Kurja lilled / Charles Baudelaire ; prantsuse k. tlk. Ain Kaalep ja Märt Väljataga

Index Scriptorium Estoniae

Baudelaire, Charles

2000-01-01

Sisu: Õnnistamine ; "Jumaldan Sind ma siin, öist taevavõlvi nägev / tlk. Ain Kaalep ; Palkon / tlk. Märt Väljataga ; Kodukäija ; Kassid / tlk. A. Kaalep ; Armastades valet / tlk. M. Väljataga ; Üksildase vein ; Päeva lõpp / tlk. Ain Kaalep. Orig.: Bénédiction ; "Je t'adore ̉ l'égal de la vo͠te nocturne ; Le balcon ; Les chats ; L'amour du mensonge ; Le vin du solitaire ; La fin de la journée

ISO sertifikaat kuulutab tootja mainet üle maailma / Ain Alvela

Index Scriptorium Estoniae

Alvela, Ain, 1967-

2006-01-01

Ilmunud ka: Delovõje Vedomosti 12. apr. lk. 24-25. ISO standardi rakendamine tagab toodangu kvaliteedi ja annab firmale usaldusväärsuse. Kommenteerib Ain Noormägi. Vt. samas: ISO 9001; ISO 14 001; Universaalne standard kohandub ettevõtte vajadustega

[Expediency of switching from combined therapy with prostamol Uno and alpha-1-adrenoblockers to monotherapy with prostamol Uno in patients with prostatic adenoma].

Science.gov (United States)

Razumov, S V; Egorov, A A

2007-01-01

A 9-month randomized open comparative trial was performed of efficacy and safety of combined treatment with prostamol Uno and tamsulosin followed by monotherapy with prostamol Uno. A total of 58 patients with prostatic adenoma (PA) treated with prostamol Uno in combination with tamsulosin were divided into two groups: 28 patients continued the above combined therapy, 30 patients were switched to monotherapy with prostamol Uno. All the patients were examined in the course of 4 visits according to standard protocol requesting information on the disease history, complaints, digital rectal examination, IPSS questionnaire, QOL, uroflowmetry with test for residual urine, transrectal ultrasonography of the prostate, blood test for PSA. The results of the trial show reduction of IPSS and QOL indices in 87% patients. QOL improved both in group 1 after 3 months of combined treatment and in group 2 who continued on monotherapy with prostamol Uno to the end of month 9 (p 0.05). Prostamol Uno was especially safe for hypotensive patients and those on antihypertensive therapy. After discontinuation of tamsulosin 100% patients of group 2 stopped exhibiting symptoms of retrograde ejaculation. None cases of a hypotonic reaction to the drug were registered. Mean cost of a course of therapy in group 1 to that of group 2 was 1:3.16. Thus, pharmacotherapy with prostamol Uno in moderate symptoms of PA is comparable in efficacy with combination prostamol Uno + tamsulosin, is safe and cost-effective.

Dietary intake of ain-93 standard diet induces Fatty liver with altered hepatic fatty acid profile in Wistar rats.

Science.gov (United States)

Farias Santos, Juliana; Suruagy Amaral, Monique; Lima Oliveira, Suzana; Porto Barbosa, Júnia; Rego Cabral, Cyro; Sofia Melo, Ingrid; Bezerra Bueno, Nassib; Duarte Freitas, Johnatan; Goulart Sant'ana, Antônio; Rocha Ataíde, Terezinha

2015-05-01

There are several standard diets for animals used in scientific research, usually conceived by scientific institutions. The AIN-93 diet is widely used, but there are some reports of fatty liver in Wistar rats fed this diet. We aimed to evaluate the hepatic repercussions of the AIN-93 diet intake in Wistar rats. Forty newly-weaned 21-day-old male Wistar rats were fed either the AIN-93 diet or a commercial diet for either 1 month or 4 months. Weight gain, serum biochemistry, hepatic histology, and hepatic fatty acid profile were analyzed. Hepatic steatosis was observed, especially in the group fed the AIN-93 diet. Serum blood glucose, absolute and relative liver weight and hepatic levels of oleic, palmitoleic, stearic, and palmitic fatty acids were related to the observed steatosis, while lipidogram and serum markers of liver function and injury were not. AIN-93 diet induced acute hepatic steatosis in Wistar rats, which may compromise its use as a standard diet for experimental studies with rodents. The hepatic fatty acid profile was associated with steatosis, with possible implications for disease prognosis. Copyright AULA MEDICA EDICIONES 2014. Published by AULA MEDICA. All rights reserved.

