether alterations in the CD200-CD200R1 system might underlie the neuroinflammation in an experimental autoimmune encephalomyelitis (EAE model of multiple sclerosis. We determined the time course of CD200 and CD200R1 expression in the brain and spinal cord of an EAE mouse model from presymptomatic to late symptomatic stages. We also assessed the correlation with associated glial activation, inflammatory response and EAE severity. Alterations in CD200 and CD200R1 expression were mainly observed in spinal cord regions in the EAE model, mostly a decrease in CD200 and an increase in CD200R1 expression. A decrease in the expression of the mRNA encoding a full CD200 protein was detected before the onset of clinical signs, and remained thereafter. A decrease in CD200 protein expression was observed from the onset of clinical signs. By contrast, CD200R1 expression increased at EAE onset, when a glial reaction associated with the production of pro- and anti-inflammatory markers occurred, and continued to be elevated during the pathology. Moreover, the magnitude of the alterations correlated with severity of the EAE mainly in spinal cord. These results suggest that neuronal-microglial communication through CD200-CD200R1 interaction is compromised in EAE. The early decreases in CD200 expression in EAE suggest that this downregulation might also
-
7 CFR 330.205 - Disposal of plant pests when permits are canceled.
2010-01-01
... 7 Agriculture 5 2010-01-01 2010-01-01 false Disposal of plant pests when permits are canceled. 330... PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE FEDERAL PLANT PEST REGULATIONS; GENERAL; PLANT PESTS; SOIL, STONE, AND QUARRY PRODUCTS; GARBAGE Movement of Plant Pests § 330.205 Disposal of...
-
46 CFR 183.330 - Distribution panels and switchboards.
2010-10-01
... (UNDER 100 GROSS TONS) ELECTRICAL INSTALLATION Power Sources and Distribution Systems § 183.330... vessel's wiring, must not have any electrically unshielded or uninsulated surfaces. (j) Switchboards and...
-
14 CFR 330.25 - What are the components of an air carrier's application for compensation?
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false What are the components of an air carrier's application for compensation? 330.25 Section 330.25 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT... CARRIERS Application Procedures § 330.25 What are the components of an air carrier's application for...
-
Nucleon-nucleus optical model up to 200 MeV. Proceedings of a specialist meeting
International Nuclear Information System (INIS)
OECD Nuclear Energy Agency; Commissariat a l'Energie Atomique
1997-01-01
The proceedings of the Specialists Meeting on Nucleon-Nucleus Optical Model up to 200 MeV contains papers on different topics in connection with the nuclear optical potential research. The purpose of the meeting was to reach a common understanding between nuclear theorists, experimentalists and the applied community on the most reliable approaches to predicting nuclear cross-sections in the medium energy region. The discussion centred around such questions as 'What are the better theoretical models today?', and 'What experimental data are required to test the models?'. 23 items are indexed separately for the INIS database. (K.A.)
-
2011-01-03
... radius of the rework is less than 20.0 mm (0.787 inch), before further flight, increase the radius and do... this AD. (B) If cracking is found and the radius of the rework is 20.0 mm (0.787 inch) or more, before... cracking is found and the radius of the rework is 20.0 mm (0.787 inch) or more. Paragraph (g)(3)(i)(B) of...
-
7 CFR 330.302 - Domestic movements of earth (including soil), stone, etc.
2010-01-01
... 7 Agriculture 5 2010-01-01 2010-01-01 false Domestic movements of earth (including soil), stone, etc. 330.302 Section 330.302 Agriculture Regulations of the Department of Agriculture (Continued) ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE FEDERAL PLANT PEST REGULATIONS; GENERAL; PLANT PESTS; SOIL, STONE, AND QUARRY...
-
12 CFR 330.6 - Single ownership accounts.
2010-01-01
... signatories on the account are merely authorized to withdraw funds on behalf of the owner. (b) Sole proprietorship accounts. Funds owned by a business which is a “sole proprietorship” (as defined in § 330.1(m... individual account(s) of the person who is the sole proprietor, added to any other individual accounts of...
-
A Critical Role for CD200R Signaling in Limiting the Growth and Metastasis of CD200+ Melanoma.
Liu, Jin-Qing; Talebian, Fatemeh; Wu, Lisha; Liu, Zhihao; Li, Ming-Song; Wu, Laichu; Zhu, Jianmin; Markowitz, Joseph; Carson, William E; Basu, Sujit; Bai, Xue-Feng
2016-08-15
CD200 is a cell surface glycoprotein that functions through engaging CD200R on cells of the myeloid lineage and inhibits their functions. Expression of CD200 was implicated in a variety of human cancer cells, including melanoma cells; however, its roles in tumor growth and immunity are not clearly understood. In this study, we used CD200R-deficient mice and the B16 tumor model to evaluate this issue. We found that CD200R-deficient mice exhibited accelerated growth of CD200(+), but not CD200(-), B16 tumors. Strikingly, CD200R-deficient mice receiving CD200(+) B16 cells i.v. exhibited massive tumor growth in multiple organs, including liver, lung, kidney, and peritoneal cavity, whereas the growth of the same tumors in wild-type mice was limited. CD200(+) tumors grown in CD200R-deficient mice contained higher numbers of CD11b(+)Ly6C(+) myeloid cells, exhibited increased expression of VEGF and HIF1α genes with increased angiogenesis, and showed significantly reduced infiltration of CD4(+) and CD8(+) T cells, presumably as the result of reduced expression of T cell chemokines, such as CXCL9 and CXCL16. The liver from CD200R-deficient mice, under metastatic growth of CD200(+) tumors, contained significantly increased numbers of CD11b(+)Gr1(-) myeloid cells and Foxp3(+) regulatory T cells and reduced numbers of NK cells. Liver T cells also had a reduced capacity to produce IFN-γ or TNF-α. Taken together, we revealed a critical role for CD200R signaling in limiting the growth and metastasis of CD200(+) tumors. Thus, targeting CD200R signaling may potentially interfere with the metastatic growth of CD200(+) tumors, like melanoma. Copyright © 2016 by The American Association of Immunologists, Inc.
-
2010-07-01
... improved pension and parents' dependency and indemnity compensation (DIC). 3.30 Section 3.30 Pensions... Dependency and Indemnity Compensation General § 3.30 Frequency of payment of improved pension and parents' dependency and indemnity compensation (DIC). Payment shall be made as shown in paragraphs (a), (b), (c), (d...
-
2010-07-01
... carbon monoxide and by-product hydrogen production subcategory. 415.330 Section 415.330 Protection of... MANUFACTURING POINT SOURCE CATEGORY Carbon Monoxide and By-Product Hydrogen Production Subcategory § 415.330 Applicability; description of the carbon monoxide and by-product hydrogen production subcategory. The provisions...
-
Modelling exhaust plume mixing in the near field of an aircraft
Directory of Open Access Journals (Sweden)
F. Garnier
Full Text Available A simplified approach has been applied to analyse the mixing and entrainment processes of the engine exhaust through their interaction with the vortex wake of an aircraft. Our investigation is focused on the near field, extending from the exit nozzle until about 30 s after the wake is generated, in the vortex phase. This study was performed by using an integral model and a numerical simulation for two large civil aircraft: a two-engine Airbus 330 and a four-engine Boeing 747. The influence of the wing-tip vortices on the dilution ratio (defined as a tracer concentration shown. The mixing process is also affected by the buoyancy effect, but only after the jet regime, when the trapping in the vortex core has occurred. In the early wake, the engine jet location (i.e. inboard or outboard engine jet has an important influence on the mixing rate. The plume streamlines inside the vortices are subject to distortion and stretching, and the role of the descent of the vortices on the maximum tracer concentration is discussed. Qualitative comparison with contrail photograph shows similar features. Finally, tracer concentration of inboard engine centreline of B-747 are compared with other theoretical analyses and measured data.
-
Managing path-breaking innovations CERN-ATLAS, Airbus, and stem cell research
Liyanage, Shanta; Nordberg, Markus
2007-01-01
Path-breaking innovations are about instigating fundamental changes in people, organizations, communities, and economies. They are complex, continuous, and evolutionary processes that take considerable time, resources, and the efforts of many individuals and organizations to be accomplished successfully. Representing distinct departures from existing practices, they differ from other types of innovation, such as product extensions and incremental improvements. By examining path-breaking innovation processes through in-depth analysis of several large-scale initiatives around the world, the authors explore how profound changes in product, process, and service can be explained and managed, and consider the practical implications for scientific, organizational, institutional, and political leaders concerned with channeling innovation toward economic growth. In-depth analysis of science and technology initiatives at CERN-ATLAS, Airbus, and in stem cell research, the authors explore and illuminate how profound cha...
-
41 CFR 102-74.330 - What smoking restrictions apply to outside areas under Executive branch control?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What smoking restrictions apply to outside areas under Executive branch control? 102-74.330 Section 102-74.330 Public... MANAGEMENT REGULATION REAL PROPERTY 74-FACILITY MANAGEMENT Facility Management Smoking § 102-74.330 What...
-
Concentrations of selected contaminants in cabin air of airbus aircrafts.
Dechow, M; Sohn, H; Steinhanses, J
1997-07-01
The concentrations of selected air quality parameters in aircraft cabins were investigated including particle numbers in cabin air compared to fresh air and recirculation air, the microbiological contamination and the concentration of volatile organic compounds (VOC). The Airbus types A310 of Swissair and A340 of Lufthansa were used for measurements. The particles were found to be mainly emitted by the passengers, especially by smokers. Depending on recirculation filter efficiency the recirculation air contained a lower or equal amount of particles compared to the fresh air, whereas the amount of bacteria exceeded reported concentrations within other indoor spaces. The detected species were mainly non-pathogenic, with droplet infection over short distances identified as the only health risk. The concentration of volatile organic compounds (VOC) were well below threshold values. Ethanol was identified as the compound with the highest amount in cabin air. Further organics were emitted by the passengers--as metabolic products or by smoking--and on ground as engine exhaust (bad airport air quality). Cleaning agents may be the source of further compounds.
-
Deformation mechanism in LiF single crystals at 1.7 to 330 K
International Nuclear Information System (INIS)
Niaz, S.; Butt, M.Z.
1999-01-01
The experimental data appertaining to the influence of temperature on the critical resolved shear stress (CRSS) of LiF ionic single crystals containing 10/sup -3/ wt% of divalent metal impurities in the range 1.7 to 330 K have been analyzed within the framework of the kink-pair nucleation (KPN) model of plastic flow in crystalline materials. The CRSS-T data when plotted in log-linear coordinates exhibit three distinct regions represented by straight lines of different slopes. In the temperature range 1.7 to 90 K, the CRSS 6 determined primarily by the stress-assisted thermally-activated escape of screw dislocations trapped in the Peierls troughs. At temperatures between 90 and 260 K, the rate process of plastic deformation is unpinning of edge-dislocation segments from short was rows of randomly dispersed point defects, e.g. residual metal impurities atoms, divalent metal ion-vacancy dipoles, induced defects formed during the pre-yield stage etc. 4. However, at higher temperatures up to 330 K, the CRSS decreases rapidly with rise in temperature, probably due to the mobility of the point defects referred to, and the KPN model becomes inapplicable. (author)
-
42 CFR 486.330 - Condition: Information management.
2010-10-01
... 42 Public Health 5 2010-10-01 2010-10-01 false Condition: Information management. 486.330 Section...: Information management. An OPO must establish and use an electronic information management system to maintain the required medical, social and identifying information for every donor and transplant recipient and...
-
42 CFR 440.330 - Benchmark health benefits coverage.
2010-10-01
...) Federal Employees Health Benefit Plan Equivalent Coverage (FEHBP—Equivalent Health Insurance Coverage). A... coverage. Health benefits coverage that is offered and generally available to State employees in the State... 42 Public Health 4 2010-10-01 2010-10-01 false Benchmark health benefits coverage. 440.330 Section...
-
Analisis Pengawasan Logistik Produk Aqua Ukuran 330ml Pada CV. Dlu'x Resto Samarinda
Mardiana, Ali Masuhud, H. Mulyadi Syp
2016-01-01
The problem in this research is "Are Determination Against Aqua Products Logistics Control 330ml sizes on CV. DLux Resto has been optimized? "This study aims to determine the amount of inventory on the CV aqua 330ml sizes. Dlu'x Resto in Samarinda.Formulation of the problem in this study is whether the determination of the logistical monitoring product inventory aqua 330ml sizes that have been carried out on the CV. Dlu'x Resto Samarinda already performed optimally.The hypothesis in this stud...
-
14 CFR 330.23 - To what address must air carriers send their applications?
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false To what address must air carriers send their applications? 330.23 Section 330.23 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF...) to the following address: U.S. Department of Transportation, Aviation Relief Desk (X-50), 1200 New...
-
7 CFR 330.300 - Soil from foreign countries or Territories or possessions. 1
2010-01-01
... 7 Agriculture 5 2010-01-01 2010-01-01 false Soil from foreign countries or Territories or possessions. 1 330.300 Section 330.300 Agriculture Regulations of the Department of Agriculture (Continued) ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE FEDERAL PLANT PEST REGULATIONS; GENERAL; PLANT PESTS; SOIL, STONE, AND QUARRY...
-
A fully microscopic model of 200 MeV proton-12C elastic and inelastic scattering
International Nuclear Information System (INIS)
Karataglidis, S.; Dortmans, P.J.; Amos, K.; de Swiniarski, R.
1996-01-01
An effective two nucleon (NN) interaction in the nuclear medium is defined from an accurate mapping of the NN g matrices obtained by solving the Brueckner-Bethe-Goldstone equations for infinite nuclear matter. That effective interaction is used in a fully microscopic calculation of the nonlocal effective proton- 12 C interaction from which are obtained predictions of the differential cross section and analysing power for 200 MeV elastic scattering. The relative motion wave functions so found are used as the distorted waves in a distorted wave approximation (DWA) study of select inelastic scattering events. The effective NN interaction is used as the transition operator in those calculations. The relevant nuclear spectroscopy for the elastic and DWA (p, p') calculations is found from a full (0 + 2) ℎω shell model evaluation of the positive parity states while a restricted (1 + 3)ℎω has been used to give the negative parity states. Results are compared with those of the 0p-shell model of Cohen and Kurath or with those based upon axially symmetric, projected Hartree-Fock calculations. The diverse structure model wave functions are assessed by using them in calculations to compare with measured longitudinal, transverse electric and transverse magnetic form factors from electron scattering to many of the excited states of 12 C. Using those models of the structure of 12 C in the completely microscopic model of the elastic and inelastic scattering of 200 MeV protons, good fits have been found to the cross section and analysing power data. 50 refs., 3 tabs., 20 figs
-
20 CFR 410.330 - Determination of relationship; child.
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Determination of relationship; child. 410.330... relationship; child. As used in this section, the term beneficiary means only a widow entitled to benefits at... “father” only, in which case it means only a miner. An individual will be considered to be the child of a...
-
46 CFR 130.330 - Charts and nautical publications.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Charts and nautical publications. 130.330 Section 130... publications. (a) Except as provided by paragraph (b) or (c) of this section, as appropriate for the intended... navigation possible; (2) U.S. Coast Pilot or similar publication; (3) Coast Guard Light List; (4) Tide Tables...
-
APPLICATION OF SSSC TO THE 330kV NIGERIAN ...
African Journals Online (AJOL)
HOD
2,3 DEPARTMENT OF ELECTRONIC AND ELECTRICAL ENGR., FEDERAL POLYTECHNIC EDE, ... Longitudinal power systems of Nigerian 330 kV transmission network have steady-state ..... C tr ller ” Unpublish Master Thesis Submitted to.
-
Triaxiality in the even-mass Hg isotopes: A discontinuity at 200Hg
International Nuclear Information System (INIS)
Morrison, I.; Spear, R.H.
1981-01-01
The mass dependence of excitation energies of the 2 + 1 , 2 + 2 , and 4 + 1 states of the even-mass Hg isotopes, and of some related B(E2) values, shows a marked discontinuity at 200 Hg. Analysis of B(E2;0 + 1 →2 + 1 ) values in terms of an extended interacting boson approximation model suggests that this discontinuity is due to a change in the proton and neutron distributions at 200 Hg. Apart from 200 Hg, the data favor γ-soft models rather than the rigid triaxial-rotor model
-
7 CFR 330.204 - Denial or cancellation of permits; reconsiderations.
2010-01-01
...; PLANT PESTS; SOIL, STONE, AND QUARRY PRODUCTS; GARBAGE Movement of Plant Pests § 330.204 Denial or... ground it will involve a danger of dissemination of the plant pest into the State, Territory or...
-
Modelling of large sodium fires: A coupled experimental and calculational approach
International Nuclear Information System (INIS)
Astegiano, J.C.; Balard, F.; Cartier, L.; De Pascale, C.; Forestier, A.; Merigot, C.; Roubin, P.; Tenchine, D.; Bakouta, N.
1996-01-01
The consequences of large sodium leaks in secondary circuit of Super-Phenix have been studied mainly with the FEUMIX code, on the basis of sodium fire experiments. This paper presents the status of the coupled AIRBUS (water experiment) FEUMIX approach under development in order to strengthen the extrapolation made for the Super-Phenix secondary circuits calculations for large leakage flow. FEUMIX code is a point code based on the concept of a global interfacial area between sodium and air. Mass and heat transfers through this global area is supposed to be similar. Then, global interfacial transfer coefficient Sih is an important parameter of the model. Correlations for the interfacial area are extracted from a large number of sodium tests. For the studies of hypothetical large sodium leak in secondary circuit of Super-Phenix, flow rates of more than 1 t/s have been considered and extrapolation was made from the existing results (maximum flow rate 225 kg/s). In order to strengthen the extrapolation, water test has been contemplated, on the basis of a thermal hydraulic similarity. The principle is to measure the interfacial area of a hot water jet in air, then to transpose the Sih to sodium without combustion, and to use this value in FEUMIX with combustion modelling. AIRBUS test section is a parallelepipedic gastight tank, 106 m 3 (5.7 x 3.7 x 5) internally insulated. Water jet is injected from heated external auxiliary tank into the cell using pressurized air tank and specific valve. The main measurements performed during each test are injected flow rate air pressure water temperature gas temperature A first series of tests were performed in order to qualify the methodology: typical FCA and IGNA sodium fire tests were represented in AIRBUS, and a comparison of the FEUMIX calculation using Sih value deduced from water experiments show satisfactory agreement. A second series of test for large flow rate, corresponding to large sodium leak in secondary circuit of Super
-
Gu, Ting-Ting; Song, Lin; Chen, Tian-Yu; Wang, Xing; Zhao, Xiao-Juan; Ding, Xiao-Qin; Yang, Yan-Zi; Pan, Ying; Zhang, Dong-Mei; Kong, Ling-Dong
2017-08-01
Fructose induces insulin resistance with kidney inflammation and injury. MicroRNAs are emerged as key regulators of insulin signaling. Morin has insulin-mimetic effect with the improvement of insulin resistance and kidney injury. This study investigated the protective mechanisms of morin against fructose-induced kidney injury, with particular focus on miR-330 expression change, inflammatory response, and insulin signaling impairment. miR-330, sphingosine kinase 1 (SphK1)/sphingosine-1-phosphate (S1P)/S1P receptor (S1PR)1/3 signaling, nuclear factor-κB (NF-κB)/NOD-like receptor family, pyrin domain containing 3 (NLRP3) inflammasome, and insulin signaling were detected in kidney cortex of fructose-fed rats and fructose-exposed HK-2 cells, respectively. Whether miR-330 mediated inflammatory response to affect insulin signaling was examined using SphK1 inhibitor, S1PR1/3 short interfering RNA, or miR-330 mimic/inhibitor, respectively. Fructose was found to downregulate miR-330 expression to increase SphK1/S1P/S1PR1/3 signaling, and then activate NF-κB/NLRP3 inflammasome to produce IL-1β, causing insulin signaling impairment. Moreover, morin upregulated miR-330 and partly attenuated inflammatory response and insulin signaling impairment to alleviate kidney injury. These findings suggest that morin protects against fructose-induced kidney insulin signaling impairment by upregulating miR-330 to reduce inflammatory response. Morin may be a potential therapeutic agent for the treatment of kidney injury associated with fructose-induced inflammation and insulin signaling impairment. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
-
Chen, Song; Wang, Chenran; Yeo, Syn; Liang, Chun-Chi; Okamoto, Takako; Sun, Shaogang; Wen, Jian; Guan, Jun-Lin
2016-01-01
Autophagy is an evolutionarily conserved cellular process controlled through a set of essential autophagy genes (Atgs). However, there is increasing evidence that most, if not all, Atgs also possess functions independent of their requirement in canonical autophagy, making it difficult to distinguish the contributions of autophagy-dependent or -independent functions of a particular Atg to various biological processes. To distinguish these functions for FIP200 (FAK family-interacting protein of 200 kDa), an Atg in autophagy induction, we examined FIP200 interaction with its autophagy partner, Atg13. We found that residues 582–585 (LQFL) in FIP200 are required for interaction with Atg13, and mutation of these residues to AAAA (designated the FIP200-4A mutant) abolished its canonical autophagy function in vitro. Furthermore, we created a FIP200-4A mutant knock-in mouse model and found that specifically blocking FIP200 interaction with Atg13 abolishes autophagy in vivo, providing direct support for the essential role of the ULK1/Atg13/FIP200/Atg101 complex in the process beyond previous studies relying on the complete knockout of individual components. Analysis of the new mouse model showed that nonautophagic functions of FIP200 are sufficient to fully support embryogenesis by maintaining a protective role in TNFα-induced apoptosis. However, FIP200-mediated canonical autophagy is required to support neonatal survival and tumor cell growth. These studies provide the first genetic evidence linking an Atg's autophagy and nonautophagic functions to different biological processes in vivo. PMID:27013233
-
Kulkarni, S; Nautiyal, C S
2000-04-01
A study was conducted to examine the growth response of a rhizobial strain Rhizobium sp. NBRI330 isolated from root nodules of Prosopis juliflora growing in alkaline soil. The strain had the ability to nodulate P. juliflora. Nursery grown plants inoculated with Rhizobium sp. NBRI330 had 60.6% higher plant dry weight, as compared with uninoculated plants. The individual stress survival limit of a rhizobial strain Rhizobium sp. NBRI330 isolated from alkaline soil in a medium containing 32% (wt/vol) salt was 8 h, and at 55 degrees C up to 3 h. The length of Rhizobium sp. NBRI330 in salt-stressed cells increased significantly to 3.04 microm from 1.75 microm of non-stressed control cells. On the contrary, the length of pH-stressed cells declined to 1.40 microm. Compared with non-stressed control rod-shaped cells, the shape of temperature-stressed cells changed to spherical, of 0.42 microm diameter. High temperature (45 degrees C) was tolerated efficiently by Rhizobium sp. NBRI330 in the presence of salt at pH 12, as compared with pH 7.
-
Sarter, N. B.; Woods, D. D.
1997-01-01
Research and operational experience have shown that one of the major problems with pilot-automation interaction is a lack of mode awareness (i.e., the current and future status and behavior of the automation). As a result, pilots sometimes experience so-called automation surprises when the automation takes an unexpected action or fails to behave as anticipated. A lack of mode awareness and automation surprises can he viewed as symptoms of a mismatch between human and machine properties and capabilities. Changes in automation design can therefore he expected to affect the likelihood and nature of problems encountered by pilots. Previous studies have focused exclusively on early generation "glass cockpit" aircraft that were designed based on a similar automation philosophy. To find out whether similar difficulties with maintaining mode awareness are encountered on more advanced aircraft, a corpus of automation surprises was gathered from pilots of the Airbus A-320, an aircraft characterized by high levels of autonomy, authority, and complexity. To understand the underlying reasons for reported breakdowns in human-automation coordination, we also asked pilots about their monitoring strategies and their experiences with and attitude toward the unique design of flight controls on this aircraft.
-
31 CFR 515.330 - Person within the United States.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Person within the United States. 515... Definitions § 515.330 Person within the United States. (a) The term person within the United States, includes: (1) Any person, wheresoever located, who is a resident of the United States; (2) Any person actually...
-
Interpretation and modeling of a subsurface injection test, 200 East Area, Hanford, Washington
International Nuclear Information System (INIS)
Smoot, J.L.; Lu, A.H.
1994-11-01
A tracer experiment was conducted in 1980 and 1981 in the unsaturated zone in the southeast portion of the Hanford 200 East Area near the Plutonium-Uranium Extraction (PUREX) facility. The field design consisted of a central injection well with 32 monitoring wells within an 8-m radius. Water containing radioactive and other tracers was injected weekly during the experiment. The unique features of the experiment were the documented control of the inputs, the experiment's three-dimensional nature, the in-situ measurement of radioactive tracers, and the use of multiple injections. The spacing of the test wells provided reasonable lag distribution for spatial correlation analysis. Preliminary analyses indicated spatial correlation on the order of 400 to 500 cm in the vertical direction. Previous researchers found that two-dimensional axisymmetric modeling of moisture content generally underpredicts lateral spreading and overpredicts vertical movement of the injected water. Incorporation of anisotropic hydraulic properties resulted in the best model predictions. Three-dimensional modeling incorporated the geologic heterogeneity of discontinuous layers and lenses of sediment apparent in the site geology. Model results were compared statistically with measured experimental data and indicate reasonably good agreement with vertical and lateral field moisture distributions
-
2012-03-30
... emergency evacuation, which could result in inadequate buoyancy to support the raft's passenger capacity... DEPARTMENT OF TRANSPORTATION Federal Aviation Administration 14 CFR Part 39 [Docket No. FAA-2011... approved under TSO TSO-C69b and installed on Model A330-200 and -300 series airplanes, Model A340-200 and...
-
Association of −330 interleukin-2 gene polymorphism with oral cancer
Directory of Open Access Journals (Sweden)
Prithvi Kumar Singh
2017-01-01
>Results: IL-2 (−330A>C gene polymorphism was significantly associated with oral cancer whereas it was neither associated with clinicopathological status nor with cancer pain. The AC heterozygous genotype was significantly associated with oral cancer patients as compared to controls [odds ratio (OR: 3.0; confidence interval (CI: 2.14-4.20; PC gene polymorphism was also associated with oral cancer in tobacco smokers and chewers. >Interpretation & conclusions: Our results showed that oral cancer patients had significantly higher frequency of AA genotype but significantly lower frequency of AC genotype and C allele compared to controls. The IL-2 AC genotype and C allele of IL-2 (−330A>C gene polymorphisms could be potential protective factors and might reduce the risk of oral cancer in Indian population.
-
A fully microscopic model of 200 MeV proton-{sup 12}C elastic and inelastic scattering
Energy Technology Data Exchange (ETDEWEB)
Karataglidis, S; Dortmans, P J; Amos, K; de Swiniarski, R
1996-03-01
An effective two nucleon (NN) interaction in the nuclear medium is defined from an accurate mapping of the NN g matrices obtained by solving the Brueckner-Bethe-Goldstone equations for infinite nuclear matter. That effective interaction is used in a fully microscopic calculation of the nonlocal effective proton-{sup 12}C interaction from which are obtained predictions of the differential cross section and analysing power for 200 MeV elastic scattering. The relative motion wave functions so found are used as the distorted waves in a distorted wave approximation (DWA) study of select inelastic scattering events. The effective NN interaction is used as the transition operator in those calculations. The relevant nuclear spectroscopy for the elastic and DWA (p, p`) calculations is found from a full (0 + 2) {Dirac_h}{omega} shell model evaluation of the positive parity states while a restricted (1 + 3){Dirac_h}{omega} has been used to give the negative parity states. Results are compared with those of the 0p-shell model of Cohen and Kurath or with those based upon axially symmetric, projected Hartree-Fock calculations. The diverse structure model wave functions are assessed by using them in calculations to compare with measured longitudinal, transverse electric and transverse magnetic form factors from electron scattering to many of the excited states of {sup 12}C. Using those models of the structure of {sup 12}C in the completely microscopic model of the elastic and inelastic scattering of 200 MeV protons, good fits have been found to the cross section and analysing power data. 50 refs., 3 tabs., 20 figs.
-
330 mJ single-frequency Ho:YLF slab amplifier
CSIR Research Space (South Africa)
Strauss, HJ
2013-04-01
Full Text Available We report on a double-pass Ho:YLF slab amplifier which delivered 350 ns long single-frequency pulses of up to 330 mJ at 2064 nm, with a maximum M(sup2) of 1.5 at 50 Hz. It was end pumped with a diode-pumped Tm:YLF slab laser and seeded with up to 50...
-
SU-E-T-470: Beam Performance of the Radiance 330 Proton Therapy System
International Nuclear Information System (INIS)
Nazaryan, H; Nazaryan, V; Wang, F; Flanz, J; Alexandrov, V
2014-01-01
Purpose: The ProTom Radiance 330 proton radiotherapy system is a fully functional, compact proton radiotherapy system that provides advanced proton delivery capabilities. It supports three-dimensional beam scanning with energy and intensity modulation. A series of measurements have been conducted to characterize the beam performance of the first installation of the system at the McLaren Proton Therapy Center in Flint, Michigan. These measurements were part of the technical commissioning of the system. Select measurements and results are presented. Methods: The Radiance 330 proton beam energy range is 70–250 MeV for treatment, and up to 330 MeV for proton tomography and radiography. Its 3-D scanning capability, together with a small beam emittance and momentum spread, provides a highly efficient beam delivery. During the technical commissioning, treatment plans were created to deliver uniform maps at various energies to perform Gamma Index analysis. EBT3 Gafchromic films were irradiated using the Planned irradiation maps. Bragg Peak chamber was used to test the dynamic range during a scan in one layer for high (250 MeV) and Low (70 MeV) energies. The maximum and minimum range, range adjustment and modulation, distal dose falloff (80%–20%), pencil beam spot size, spot placement accuracy were also measured. The accuracy testing included acquiring images, image registration, receiving correction vectors and applying the corrections to the robotic patient positioner. Results: Gamma Index analysis of the Treatment Planning System (TPS) data vs. Measured data showed more than 90% of points within (3%, 3mm) for the maps created by the TPS. At Isocenter Beam Size (One sigma) < 3mm at highest energy (250 MeV) in air. Beam delivery was within 0.6 mm of the intended target at the entrance and the exit of the beam, through the phantom. Conclusion: The Radiance 330 Beam Performance Measurements have confirmed that the system operates as designed with excellent clinical
-
SU-E-T-470: Beam Performance of the Radiance 330 Proton Therapy System
Energy Technology Data Exchange (ETDEWEB)
Nazaryan, H; Nazaryan, V; Wang, F [ProTom International, Inc., Flower Mound, TX (United States); Flanz, J [Massachusetts General Hospital, Boston, MA (United States); Alexandrov, V [ZAO ProTom, Protvino, Moscow region (Russian Federation)
2014-06-01
Purpose: The ProTom Radiance 330 proton radiotherapy system is a fully functional, compact proton radiotherapy system that provides advanced proton delivery capabilities. It supports three-dimensional beam scanning with energy and intensity modulation. A series of measurements have been conducted to characterize the beam performance of the first installation of the system at the McLaren Proton Therapy Center in Flint, Michigan. These measurements were part of the technical commissioning of the system. Select measurements and results are presented. Methods: The Radiance 330 proton beam energy range is 70–250 MeV for treatment, and up to 330 MeV for proton tomography and radiography. Its 3-D scanning capability, together with a small beam emittance and momentum spread, provides a highly efficient beam delivery. During the technical commissioning, treatment plans were created to deliver uniform maps at various energies to perform Gamma Index analysis. EBT3 Gafchromic films were irradiated using the Planned irradiation maps. Bragg Peak chamber was used to test the dynamic range during a scan in one layer for high (250 MeV) and Low (70 MeV) energies. The maximum and minimum range, range adjustment and modulation, distal dose falloff (80%–20%), pencil beam spot size, spot placement accuracy were also measured. The accuracy testing included acquiring images, image registration, receiving correction vectors and applying the corrections to the robotic patient positioner. Results: Gamma Index analysis of the Treatment Planning System (TPS) data vs. Measured data showed more than 90% of points within (3%, 3mm) for the maps created by the TPS. At Isocenter Beam Size (One sigma) < 3mm at highest energy (250 MeV) in air. Beam delivery was within 0.6 mm of the intended target at the entrance and the exit of the beam, through the phantom. Conclusion: The Radiance 330 Beam Performance Measurements have confirmed that the system operates as designed with excellent clinical
-
A forecast comparison of volatility models
DEFF Research Database (Denmark)
Hansen, Peter Reinhard; Lunde, Asger
2005-01-01
We compare 330 ARCH-type models in terms of their ability to describe the conditional variance. The models are compared out-of-sample using DM-$ exchange rate data and IBM return data, where the latter is based on a new data set of realized variance. We find no evidence that a GARCH(1,1) is outpe......We compare 330 ARCH-type models in terms of their ability to describe the conditional variance. The models are compared out-of-sample using DM-$ exchange rate data and IBM return data, where the latter is based on a new data set of realized variance. We find no evidence that a GARCH(1...... snooping (RC). Our empirical results show that the RC lacks power to an extent that makes it unable to distinguish "good" and "bad" models in our analysis....
-
Test Results of a 200 W Class Hall Thruster
Jacobson, David; Jankovsky, Robert S.
1999-01-01
The performance of a 200 W class Hall thruster was evaluated. Performance measurements were taken at power levels between 90 W and 250 W. At the nominal 200 W design point, the measured thrust was 11.3 mN. and the specific impulse was 1170 s excluding cathode flow in the calculation. A laboratory model 3 mm diameter hollow cathode was used for all testing. The engine was operated on laboratory power supplies in addition to a breadboard power processing unit fabricated from commercially available DC to DC converters.
-
International Nuclear Information System (INIS)
Javaux, Denis
2002-01-01
This paper describes a method for predicting the errors that may appear when human operators or users interact with systems behaving as finite state systems. The method is a generalization of a method used for predicting errors when interacting with autopilot modes on modern, highly computerized airliners [Proc 17th Digital Avionics Sys Conf (DASC) (1998); Proc 10th Int Symp Aviat Psychol (1999)]. A cognitive model based on spreading activation networks is used for predicting the user's model of the system and its impact on the production of errors. The model strongly posits the importance of implicit learning in user-system interaction and its possible detrimental influence on users' knowledge of the system. An experiment conducted with Airbus Industrie and a major European airline on pilots' knowledge of autopilot behavior on the A340-200/300 confirms the model predictions, and in particular the impact of the frequencies with which specific state transitions and contexts are experienced
-
SUPPLY CHAIN FEATURES OF THE AEROSPACE INDUSTRY PARTICULAR CASE AIRBUS AND BOEING
Directory of Open Access Journals (Sweden)
Daniela MOCENCO
2015-10-01
Full Text Available Aerospace sector is one of the most globalized industries in terms of market structure and production system. Through aircraft development programs aviation industry has introduced new solutions to develop its products. The role of the partners involved in the development programs for the new generation aircraft is becoming increasingly important. Supply chain management has become a key factor for major manufacturers in the industry. The new strategies introduced by the aircraft manufacturers have increased the complexity of the supply process, design and production from the aviation industry. This paper highlights a series of factors regarding the aircraft programs supply chain management. In the first part are described the problems encountered by the manufacturers and airlines during the development of the most recent aircraft launched A350XWB and B787 Dreamliner; the second part focuses on the organizational structure of the supply chain, suppliers role within supply chain and also there are described the effects of the new strategies adopted by Airbus and Boeing in the aircraft development; the last part focuses on the risks and challenges that aviation industry is facing.
-
2012-02-07
..., and the FAA must issue a finding of regulatory adequacy pursuant to Sec. 611 of Public Law 92-574, the ``Noise Control Act of 1972.'' The FAA issues special conditions, as defined in 14 CFR 11.19, in... novel or unusual design features: The Model LJ-200-1A10 airplane flight deck design incorporates a...
-
Эстонская фирма помогает Airbus / Райго Неудорф
Неудорф, Райго
2009-01-01
Info- ja automaatikasüsteemidega tegelev ettevõte IB Krates OÜ teeb koostööd Euroopa lennukitootjaga Airbus, luues lennukite juhtimissüsteemide uut tarkvara. Eestist osaleb koostööprojektis ka Tallinna Tehnikaülikool
-
21 CFR 172.330 - Calcium pantothenate, calcium chloride double salt.
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Calcium pantothenate, calcium chloride double salt... FOOD FOR HUMAN CONSUMPTION Special Dietary and Nutritional Additives § 172.330 Calcium pantothenate, calcium chloride double salt. The food additive calcium chloride double salt of calcium pantothenate may...
-
Waste site grouping for 200 Areas soil investigations
International Nuclear Information System (INIS)
1997-01-01
The purpose of this document is to identify logical waste site groups for characterization based on criteria established in the 200 Areas Soil Remediation Strategy (DOE-RL 1996a). Specific objectives of the document include the following: finalize waste site groups based on the approach and preliminary groupings identified in the 200 Areas Soil Remediation Strategy; prioritize the waste site groups based on criteria developed in the 200 Areas Soil Remediation Strategy; select representative site(s) that best represents typical and worse-case conditions for each waste group; develop conceptual models for each waste group. This document will serve as a technical baseline for implementing the 200 Areas Soil Remediation Strategy. The intent of the document is to provide a framework, based on waste site groups, for organizing soil characterization efforts in the 200 Areas and to present initial conceptual models
-
Nuclear models to 200 MeV for high-energy data evaluations. Vol.12
International Nuclear Information System (INIS)
Chadwick, M.; Reffo, G.; Dunford, C.L.; Oblozinsky, P.
1998-01-01
The work of the Nuclear Energy Agency's Subgroup 12 is described, which represents a collaborative effort to summarize the current status of nuclear reaction modelling codes and prioritize desired future model improvements. Nuclear reaction modelling codes that use appropriate physics in the energy region up to 200 MeV are the focus of this study, particularly those that have proved useful in nuclear data evaluation work. This study is relevant to developing needs in accelerator-driven technology programs, which require accurate nuclear data to high energies for enhanced radiation transport simulations to guide engineering design. (author)
-
Measurements on the SPS 200 MHz Travelling Wave Cavity towards an Impedance Model
Roggen, Toon; Caspers, Fritz; Vollinger, Christine; CERN. Geneva. ATS Department
2016-01-01
This note discusses the contribution of the SPS 200 MHz TWC (Travelling Wave Cavity) to the SPS longitudinal impedance model. The measurement method and setup is briefly explained and a comparison with simulations is discussed for both the fundamental pass band (FPB) as well as the Higher Order Modes (HOMs). In addition a number of improvements to the measurement setup are discussed.
-
330 kWe Packaged CHP System with Reduced Emissions
Energy Technology Data Exchange (ETDEWEB)
Plahn, Paul [Cummins Power Generation, Minneapolis, MN (United States); Keene, Kevin [Cummins Power Generation, Minneapolis, MN (United States); Pendray, John [Cummins Power Generation, Minneapolis, MN (United States)
2015-03-31
The objective of this project was to develop a flexible, 330 kWe packaged Combined Heat and Power (CHP) system that can be deployed to commercial and light industrial applications at a lower total cost of ownership than current CHP solutions. The project resulted in a CHP system that is easy to use and inexpensive to install, offering world class customer support, while providing a low-emissions, higher-efficiency internal combustion engine for a CHP system of this size.
-
Performance investigation of ground cooling for the airbus A380 in the United Arab Emirates
International Nuclear Information System (INIS)
Aranjo, Brendan Savio; Hughes, Ben Richard; Chaudry, Hassam Nasarullah
2012-01-01
A combination of the United Arab Emirates (UAE) climate and the increased size of the super jumbo, Airbus A380, have exceeded the working capacity for current ground cooling techniques. These are evident when the aircraft is being prepared for flight and when in the hanger under maintenance with internal cabin temperatures reported at above 30 °C. The existing system used, delivers air at 11.6 °C after which the cabin temperature is still at a high temperature of 31 °C and unable to cool down due to the temperature rises caused by climate conditions and heat dissipation from the electronics in the cabin. The CFD based temperature profile results highlighted that a decrease in inlet temperature to −18 °C at a constant pressure and mass flow rate is sufficient to provide efficient cooling to the cabin at 22 °C. Boundary conditions are determined to specify a new effective cooling system and resolve the ground cooling issue. - Highlights: ► Computational Fluid Dynamics (CFD) analysis was carried out on the aircraft cabin. ► Existing system delivers air at 11.6 °C. ► Cabin temperature is still at a high temperature of 31 °C. ► The inlet temperature of the air should be −18 °C using the existing system. ► Air is delivered at 6.5 kg/s, to cool the cabin to a comfortable temperature of 22 °C.
-
12 CFR 330.14 - Retirement and other employee benefit plan accounts.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Retirement and other employee benefit plan... STATEMENTS OF GENERAL POLICY DEPOSIT INSURANCE COVERAGE § 330.14 Retirement and other employee benefit plan accounts. (a) “Pass-through” insurance. Any deposits of an employee benefit plan in an insured depository...
-
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false What requirements must I pass down to persons at lower tiers with whom I intend to do business? 19.330 Section 19.330 Money and Finance...) Responsibilities of Participants Regarding Transactions Doing Business with Other Persons § 19.330 What...
-
20 CFR 669.330 - How are services delivered to the customer?
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false How are services delivered to the customer... Farmworker Jobs Program Customers and Available Program Services § 669.330 How are services delivered to the customer? To ensure that all services are focused on the customer's needs, services are provided through a...
-
2010-04-01
... 21 Food and Drugs 9 2010-04-01 2010-04-01 false What requirements must I pass down to persons at lower tiers with whom I intend to do business? 1404.330 Section 1404.330 Food and Drugs OFFICE OF... Participants Regarding Transactions Doing Business with Other Persons § 1404.330 What requirements must I pass...