Keila Tervisekeskus. Ujula = Keila Health Club. Swimming Pool / Ain Padrik

Index Scriptorium Estoniae

Padrik, Ain, 1947-

2001-01-01

Projekteerija: Arhitektuuribüroo Künnapu & Padrik. Arhitektid Ain Padrik ja Kristi Alamaa, sisearhitekt Sirje Männik. Konstruktsioonid: Jaan Laks, A-Grupp. Ujulas on võistlus- ja lastebassein, suvel on avatud välibassein. 5 ill.: I korruse plaan, ristlõige, vaated

Tumedad ained kirjanduses ja päriselt / Mare Müürsepp

Index Scriptorium Estoniae

Müürsepp, Mare

2007-01-01

Analüüsitud on Philip Pullmani triloogiasse "Tema tumedad ained" kuuluvaid romaane : Pullman, Philip. Kuldne kompass. Tallinn : Tiritamm, 2002; Pullman, Philip. Inglite torn. Tallinn : Tiritamm, 2004; Pullman, Philip. Vaigust kiiker. Tallinn : Tiritamm, 2005

Aine y riesgo cardiovascular: los menos posibles, a la menor dosis posible y durante el menor tiempo posible

Directory of Open Access Journals (Sweden)

Ferrán Catalá-López

2014-09-01

Conclusiones: Existe poca evidencia para sugerir que alguno de los AINE estudiados es seguro en términos de riesgo cardiovascular. Naproxeno parece ser menos perjudicial que el resto. El riesgo cardiovascular asociado al uso de AINE debe ser tenido en cuenta en la prescripción de cualquiera de estos medicamentos.

Poolsajandi õnnesoovid Jaak Aaviksoole / Ain Heinaru, Jaak Kangilaski, Tõnu Lehtsaar...[jt.

Index Scriptorium Estoniae

2004-01-01

Mõtteid Tartu Ülikooli rektorist tema 50. sünnipäeva puhul : Ain Heinaru, Jaak Kangilaski, Tõnu Lehtsaar, Indrek Reimand, Toomas Kiho, Leelo Kriisa, Peeter Olesk, Risto Tammelo, Birute Klaas, Peeter Saari, Andrus Ansip, Mait Klaassen, Marika Kullamaa, Kaupo Bend

Perancangan alat Pendeteksi Intensitas Cahaya Menggunakan LDR Berbasis Arduino uno

OpenAIRE

Karlina

2017-01-01

132411080 Telah dirancang dan dibuat alat ukur intensitas cahaya menggunakan LDR berbasis arduino uno. Alat ukur intensitas cahaya ini menggunakan LDR sebagai sensor intensitas cahaya,mikrokontroller,arduino uno berfungsi sebagai pengolah sinyal elektronik dari LDR dan sebagai pengolah data,sedangkan hasil pengolahan data akan ditampilkan pada LCD Dari hasil pengujian alat ini dihasilkan persentase kesalahan relatif rata-rata sekitar % Kata kunci :Arduino Uno,Lcd,LDR.

The Scientific Method Ain't What It Used to Be

Science.gov (United States)

Herreid, Clyde Freeman

2010-01-01

Remember the time when all you had to do was memorize these five steps: ask a question, formulate a hypothesis, perform experiment, collect data, and draw conclusions? And you received full credit for defining the scientific method. Well, those days are gone. This article discusses why the "scientific method ain't what it used to be." (Contains 2…

Simulasi Sensor Seismometer Horizontal Menggunakan MEMS Accelerometer Berbasis Arduino UNO

OpenAIRE

Hutapea, Cynthya Dorothy

2017-01-01

130801045 Telah dirancang sebuah alat sebagai seismometer horizontal menggunakan GY-521 dan Arduino UNO ATMEGA 328P. Alat ini terdiri dari GY-521 modul MPU-6050 sebagai sensor vibrasi dan arduino UNO sebagai pengendali sistem. Perangkat lunak yang digunakan sebagai pengendali sistem adalah Arduino IDE. Cara kerja alat tersebut cukup sederhana yaitu accelerometer MPU-6050 mengukur amplitudo dan frekuensi dari kecepatan suatu getaran dan kemudian datanya akan dikirim ke arduino. Arduino UNO ...

An activity-based cost analysis of the Honduras community-based, integrated child care (AIN-C) programme.

Science.gov (United States)

Fiedler, John L; Villalobos, Carlos A; De Mattos, Annette C

2008-11-01

The Honduras AIN-C programme is a preventive health and nutrition programme of the Honduras Ministry of Health (MOH) that relies on volunteers to help mothers monitor and maintain the adequate growth of young children. A quasi-experimental, design-based evaluation found that the programme achieved near-universal coverage and was effective in improving mothers' child-rearing knowledge, attitudes and practices, including feeding and appropriate care-giving and care-seeking practices for children with diarrhoea and acute respiratory illness. The programme is widely regarded as a model. This study was undertaken to provide the first comprehensive estimates of the cost of the AIN-C programme, with the goal of providing a programme and financial planning tool for Honduras. An additional comparison of study findings was also undertaken to determine the cost of the AIN-C programme's community-based services relative to a similar facility-based service. Expressed in mid-2005 US dollars, the study found that after the programme is phased-in: (1) the annual, recurrent cost per child under 2 years participating in the programme is $6.43; (2) the annual, incremental budget requirements per child under 2 years participating in the programme are $3.90; (3) the cost of an AIN-C monthly growth monitoring and counselling session per child is 11% of the cost of a traditional MOH, facility-based growth and development consultation per child; and (4) the effect of mothers substituting AIN-C monitor care for MOH facility-based care 'saves' 203 000 outpatient visits a year, with a potential cost saving of $1.66 million, the equivalent of 60% of the recurrent cost of the programme and roughly equal to the annual incremental budget requirements of the programme. Sensitivity analysis of the cost estimates is performed to provide insight, for countries considering introducing a similar programme, into how modifications of key characteristics of the programme affect its costs.

Pamidronato endovenoso en espondilitis anquilosante refractaria a antiinflamatorios no esteroideos (AINES y sulfasalazina

Directory of Open Access Journals (Sweden)

Augusto García-Poma

2007-03-01

Full Text Available Objetivo: Evaluar la terapia con pamidronato, en pacientes con espondilitis anquilosante (EA activa, con respuesta subóptima o falla a los antiinflamatorios no-esteroideos (AINES y sulfasalazina. Diseño: Estudio clínico comparativo. Lugar: Hospital Nacional Edgardo Rebagliati Martins, EsSalud, Lima, Perú. Participantes: Pacientes con espondilitis anquilosante. Intervenciones. Se incluyó 9 pacientes con EA (6 varones, con enfermedad activa (BASDAI > o = 4, actividad axial y falta de respuesta a los Aines y sulfasalazina a dosis de 3g/d. Todos los pacientes recibieron 60 mg de pamidronato mensual, en infusión endovenosa, durante 6 meses, y continuaron tomando AINES y sulfasalazina. La mejoría clínica fue evaluada usando el ASAS 20. En forma secundaria se evaluó el ASAS 40, BASDAI 50, BASDAI, BASFI Y BASMI, a las 24 y 48 semanas (32 a 86 semanas. La diferencia entre el índice de pre y postratamiento fue evaluada usando la prueba de Wilcoxon. Principales medidas de resultados: Evaluación del ASAS 20. Resultados: El 67% alcanzó un Asas 20 a las 24 semanas y 78% a las 48 semanas; 33,3% y 55,6% tuvieron ASAS 40 y 33,3%; y 44,4% alcanzó BASDAI 50 a las 24 y 48 semanas, respectivamente. Un paciente recayó a la semana 20. Tres pacientes (33,3% permanecieron sin cambios. A las 24 y 48 semanas, la media de BASDAI disminuyó en 45,1% (p=0,007 y en 52,1% (p=0,01, la media de BASFI en 38,2% (p=0,007 y en 52,3% (p=0,007, y la media de BASMI en 39,2% (p=0,01 y 39,2% (p=0,01, respectivamente. Los eventos adversos no fueron importantes con esta terapia. Conclusiones: El tratamiento con pamidronato demostró ser efectivo en este grupo de pacientes con EA, refractaria a AINES y a sulfasalazina.