-
Directory of Open Access Journals (Sweden)
Jiahui Liu
2017-12-01
Full Text Available This study was performed to determine whether EMAP II increases the permeability of the blood-tumor barrier (BTB by affecting the expression of miR-330-3p as well as its possible mechanisms. We determined the over-expression of miR-330-3p in glioma microvascular endothelial cells (GECs by Real-time PCR. Endothelial monocyte-activating polypeptide-II (EMAP-II significantly decreased the expression of miR-330-3p in GECs. Pre-miR-330-3p markedly decreased the permeability of BTB and increased the expression of tight junction (TJ related proteins ZO-1, occludin and claudin-5, however, anti-miR-330-3p had the opposite effects. Anti-miR-330-3p could enhance the effect of EMAP-II on increasing the permeability of BTB, however, pre-miR-330-3p partly reversed the effect of EMAP-II on that. Similarly, anti-miR-330-3p improved the effects of EMAP-II on increasing the expression levels of PKC-α and p-PKC-α in GECs and pre-miR-330-3p partly reversed the effects. MiR-330-3p could target bind to the 3′UTR of PKC-α. The results of in vivo experiments were similar to those of in vitro experiments. These suggested that EMAP-II could increase the permeability of BTB through inhibiting miR-330-3p which target negative regulation of PKC-α. Pre-miR-330-3p and PKC-α inhibitor decreased the BTB permeability and up-regulated the expression levels of ZO-1, occludin and claudin-5 while anti-miR-330-3p and PKC-α activator brought the reverse effects. Compared with EMAP-II, anti-miR-330-3p and PKC-α activator alone, the combination of the three combinations significantly increased the BTB permeability. EMAP-II combined with anti-miR-330-3p and PKCα activator could enhance the DOX’s effects on inhibiting the cell viabilities and increasing the apoptosis of U87 glioma cells. Our studies suggest that low-dose EMAP-II up-regulates the expression of PKC-α and increases the activity of PKC-α by inhibiting the expression of miR-330-3p, reduces the expression of ZO-1
-
Directory of Open Access Journals (Sweden)
Joanne L Attema
Full Text Available The miR-200b~200a~429 gene cluster is a key regulator of EMT and cancer metastasis, however the transcription-based mechanisms controlling its expression during this process are not well understood. We have analyzed the miR-200b~200a~429 locus for epigenetic modifications in breast epithelial and mesenchymal cell lines using chromatin immunoprecipitation assays and DNA methylation analysis. We discovered a novel enhancer located approximately 5.1kb upstream of the miR-200b~200a~429 transcriptional start site. This region was associated with the active enhancer chromatin signature comprising H3K4me1, H3K27ac, RNA polymerase II and CpG dinucleotide hypomethylation. Luciferase reporter assays revealed the upstream enhancer stimulated the transcription of the miR-200b~200a~429 minimal promoter region approximately 27-fold in breast epithelial cells. Furthermore, we found that a region of the enhancer was transcribed, producing a short, GC-rich, mainly nuclear, non-polyadenylated RNA transcript designated miR-200b eRNA. Over-expression of miR-200b eRNA had little effect on miR-200b~200a~429 promoter activity and its production did not correlate with miR-200b~200a~429 gene expression. While additional investigations of miR-200b eRNA function will be necessary, it is possible that miR-200b eRNA may be involved in the regulation of miR-200b~200a~429 gene expression and silencing. Taken together, these findings reveal the presence of a novel enhancer, which contributes to miR-200b~200a~429 transcriptional regulation in epithelial cells.
-
International Nuclear Information System (INIS)
Longacre, R.S.
2011-01-01
In this paper we compare two models with central Au-Au collisions at √(ovr s NN )=200 GeV. The first model is a minijet model which assumes that around ∼50 minijets are produced in back-to-back pairs and have an altered fragmentation functions. It is also assumed that the fragments are transparent and escape the collision zone and are detected. The second model is a glasma flux tube model which leads to flux tubes on the surface of a radial expanding fireball driven by interacting flux tubes near the center of the fireball through plasma instabilities. This internal fireball becomes an opaque hydro fluid which pushes the surface flux tubes outward. Around ∼12 surface flux tubes remain and fragment with ∼1/2 the produced particles escaping the collision zone and are detected. Both models can reproduce two particle angular correlations in the different p t1 p t2 bins. We also compare the two models for three additional effects: meson baryon ratios; the long range nearside correlation called the ridge; and the so-called mach cone effect when applied to three particle angular correlations.
-
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What requirements must I pass down to persons at lower tiers with whom I intend to do business? 105-68.330 Section 105-68.330... Business with Other Persons § 105-68.330 What requirements must I pass down to persons at lower tiers with...
-
21 CFR 330.3 - Imprinting of solid oral dosage form drug products.
2010-04-01
... 21 Food and Drugs 5 2010-04-01 2010-04-01 false Imprinting of solid oral dosage form drug products... AS SAFE AND EFFECTIVE AND NOT MISBRANDED General Provisions § 330.3 Imprinting of solid oral dosage form drug products. A requirement to imprint an identification code on solid oral dosage form drug...
-
International Nuclear Information System (INIS)
Gatuzz, E.; Mendoza, C.; García, J.; Lohfink, A.; Kallman, T. R.; Witthoeft, M.; Bautista, M. A.; Palmeri, P.; Quinet, P.
2013-01-01
We present detailed analyses of oxygen K absorption in the interstellar medium (ISM) using four high-resolution Chandra spectra toward the X-ray low-mass binary XTE J1817-330. The 11-25 Å broadband is described with a simple absorption model that takes into account the pile-up effect and results in an estimate of the hydrogen column density. The oxygen K-edge region (21-25 Å) is fitted with the physical warmabs model, which is based on a photoionization model grid generated with the XSTAR code with the most up-to-date atomic database. This approach allows a benchmark of the atomic data which involves wavelength shifts of both the K lines and photoionization cross sections in order to fit the observed spectra accurately. As a result we obtain a column density of N H = 1.38 ± 0.01 × 10 21 cm –2 ; an ionization parameter of log ξ = –2.70 ± 0.023; an oxygen abundance of A O = 0.689 +0.015 -0.010 ; and ionization fractions of O I/O = 0.911, O II/O = 0.077, and O III/O = 0.012 that are in good agreement with results from previous studies. Since the oxygen abundance in warmabs is given relative to the solar standard of Grevesse and Sauval, a rescaling with the revision by Asplund et al. yields A O =0.952 +0.020 -0.013 , a value close to solar that reinforces the new standard. We identify several atomic absorption lines—Kα, Kβ, and Kγ in O I and O II and Kα in O III, O VI, and O VII—the last two probably residing in the neighborhood of the source rather than in the ISM. This is the first firm detection of oxygen K resonances with principal quantum numbers n > 2 associated with ISM cold absorption.
-
Energy Technology Data Exchange (ETDEWEB)
A. T. Urbon
2003-07-01
This Closure Report (CR) documents the activities performed to close Corrective Action Unit (CAU) 330: Areas 6, 22, and 23 Tanks and Spill Sites, in accordance with the Federal Facility Agreement and Consent Order (FFACO of 1996), and the Nevada Division of Environmental Protection (NDEP)-approved Streamlined Approach for Environmental Restoration (SAFER) Plan for CAU 330: Areas 6, 22, and 23 Tanks and Spill Sites, Nevada Test Site (NTS), Nevada (U.S. Department of Energy, National Nuclear Security Administration Nevada Operation Office [NNSA/NV], 2001). CAU 330 consists of the following four Corrective Action Sites (CASs): 06-02-04, 22-99-06, 23-01-02, and 23-25-05 (Figure 1).
-
Directory of Open Access Journals (Sweden)
Guido Sebastiani
2017-12-01
Full Text Available Gestational diabetes mellitus (GDM is characterized by insulin resistance accompanied by low/absent beta-cell compensatory adaptation to the increased insulin demand. Although the molecular mechanisms and factors acting on beta-cell compensatory response during pregnancy have been partially elucidated and reported, those inducing an impaired beta-cell compensation and function, thus evolving in GDM, have yet to be fully addressed. MicroRNAs (miRNAs are a class of small endogenous non-coding RNAs, which negatively modulate gene expression through their sequence-specific binding to 3′UTR of mRNA target. They have been described as potent modulators of cell survival and proliferation and, furthermore, as orchestrating molecules of beta-cell compensatory response and function in diabetes. Moreover, it has been reported that miRNAs can be actively secreted by cells and found in many biological fluids (e.g., serum/plasma, thus representing both optimal candidate disease biomarkers and mediators of tissues crosstalk(s. Here, we analyzed the expression profiles of circulating miRNAs in plasma samples obtained from n = 21 GDM patients and from n = 10 non-diabetic control pregnant women (24–33 weeks of gestation using TaqMan array microfluidics cards followed by RT-real-time PCR single assay validation. The results highlighted the upregulation of miR-330-3p in plasma of GDM vs non-diabetics. Furthermore, the analysis of miR-330-3p expression levels revealed a bimodally distributed GDM patients group characterized by high or low circulating miR-330 expression and identified as GDM-miR-330high and GDM-miR-330low. Interestingly, GDM-miR-330high subgroup retained lower levels of insulinemia, inversely correlated to miR-330-3p expression levels, and a significant higher rate of primary cesarean sections. Finally, miR-330-3p target genes analysis revealed major modulators of beta-cell proliferation and of insulin secretion, such as the
-
12 CFR 550.330 - Are there investments in which I may not invest funds of a fiduciary account?
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Are there investments in which I may not invest... on Self Dealing § 550.330 Are there investments in which I may not invest funds of a fiduciary account? You may not invest funds of a fiduciary account for which you have investment discretion in the...
-
7 CFR 330.211 - Labeling of plant pests for movement under permits.
2010-01-01
... 7 Agriculture 5 2010-01-01 2010-01-01 false Labeling of plant pests for movement under permits... AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE FEDERAL PLANT PEST REGULATIONS; GENERAL; PLANT PESTS; SOIL, STONE, AND QUARRY PRODUCTS; GARBAGE Movement of Plant Pests § 330.211 Labeling of...
-
Bayesian model comparison for one-dimensional azimuthal correlations in 200GeV AuAu collisions
Directory of Open Access Journals (Sweden)
Eggers Hans C.
2016-01-01
Full Text Available In the context of data modeling and comparisons between different fit models, Bayesian analysis calls that model best which has the largest evidence, the prior-weighted integral over model parameters of the likelihood function. Evidence calculations automatically take into account both the usual chi-squared measure and an Occam factor which quantifies the price for adding extra parameters. Applying Bayesian analysis to projections onto azimuth of 2D angular correlations from 200 GeV AuAu collisions, we consider typical model choices including Fourier series and a Gaussian plus combinations of individual cosine components. We find that models including a Gaussian component are consistently preferred over pure Fourier-series parametrizations, sometimes strongly so. For 0–5% central collisions the Gaussian-plus-dipole model performs better than Fourier Series models or any other combination of Gaussian-plus-multipoles.
-
ISABELLE: a 200 + 200 GeV colliding beam facility
International Nuclear Information System (INIS)
Courant, E.D.
1977-01-01
Plans are under way for the construction of a pair of intersecting storage rings providing for colliding beams of protons of energy at least 200 GeV. The rings (circumference 2.62 km) will contain superconducting magnets constructed with braided Nb--Ti filamentary wire, with a peak field of 4.0 T corresponding to an energy of 200 GeV. A current of 10 A of protons will be injected at 29 GeV from the existing AGS accelerator at Brookhaven, using the energy stacking technique similar to that employed at the CERN ISR; subsequently the stored beam will be accelerated gradually in the storage rings. Six intersection areas will be provided for experiments. They are designed to provide flexibility in beam characteristics for different experiments. The maximum luminosity at full energy is expected to be 1.0 x 10 33 cm -2 s -1 , at 29 GeV it will be approximately 10 32 cm -2 s -1 . Recent work with prototype magnets indicates that fields of 5.0 T can be produced. This has led to an alternative design of somewhat larger rings (circumference 3.77 km) that should be capable of providing colliding beams at 400 + 400 GeV
-
Implications of pion interferometry for O+Au at 200 A GeV
Energy Technology Data Exchange (ETDEWEB)
Gyulassy, M.; Padula, S.S.
1989-01-19
Recent NA35 data on O+Au -> ..pi../sup -/..pi../sup -/+X at 200 A GeV are shown to be consistent with both a hadronic resonance gas model and a quark-gluon plasma model for this reaction. We show, in addition, that much higher statistics data will be required to differentiate between these models even with the outward and sideward transverse projected correlation functions.
-
Implications of pion interferometry for O+Au at 200 A GeV
International Nuclear Information System (INIS)
Gyulassy, M.; Padula, S.S.
1989-01-01
Recent NA35 data on O+Au → π - π - +X at 200 A GeV are shown to be consistent with both a hadronic resonance gas model and a quark-gluon plasma model for this reaction. We show, in addition, that much higher statistics data will be required to differentiate between these models even with the outward and sideward transverse projected correlation functions. (orig.)
-
2010-07-01
... ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR POLLUTION CONTROLS CONTROL OF EMISSIONS FROM RECREATIONAL ENGINES AND VEHICLES Testing Production-Line Vehicles and Engines § 1051.330 May I sell vehicles from an... 40 Protection of Environment 32 2010-07-01 2010-07-01 false May I sell vehicles from an engine...
-
2010-07-01
... 40 Protection of Environment 32 2010-07-01 2010-07-01 false May I sell engines from an engine... ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR POLLUTION CONTROLS CONTROL OF EMISSIONS FROM NEW, LARGE NONROAD SPARK-IGNITION ENGINES Testing Production-line Engines § 1048.330 May I sell engines from an engine...
-
2010-07-01
... 40 Protection of Environment 32 2010-07-01 2010-07-01 false May I sell engines from an engine... ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR POLLUTION CONTROLS CONTROL OF EMISSIONS FROM SPARK-IGNITION PROPULSION MARINE ENGINES AND VESSELS Testing Production-line Engines § 1045.330 May I sell engines from an...
-
2010-01-01
... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false What requirements must I pass down to persons at lower tiers with whom I intend to do business? 919.330 Section 919.330 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) GOVERNMENTWIDE DEBARMENT...
-
Gatuzz, E.; Garcia, J.; Menodza, C.; Kallman, T. R.; Witthoeft, M.; Lohfink, A.; Bautista, M. A.; Palmeri, P.; Quinet, P.
2013-01-01
We present detailed analyses of oxygen K absorption in the interstellar medium (ISM) using four high-resolution Chandra spectra towards the X-ray low-mass binary XTE J1817-330. The 11-25 A broadband is described with a simple absorption model that takes into account the pileup effect and results in an estimate of the hydrogen column density. The oxygen K-edge region (21-25 A) is fitted with the physical warmabs model, which is based on a photoionization model grid generated with the XSTAR code with the most up-to-date atomic database. This approach allows a benchmark of the atomic data which involves wavelength shifts of both the K lines and photoionization cross sections in order to fit the observed spectra accurately. As a result we obtain: a column density of N(sub H) = 1.38 +/- 0.01 x 10(exp 21) cm(exp -2); ionization parameter of log xi = .2.70 +/- 0.023; oxygen abundance of A(sub O) = 0.689(exp +0.015./-0.010); and ionization fractions of O I/O = 0.911, O II/O = 0.077, and O III/O = 0.012 that are in good agreement with previous studies. Since the oxygen abundance in warmabs is given relative to the solar standard of Grevesse and Sauval (1998), a rescaling with the revision by Asplund et al. (2009) yields A(sub O) = 0.952(exp +0.020/-0.013, a value close to solar that reinforces the new standard. We identify several atomic absorption lines.K-alpha , K-beta, and K-gamma in O I and O II; and K-alpha in O III, O VI, and O VII--last two probably residing in the neighborhood of the source rather than in the ISM. This is the first firm detection of oxygen K resonances with principal quantum numbers n greater than 2 associated to ISM cold absorption.
-
Gatuzz, E.; Garcia, J.; Mendoza, C.; Kallman, T. R.; Witthoeft, M.; Lohfink, A.; Bautista, M. A.; Palmeri, P.; Quinet, P.
2013-01-01
We present detailed analyses of oxygen K absorption in the interstellar medium (ISM) using four high-resolution Chandra spectra toward the X-ray low-mass binary XTE J1817-330. The 11-25 Angstrom broadband is described with a simple absorption model that takes into account the pile-up effect and results in an estimate of the hydrogen column density. The oxygen K-edge region (21-25 Angstroms) is fitted with the physical warmabs model, which is based on a photoionization model grid generated with the xstar code with the most up-to-date atomic database. This approach allows a benchmark of the atomic data which involves wavelength shifts of both the K lines and photoionization cross sections in order to fit the observed spectra accurately. As a result we obtain a column density of N(sub H) = 1.38 +/- 0.01 × 10(exp 21) cm(exp -2); an ionization parameter of log xi = -2.70 +/- 0.023; an oxygen abundance of A(sub O) = 0.689 (+0.015/-0.010); and ionization fractions of O(sub I)/O = 0.911, O(sub II)/O = 0.077, and O(sub III)/O = 0.012 that are in good agreement with results from previous studies. Since the oxygen abundance in warmabs is given relative to the solar standard of Grevesse & Sauval, a rescaling with the revision by Asplund et al. yields A(sub O) = 0.952(+0.020/-0.013), a value close to solar that reinforces the new standard.We identify several atomic absorption lines-K(alpha), K(beta), and K(gamma) in O(sub I) and O(sub II) and K(alpha) in O(sub III), O(sub VI), and O(sub VII)-the last two probably residing in the neighborhood of the source rather than in the ISM. This is the first firm detection of oxygen K resonances with principal quantum numbers n greater than 2 associated with ISM cold absorption.
-
Directory of Open Access Journals (Sweden)
Phillipe Nédélec
2015-06-01
Full Text Available This article presents the In-service Aircraft of a Global Observing System (IAGOS developed for operations on commercial long-range Airbus aircraft (A330/A340 for monitoring the atmospheric composition. IAGOS is the continuation of the former Measurement of OZone and water vapour on Airbus In-service airCraft (MOZAIC programme (1994–2014 with five aircraft operated by European airlines over 20 yr. MOZAIC has provided unique scientific database used worldwide by the scientific community. In continuation of MOZAIC, IAGOS aims to equip a fleet up to 20 aircraft around the world and for operations over decades. IAGOS started in July 2011 with the first instruments installed aboard a Lufthansa A340-300, and a total of six aircraft are already in operation. We present the technical aircraft system concept, with basic instruments for O3, CO, water vapour and clouds; and optional instruments for measuring either NOy, NOx, aerosols or CO2/CH4. In this article, we focus on the O3 and CO instrumentation while other measurements are or will be described in specific papers. O3 and CO are measured by optimised but well-known methods such as UV absorption and IR correlation, respectively. We describe the data processing/validation and the data quality control for O3 and CO. Using the first two overlapping years of MOZAIC/IAGOS, we conclude that IAGOS can be considered as the continuation of MOZAIC with the same data quality of O3 and CO measurements.
-
All-solid-state ultraviolet 330 nm laser from frequency-doubling of Nd:YLF red laser in CsB3O5
International Nuclear Information System (INIS)
Chen, Ming; Wang, Zhi-chao; Wang, Bao-shan; Yang, Feng; Zhang, Guo-chun; Zhang, Shen-jin; Zhang, Feng-feng; Zhang, Xiao-wen; Zong, Nan; Wang, Zhi-min; Bo, Yong; Peng, Qin-jun; Cui, Da-fu; Wu, Yi-cheng; Xu, Zu-yan
2016-01-01
We demonstrate an ultraviolet (UV) 330 nm laser from second-harmonic generation (SHG) of an all-solid-state Nd:YLF red laser in a CsB 3 O 5 (CBO) crystal for the first time, to our best knowledge. Under an input power of 4.8 W at 660 nm, a maximum average output power of 330 nm laser was obtained to be 1.28 W, corresponding to a frequency conversion efficiency of about 26.7%.
-
Zeng, Qiang; Chang, Hong
2016-10-01
To investigate the correlation of single nucleotide polymorphism (SNP) of Interleukin-2(IL-2)-330T/G with genetic susceptibility and the efficacy of immunosuppressive therapy in patients with aplastic anemia. The peripheral blood samples from 103 patients with aplastic anemia in our hospital were collected. Out of 103 patients 46 received immuosuppressive therapy and were observed for 4 months, and 100 healthy adults were selected as control. The electrophoresis and DNA sequence were performed. The polymerase chain reaction(PCR) was used to amplify the polymorphic gene segment of IL-2 -330T/G from 103 aplastic anemia patients and 100 healthy adults. The frequencis of IL-2-330 GG genotype and G allele were a little higher in patients with aplastic anemia than that in the healthy adults(12.6% vs 12.0%, P>0.05; 27.7% vs 33.5%, P>0.05), but not statistically significant(P>0.05); in the 103 patients with aplastic anemia, 46 received immunosuppressive therapy, whereas 29 patients showed response, no significant difference was found between the responders and non-responders in the IL-2-330 GG genotype and G allele (31.0% vs 48.3%, P>0.05; 64.8% vs 61.8%, P>0.05). IL-2 -330T/G gene polymorphism may not correlate with the susceptibility of aplastic anemia or the efficacy of immunosuppressive therapy.
-
Energy Technology Data Exchange (ETDEWEB)
Chung, B. D.; Lee, W. J.; Sim, S. K.; Song, J. H.; Kim, H. C.
1997-09-01
The work reported in this document identifies the thermal-hydraulic phenomena that are expected to occur during a number of key transients in a 330 MWt SMART integral reactor which is under development at KAERI. The result of this efforts is based on the current design concept of SMART integral reactor. Although the design is still evolving, the preliminary Phenomena Identification and Ranking Table (PIRT) has been developed based on the experts` knowledge and experience. The preliminary PIRT has been developed by the consensus of KAERI expert panelists and AHP (Analytical Hierarchy Process). Preliminary PIRT developed in this report is intended for use to identify and integrate development areas of further experimental tests needed and thermal-hydraulic models and correlations and code improvements for the safety analysis of the SMART integral reactor. (author). 7 refs., 21 tabs., 22 figs.
-
12 CFR 330.7 - Accounts held by an agent, nominee, guardian, custodian or conservator.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Accounts held by an agent, nominee, guardian..., nominee, guardian, custodian or conservator. (a) Agency or nominee accounts. Funds owned by a principal or... coverage shall be governed by the provisions of § 330.13. (b) Guardian, custodian or conservator accounts...
-
Directory of Open Access Journals (Sweden)
Arezou Sayad
2014-01-01
Full Text Available Multiple sclerosis (MS is a chronic neuroinflammatory demyelinating disease of the central nervous system. The cytokine genes are involved in autoimmune diseases such as MS. In this study, we report the influence of −330 interleukin-2 (IL2 gene polymorphism on its plasma levels in a group of Iranian MS patients. In this study 100 MS patients and 100 ethnically, age, and sex matched healthy controls were selected from Medical Genetics Department of Sarem Women Hospital. Blood samples of all individuals were collected in EDTA tubes. The restriction fragment length polymorphism PCR (RFLP method was applied to determine various alleles and genotypes in these individuals. Plasma concentration of IL2 was measured in all the samples using human IL2 kit. The frequency of −330 T/T IL2 genotype was higher in MS patients compared to normal individuals. Accordingly, the plasma levels of IL2 were significantly higher (P<0.0001 in patients when compared to the control group. In conclusion, in case of MS patients the −330 T/T IL2 genotype is associated with higher plasma levels of IL2.
-
Directory of Open Access Journals (Sweden)
Anna Curry
Full Text Available Cell-surface CD200 expression by mouse EMT6 breast tumor cells increased primary tumor growth and metastasis to the draining lymph nodes (DLN in normal (WT BALB/c female recipients, while lack of CD200R1 expression in a CD200R1-/- host negated this effect. Silencing CD200 expression in EMT6siCD200 tumor cells also reduced their ability to grow and metastasize in WT animals. The cellular mechanisms responsible for these effects have not been studied in detail. We report characterization of tumor infiltrating (TILs and draining lymph node (DLN cells in WT and CD200-/- BALB/c mice, receiving WT tumor cells, or EMT6 lacking CD200 expression (EMT6siCD200 cells. Our data show an important correlation with augmented CD8+ cytotoxic T cells and resistance to tumor growth in mice lacking exposure (on either host cells or tumor to the immunoregulatory molecule CD200. Confirmation of the importance of such CD8+ cells came from monitoring tumor growth and characterization of the TILs and DLN cells in WT mice challenged with EMT6 and EMT6siCD200 tumors and treated with CD8 and CD4 depleting antibodies. Finally, we have assessed the mechanisms(s whereby addition of metformin as an augmenting chemotherapeutic agent in CD200-/- animals given EMT6 tumors and treated with a previously established immunotherapy regime can increase host resistance. Our data support the hypothesis that increased autophagy in the presence of metformin increases CD8+ responses and tumor resistance, an effect attenuated by the autophagy inhibitor verteporfin.
-
Directory of Open Access Journals (Sweden)
Siddappa N Byrareddy
Full Text Available Lectin-like molecules and their receptors are cell surface molecules that have been shown to play a role in either facilitating infection or serving as transporters of HIV/SIV in vivo. The role of these lectin-like molecules in the pathogenesis of HIV/SIV infection continues to be defined. In efforts to gain further insight on the potential role of these lectin-like molecules, our laboratory generated monoclonal antibodies (mAb against the human analogs of rhesus macaque CD200, CD200R and Mincle, since the rhesus macaques are accepted as the most reliable animal model to study human HIV infection. The characterization of the cell lineages from the blood and various tissues of rhesus macaques that express these lectin-like molecules are described herein. Among the mononuclear cells, the cells of the myeloid lineage of rhesus macaques are the predominant cell lineages that express readily detectable levels of CD200, CD200R and Mincle that is similar to the expression of Siglec-1 and Siglec-3 reported by our laboratory earlier. Subset analysis revealed that a higher frequency of the CD14+/CD16- subset from normal rhesus macaques express CD200, CD200R and Mincle. Differences in the frequencies and density of expression of these molecules by the gated population of CD14+ cells from various tissues are noted with PBMC and bone marrow expressing the highest and the mononuclear cells isolated from the colon and ileum expressing the lowest levels. While a significant frequency of pDCs and mDCs express Siglec-1/Siglec-3, a much lower frequency expresses CD200, CD200R and Mincle in PBMCs from rhesus macaques. The mAb against CD200 and CD200R but not Mincle appear to inhibit the infection of macrophage tropic SIV/SHIV in vitro. We conclude that these mAbs may have potential to be used as adjunctive therapeutic agents to control/inhibit SIV/HIV infection.
-
Multi-physics fluid-structure interaction modelling software
CSIR Research Space (South Africa)
Malan, AG
2008-11-01
Full Text Available -structure interaction modelling software AG MALAN AND O OXTOBY CSIR Defence, Peace, Safety and Security, PO Box 395, Pretoria, 0001 Email: amalan@csir.co.za – www.csir.co.za Internationally leading aerospace company Airbus sponsored key components... of the development of the CSIR fl uid-structure interaction (FSI) software. Below are extracts from their evaluation of the devel- oped technology: “The fi eld of FSI covers a massive range of engineering problems, each with their own multi-parameter, individual...
-
17 CFR 200.26a - Office of Information Technology.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Office of Information Technology. 200.26a Section 200.26a Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... Organization § 200.26a Office of Information Technology. The Office of Information Technology is responsible...
-
21 CFR 1404.200 - What is a covered transaction?
2010-04-01
... 21 Food and Drugs 9 2010-04-01 2010-04-01 false What is a covered transaction? 1404.200 Section 1404.200 Food and Drugs OFFICE OF NATIONAL DRUG CONTROL POLICY GOVERNMENTWIDE DEBARMENT AND SUSPENSION (NONPROCUREMENT) Covered Transactions § 1404.200 What is a covered transaction? A covered transaction is a...
-
Väike maakool elab veel : J. V. Veski nimeline Maarja põhikool 330 / Sirje Tohver
Tohver, Sirje, 1948-
2010-01-01
Tänavu tähistatakse Maarjas kolme juubelit: 790 aastat rahva ristimisest, 630 aastat Maarja-Magdaleena kiriku ja 330 aastat kooli esmamainimisest. Kuulsaim õpilane on Eesti tänapäeva kirjakeele rajaja J. V. Veski
-
Directory of Open Access Journals (Sweden)
A. B. Bayramov
2015-01-01
Full Text Available Application of dynamic modeling method upon ECAST to assess reactions of aircraft of Airbus type to random atmospheric disturbances without the use of Monte-Carlo method is considered. Application of the method will determine the significance of aircraft reactions to these disturbances, which will help in predicting the flight safety level.
-
7 CFR 330.301 - Stone and quarry products from certain areas in Canada.
2010-01-01
... 7 Agriculture 5 2010-01-01 2010-01-01 false Stone and quarry products from certain areas in Canada... § 330.301 Stone and quarry products from certain areas in Canada. Stone and quarry products from areas in Canada infested with the gypsy moth may be moved from Canada into or through the United States...
-
7 CFR 330.206 - Permits for plant pest movement associated with National Defense projects.
2010-01-01
... 7 Agriculture 5 2010-01-01 2010-01-01 false Permits for plant pest movement associated with... (Continued) ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE FEDERAL PLANT PEST REGULATIONS; GENERAL; PLANT PESTS; SOIL, STONE, AND QUARRY PRODUCTS; GARBAGE Movement of Plant Pests § 330.206...
-
The VASIMR[registered trademark] VF-200-1 ISS Experiment as a Laboratory for Astrophysics
Glover Tim W.; Squire, Jared P.; Longmier, Benjamin; Cassady, Leonard; Ilin, Andrew; Carter, Mark; Olsen, Chris S.; McCaskill, Greg; Diaz, Franklin Chang; Girimaji, Sharath;
2010-01-01
The VASIMR[R] Flight Experiment (VF-200-1) will be tested in space aboard the International Space Station (ISS) in about four years. It will consist of two 100 kW parallel plasma engines with opposite magnetic dipoles, resulting in a near zero-torque magnetic system. Electrical energy will come from ISS at low power level, be stored in batteries and used to fire the engine at 200 kW. The VF-200-1 project will provide a unique opportunity on the ISS National Laboratory for astrophysicists and space physicists to study the dynamic evolution of an expanding and reconnecting plasma loop. Here, we review the status of the project and discuss our current plans for computational modeling and in situ observation of a dynamic plasma loop on an experimental platform in low-Earth orbit. The VF-200-1 project is still in the early stages of development and we welcome new collaborators.
-
A 200-year climate record in Central Europe: implications for agriculture
Czech Academy of Sciences Publication Activity Database
Trnka, M.; Brázdil, R.; Dubrovský, Martin; Semerádová, D.; Štěpánek, P.; Dobrovolný, P.; Možný, M.; Eitzinger, J.; Málek, J.; Formayer, H.; Balek, J.; Žalud, Z.
2011-01-01
Roč. 31, č. 4 (2011), s. 631-341 ISSN 1774-0746 R&D Projects: GA ČR GA521/08/1682; GA AV ČR IAA300420806 Grant - others:MŠMT(CZ) ME10128 Institutional research plan: CEZ:AV0Z30420517 Keywords : Agroclimatic zoning * Climate reconstruction * Climate variability * Drought stress * Growing season Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 3.330, year: 2011 http://www.springerlink.com/content/4084302776215386/
-
2013-08-22
... passengers. The Model 777-200, -300, and -300ER series airplanes have fly-by-wire controls, fully software... lead acid batteries and nickel cadmium batteries. These special conditions provide an equivalent level... characteristics that differ significantly from those of the nickel cadmium and lead acid rechargeable batteries...
-
Energy Technology Data Exchange (ETDEWEB)
Vogel, C.
1996-04-01
The present work deals with mechanical behaviour of zirconium alpha at 200 deg. C and crack initiation prediction methods, particularly when loading conditions lead to interaction of fatigue and creep phenomena. A classical approach used to study interaction between cyclic effects and constant loading effects does not give easy understanding of experimental results. Therefore, a new approach has been developed, which allow to determine a number of cycles for crack initiation for complex structures under large loading conditions. To study influence of fatigue and creep interaction on crack initiation, a model was chosen, using a scalar variable, giving representation of the material deterioration state. The model uses a non linear cumulating effect between the damage corresponding to cyclic loads and the damage correlated to time influence. The model belongs to uncoupled approaches between damage and behaviour, which is described here by a two inelastic deformations model. This mechanical behaviour model is chosen because it allows distinction between a plastic and a viscous part in inelastic flow. Cyclic damage is function of stress amplitude and mean stress. For the peculiar sensitivity of the material to creep, a special parameter bas been defined to be critical toward creep damage. It is the kinematic term associated to state variables describing this type of hardening in the viscous mechanism. (author).
-
Small passenger car transmission test-Chevrolet 200 transmission
Bujold, M. P.
1980-01-01
The small passenger car transmission was tested to supply electric vehicle manufacturers with technical information regarding the performance of commerically available transmissions which would enable them to design a more energy efficient vehicle. With this information the manufacturers could estimate vehicle driving range as well as speed and torque requirements for specific road load performance characteristics. A 1979 Chevrolet Model 200 automatic transmission was tested per a passenger car automatic transmission test code (SAE J651b) which required drive performance, coast performance, and no load test conditions. The transmission attained maximum efficiencies in the mid-eighty percent range for both drive performance tests and coast performance tests. Torque, speed and efficiency curves map the complete performance characteristics for Chevrolet Model 200 transmission.
-
Energy Technology Data Exchange (ETDEWEB)
Krivushkin, L.F.; Gorazeeva, T.F.
1978-08-01
Studies were made in order to project the operating levels in the Southern Integrated Power Grid to the year 2000. The short-circuit current levels and, the requirements which circuit breakers will have to meet are estimated. A gradual transition from 330 to 750 kV generation is foreseen, with 330 kV networks remaining only for a purely distribution service. The number of 330 kV line hookups and the number of circuit breakers at nodal points (stations and substations) will not change significantly, they will account for 40% of all circuit breakers installed in 25% of all nodal points. Short-circuit currents are expected to reach the 46 kA level in 750 kV networks and 63 kA (standing wave voltage 1.5 to 2.5 kV/microsecond) in 330 kV networks. These are the ratings of circuit breakers; of the 63 kA ones 150 will be needed by 1980--1990 and 400 by 1990--2000. It will also be eventually worthwhile to install circuit breakers with a 63 kA-750 kV rating.
-
Hanford 200 Areas Development Plan
Energy Technology Data Exchange (ETDEWEB)
Rinne, C.A.; Daly, K.S.
1993-08-01
The purpose of the Hanford 200 Areas Development Plan (Development Plan) is to guide the physical development of the 200 Areas (which refers to the 200 East Area, 200 West Area, and 200 Area Corridor, located between the 200 East and 200 West Areas) in accordance with US Department of Energy (DOE) Order 4320.lB (DOE 1991a) by performing the following: Establishing a land-use plan and setting land-use categories that meet the needs of existing and proposed activities. Coordinating existing, 5-year, and long-range development plans and guiding growth in accordance with those plans. Establishing development guidelines to encourage cost-effective development and minimize conflicts between adjacent activities. Identifying site development issues that need further analysis. Integrating program plans with development plans to ensure a logical progression of development. Coordinate DOE plans with other agencies [(i.e., Washington State Department of Ecology (Ecology) and US Environmental Protection Agency (EPA)]. Being a support document to the Hanford Site Development Plan (DOE-RL 1990a) (parent document) and providing technical site information relative to the 200 Areas.
-
Hanford 200 Areas Development Plan
International Nuclear Information System (INIS)
Rinne, C.A.; Daly, K.S.
1993-08-01
The purpose of the Hanford 200 Areas Development Plan (Development Plan) is to guide the physical development of the 200 Areas (which refers to the 200 East Area, 200 West Area, and 200 Area Corridor, located between the 200 East and 200 West Areas) in accordance with US Department of Energy (DOE) Order 4320.lB (DOE 1991a) by performing the following: Establishing a land-use plan and setting land-use categories that meet the needs of existing and proposed activities. Coordinating existing, 5-year, and long-range development plans and guiding growth in accordance with those plans. Establishing development guidelines to encourage cost-effective development and minimize conflicts between adjacent activities. Identifying site development issues that need further analysis. Integrating program plans with development plans to ensure a logical progression of development. Coordinate DOE plans with other agencies [(i.e., Washington State Department of Ecology (Ecology) and US Environmental Protection Agency (EPA)]. Being a support document to the Hanford Site Development Plan (DOE-RL 1990a) (parent document) and providing technical site information relative to the 200 Areas
-
17 CFR 200.21a - The Ethics Counsel.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false The Ethics Counsel. 200.21a...; CONDUCT AND ETHICS; AND INFORMATION AND REQUESTS Organization and Program Management General Organization § 200.21a The Ethics Counsel. (a) The Ethics Counsel within the Office of the General Counsel of the...
-
Bradshaw, James F.; Sandefur, Paul G., Jr.; Young, Clarence P., Jr.
1991-01-01
A comprehensive study of braze alloy selection process and strength characterization with application to wind tunnel models is presented. The applications for this study include the installation of stainless steel pressure tubing in model airfoil sections make of 18 Ni 200 grade maraging steel and the joining of wing structural components by brazing. Acceptable braze alloys for these applications are identified along with process, thermal braze cycle data, and thermal management procedures. Shear specimens are used to evaluate comparative shear strength properties for the various alloys at both room and cryogenic (-300 F) temperatures and include the effects of electroless nickel plating. Nickel plating was found to significantly enhance both the wetability and strength properties for the various braze alloys studied. The data are provided for use in selecting braze alloys for use with 18 Ni grade 200 steel in the design of wind tunnel models to be tested in an ambient or cryogenic environment.
-
21 CFR 522.1660a - Oxytetracycline solution, 200 milligrams/milliliter.
2010-04-01
... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Oxytetracycline solution, 200 milligrams... FORM NEW ANIMAL DRUGS § 522.1660a Oxytetracycline solution, 200 milligrams/milliliter. (a) Specifications. Each milliliter of sterile solution contains 200 milligrams of oxytetracycline base. (b) Sponsors...
-
Directory of Open Access Journals (Sweden)
Li Li
2008-10-01
Full Text Available Li Li1, XinYu Zhang1, ChunHong Yan1, QingXiang Liang21Biomedical Engineering Lab, Faculty of Information Engineering, ShenZhen University, ShenZhen, China; 2Bao An People’s Hospital, ShenZhen, ChinaObjective: Extensive marketing of devices for self-measurement of blood pressure has created a need for purchasers to be able to satisfy themselves that such devices have been evaluated according to agreed criteria. The Oregon Scientific BPU 330 blood pressure monitor is an electronic device for upper arm measurement. This study assessed the accuracy of the Oregon Scientific BPU 330 blood pressure monitor according to the International Protocol by the Working Group on Blood Pressure Monitoring of the European Society of Hypertension for validation of blood pressure measuring devices.Method: 52 participants over 30 years of age were studied in the validation. Nine blood pressure measurements were taken alternately with a mercury sphygmomanometer by two observers, and by the supervisor, using the BPU 330 device. A total of 33 participants were selected for the analysis. The validation was divided into two phases. Phase 1 included 15 participants. If the device passed phase 1, 18 more participants were included. The 99 pairs of measurements were compared according to the International Protocol. The device was given a pass/fail recommendation based on its accuracy compared with the mercury standard (within 5, 10, and 15 mmHg, as well as the number met in the ranges specified by the International Protocol.Results: The mean and standard deviation of the difference between the mean of the observers and the BPU 330 device were 1.7 ± 4.7 mmHg and 2.8 ± 3.9 mmHg for systolic blood pressure (SBP and diastolic blood pressure (DBP, respectively. In phase 1, the device passed with a total of 33, 43, and 44 SBP readings; 38, 44, and 45 DBP readings were within 5, 10, and 15 mmHg, respectively. In phase 2.1, 81, 95, and 96 for SBP, and 83, 95, and 98 for DBP
-
A predictive model for dimensional errors in fused deposition modeling
DEFF Research Database (Denmark)
Stolfi, A.
2015-01-01
This work concerns the effect of deposition angle (a) and layer thickness (L) on the dimensional performance of FDM parts using a predictive model based on the geometrical description of the FDM filament profile. An experimental validation over the whole a range from 0° to 177° at 3° steps and two...... values of L (0.254 mm, 0.330 mm) was produced by comparing predicted values with external face-to-face measurements. After removing outliers, the results show that the developed two-parameter model can serve as tool for modeling the FDM dimensional behavior in a wide range of deposition angles....
-
24 CFR 200.926a - Residential building code comparison items.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Residential building code comparison items. 200.926a Section 200.926a Housing and Urban Development Regulations Relating to Housing and... § 200.926a Residential building code comparison items. HUD will review each local and State code...
-
Ride-along data LOS 130, 170 & LO330 shots z3139, 3140 and 3141
Energy Technology Data Exchange (ETDEWEB)
Loisel, Guillaume Pascal [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)
2017-10-01
Each instrument records the x-ray emission from the Z-pinch dynamic hohlraum (ZPDH); LOS 130 TIXTLs instruments record the absorption of the pinch backlighter through an expanding NaF/Mg foil; LOS 170 MLM instruments record monochromatic images at 276 and 528 eV energies near and before ZPDH stagnation time; LOS 330 TREX 6A & B: recoded time resolved absorption spectra from a radiatively heated Ne gas.
-
International Nuclear Information System (INIS)
Sushch, Iurii
2012-01-01
Recently, imaging atmospheric Cherenkov telescopes (IACTs) have discovered numerous new sources representing various source classes in the very high energy (VHE; E>100 GeV) sky. This work presents studies of representatives of three types of Galactic VHE emitters: the Supernova remnants (SNRs) G1.9+0.3 and G330.2+1.0, the pulsar wind nebula (PWN) HESS J1303.631 and the binary system PSR B1259.63/LS 2883. The analysis of the H.E.S.S. data and the broadband emission modeling are presented. G1.9+0.3 and G330.2+1.0 are synchrotron-dominated SNRs whose non-thermal X-ray emission implies that intensive particle acceleration occurs at their shock fronts. This makes them promising candidates for the detection at VHEs. They were observed by the High Energy Stereoscopic System (H.E.S.S.) yielding no signs of significant VHE γ-ray emission from either SNR. The 99% confidence level upper limits on the TeV flux were determined. For an assumed spectral index of 2.5 the obtained upper limits are F G1.9 (>260 GeV) -13 cm -2 s -1 for G1.9+0.3 and F G330 (>380 GeV) -12 cm -2 s -1 for G330.2+1.0. Upper limits on the VHE emission provide constraints on the interior magnetic field in the context of a leptonic scenario and on the interstellar medium (ISM) density and cosmic-ray (CR) efficiency in a hadronic scenario. Lower limits on the interior magnetic fields were estimated at 15 μG for G1.9+0.3 and 14 μG for G330.2+1.0. In the case of the hadronic scenario, the H.E.S.S. upper limits are two orders of magnitude greater than the flux prediction. Obtained upper limits on the ISM densities are compatible with other estimates of the densities (from the thermal X-ray emission for G330.2+1.0 and from the expansion rate for G1.9+0.3). The CR efficiency cannot be constrained with the current H.E.S.S. upper limits. HESS J1303-631 is an initially unidentified H.E.S.S. source which was recently identified as a PWN associated with the pulsar PSR J1301-6305. The broadband emission of the source
-
Modeling of creep-fatigue interaction of zirconium α under cyclic loading at 200 C
International Nuclear Information System (INIS)
Vogel, C.
1996-04-01
The present work deals with mechanical behaviour of zirconium alpha at 200 deg. C and crack initiation prediction methods, particularly when loading conditions lead to interaction of fatigue and creep phenomena. A classical approach used to study interaction between cyclic effects and constant loading effects does not give easy understanding of experimental results. Therefore, a new approach has been developed, which allow to determine a number of cycles for crack initiation for complex structures under large loading conditions. To study influence of fatigue and creep interaction on crack initiation, a model was chosen, using a scalar variable, giving representation of the material deterioration state. The model uses a non linear cumulating effect between the damage corresponding to cyclic loads and the damage correlated to time influence. The model belongs to uncoupled approaches between damage and behaviour, which is described here by a two inelastic deformations model. This mechanical behaviour model is chosen because it allows distinction between a plastic and a viscous part in inelastic flow. Cyclic damage is function of stress amplitude and mean stress. For the peculiar sensitivity of the material to creep, a special parameter bas been defined to be critical toward creep damage. It is the kinematic term associated to state variables describing this type of hardening in the viscous mechanism. (author)
-
Conversion of the Iridoid Glucoside Antirrhinoside into 3-Azabicyclo[3.3.0]-octane Building Blocks
DEFF Research Database (Denmark)
Franzyk, Henrik; Frederiksen, Signe Maria; Jensen, Søren Rosendal
2000-01-01
The iridoid glucoside antirrhinoside (1) was transformed into polysubstituted 3-azabicyclo[3.3.0]octanes 3, 12 and 13 in 4-5 steps. Ozonolysis of the diacetonide of 1 and of its 7-deoxy-derivative 8 afforded cyclopentanoids 2 and 10, respectively. Conditions for the selective conversion of 2 and 10...
-
International Nuclear Information System (INIS)
Hong, Byung Sik
1999-01-01
The energy dependence of the thermodynamical parameters in nucleus-nucleus collisions are studied from 1A to 200A GeV in the framework of the statistical thermal model. The energy and entropy densities, as well as the pressure, of hot and dense hadronic matter are calculated by using the available input parameters of the model. No discontinuity or steep rise in the thermodynamical parameters has been found. The equation of state in terms of the speed of sound is investigated as a function of the energy density, and it increases monotonically up to 200A GeV. The estimated sonic velocities above 10A GeV are very close to that of an ideal ultrarelativistic hadron gas in the presence of resonances
-
2010-04-01
... furnish advisory services in connection with the financing or construction of a project and the related... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Definitions. 200.215 Section 200... Participation Review and Clearance Procedure § 200.215 Definitions. (a) Affiliate. Any person or business...
-
Hydrodynamical assessment of 200A GeV collisions
International Nuclear Information System (INIS)
Schnedermann, E.; Heinz, U.
1994-01-01
We are analyzing the hydrodynamics of 200A GeV S+S collisions using a new approach which tries to quantify the uncertainties arising from the specific implementation of the hydrodynamical model. Based on a previous phenomenological analysis we use the global hydrodynamics model to show that the amount of initial flow, or initial energy density, cannot be determined from the hadronic momentum spectra. We additionally find that almost always a sizable transverse flow develops, which causes the system to freeze out, thereby limiting the flow velocity in itself. This freeze-out dominance in turn makes a distinction between a plasma and a hadron resonance gas equation of state very difficult, whereas a pure pion gas can easily be ruled out from present data. To complete the picture we also analyze particle multiplicity data, which suggest that chemical equilibrium is not reached with respect to the strange particles. However, the overpopulation of pions seems to be at most moderate, with a pion chemical potential far away from the Bose divergence
-
24 CFR 200.929a - Fair Housing Accessibility Guidelines.
2010-04-01
... Guidelines. 200.929a Section 200.929a Housing and Urban Development Regulations Relating to Housing and Urban... Fair Housing Accessibility Guidelines. Builders and developers may use the Department's Fair Housing Accessibility Guideline when designing or constructing covered multifamily dwelling units in order to comply...
-
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Publication. 200.13 Section 200.13 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION INFORMAL RULES OF PRACTICE FOR PASSENGER SERVICE § 200.13 Publication. (a) General notice of any...
-
45 CFR 2555.200 - Application.
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Application. 2555.200 Section 2555.200 Public Welfare Regulations Relating to Public Welfare (Continued) CORPORATION FOR NATIONAL AND COMMUNITY SERVICE... Coverage § 2555.200 Application. Except as provided in §§ 2555.205 through 2555.235(a), these Title IX...
-
International Nuclear Information System (INIS)
Madland, D.
1997-01-01
Conclusions of the specialists meeting on the nucleon-nucleus optical model up to 200 MeV are drawn, from both the experimental and the theoretical point of view. Five general approaches to the medium-energy optical potential are discussed: Dirac and Schroedinger phenomenological potentials, dispersive potentials, semi-microscopic potentials, microscopic potentials and coupled-channel potentials. (K.A.)
-
International Nuclear Information System (INIS)
Yue Ning; Nath, Ravinder
2002-01-01
Since the publication of the AAPM Task Group 43 report in 1995, Model 200 103 Pd seed, which has been widely used in prostate seed implants and other brachytherapy procedures, has undergone some changes in its internal geometry resulting from the manufacturer's transition from lower specific activity reactor-produced 103 Pd ('heavy seeds') to higher specific activity accelerator-produced radioactive material ('light seeds'). Based on previously reported theoretical calculations and measurements, the dose rate constants and the radial dose functions of the two types of seeds are nearly the same and have already been reported. In this work, the anisotropy function of the 'light seed' was experimentally measured and an averaging method for the determination of the anisotropy constant from distance-dependent values of anisotropy factors is presented based upon the continuous low dose rate irradiation linear quadratic model for cell killing. The anisotropy function of Model 200 103 Pd 'light seeds' was measured in a Solid Water trade mark sign phantom using 1x1x1 mm micro LiF TLD chips at radial distances of 1, 2, 3, 4, 5, and 6 cm and at angles from 0 to 90 deg. with respect to the longitudinal axis of the seeds. At a radial distance of 1 cm, the measured anisotropy function of the 103 Pd 'light seed' is considerably lower than that of the 103 Pd 'heavy seed' reported in the TG 43 report. Our measured values at all radial distances are in excellent agreement with the results of a Monte Carlo simulation reported by Weaver, except for points along and near the seed longitudinal axis. The anisotropy constant of the 103 Pd 'light seed' was calculated using the linear quadratic biological model for cell killing in 30 clinical implants. For the model 200 ''light seed,'' it has a value of 0.865. However, our biological model calculations lead us to conclude that if the anisotropy factors of an interstitial brachytherapy seed vary significantly over radial distances anisotropy
-
A P + DEUTERON PROTON POLARIMETER AT 200 MEV.
Energy Technology Data Exchange (ETDEWEB)
HUANG,H.; ROSER,T.; ZELENSKI,A.; KURITA,K.; STEPHENSON,E.; TOOLE,R.
2002-06-02
There has been concern about the analyzing power of the p-Carbon polarimeter at the end of 200 MeV LINAC of BNL. A new polarimeter based on proton-deuteron scattering was installed and we have repeated the calibration of proton-Carbon scattering at 12 degrees and 200 MeV against proton-deuteron scattering. The result is consistent with the value of A=0.62 now used to measure the beam polarization at the end of the LINAC.
-
Blot, R.; Nedelec, P.; Petetin, H.; Thouret, V.; Cohen, Y.
2017-12-01
The In-Service Aircraft for a Global Observing System (IAGOS; http://www.iagos.org) is an European Research Infrastructure that provides cost-effective global atmospheric composition measurements at high resolution using commercial passenger aircraft. It is the continuation of the MOZAIC (1994-2014) and the CARIBIC (since 1997) programs that has provided a unique scientific database using 6 aircraft operated by European airlines over two decades. Thanks to growing interests of several international Airlines to contribute to the academic climate research, the IAGOS aircraft fleet (started in 2011), with the IAGOS-CORE basic instrumentation, has expanded to 9 Airbus A340/A330 aircraft up to now. Here, we present this IAGOS-CORE instrumentation that continuously sample carbon monoxide, ozone, water vapor and cloud droplets. We focus on carbon monoxide and ozone measurements which are performed by optimized, but well known, methods such as UV absorption and IR correlation. We describe the data processing/validation and the data quality control. With already more than 20 and 15 years of continuous ozone and carbon monoxide measurements, respectively, the IAGOS/MOZAIC data are particularly suitable for climatologies and trends. Also, since commercial aircraft are daily operated, the near-real time IAGOS-CORE data are also used to observe pollution plumes and to validate air-quality models as well as satellite products.
-
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Yogurt. 131.200 Section 131.200 Food and Drugs... CONSUMPTION MILK AND CREAM Requirements for Specific Standardized Milk and Cream § 131.200 Yogurt. (a) Description. Yogurt is the food produced by culturing one or more of the optional dairy ingredients specified...
-
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Application. 3.200 Section 3.200 Housing and Urban Development Office of the Secretary, Department of Housing and Urban Development... Coverage § 3.200 Application. Except as provided in §§ 3.205 through 3.235(a), these Title IX regulations...
-
Catch tanks inhibitor addition 200-East and 200-West Areas
International Nuclear Information System (INIS)
Palit, A.N.
1996-01-01
Reported is the study of 11 catch tanks in the 200-East Area and the 7 catch tanks in the 200-West Area listed as active. The location, capacity, material of construction, annual total accumulation, annual rain intrusion, waste transfer rate, and access for chemical injection in these tanks are documented. The present and future utilization and isolation plans for the catch tanks are established
-
Terceirização e resistência no Brasil: o Projeto de Lei n. 4.330/04 e a ação dos atores coletivos
Directory of Open Access Journals (Sweden)
Filipe Augusto Silveira de Souza
Full Text Available Resumo É notável a crescente flexibilização das relações de trabalho no cenário nacional, sobretudo a partir da década de 1990. Uma miríade de modalidades atípicas de contratação emergiu, sendo de especial relevância, para esse trabalho, a terceirização das atividades produtivas, anteriormente restrita a poucas hipóteses: a subempreitada e a contratação de serviços de vigilância e de mão de obra temporária - em bases muito mais limitadas do que as previstas atualmente. Foi apenas no início da década de 1990 que se instituiu, por intermédio do Enunciado n. 331 do Tribunal Superior do Trabalho (TST, a previsão de terceirização para as atividades-meio e, ato contínuo, em 1998 foi proposto o Projeto de Lei n. 4.302/98 (PL n. 4.302/98, cuja previsão da extensão da terceirização às atividades-fim foi incorporada, em 2004, ao Projeto de Lei n. 4.330/04 (PL n. 4.330/04. Tendo em vista essas mudanças em curso, o objetivo deste artigo é discutir, ainda que preliminarmente, o instituto da terceirização no cenário nacional, privilegiando sua dimensão histórica, em especial sua inserção no âmbito legal, com vistas a contextualizar o momento atual, no qual têm lugar debates acerca dos impactos do PL n. 4.330/04, destacadamente a partir de abril de 2015, quando o tema emergiu na mídia de massa. A revisão bibliográfica empreendida resultou na definição de um objetivo intermediário, que consistiu na identificação e análise crítica da participação de atores coletivos, a exemplo das entidades de classe representativas do patronato e dos trabalhadores, além de associações de profissionais do Direito, na discussão das implicações sociais e trabalhistas advindas da eventual aprovação do PL n. 4.330/04. As atuações desses diferentes atores foram assumidas como representativas das forças que expressam tendências e contratendências e, portanto, interesses divergentes em torno do tema da terceirização.
-
Energy Technology Data Exchange (ETDEWEB)
Sushch, Iurii
2012-10-19
Recently, imaging atmospheric Cherenkov telescopes (IACTs) have discovered numerous new sources representing various source classes in the very high energy (VHE; E>100 GeV) sky. This work presents studies of representatives of three types of Galactic VHE emitters: the Supernova remnants (SNRs) G1.9+0.3 and G330.2+1.0, the pulsar wind nebula (PWN) HESS J1303.631 and the binary system PSR B1259.63/LS 2883. The analysis of the H.E.S.S. data and the broadband emission modeling are presented. G1.9+0.3 and G330.2+1.0 are synchrotron-dominated SNRs whose non-thermal X-ray emission implies that intensive particle acceleration occurs at their shock fronts. This makes them promising candidates for the detection at VHEs. They were observed by the High Energy Stereoscopic System (H.E.S.S.) yielding no signs of significant VHE {gamma}-ray emission from either SNR. The 99% confidence level upper limits on the TeV flux were determined. For an assumed spectral index of 2.5 the obtained upper limits are F{sub G1.9}(>260 GeV)<4.6 x 10{sup -13} cm{sup -2}s{sup -1} for G1.9+0.3 and F{sub G330}(>380 GeV)<1.6 x 10{sup -12} cm{sup -2}s{sup -1} for G330.2+1.0. Upper limits on the VHE emission provide constraints on the interior magnetic field in the context of a leptonic scenario and on the interstellar medium (ISM) density and cosmic-ray (CR) efficiency in a hadronic scenario. Lower limits on the interior magnetic fields were estimated at 15 {mu}G for G1.9+0.3 and 14 {mu}G for G330.2+1.0. In the case of the hadronic scenario, the H.E.S.S. upper limits are two orders of magnitude greater than the flux prediction. Obtained upper limits on the ISM densities are compatible with other estimates of the densities (from the thermal X-ray emission for G330.2+1.0 and from the expansion rate for G1.9+0.3). The CR efficiency cannot be constrained with the current H.E.S.S. upper limits. HESS J1303-631 is an initially unidentified H.E.S.S. source which was recently identified as a PWN associated with
-
200 GW for Germany; 200 Gigawatt fuer Deutschland
Energy Technology Data Exchange (ETDEWEB)
Fuhs, Michael; Enkhardt, Sandra
2012-11-01
200 GW of solar power, i.e. seven times as much as today: Is that a realistic goal, or is it just propaganda for a lobby intending to make a good life for manufacturers and fitters? There is much to suggest that it may be a socially relevant goal.
-
Prospects for the Higgs boson in e+e- collisions at LEP 200
International Nuclear Information System (INIS)
Gross, E.; Lellouch, D.; Read, A.L.
1998-05-01
The authors evaluate the combined sensitivity of the four LEP collaborations to exclude or discover the Standard Model Higgs boson with the LEP collider at centre-of-mass energies of 189-200 GeV. It is argued that neighter Standard Model nor the Supersymmetric Higgs search benefits from an upgrade of LEP to its peak centre-of-mass energy (e.g. upgrade 198 GeV to 200 GeV) if this degrades the integrated luminosity by a factor of two or more. 7 refs., 11 figs
-
International Nuclear Information System (INIS)
Jiang, Z; Christenson, R
2011-01-01
Control devices can be used to dissipate the energy of a civil structure subjected to dynamic loading, such as earthquake, wave and wind excitation, thus reducing structural damage and preventing failure. The magneto-rheological (MR) fluid damper is a promising device for use in civil structures due to its mechanical simplicity, inherent stability, high dynamic range, large temperature operating range, robust performance, and low power requirements. The MR damper is intrinsically nonlinear and rate dependent. Thus a challenging aspect of applying this technology is the development of accurate models to describe the behavior of such dampers for control design and evaluation purposes. In particular, a new type of experimental testing called real-time hybrid simulation (RTHS) combines numerical simulation with laboratory testing of physical components. As with any laboratory testing, safety is of critical importance. For RTHS in particular the feedback and dynamic interaction of physical and numerical components can result in potentially unstable behavior. For safety purposes, it is desired to conduct pretest simulations where the physical specimen is replaced with an appropriate numerical model yet the numerical RTHS component is left unchanged. These pretest simulations require a MR damper model that can exhibit stability and convergence at larger fixed integration time steps, and provide computational efficiency, speed of calculation, and accuracy during pretest verification of the experimental setup. Several models for MR dampers have been proposed, including the hyperbolic tangent, Bouc–Wen, viscous plus Dahl and algebraic models. This paper examines the relative performance of four MR damper models of large-scale 200 kN MR dampers as needed for pretest simulations of RTHS. Experimental tests are conducted on two large-scale MR dampers located at two RTHS test facilities at the Smart Structures Technology Laboratory at the University of Illinois at Urbana
-
Superhigh-resolution 200ppi series TFT-LCDs; Chokoseisai 200ppi ekisho display series
Energy Technology Data Exchange (ETDEWEB)
Kawamata, K.; Hirai, H. [Toshiba Corp., Tokyo (Japan)
2000-02-01
We have developed a 202 pixels per inch (ppi) thin-film transistor liquid crystal display (TFT-LCD) using low-temperature polycrystalline silicon (LTPS) technology. The superhigh resolution of 202 ppi offers the same image quality as printed matter such as magazines. The 200 ppi series TFT-LCDs are expected to support further developments in such areas as electronic books (e-books) and personal digital-picture viewers. Our lineup of 200 ppi TFT-LCDs includes a 4-inch display with VGA resolution, which is suitable for palmtop-size applications, and a 6.3-inch display with XGA resolution, which is suitable for typical photograph or paperback book-size applications. Larger size LCDs with 200 ppi resolution will be developed. (author)
-
Preliminary Core Design Analysis of a 200MWth Pebble Bed-type VHTR
International Nuclear Information System (INIS)
Jo, Chang Keun; Noh, Jae Man
2007-01-01
This paper intends to suggest the preliminary core design analysis of a VHTR for a hydrogen production. The nuclear hydrogen system that utilizes the high temperature heat generated from the VHTR is a promising candidate for a cost effective, safe and clean supply of hydrogen in the age of hydrogen economy. Among two candidate VHTR cores, that is, a prismatic modular reactor (PMR) and a pebble bed-type reactor (PBR), we focus on the design of a 200MWth PBR (hereinafter PBR200) in this paper. Here, the 200MWth power is selected for a demonstration plant. The core configuration of the PBR200 is similar to the PBMR (Pebble Bed Modular Reactor, 400MWth) of South Africa, but the overall dimension of the reactor system is scaled-down. This paper is to suggest two candidate PBR200 cores. One is an annular core with an inner reflector (PBR200-CD1) which was presented at IWRES07, and the other is a cylindrical core without an inner reflector (PBR200-CD2)
-
2010-07-01
... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Application. 54.200 Section 54.200 Judicial Administration DEPARTMENT OF JUSTICE (CONTINUED) NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Coverage § 54.200 Application...
-
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Application. 200.602 Section 200.602 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION ORGANIZATION; CONDUCT... Programs or Activities Conducted by the Securities and Exchange Commission § 200.602 Application. This...
-
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Purpose. 200.550 Section 200.550 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION ORGANIZATION; CONDUCT AND ETHICS; AND INFORMATION AND REQUESTS Regulations Pertaining to the Protection of the Environment § 200...
-
miR-200–containing extracellular vesicles promote breast cancer cell metastasis
Le, Minh T.N.; Hamar, Peter; Guo, Changying; Basar, Emre; Perdigão-Henriques, Ricardo; Balaj, Leonora; Lieberman, Judy
2014-01-01
Metastasis is associated with poor prognosis in breast cancer patients. Not all cancer cells within a tumor are capable of metastasizing. The microRNA-200 (miR-200) family, which regulates the mesenchymal-to-epithelial transition, is enriched in the serum of patients with metastatic cancers. Ectopic expression of miR-200 can confer metastatic ability to poorly metastatic tumor cells in some settings. Here, we investigated whether metastatic capability could be transferred between metastatic and nonmetastatic cancer cells via extracellular vesicles. miR-200 was secreted in extracellular vesicles from metastatic murine and human breast cancer cell lines, and miR-200 levels were increased in sera of mice bearing metastatic tumors. In culture, murine and human metastatic breast cancer cell extracellular vesicles transferred miR-200 microRNAs to nonmetastatic cells, altering gene expression and promoting mesenchymal-to-epithelial transition. In murine cancer and human xenograft models, miR-200–expressing tumors and extracellular vesicles from these tumors promoted metastasis of otherwise weakly metastatic cells either nearby or at distant sites and conferred to these cells the ability to colonize distant tissues in a miR-200–dependent manner. Together, our results demonstrate that metastatic capability can be transferred by the uptake of extracellular vesicles. PMID:25401471
-
2010-04-01
... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Prescription drugs; reminder advertisements and reminder labeling to provide price information to consumers. 200.200 Section 200.200 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL GENERAL Prescription Drug Consumer Price Listing §...
-
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Application. 19.200 Section 19.200 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF... RECEIVING FEDERAL FINANCIAL ASSISTANCE Coverage § 19.200 Application. Except as provided in §§ 19.205...
-
14 CFR 1253.200 - Application.
2010-01-01
... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Application. 1253.200 Section 1253.200 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Coverage § 1253.200 Application...
-
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Authority. 200.50 Section 200.50 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION ORGANIZATION; CONDUCT AND ETHICS; AND INFORMATION AND REQUESTS Canons of Ethics § 200.50 Authority. The Canons of Ethics for...
-
TeV γ-ray observations of the young synchrotron-dominated SNRs G1.9+0.3 and G330.2+1.0 with H.E.S.S.
H.E.S.S. Collaboration; Abramowski, A.; Aharonian, F.; Benkhali, F. Ait; Akhperjanian, A. G.; Angüner, E.; Anton, G.; Balenderan, S.; Balzer, A.; Barnacka, A.; Becherini, Y.; Becker Tjus, J.; Bernlöhr, K.; Birsin, E.; Bissaldi, E.; Biteau, J.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bordas, P.; Brucker, J.; Brun, F.; Brun, P.; Bulik, T.; Carrigan, S.; Casanova, S.; Cerruti, M.; Chadwick, P. M.; Chalme-Calvet, R.; Chaves, R. C. G.; Cheesebrough, A.; Chrétien, M.; Colafrancesco, S.; Cologna, G.; Conrad, J.; Couturier, C.; Cui, Y.; Dalton, M.; Daniel, M. K.; Davids, I. D.; Degrange, B.; Deil, C.; deWilt, P.; Dickinson, H. J.; Djannati-Ataï, A.; Domainko, W.; O'C. Drury, L.; Dubus, G.; Dutson, K.; Dyks, J.; Dyrda, M.; Edwards, T.; Egberts, K.; Eger, P.; Espigat, P.; Farnier, C.; Fegan, S.; Feinstein, F.; Fernandes, M. V.; Fernandez, D.; Fiasson, A.; Fontaine, G.; Förster, A.; Füßling, M.; Gajdus, M.; Gallant, Y. A.; Garrigoux, T.; Giavitto, G.; Giebels, B.; Glicenstein, J. F.; Grondin, M.-H.; Grudzińska, M.; Häffner, S.; Hahn, J.; Harris, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hervet, O.; Hillert, A.; Hinton, J. A.; Hofmann, W.; Hofverberg, P.; Holler, M.; Horns, D.; Jacholkowska, A.; Jahn, C.; Jamrozy, M.; Janiak, M.; Jankowsky, F.; Jung, I.; Kastendieck, M. A.; Katarzyński, K.; Katz, U.; Kaufmann, S.; Khélifi, B.; Kieffer, M.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Kneiske, T.; Kolitzus, D.; Komin, Nu.; Kosack, K.; Krakau, S.; Krayzel, F.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lefaucheur, J.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Lennarz, D.; Lohse, T.; Lopatin, A.; Lu, C.-C.; Marandon, V.; Marcowith, A.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; McComb, T. J. L.; Méhault, J.; Meintjes, P. J.; Menzler, U.; Meyer, M.; Moderski, R.; Mohamed, M.; Moulin, E.; Murach, T.; Naumann, C. L.; de Naurois, M.; Niemiec, J.; Nolan, S. J.; Oakes, L.; Ohm, S.; Wilhelmi, E. de Oña; Opitz, B.; Ostrowski, M.; Oya, I.; Panter, M.; Parsons, R. D.; Arribas, M. Paz; Pekeur, N. W.; Pelletier, G.; Perez, J.; Petrucci, P.-O.; Peyaud, B.; Pita, S.; Poon, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Raue, M.; Reimer, A.; Reimer, O.; Renaud, M.; Reyes, R. de los; Rieger, F.; Rob, L.; Romoli, C.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Sanchez, D. A.; Santangelo, A.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwarzburg, S.; Schwemmer, S.; Sol, H.; Spengler, G.; Spies, F.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Stycz, K.; Sushch, I.; Szostek, A.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tluczykont, M.; Trichard, C.; Valerius, K.; van Eldik, C.; van Soelen, B.; Vasileiadis, G.; Venter, C.; Viana, A.; Vincent, P.; Völk, H. J.; Volpe, F.; Vorster, M.; Vuillaume, T.; Wagner, S. J.; Wagner, P.; Ward, M.; Weidinger, M.; Weitzel, Q.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Zabalza, V.; Zacharias, M.; Zajczyk, A.; Zdziarski, A. A.; Zech, A.; Zechlin, H.-S.
2014-06-01
The non-thermal nature of the X-ray emission from the shell-type supernova remnants (SNRs) G1.9+0.3 and G330.2+1.0 is an indication of intense particle acceleration in the shock fronts of both objects. This suggests that the SNRs are prime candidates for very-high-energy (VHE; E > 0.1 TeV) γ-ray observations. G1.9+0.3, recently established as the youngest known SNR in the Galaxy, also offers a unique opportunity to study the earliest stages of SNR evolution in the VHE domain. The purpose of this work is to probe the level of VHE γ-ray emission from both SNRs and use this to constrain their physical properties. Observations were conducted with the H.E.S.S. (High Energy Stereoscopic System) Cherenkov Telescope Array over a more than six-year period spanning 2004-2010. The obtained data have effective livetimes of 67 h for G1.9+0.3 and 16 h for G330.2+1.0. The data are analysed in the context of the multiwavelength observations currently available and in the framework of both leptonic and hadronic particle acceleration scenarios. No significant γ-ray signal from G1.9+0.3 or G330.2+1.0 was detected. Upper limits (99 per cent confidence level) to the TeV flux from G1.9+0.3 and G330.2+1.0 for the assumed spectral index Γ = 2.5 were set at 5.6 × 10-13 cm-2 s-1 above 0.26 TeV and 3.2 × 10-12 cm-2 s-1 above 0.38 TeV, respectively. In a one-zone leptonic scenario, these upper limits imply lower limits on the interior magnetic field to BG1.9 ≳ 12 μG for G1.9+0.3 and to BG330 ≳ 8 μG for G330.2+1.0. In a hadronic scenario, the low ambient densities and the large distances to the SNRs result in very low predicted fluxes, for which the H.E.S.S. upper limits are not constraining.
-
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Application. 41.200 Section 41.200 Public Lands: Interior Office of the Secretary of the Interior NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Coverage § 41.200 Application...
-
15 CFR 200.106 - Publications.
2010-01-01
... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Publications. 200.106 Section 200.106... FEES § 200.106 Publications. Publications provide the primary means of communicating the results of the... issues some fifteen categories of publications including three periodicals, ten non-periodicals series...
-
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Authority. 200.605 Section 200.605... GENERAL INTRODUCTION TO FHA PROGRAMS Affirmative Fair Housing Marketing Regulations § 200.605 Authority. The regulations in this subpart are issued pursuant to the authority to issue regulations granted to...
-
A Deep X-Ray View of the Synchrotron-dominated Supernova Remnant G330.2+1.0
Williams, Brian J.; Hewitt, John W.; Petre, Robert; Temim, Tea
2018-03-01
We present moderately deep (125 ks) XMM-Newton observations of supernova remnant G330.2+1.0. This remnant is one of only a few known that fall into the “synchrotron-dominated” category, with the emission almost entirely dominated by a nonthermal continuum. Previous X-ray observations could only characterize the spectra of a few regions. Here, we examine the spectra from 14 regions surrounding the entire rim, finding that the spectral properties of the nonthermal emission do not vary significantly in any systematic way from one part of the forward shock to another, unlike several other remnants of this class. We confirm earlier findings that the power-law index, Γ, ranges from about 2.1–2.5, while the absorbing column density is generally between (2.0–2.6) × 1022 cm‑2. Fits with the srcut model find values of the roll-off frequency in the range of 1017.1–1017.5 Hz, implying energies of accelerated electrons of ∼100 TeV. These values imply a high shock velocity of ∼4600 km s‑1, favoring a young age of the remnant. Diffuse emission from the interior is nonthermal in origin as well, and fits to these regions yield similar values to those along the rim, also implying a young age. Thermal emission is present in the east, and the spectrum is consistent with a ∼650 km s‑1 shock wave encountering interstellar or circumstellar material with a density of ∼1 cm‑3.
-
24 CFR 200.47 - Firm commitments.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Firm commitments. 200.47 Section 200.47 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued... Eligibility Requirements for Existing Projects Commitment Applications § 200.47 Firm commitments. A valid firm...
-
Directory of Open Access Journals (Sweden)
Varun Sheel
2016-05-01
Full Text Available This article is based on the study of the seasonal and interannual variability of carbon monoxide (CO and ozone (O3 at different altitudes of the troposphere over Hyderabad, India, during 2006–2010 using Measurement of OZone and water vapour by Airbus In-Service Aircraft (MOZAIC and observation from Tropospheric Emission Spectrometer (TES aboard NASA's Aura satellite. The MOZAIC observations show maximum seasonal variability in both CO and O3 during winter and pre-monsoon season, with CO in the range (100–200±13 ppbv and O3 in the range (50–70±9 ppbv. The time-series of MOZAIC data shows a significant increase of 4.2±1.3 % in the surface CO and 6.7±1.3 % in the surface O3 during 2006–2010 in Hyderabad. From MOZAIC observations, we identify CO and O3 profiles that are anomalous with respect to the monthly mean and compare those with Weather Research Forecast model coupled with Chemistry (WRF-Chem and Model for OZone and Related Tracers, version 4 profiles for the same day. The anomalous profiles of WRF-Chem are simulated using three convection schemes. The goodness of comparison depends on the convection scheme and the altitude region of the troposphere.
-
Dietary Plans for Carbohydrate Loading
1989-11-01
BOIL 0.75 CUP 142.5 GMS FRUIT COCKTAIL-CAN/JUICE 1.50 CUPS 372.0 GMS CIDER- FERMENTED 11.00 FL OZS 330.0 GMS DINNER BEEF-LEAN-SIMMER/ROAST 1.50 SLICES...RAW-SHRED 1.50 CUPS 135.0 GMS SAL DRESS-MAYO-LOW CAL 2.00 TBSPS 32.0 GMS VINEGAR -CIDER 2.00 TBSPS 30.0 GMS PEANUT BUTTER-CHUNK STYLE 2.00 TBSPS 32.3...CIDER- FERMENTED 11.00 FL OZS 3.30 Gm (1%) LETTUCE-ICEBERG-RAW-LEAVES 1.00 SERVING 2.82 Gm (0%) NUT-WALNUT-PERSIAN/ENGLISH 4.00 TSPS 1.83 Gm (0
-
DEFF Research Database (Denmark)
Gabe, Maria Buur Nordskov; Sparre-Ulrich, Alexander Hovard; Pedersen, Mie Fabricius
2018-01-01
using human125I-GIP(3-30)NH2. The selectivity of human GIP(3-30)NH2was examined by testing for agonistic and antagonistic properties on 62 human GPCRs. Human GIP(3-30)NH2inhibited GIP(1-42)-induced cAMP and β-arrestin 1 and 2 recruitment on the human GIPR and Schild plot analysis showed competitive...... in transfected cells as well as in human adipocytes....
-
46 CFR 117.200 - Survival craft-general.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Survival craft-general. 117.200 Section 117.200 Shipping... Number and Type of Survival Craft § 117.200 Survival craft—general. (a) Each survival craft required on a... craft they replace. (c) A summary of survival craft requirements is provided in Table 117.200(c). Table...
-
6 CFR 27.200 - Information regarding security risk for a chemical facility.
2010-01-01
... chemical facility. 27.200 Section 27.200 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY CHEMICAL FACILITY ANTI-TERRORISM STANDARDS Chemical Facility Security Program § 27.200 Information regarding security risk for a chemical facility. (a) Information to determine security risk. In order to...
-
Contacting graphene in a 200 mm wafer silicon technology environment
Lisker, Marco; Lukosius, Mindaugas; Kitzmann, Julia; Fraschke, Mirko; Wolansky, Dirk; Schulze, Sebastian; Lupina, Grzegorz; Mai, Andreas
2018-06-01
Two different approaches for contacting graphene in a 200 mm wafer silicon technology environment were tested. The key is the opportunity to create a thin SiN passivation layer on top of the graphene protecting it from the damage by plasma processes. The first approach uses pure Ni contacts with a thickness of 200 nm. For the second attempt, Ni is used as the contact metal which substitutes the Ti compared to a standard contact hole filling process. Accordingly, the contact hole filling of this "stacked via" approach is Ni/TiN/W. We demonstrate that the second "stacked Via" is beneficial and shows contact resistances of a wafer scale process with values below 200 Ohm μm.
-
24 CFR 200.83 - Interest rate.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Interest rate. 200.83 Section 200... Eligibility Requirements for Existing Projects Mortgage Provisions § 200.83 Interest rate. (a) The mortgage shall bear interest at the rate agreed upon by the mortgagee and the mortgagor. (b) Interest shall be...
-
Energy Technology Data Exchange (ETDEWEB)
Jincai, Li; Zuying, Gao; Baocheng, Xu; Junxiao, He [Institute of Nuclear Energy and Technology, Tsingua Univ., Beijing (China)
1997-09-01
The NHR-200 is a commercial 200-MW District Heating Reactor developed in China. It is designed on the basis of design, construction and four-year operating experience of the 5MW Experimental Heating Reactor (NHR-5). It has special safety features which are briefly described in this paper. Accident classification and safety criteria are also explained. Some typical and serious accidents are studied theoretically, and their results are detailed in this paper. They demonstrate the excellent safety characteristics of HR-200. (author). 4 refs, 9 figs, 1 tab.
-
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Welding. 179.200-10 Section 179.200-10... Specifications for Non-Pressure Tank Car Tanks (Classes DOT-111AW and 115AW) § 179.200-10 Welding. (a) All joints... W (IBR, see § 171.7 of this subchapter). Welding procedures, welders and fabricators shall be...
-
10 CFR 1021.200 - DOE planning.
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false DOE planning. 1021.200 Section 1021.200 Energy DEPARTMENT... Decisionmaking § 1021.200 DOE planning. (a) DOE shall provide for adequate and timely NEPA review of DOE... accordance with 40 CFR 1501.2 and this section. In its planning for each proposal, DOE shall include adequate...
-
Strangeness production in p+Pb reactions at 200 GeV/c
International Nuclear Information System (INIS)
Greiner, D.E.; Andersen, E.; Blaes, R.; Cherney, M.; Cruz, B. de la; Fernandez, C.; Garabatos, C.; Garzon, J.A.; Geist, W.M.; Gruhn, C.R.; Hafidouni, M.; Hrubec, J.; Jones, P.G.; Judd, E.G.; Kuipers, J.P.M.; Ladrem, M.; Ladron de Guevara, P.; Loevhoeiden, G.; MacNaughton, J.; Mosquera, J.; Natkaniec, Z.; Nelson, J.M.; Neuhofer, G.; Perez de los Heros, C.; Plo, M.; Porth, P.; Powell, B.; Ramil, A.; Rohringer, H.; Sakrejda, I.; Thorsteinsen, T.F.; Traxler, J.; Voltolini, C.; Wozniak, K.; Yanez, A.; Zybert, R.
1994-01-01
The production of the strange particles Λ, anti Λ and K S 0 in p+Pb collisions at 200 GeV/c has been measured using the NA36 TPC. Rapidity distributions and multiplicity dependences are presented and compared to model calculations. Reinteractions in the target are important to describe the observed spectra. Inverse slopes T∼200 MeV are extracted from the transverse mass distributions. (orig.)
-
Gravity-Driven Deposits in an Active Margin (Ionian Sea) Over the Last 330,000 Years
Köng, Eléonore; Zaragosi, Sébastien; Schneider, Jean-Luc; Garlan, Thierry; Bachèlery, Patrick; Sabine, Marjolaine; San Pedro, Laurine
2017-11-01
In the Ionian Sea, the subduction of the Nubia plate underneath the Eurasia plate leads to an important sediment remobilization on the Calabrian Arc and the Mediterranean Ridge. These events are often associated with earthquakes and tsunamis. In this study, we analyze gravity-driven deposits in order to establish their recurrence time on the Calabrian Arc and the western Mediterranean Ridge. Four gravity cores collected on ridges and slope basins of accretionary prisms record turbidites, megaturbidites, slumping and micro-faults over the last 330,000 years. These turbidites were dated by correlation with a hemipelagic core with a multi-proxy approach: radiometric dating, δ18O, b* colour curve, sapropels and tephrochronology. The origin of the gravity-driven deposits was studied with a sedimentary approach: grain-size, lithology, thin section, geochemistry of volcanic glass. The results suggest three periods of presence/absence of gravity-driven deposits: a first on the western lobe of the Calabrian Arc between 330,000 and 250,000 years, a second between 120,000 years and present day on the eastern lobe of the Calabrian Arc and over the last 60,000 years on the western lobe, and a third on the Mediterranean Ridge over the last 37,000 years. Return times for gravity-driven deposits are around 1,000 years during the most important record periods. The turbidite activity also highlights the presence of volcaniclastic turbidites that seems to be link to the Etna changing morphology over the last 320,000 years.
-
International Nuclear Information System (INIS)
Gotoh, Y.; Yamaki, T.; Tokiguchi, K.
1992-01-01
Thermal desorption spectroscopy (TDS) measurements were made on D 2 and CD 4 from surface layers of pyrolytic graphite cleavage faces after 3 keV D + 3 irradiation to 1.5 x 10 18 D/cm 2 at irradiation temperatures from 330 to 1000 K. Thermal desorption of both D 2 and CD 4 was observed to rise simultaneously at around 700 K. The D 2 peak was found at T m = 900-1000 K, while the CD 4 peak appeared at a lower temperature, 800-840 K. The T m for the D 2 TDS increased, while that for the CD 4 decreased with increasing irradiation temperature. These results obviously indicate that the D 2 desorption is detrapping/recombination limited, while the CD 4 desorption is most likely to be diffusion limited. The amount of thermally desorbed D 2 after the D + irradiation was observed to monotonously decrease as the irradiation temperature was increased from 330 to 1000 K. These tendencies agreed with previous results for the irradiation temperature dependencies of both C1s chemical shift (XPS) and the interlayer spacing, d 002 (HRTEM), on the graphite basal face. (orig.)
-
Design and initial characterization of the SC-200 proteomics standard mixture.
Bauman, Andrew; Higdon, Roger; Rapson, Sean; Loiue, Brenton; Hogan, Jason; Stacy, Robin; Napuli, Alberto; Guo, Wenjin; van Voorhis, Wesley; Roach, Jared; Lu, Vincent; Landorf, Elizabeth; Stewart, Elizabeth; Kolker, Natali; Collart, Frank; Myler, Peter; van Belle, Gerald; Kolker, Eugene
2011-01-01
High-throughput (HTP) proteomics studies generate large amounts of data. Interpretation of these data requires effective approaches to distinguish noise from biological signal, particularly as instrument and computational capacity increase and studies become more complex. Resolving this issue requires validated and reproducible methods and models, which in turn requires complex experimental and computational standards. The absence of appropriate standards and data sets for validating experimental and computational workflows hinders the development of HTP proteomics methods. Most protein standards are simple mixtures of proteins or peptides, or undercharacterized reference standards in which the identity and concentration of the constituent proteins is unknown. The Seattle Children's 200 (SC-200) proposed proteomics standard mixture is the next step toward developing realistic, fully characterized HTP proteomics standards. The SC-200 exhibits a unique modular design to extend its functionality, and consists of 200 proteins of known identities and molar concentrations from 6 microbial genomes, distributed into 10 molar concentration tiers spanning a 1,000-fold range. We describe the SC-200's design, potential uses, and initial characterization. We identified 84% of SC-200 proteins with an LTQ-Orbitrap and 65% with an LTQ-Velos (false discovery rate = 1% for both). There were obvious trends in success rate, sequence coverage, and spectral counts with protein concentration; however, protein identification, sequence coverage, and spectral counts vary greatly within concentration levels.
-
Requests for Help in a Multilingual Professional Environment Testimonies and Actantial Models
Directory of Open Access Journals (Sweden)
Lejot Eve
2017-12-01
Full Text Available Professional multilingual environments using English as a lingua franca are prone to imbalances in communication, linguistic insecurity and rising tension. Non-native English speakers develop avoidance strategies in order to lessen their apprehension. To overcome these imbalances, this research aims to understand the relationships formed around languages focusing on the dynamics of integration and the requests for help. Guided by the actantial models of Greimas (1966, this qualitative study employs semiolinguistics and discourse analysis, including 19 narrative interviews with employees of Airbus and UNESCO in Hamburg, Germany in 2013. This methodology draws on actors connected through relationships of power and/or collaboration. The actantial models applied seek linguistic input through designational paradigms, shifters and modal occurrences. The actantial models illustrate how a good language competence provides a better understanding of one’s direct as well as passive environment. The learning process is shown to be a conduit to integration. The actantial model and discourse analysis shed light on the complex situation of multilingual communication settings by highlighting the influence of individuals’ linguistic skills. As a matter of fact, depending on the role of each individual in a given situation, lending a helping hand sometimes equates to upsetting the balance.
-
The importance of international cooperation
CSIR Research Space (South Africa)
NASR, Jean-Marc
2017-01-01
Full Text Available Limited R&D budgets Marginal growth Increased R&T with international institutes & academia Intra-African market Center of gravity has changed Global supply sourcing Local Servicing of products Airbus Global Footprint May 2017 Airbus... 31% Europe 69% Non-Europe Other countries 11,575 (9%) Non-European Workforce 20% (in 2020) PHILOSOPHY OF INTERNATIONALIZATION Airbus Footprint in Africa May 2017 Airbus Corporate Presentation 4 Addis Ababa Nairobi Abuja Algiers Cairo...
-
Acquisition and use of Orlando, Florida and Continental Airbus radar flight test data
Eide, Michael C.; Mathews, Bruce
1992-01-01
Westinghouse is developing a lookdown pulse Doppler radar for production as the sensor and processor of a forward looking hazardous windshear detection and avoidance system. A data collection prototype of that product was ready for flight testing in Orlando to encounter low level windshear in corroboration with the FAA-Terminal Doppler Weather Radar (TDWR). Airborne real-time processing and display of the hazard factor were demonstrated with TDWR facilitated intercepts and penetrations of over 80 microbursts in a three day period, including microbursts with hazard factors in excess of .16 (with 500 ft. PIREP altitude loss) and the hazard factor display at 6 n.mi. of a visually transparent ('dry') microburst with TDWR corroborated outflow reflectivities of +5 dBz. Range gated Doppler spectrum data was recorded for subsequent development and refinement of hazard factor detection and urban clutter rejection algorithms. Following Orlando, the data collection radar was supplemental type certified for in revenue service on a Continental Airlines Airbus in an automatic and non-interferring basis with its ARINC 708 radar to allow Westinghouse to confirm its understanding of commercial aircraft installation, interface realities, and urban airport clutter. A number of software upgrades, all of which were verified at the Receiver-Transmitter-Processor (RTP) hardware bench with Orlando microburst data to produce desired advanced warning hazard factor detection, included some preliminary loads with automatic (sliding window average hazard factor) detection and annunciation recording. The current (14-APR-92) configured software is free from false and/or nuisance alerts (CAUTIONS, WARNINGS, etc.) for all take-off and landing approaches, under 2500 ft. altitude to weight-on-wheels, into all encountered airports, including Newark (NJ), LAX, Denver, Houston, Cleveland, etc. Using the Orlando data collected on hazardous microbursts, Westinghouse has developed a lookdown pulse Doppler
-
2010-07-01
...) Children means— (1) Persons up through age 21 who are entitled to a free public education through grade 12... 34 Education 1 2010-07-01 2010-07-01 false Definitions. 200.103 Section 200.103 Education Regulations of the Offices of the Department of Education OFFICE OF ELEMENTARY AND SECONDARY EDUCATION...
-
Ferri, Antonio; Nucci, Louis M
1954-01-01
Contains theoretical and experimental analysis of circular inlets having a central body at Mach numbers of 3.30, 2.75, and 2.45. The inlets have been designed in order to have low drag and high pressure recovery. The pressure recoveries obtained are of the same order of magnitude as those previously obtained by inlets having very large external drag.
-
1982-09-30
catalyst for the work of this department is the Economics and Finance Council and its eight committees -- Corporate Accounting, Revenue Accounting...Fokker BV Dr. Jaap Kamp, General Manager, International Corporate Finance , Algemene Bank Nederland NV, Amsterdam, Netherlands 2:55 PM Questions 3:15...Hawkins, Vice President Finance & Taxation AIR SALE: Maidenhead, Berks William R. Pascall, Managing Director AIRBUS INDUSTRIE: New York, New York
-
RAM R-200 - A Portable Ruggedized Radiation Monitoring System
International Nuclear Information System (INIS)
Wengrowicz, U.; Mazor, T.; Assido, H.; Kadmon, Y.; Tirosh, D.; Shani, G.
1999-01-01
RAM R-200, a new generation of ruggedized portable radiation-monitoring systems, is presented. The system which is a result of interdisciplinary research, was developed at the NRCN in collaboration with Ben-Gurion University. It consists of RAM R-200 - a portable radiation meter, and a variety of external probes for wide range gamma radiation fields and beta-gamma contamination detection and measurement. The meter or each one of the external probes can be used as a portable system or a stand-alone radiation measurement station. All the system's components were specially designed to meet severe environmental conditions
-
2010-07-01
... MANAGEMENT REGULATION PERSONAL PROPERTY 38-SALE OF PERSONAL PROPERTY Reporting Requirements § 102-38.330 Are... reports you must submit to the General Services Administration (GSA), Personal Property Management Policy... negotiated sales with an estimated fair market value in excess of $5,000 (see § 102-38.115). For each...
-
19 CFR 200.735-103 - Counseling service.
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Counseling service. 200.735-103 Section 200.735-103 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION EMPLOYEE RESPONSIBILITIES AND CONDUCT General Provisions § 200.735-103 Counseling service. (a) The Chairman shall appoint a Designated Agency...
-
Spaulding, A. P., Jr.
1979-01-01
The preliminary design criteria of the MP1-200 wind turbine are given along with a brief description of the wind turbine generator. Performance and operational experience and cost factors are included. Recommendations for additional research are listed.
-
2014-12-01
Local Economic Impact of UH-72A Manufacture ................42 viii e. EADS’ (Now Airbus Group’s) Suppliers and Subcontractors...Headquarters, Department of the Army IFR instrument flight rules IOTE initial operational test and evaluation IR infrared KO contracting officer kt...instrument flight rules ( IFR ) and visual flight rules (VFR) capabilities, thereby allowing flight at night and under low visibility weather
-
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Application. 28.200 Section 28.200 Money and Finance: Treasury Office of the Secretary of the Treasury NONDISCRIMINATION ON THE BASIS OF... Application. Except as provided in §§ 28.205 through 28.235(a), these Title IX regulations apply to every...
-
24 CFR 200.73 - Property development.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Property development. 200.73 Section 200.73 Housing and Urban Development Regulations Relating to Housing and Urban Development... Continuing Eligibility Requirements for Existing Projects Property Requirements § 200.73 Property development...
-
A Review of Subsurface Behavior of Plutonium and Americium at the 200-PW-1/3/6 Operable Units
Energy Technology Data Exchange (ETDEWEB)
Cantrell, Kirk J.; Riley, Robert G.
2008-01-31
This report begins with a brief summary of the history and current status of 200-PW-1/3/6 OUs in section 2.0. This is followed by a description of our concentual model of Pu/Am migration at the 200-PW-1/3/6 OUs, during both past artificial recharge conditions and current natural recharge condictions (section 3.0). Section 4.0 discusses data gaps and information needs. The final section (section 5.0) provides recommendations for futher work to address the data gaps and information needs identified in section 4.0.
-
A Review of Subsurface Behavior of Plutonium and Americium at the 200-PW-1/3/6 Operable Units
International Nuclear Information System (INIS)
Cantrell, Kirk J.; Riley, Robert G.
2008-01-01
This report begins with a brief summary of the history and current status of 200-PW-1/3/6 OUs in section 2.0. This is followed by a description of our conceptual model of Pu/Am migration at the 200-PW-1/3/6 OUs, during both past artificial recharge conditions and current natural recharge conditions (section 3.0). Section 4.0 discusses data gaps and information needs. The final section (section 5.0) provides recommendations for further work to address the data gaps and information needs identified in section 4.0
-
7 CFR 948.200 - Accounting and collections.
2010-01-01
... 7 Agriculture 8 2010-01-01 2010-01-01 false Accounting and collections. 948.200 Section 948.200 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing... Accounting and Collections § 948.200 Accounting and collections. (a) Each handler's assessment account with...
-
17 CFR 200.735-16 - Delegation.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Delegation. 200.735-16 Section 200.735-16 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION ORGANIZATION; CONDUCT... Former Members and Employees of the Commission § 200.735-16 Delegation. Any official responsibility...
-
7 CFR 3052.200 - Audit requirements.
2010-01-01
... 7 Agriculture 15 2010-01-01 2010-01-01 false Audit requirements. 3052.200 Section 3052.200 Agriculture Regulations of the Department of Agriculture (Continued) OFFICE OF THE CHIEF FINANCIAL OFFICER, DEPARTMENT OF AGRICULTURE AUDITS OF STATES, LOCAL GOVERNMENTS, AND NON-PROFIT ORGANIZATIONS Audits § 3052.200...
-
36 CFR 200.2 - Field organization.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Field organization. 200.2 Section 200.2 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE ORGANIZATION, FUNCTIONS, AND PROCEDURES Organization § 200.2 Field organization. The field organization of the Forest...
-
1997-1998 Annual Review of the 200 West and 200 East area performance assessments
International Nuclear Information System (INIS)
WOOD, M.I.
1999-01-01
An annual review of the 200 West and 200 East Area Performance Assessment (PA) analyses for fiscal year 1998 was completed. Burial ground disposal operations were found to be compliant with performance objectives in DOE Order 5820.2A. Other newly generated information and analyses relevant to PA assumptions and results were summarized. This report was initially submitted to the Department of Energy-Richland Office (DOE-RL) as a letter report in October, 1998
-
Demonstration of a Submillimeter-Wave HEMT Oscillator Module at 330 GHz
Radisic, Vesna; Deal, W. R.; Mei, X. B.; Yoshida, Wayne; Liu, P. H.; Uyeda, Jansen; Lai, Richard; Samoska, Lorene; Fung, King Man; Gaier, Todd;
2010-01-01
In this work, radial transitions have been successfully mated with a HEMT-based MMIC (high-electron-mobility-transistor-based monolithic microwave integrated circuit) oscillator circuit. The chip has been assembled into a WR2.2 waveguide module for the basic implementation with radial E-plane probe transitions to convert the waveguide mode to the MMIC coplanar waveguide mode. The E-plane transitions have been directly integrated onto the InP substrate to couple the submillimeter-wave energy directly to the waveguides, thus avoiding wire-bonds in the RF path. The oscillator demonstrates a measured 1.7 percent DC-RF efficiency at the module level. The oscillator chip uses 35-nm-gate-length HEMT devices, which enable the high frequency of oscillation, creating the first demonstration of a packaged waveguide oscillator that operates over 300 GHz and is based on InP HEMT technology. The oscillator chip is extremely compact, with dimensions of only 1.085 x 320 sq mm for a total die size of 0.35 sq mm. This fully integrated, waveguide oscillator module, with an output power of 0.27 mW at 330 GHz, can provide low-mass, low DC-power-consumption alternatives to existing local oscillator schemes, which require high DC power consumption and large mass. This oscillator module can be easily integrated with mixers, multipliers, and amplifiers for building high-frequency transmit and receive systems at submillimeter wave frequencies. Because it requires only a DC bias to enable submillimeter wave output power, it is a simple and reliable technique for generating power at these frequencies. Future work will be directed to further improving the applicability of HEMT transistors to submillimeter wave and terahertz applications. Commercial applications include submillimeter-wave imaging systems for hidden weapons detection, airport security, homeland security, and portable low-mass, low-power imaging systems
-
42 CFR 403.200 - Basis and scope.
2010-10-01
... 42 Public Health 2 2010-10-01 2010-10-01 false Basis and scope. 403.200 Section 403.200 Public... PROVISIONS SPECIAL PROGRAMS AND PROJECTS Medicare Supplemental Policies § 403.200 Basis and scope. (a... intent of that section is to enable Medicare beneficiaries to identify Medicare supplemental policies...
-
46 CFR 180.200 - Survival craft-general.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Survival craft-general. 180.200 Section 180.200 Shipping...) LIFESAVING EQUIPMENT AND ARRANGEMENTS Number and Type of Survival Craft § 180.200 Survival craft—general. (a) Each survival craft required on a vessel by this part must meet one of the following: (1) For an...
-
12 CFR 563.200 - Conflicts of interest.
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Conflicts of interest. 563.200 Section 563.200...-OPERATIONS Reporting and Bonding § 563.200 Conflicts of interest. If you are a director, officer, or employee..., or those of others with whom you have a personal or business relationship, at the expense of the...
-
19 CFR 200.735-104a - Proscribed actions.
2010-04-01
... independence or impartiality; (e) Making a Government decision outside official channels; or (f) Affecting...-104a Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION EMPLOYEE RESPONSIBILITIES AND CONDUCT Provisions Governing Ethical and Other Conduct and Responsibilities of Employees § 200.735-104a Proscribed...
-
21 CFR 73.200 - Synthetic iron oxide.
2010-04-01
... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Synthetic iron oxide. 73.200 Section 73.200 Food... COLOR ADDITIVES EXEMPT FROM CERTIFICATION Foods § 73.200 Synthetic iron oxide. (a) Identity. (1) The color additive synthetic iron oxide consists of any one or any combination of synthetically prepared...
-
Economic analysis of process steam and electricity generation by a 200 MW NHR
International Nuclear Information System (INIS)
Tian Li; Wang Yongqing
2000-01-01
New applications for low temperature nuclear heating reactors should be developed using economic analysis. This paper compares and analyzes the economics of the generation 1.5 MPa process steam and electricity by a 200 MW nuclear heating reactor (NHR-200) for industrial development. The project is very attractive economically with an internal rate of return of 19.61%, a net present worth (discount rate 10%) of 765 million yuan RMB and a capital recovery or payback period of about 5 years after construction is completed. Compared with only using the NHR-200 for in winter heating, the economic of process steam and electricity generation by NHR-200 are much better. In addition, the NHR-200 will significantly improve environmental pollution in cities and reduce the transport of coal from north to south in China
-
Summary of the 200x200 GeV μ+-μ- collider working group
International Nuclear Information System (INIS)
Neuffer, D.; Whittum, D.; Bombade, P.; Cline, D.; Jackson, G.; McIntyre, P.; Peters, G.; Sasaki, M.; Summers, D.; Yokoya, K.
1996-01-01
We report the discussions and some preliminary results from the sessions of the 200x200 GeV μ + -μ - Collider working group. The physics motivation for such a open-quote open-quote medium-energy close-quote close-quote collider is discussed. Possible parameters for such a system are described, and compared with higher-energy systems. Relatively-high luminosities (L∼10 33 cm -2 s -1 ) appear possible. Modifications of existing facilities to obtain medium-energy μ + -μ - collisions are discussed. Other discussion topics (μ-p colliders, low-energy μ sources, etc.) are summarized. copyright 1995 American Institute of Physics
-
Energy Technology Data Exchange (ETDEWEB)
Gris, Ph [CEA Saclay, 91 - Gif-sur-Yvette (France). Dept. d` Astrophysique, de la Physique des Particules, de la Physique Nucleaire et de l` Instrumentation Associee; [Paris-6 Univ., 75 (France)
1998-05-01
This thesis is devoted to the study of some supersymmetric quarks such as s-top and s-bottom. This investigation field is all the more interesting since the weak mass of these squarks could be explained by the strong Yukawa coupling between top and bottom quarks. The theoretical framework is defined and the insufficiency of the standard model is highlighted. Different models such as MSSM, supergravity models in which supersymmetry is a global symmetry are described. Squark phenomenology at LEP200 is exposed and the most likely disintegration channels for stop and s-bottom quarks are investigated in various models (MSSM, mSUGRA, supergravity models with light gravitino). The experimental tool used in this work, DELPHI detector is presented, the main elements involved in the search for squarks are precisely described. The last part of this thesis is dedicated to the effective search for squarks, the analysis deals with the energies: {radical}s=161, 172 and 183 GeV for which the luminosity values collected by DELPHI are respectively 9.7, 10 and 54 pb{sup -1}. The results are interpreted within the frameworks of different supersymmetric theories 184 refs.
-
2010-01-01
... 7 Agriculture 5 2010-01-01 2010-01-01 false Action on applications for permits to move plant pests... PEST REGULATIONS; GENERAL; PLANT PESTS; SOIL, STONE, AND QUARRY PRODUCTS; GARBAGE Movement of Plant Pests § 330.203 Action on applications for permits to move plant pests; form of and conditions in...
-
Irizar, J.; Gulde, S.; Skegg, M.; Levillain, Y.; Weber, H.
2017-09-01
Sentinel 4 is an imaging UVN (UV-VIS-NIR) dispersive spectrometer, developed by Airbus DS under an ESA contract in the frame of the joint EU/ESA COPERNICUS program. The instrument is introduced in a dedicated presentation in this conference.
-
21 CFR 137.200 - Whole wheat flour.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Whole wheat flour. 137.200 Section 137.200 Food... Flours and Related Products § 137.200 Whole wheat flour. (a) Whole wheat flour, graham flour, entire wheat flour is the food prepared by so grinding cleaned wheat, other than durum wheat and red durum...
-
Comparison of the Nellcor N-200 and N-3000 pulse oximeters during simulated postoperative activities
DEFF Research Database (Denmark)
Lie, C; Kehlet, H; Rosenberg, J
1997-01-01
Twenty-six healthy volunteers were monitored simultaneously with the Nellcor N-200 and N-3000 pulse oximeters during nonhypoxaemic simulated postoperative activity. The overall number of registered events (hypoxaemic episodes or loss of signal) was fewer with the N-3000 than with the N-200 (8 vs...... to loss of signal were significantly rarer with the N-3000 than with the N-200 (3 vs. 13, p = 0.001). The Nellcor N-3000 oximeter may offer an advantage over the N-200 model when monitoring patients in the postoperative period....
-
17 CFR 200.505 - Original classification.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Original classification. 200... Information and Material § 200.505 Original classification. (a) No Commission Member or employee has the authority to classify any information on an original basis. (b) If a Commission employee originates...
-
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Employment. 200.640 Section... Programs or Activities Conducted by the Securities and Exchange Commission § 200.640 Employment. No... employment under any program or activity conducted by the agency. The definitions, requirements, and...
-
The ρ radiative decay width: A measurement at 200 GeV
International Nuclear Information System (INIS)
Capraro, L.; Levy, P.; Querrou, M.; Hecke, B. van; Verbeken, M.; Amendolia, S.R.; Batignani, G.; Bedeschi, A.; Bellamy, E.H.; Bertolucci, E.; Bosisio, L.; Bottigli, U.; Bradaschia, C.; Fidecaro, F.; Foa, L.; Focardi, E.; Giannetti, P.; Giorgi, M.A.; Marrocchesi, P.S.; Menzione, A.; Ristori, L.; Scribano, A.; Stefanini, A.; Tonelli, G.; Beck, G.A.; Bologna, G.; D'Ettorre Piazzoli, B.; Mannocchi, G.; Picchi, P.; Istituto Nazionale di Fisica Nucleare, Frascati; Budinich, M.; Liello, F.; Paver, N.; Rolandi, L.; Green, M.G.; March, P.V.; Landon, M.P.J.; Strong, J.A.; Tenchini, R.
1987-01-01
The ρ - radiative decay width has been measured by studying the production of ρ - via the Primakoff effect by 200 GeV incident π - on Cu and Pb targets. This width was obtained by fitting the measured dσ/dt for ρ production with the theoretical coherent differential cross section including both the electromagnetic and strong contributions. The measured radiative width value is 81±4±4 keV: it is consistent with the ratio Γ(ρ → πγ)/Γ(ω → πγ) ∝ 1/9 as expected from the vector dominance and the quark model. (orig.)
-
DEFF Research Database (Denmark)
Bunch, Lennart; Nielsen, Birgitte; Jensen, Anders A.
2006-01-01
The natural product kainic acid is used as template for the rational design of a novel conformationally restricted (S)-glutamic acid (Glu) analogue, (1R,4S,5R,6S)-3-azabicyclo[3.3.0]octane-4,6-dicarboxylic acid (1a). The target structure 1a was synthesized from commercially available (S)-pyroglut......The natural product kainic acid is used as template for the rational design of a novel conformationally restricted (S)-glutamic acid (Glu) analogue, (1R,4S,5R,6S)-3-azabicyclo[3.3.0]octane-4,6-dicarboxylic acid (1a). The target structure 1a was synthesized from commercially available (S...
-
2010-07-01
....200 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) POLLUTION OIL OR HAZARDOUS MATERIAL POLLUTION PREVENTION REGULATIONS FOR VESSELS Vessel Equipment § 155.200... outside the Boundary Lines, as defined in 46 CFR part 7, in any ocean or the Gulf of Mexico; any tank...
-
Analysis of neutron dose rates on RGTT200K core using MCNP5
International Nuclear Information System (INIS)
Suwoto; Zuhair
2016-01-01
The conceptual design of RGTT200K (High Temperature Gas-cooled Reactor of 200 MWth Cogeneration) is the non-annular cylindrical reactor core with TRISO kernel coated fuel particles in the form of balls called pebble and cooled by helium gas. The RGTT200K reactor core design adopts high temperature gas cooled reactor (HTGR) technology with inherent passive safety. The RGTT200K spherical fuel called pebble fuel containing thousand of TRISO-coated fuel particles of uranium oxide (UO 2 ) 10 % enriched. TRISO coating comprises four layers, namely: porous carbon buffer layer, inner pyrolytic carbon layer (IPyC, Inner Pyrolytic Carbon), silicon carbide layer (SiC) and a layer of pyrolytic carbon outer portion (OPyC, Outer Pyrolytic Carbon). Modeling and analysis of preliminary calculation of neutron dose rate on normal operating temperature (T kernel =1200K) and accident temperature (T kernel =1800K) of the RGTT200K core were performed using Monte Carlo MCNP5v1.2 code. The continuous energy nuclear data cross-sections was taken from ENDF/B-VII, JENDL-4 and JEFF-3.1 nuclear data files . Double heterogeneity model in TRISO-coated fuel particles kernel and the pebble of RGTT200K core. By utilizing EGS99304 code, the 640 amount of energy group structures (SAND-II neutron group structures) is used in the neutron fluxes and spectrum calculation in RGTT200K reactor. The RGTT200K reactor core is divided into 25 zones (5 zones in radial and 10 zones in axial directions), while the modeling of radiation and biological shielding reactor RGTT200K are used to determine of preliminary neutron dose rate emitted by the neutron source with tally cards are available in the MCNP5v1.2 code. The calculation result analyses of the neutron dose rate distributions are determined using a conversion factor of flux-to-dose taken from International Commission on Radiological Protection, ICRP. The preliminary calculations result show that the neutrons dose rate using ICRP-74 conversion factor for
-
17 CFR 200.71 - Fiduciary relationships.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Fiduciary relationships. 200...; CONDUCT AND ETHICS; AND INFORMATION AND REQUESTS Canons of Ethics § 200.71 Fiduciary relationships. A... are involved in questions to be determined by him. Such relationships would include trustees...
-
14 CFR 1251.200 - Discrimination prohibited.
2010-01-01
... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Discrimination prohibited. 1251.200 Section... OF HANDICAP Employment Practices § 1251.200 Discrimination prohibited. (a) General. (1) No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any...
-
Fluctuations of multiplicities in rapidity windows in sulphur-sulphur collisions at 200 A GeV
Bächler, J; Runge, K; Schmoetten, E; Bartke, Jerzy; Gladysz-Dziadus, E; Kowalski, M; Stefanski, P; Bialkowska, H; Böck, R K; Brockmann, R; Sandoval, A; Buncic, P; Ferenc, D; Kadija, K; Ljubicic, A; Vranic, D; Chase, S I; Harris, J W; Odyniec, Grazyna Janina; Pugh, Howel G; Rai, G; Teitelbaum, L; Tonse, S R; Derado, I; Eckardt, V; Gebauer, H J; Rauch, W; Schmitz, N; Seyboth, P; Seyerlein, J; Vesztergombi, G; Eschke, J; Heck, W; Kabana, S; Kühmichel, A; Lahanas, L; Lee, Y; Le Vine, M J; Margetis, S; Renfordt, R E; Röhrich, D; Rothard, H; Schmidt, E; Schneider, I; Stock, Reinhard; Ströbele, H; Wenig, S; Fleischmann, B; Fuchs, M; Gazdzicki, M; Kosiec, J; Skrzypczak, E; Keidel, R; Piper, A; Pühlhofer, F; Nappi, E; Posa, F; Paic, G; Panagiotou, A D; Petridis, A; Vasileiadis, G; Pfennig, J
1992-01-01
Multiplicity distributions and their second moments fornegatively charged particles produced in32S-S central and minimum bias interactions at 200A GeV are studied in various rapidity intervals. Fritiof and Venus models mostly describe the dependence of second moments on rapidity intervals in minimum bias interactions, but not in central collisions. For central collisions the behaviour of second moments might indicate enhanced multiplicity fluctuations.
-
RCRA facility investigation report for the 200-PO-1 operable unit. Revision 1
International Nuclear Information System (INIS)
1997-05-01
This Resource Conservation and Recovery Act (RCRA) Facility Investigation (RFI) report is prepared in support of the RFI/corrective measures study process for the 200-PO-1 Groundwater Operable Unit in the 200 East Area of the Hanford Site. This report summarizes existing information on this operable unit presented in the 200 East and PUREX Aggregate Area Management Study Reports, contaminant specific studies, available modeling data, and groundwater monitoring data summary reports. Existing contaminant data are screened against current regulatory limits to determine contaminants of potential concern (COPC). Each identified COPC is evaluated using well-specific and plume trend analyses
-
Characterization and decant of Tank 42H sludge sample ESP-200
International Nuclear Information System (INIS)
Hay, M.S.
2000-01-01
DWPF Engineering requested that the Savannah River Technology Center (SRTC) provide a demonstration of the DWPF flowsheet on sludge from Tank 42H in the Shielded Cell facility. A 5 liter sample of the Tank 42H sludge (ESP-200), obtained with the tank contents fully mixed, arrived at SRTC on January 20, 1998. This report details receipt of the 5 liter sample at SRTC, the decant of the sample, and the characterization of the pre- and post-decant Tank 42H sludge. Evaluation of the measured composition of the supernate indicates Sample ESP-200 became diluted approximately 20 percent by volume prior to receipt. This dilution complicates the relationship of the characterization of Post-Decant ESP-200 to the current contents of Tank 42H. For the purposes of modeling the current tank contents of Tank 42H, this report provides an estimated composition based on analytical data of recent samples from Tank 42H
-
Characterization and decant of Tank 42H sludge sample ESP-200
Energy Technology Data Exchange (ETDEWEB)
Hay, M.S.
2000-04-25
DWPF Engineering requested that the Savannah River Technology Center (SRTC) provide a demonstration of the DWPF flowsheet on sludge from Tank 42H in the Shielded Cell facility. A 5 liter sample of the Tank 42H sludge (ESP-200), obtained with the tank contents fully mixed, arrived at SRTC on January 20, 1998. This report details receipt of the 5 liter sample at SRTC, the decant of the sample, and the characterization of the pre- and post-decant Tank 42H sludge. Evaluation of the measured composition of the supernate indicates Sample ESP-200 became diluted approximately 20 percent by volume prior to receipt. This dilution complicates the relationship of the characterization of Post-Decant ESP-200 to the current contents of Tank 42H. For the purposes of modeling the current tank contents of Tank 42H, this report provides an estimated composition based on analytical data of recent samples from Tank 42H.
-
200-BP-5 operable unit treatability test report
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-04-01
The 200-BP-5 Operable Unit was established in response to recommendations presented in the 200 East Groundwater Aggregate Area Management Study Report (AAMSR) (DOE-RL 1993a). Recognizing different approaches to remediation, the groundwater AAMSR recommended separating groundwater from source and vadose zone operable units and subdividing 200 East Area groundwater into two operable units. The division between the 200-BP-5 and 200-PO-1 Operable Units was based principally on source operable unit boundaries and distribution of groundwater plumes derived from either B Plant or Plutonium/Uranium Extraction (PUREX) Plant liquid waste disposal sites.
-
200-BP-5 operable unit treatability test report
International Nuclear Information System (INIS)
1996-04-01
The 200-BP-5 Operable Unit was established in response to recommendations presented in the 200 East Groundwater Aggregate Area Management Study Report (AAMSR) (DOE-RL 1993a). Recognizing different approaches to remediation, the groundwater AAMSR recommended separating groundwater from source and vadose zone operable units and subdividing 200 East Area groundwater into two operable units. The division between the 200-BP-5 and 200-PO-1 Operable Units was based principally on source operable unit boundaries and distribution of groundwater plumes derived from either B Plant or Plutonium/Uranium Extraction (PUREX) Plant liquid waste disposal sites
-
Time-dependent Bloch-Maxwell modelling of 1 mJ, 200 fs seeded soft x-ray laser
International Nuclear Information System (INIS)
Zeitoun, Ph.; Oliva, E.; Fajardo, M.; Velarde, P.; Ros, D.; Sebban, S.
2010-01-01
Complete text of publication follows. Seeding of high harmonic generation in a soft x-ray plasma amplifier has been first proposed and tested by T. Ditmire and collaborators. The experiment demonstrated low amplification (*2), with a very strong background coming from the soft x-ray laser ASE. Later seeding experiments reached very high amplification factors (up to 600) in both gas (Ph. Zeitoun et al.) and solid amplifiers (Wang et at.). Surprisingly, solid amplifiers extracted less energy (90 nJ) than gas amplifier (∼ 1 μJ) with equivalent pump energy. We recently demonstrated that 50-100 μJ is achievable with adequate plasma tailoring. However, this energy is still low as compared to the 10 mJ per pulse demonstrated on the ASE soft x-ray laser running at PALS facility (Czech Republic). In order to model the seeding process of PALS soft x-ray laser, we developed a time-dependent Bloch-Maxwell model that solves coherently the pumping, amplification and saturation processes. We demonstrated that direct seeding, with femtosecond pulse, a soft x-ray plasma amplifier having gain duration of several 100s of picosecond cannot extract the stored energy keeping the output beam energy in the 100 μJ range. We proposed and fully modelled a new seeding scheme that allows to achieve 10 mJ, 200 fs soft x-ray laser.
-
12 CFR 550.200 - Must I review a prospective account before I accept it?
2010-01-01
... accept it? 550.200 Section 550.200 Banks and Banking OFFICE OF THRIFT SUPERVISION, DEPARTMENT OF THE... § 550.200 Must I review a prospective account before I accept it? Before accepting a prospective fiduciary account, you must review it to determine whether you can properly administer the account. ...
-
Boersma, Adriana A.; Jong, Betty Meyboom-de; Kleiverda, Gunilla
Objective To evaluate the efficacy and safety of home administration of buccal misoprostol after mifepristone for medical abortion up to 70 days' gestation in a general practice in Curacao, where induced abortion is severely restricted by law. Methods In a prospective study 330 women received 200 mg
-
Design and analysis of Helium Brayton cycle for energy conversion system of RGTT200K
International Nuclear Information System (INIS)
Ignatius Djoko Irianto
2016-01-01
The helium Brayton cycle for the design of cogeneration energy conversion system for RGTT200K have been analyzed to obtain the higher thermal efficiency and energy utilization factor. The aim of this research is to analyze the potential of the helium Brayton cycle to be implemented in the design of cogeneration energy conversion system of RGTT200K. Three configuration models of cogeneration energy conversion systems have been investigated. In the first configuration model, an intermediate heat exchanger (IHX) is installed in series with the gas turbine, while in the second configuration model, IHX and gas turbines are installed in parallel. The third configuration model is similar to the first configuration, but with two compressors. Performance analysis of Brayton cycle used for cogeneration energy conversion system of RGTT200K has been done by simulating and calculating using CHEMCAD code. The simulation result shows that the three configuration models of cogeneration energy conversion system give the temperature of thermal energy in the secondary side of IHX more than 800 °C at the reactor coolant mass flow rate of 145 kg/s. Nevertheless, the performance parameters, which include thermal efficiency and energy utilization factor (EUF), are different for each configuration model. By comparing the performance parameter in the three configurations of helium Brayton cycle for cogeneration energy conversion systems RGTT200K, it is found that the energy conversion system with a first configuration has the highest thermal efficiency and energy utilization factor (EUF). Thermal efficiency and energy utilization factor for the first configuration of the reactor coolant mass flow rate of 145 kg/s are 35.82 % and 80.63 %. (author)
-
17 CFR 200.70 - Business promotions.
2010-04-01
... AND ETHICS; AND INFORMATION AND REQUESTS Canons of Ethics § 200.70 Business promotions. A member must not engage in any other business, employment or vocation while in office, nor may he ever use the... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Business promotions. 200.70...
-
45 CFR 604.200 - Agency and legislative liaison.
2010-10-01
... 45 Public Welfare 3 2010-10-01 2010-10-01 false Agency and legislative liaison. 604.200 Section 604.200 Public Welfare Regulations Relating to Public Welfare (Continued) NATIONAL SCIENCE FOUNDATION NEW RESTRICTIONS ON LOBBYING Activities by Own Employees § 604.200 Agency and legislative liaison. (a...
-
34 CFR 200.6 - Inclusion of all students.
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false Inclusion of all students. 200.6 Section 200.6... Basic Programs Operated by Local Educational Agencies Standards and Assessments § 200.6 Inclusion of all...— (A) For each student with a disability, as defined under section 602(3) of the IDEA, appropriate...
-
24 CFR 92.200 - Private-public partnership.
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Private-public partnership. 92.200 Section 92.200 Housing and Urban Development Office of the Secretary, Department of Housing and Urban Development HOME INVESTMENT PARTNERSHIPS PROGRAM Program Requirements § 92.200 Private-public partnership...
-
24 CFR 200.36 - Financial reporting requirements.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Financial reporting requirements. 200.36 Section 200.36 Housing and Urban Development Regulations Relating to Housing and Urban... Regulations § 200.36 Financial reporting requirements. The mortgagor must comply with the financial reporting...
-
17 CFR 200.735-7 - Negotiation for employment.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Negotiation for employment. 200.735-7 Section 200.735-7 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... Employees and Former Members and Employees of the Commission § 200.735-7 Negotiation for employment. (a) An...
-
45 CFR 149.200 - Use of reimbursements.
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false Use of reimbursements. 149.200 Section 149.200 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES REQUIREMENTS RELATING TO HEALTH CARE ACCESS REQUIREMENTS FOR THE EARLY RETIREE REINSURANCE PROGRAM Use of Reimbursements § 149.200 Use of reimbursements...
-
Directory of Open Access Journals (Sweden)
Maria Helena Matiko Akao Larsson
1980-09-01
Full Text Available De 330 soros humanos examinados pela prova de soroaglutinação lenta em tubos, 4(1,21% apresentaram aglutininas anti Brucella canis em diluição 1:100 (1 reagente com título 100, 2 reagentes com título 200 e 1 reagente com título 400.Of the 330 human sera tested by tube agglutination test, 4 (1.21% were positive for Brucella canis antibodies with tilers 1:100 or higher (1 reagent with titer of 1:100, 2 reagents with titer of 1:200, and 1 reagent with tiler of 1:400.
-
Liu, Tongxu; Li, Xiaomin; Li, Fangbai; Han, Rui; Wu, Yundang; Yuan, Xiu; Wang, Ying
2016-07-01
Although c-type cytochromes (c-Cyts) mediating metal reduction have been mainly investigated with in vitro purified proteins of dissimilatory metal reducing bacteria, the in vivo behavior of c-Cyts is still unclear given the difficulty in measuring the proteins of intact cells. Here, c-Cyts in living Shewanella putrefaciens 200 (SP200) was successfully quantified using diffuse-transmission UV/Vis spectroscopy due to the strong absorbance of hemes, and the in situ spectral kinetics of Cr(VI) reduction by c-Cyts were examined over time. The reduced product Cr(III) observed on the cell surface may play a role in inhibiting the Cr(VI) reduction and reducing the cell numbers with high concentrations (>200 μM) of Cr(VI) evidenced by the 16S rRNA analysis. A brief kinetic model was established with two predominant reactions, redox transformation of c-Cyts and Cr(VI) reduction by reduced c-Cyts, but the fitting curves were not well-matched with c-Cyts data. The Cr(III)-induced inhibitory effect to the cellular function of redox transformation of c-Cyts was then added to the model, resulting in substantially improved the model fitting. This study provides a case of directly examining the reaction properties of outer-membrane enzyme during microbial metal reduction processes under physiological conditions.
-
9 CFR 201.200 - Sale of livestock to a packer on credit.
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Sale of livestock to a packer on credit. 201.200 Section 201.200 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS... credit to ________, a packer, and I understand that in doing so I will have no rights under the trust...
-
Main design and safety features of a 200MW nuclear heating reactor
International Nuclear Information System (INIS)
Zheng, Wenxiang; Gao, Zuying; Wang, Dazhong
1992-01-01
Inept has been in charge of the development of a nuclear heating reactor since 1980s, which is one of the national key R and D Programs in China. A 5MWt experimental NCR was completed at Inept in 1989 and has operated successfully for space heating since then. In order to realize the commercialization of the NCR, it has been decided to construct a 200MW demonstration NCR in 1993. A number of advanced features, including natural circulation, integrated arrangement, self-pressurized performance, dual vessel structure, hydraulic control rod drive and passive safety systems, have been incorporated into the NCR-200 to achieve its safety goal and economic viability. This makes the NCR safe, simple, reliable, easy-constructed and maintained. At present, the design work of the NCR-200 have shown that its safety characteristics are excellent. The NCR could play an important role in resolving future energy and environmental problems in China. The paper will mainly cover the key design considerations, main technical features and safety analysis results of the NCR-200
-
41 CFR 102-117.200 - What is HAZMAT?
2010-07-01
... Shipping Hazardous Material (HAZMAT) § 102-117.200 What is HAZMAT? HAZMAT is a substance or material the... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is HAZMAT? 102-117.200 Section 102-117.200 Public Contracts and Property Management Federal Property Management...
-
34 CFR 200.12 - Single State accountability system.
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false Single State accountability system. 200.12 Section 200... Improving Basic Programs Operated by Local Educational Agencies State Accountability System § 200.12 Single State accountability system. (a)(1) Each State must demonstrate in its State plan that the State has...
-
29 CFR 2530.200b-6 - Maritime industry.
2010-07-01
... 29 Labor 9 2010-07-01 2010-07-01 false Maritime industry. 2530.200b-6 Section 2530.200b-6 Labor... Provisions § 2530.200b-6 Maritime industry. (a) General. Sections 202(a)(3)(D), 203(b)(2)(D) and 204(b)(3)(E... provisions applicable to the maritime industry. In general, those provisions permit statutory standards...
-
CCNA routing and switching study guide exams 100-101, 200-101, and 200-120
Lammle, Todd
2013-01-01
Prepare for the new CCNA exams with this Todd Lammle study guide Cisco author, speaker, and trainer Todd Lammle is considered the authority on all things networking, and his books have sold almost a million copies worldwide. This all-purpose CCNA study guide methodically covers all the objectives of the ICND1 (100-101) and ICND2 (200-101) exams as well as providing additional insight for those taking CCNA Composite (200-120) exam. It thoroughly examines operation of IP data networks, LAN switching technologies, IP addressing (IPv4/IPv6), IP routing technologies, IP services, network device s
-
Ferranti, L.; Wan, Y.; Keviczky, T.
2018-01-01
This paper focuses on the longitudinal control of an Airbus passenger aircraft in the presence of elevator jamming faults. In particular, in this paper, we address permanent and temporary actuator jamming faults using a novel reconfigurable fault-tolerant predictive control design. Due to their
-
Type QH-200 conveyor-belt nuclear scale
International Nuclear Information System (INIS)
Li Shuming; Dong Shiyuan; Li Furong; Wan Zemin
1991-01-01
Type QH-200 conveyor-belt nuclear scale is a reliable and on-line device that weighs solids mass flow continuously by γ-ray absorption and scattering. The operation principle and measuring method are described. And some factors influencing the accuracy are discussed. The full scale total weight of type QH-200 nuclear scale is 10 6 t. The result of calibration in the industrial field shows that the accuracy of QH-200 is better than ±1.0% for typical belt loading
-
12 CFR 411.200 - Agency and legislative liaison.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Agency and legislative liaison. 411.200 Section 411.200 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES NEW RESTRICTIONS ON LOBBYING Activities by Own Employees § 411.200 Agency and legislative liaison. (a) The prohibition on the use of...
-
Hoefert, Jaimee E; Bjerke, Glen A; Wang, Dongmei; Yi, Rui
2018-06-04
The microRNA (miRNA)-200 (miR-200) family is highly expressed in epithelial cells and frequently lost in metastatic cancer. Despite intensive studies into their roles in cancer, their targets and functions in normal epithelial tissues remain unclear. Importantly, it remains unclear how the two subfamilies of the five-miRNA family, distinguished by a single nucleotide within the seed region, regulate their targets. By directly ligating miRNAs to their targeted mRNA regions, we identify numerous miR-200 targets involved in the regulation of focal adhesion, actin cytoskeleton, cell cycle, and Hippo/Yap signaling. The two subfamilies bind to largely distinct target sites, but many genes are coordinately regulated by both subfamilies. Using inducible and knockout mouse models, we show that the miR-200 family regulates cell adhesion and orientation in the hair germ, contributing to precise cell fate specification and hair morphogenesis. Our findings demonstrate that combinatorial targeting of many genes is critical for miRNA function and provide new insights into miR-200's functions. © 2018 Hoefert et al.
-
17 CFR 200.506 - Derivative classification.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Derivative classification. 200.506 Section 200.506 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION ORGANIZATION; CONDUCT AND ETHICS; AND INFORMATION AND REQUESTS Classification and Declassification of National Security...
-
10 CFR 603.200 - Contracting officer responsibilities.
2010-01-01
....200 Energy DEPARTMENT OF ENERGY (CONTINUED) ASSISTANCE REGULATIONS TECHNOLOGY INVESTMENT AGREEMENTS Appropriate Use of Technology Investment Agreements § 603.200 Contracting officer responsibilities... contracting officer's judgment that the use of a TIA could benefit the RD&D objectives in ways that likely...
-
The FIREBall-2 UV sample grating efficiency at 200-208nm
Quiret, S.; Milliard, B.; Grange, R.; Lemaitre, G. R.; Caillat, A.; Belhadi, M.; Cotel, A.
2014-07-01
The FIREBall-2 (Faint Intergalactic Redshifted Emission Balloon-2) is a balloon-borne ultraviolet spectro-imaging mission optimized for the study of faint diffuse emission around galaxies. A key optical component of the new spectrograph design is the high throughput cost-effective holographic 2400 ℓ =mm, 110x130mm aspherized reflective grating used in the range 200 - 208nm, near 28°deviation angle. In order to anticipate the efficiency in flight conditions, we have developed a PCGrate model for the FIREBall grating calibrated on linearly polarized measurements at 12° deviation angle in the range 240-350nm of a 50x50mm replica of the same master selected for the flight grating. This model predicts an efficiency within [64:7; 64:9]+/-0:7% (S polarization) and [38:3; 45]+/-2:2% (P-polarization) for the baseline aluminum coated grating with an Al2O3 natural oxidation layer and within [63:5; 65] +/-1% (S-polarization) and [51:3; 54:8] +/-2:8% (P-polarization) for an aluminum plus a 70nm MgF2 coating, in the range 200 - 208nm and for a 28°deviation angle. The model also shows there is room for significant improvements at shorter wavelengths, of interest for future deep UV spectroscopic missions.
-
Noise Emission of a 200 kW Vertical Axis Wind Turbine
Directory of Open Access Journals (Sweden)
Erik Möllerström
2015-12-01
Full Text Available The noise emission from a vertical axis wind turbine (VAWT has been investigated. A noise measurement campaign on a 200 kW straight-bladed VAWT has been conducted, and the result has been compared to a semi-empirical model for turbulent-boundary-layer trailing edge (TBL-TE noise. The noise emission from the wind turbine was measured, at wind speed 8 m/s, 10 m above ground, to 96.2 dBA. At this wind speed, the turbine was stalling as it was run at a tip speed lower than optimal due to constructional constraints. The noise emission at a wind speed of 6 m/s, 10 m above ground was measured while operating at optimum tip speed and was found to be 94.1 dBA. A comparison with similar size horizontal axis wind turbines (HAWTs indicates a noise emission at the absolute bottom of the range. Furthermore, it is clear from the analysis that the turbulent-boundary-layer trailing-edge noise, as modeled here, is much lower than the measured levels, which suggests that other mechanisms are likely to be important, such as inflow turbulence.
-
Development of a 200kW multi-fuel type PAFC power plant
Energy Technology Data Exchange (ETDEWEB)
Take, Tetsuo; Kuwata, Yutaka; Adachi, Masahito; Ogata, Tsutomu [NTT Integrated Information & Energy System Labs., Tokyo (Japan)
1996-12-31
Nippon Telegraph and Telephone Corporation (NFT) has been developing a 200 kW multi-fuel type PAFC power plant which can generate AC 200 kW of constant power by switching fuel from pipeline town gas to liquefied propane gas (LPG) and vice versa. This paper describes the outline of the demonstration test plant and test results of its fundamental characteristics.