Valik arvamusi läbi aastate / Ain-Elmar Kaasik

Index Scriptorium Estoniae

Kaasik, Ain-Elmar, 1934-

2008-01-01

Valik Eesti Teaduste Akadeemia Aastaraamatus rubriigis "Arvamusi akadeemikutelt" ilmunud kirjutisi, kus vabas vormis käsitletakse mitmesuguseid aktuaalseid küsimusi, eelkõige hariduse, teadustöö ning ühiskonna suhteid. Kokku on rubriigis avaldatud ligi kaks ja poolsada kirjutist. Siinse valiku autoriteks akadeemikud Raimund Hagelberg, Mart Saarma, Boris Tamm, Ene Ergma, Arvo Krikmann, Agu Laisk, Hans-Voldemar Trass, Harald Keres, Anto Raukas, Rein Küttner, Enn Tõugu, Raimund-Johannes Ubar, Ain-Elmar Kaasik

Aineüleste pädevuste koolitus Pestalozzi programmi raames / Tiia Pukk, Tiiu Vaher

Index Scriptorium Estoniae

Pukk, Tiia

2011-01-01

1969 alguse saanud Pestalozzi koolitusprogramm on suunatud Euroopa kultuurikonventsiooniga ühinenud 49 riigi haridustöötajatele. Seekordne üritus toimus Tartus, koolituse teemaks aineülesed pädevused

UNO ACT Class Profile, 1989-90 [and] 1990-91.

Science.gov (United States)

Crawford, A. E., II

1991-01-01

The report "UNO Act Class Profile, 1989-90" in the first of two serial issues presents salient parts of data from "The Class Profile Report" of the American College Testing (ACT) Corporation, which provides detailed information concerning the academic past of 1,359 freshmen entering the University of Nebraska at Omaha (UNO) in…

GarcÍa Lorca luulest ja Ain Kaalepi tõlkest / Jüri Talvet

Index Scriptorium Estoniae

Talvet, Jüri, 1945-

1998-01-01

Arvustus: GarcÍa Lorca, Federico. Mu kätes põleb tuli : valitud luuletused / tlk. ja saateks: Ain Kaalep. 2. tr. Tallinn : Vagabund, 1997. Ilmunud ka kogumikus: Talvet, Jüri. Tõrjumatu äär. Tartu : Ilmamaa, 2005, lk. 442-453

New frameshift CF mutation 3729delAinsTCT in a Tunisian cystic

Indian Academy of Sciences (India)

Home; Journals; Journal of Genetics; Volume 92; Issue 1. New frameshift CF mutation 3729delAinsTCT in a Tunisian cystic fibrosis patient. Sondess Hadj Fredj Monia Boudaya Sabrine Oueslati Safa Sahnoun Chaima Sahli Hajer Siala Khedija Boussetta Amina Bibi Taieb Messaoud. Research Note Volume 92 Issue 1 April ...

Üks liblika tiivalöök Brasiilias võib tekitada Texases tornaado / Ain Kallis

Index Scriptorium Estoniae

Kallis, Ain, 1942-

2008-01-01

Meteoroloog ja matemaatik Edward Norton Lorenz (1917-2008) tegi 1961. aastal tavalist numbrilist ilmaprognoosi. Arvutustes tehtud väikese ümarduse tõttu muutus lõpp-prognoos ebatäpseks. Kogetu põhjal formuleeris ta ühe kaoseteooria põhiprintsiibi

COxSwAIN: Compressive Sensing for Advanced Imaging and Navigation

Science.gov (United States)

Kurwitz, Richard; Pulley, Marina; LaFerney, Nathan; Munoz, Carlos

2015-01-01

The COxSwAIN project focuses on building an image and video compression scheme that can be implemented in a small or low-power satellite. To do this, we used Compressive Sensing, where the compression is performed by matrix multiplications on the satellite and reconstructed on the ground. Our paper explains our methodology and demonstrates the results of the scheme, being able to achieve high quality image compression that is robust to noise and corruption.

A retrospective review of the Honduras AIN-C program guided by a community health worker performance logic model.

Science.gov (United States)

Rodríguez, Daniela C; Peterson, Lauren A

2016-05-06

Factors that influence performance of community health workers (CHWs) delivering health services are not well understood. A recent logic model proposed categories of support from both health sector and communities that influence CHW performance and program outcomes. This logic model has been used to review a growth monitoring program delivered by CHWs in Honduras, known as Atención Integral a la Niñez en la Comunidad (AIN-C). A retrospective review of AIN-C was conducted through a document desk review and supplemented with in-depth interviews. Documents were systematically coded using the categories from the logic model, and gaps were addressed through interviews. Authors reviewed coded data for each category to analyze program details and outcomes as well as identify potential issues and gaps in the logic model. Categories from the logic model were inconsistently represented, with more information available for health sector than community. Context and input activities were not well documented. Information on health sector systems-level activities was available for governance but limited for other categories, while not much was found for community systems-level activities. Most available information focused on program-level activities with substantial data on technical support. Output, outcome, and impact data were drawn from various resources and suggest mixed results of AIN-C on indicators of interest. Assessing CHW performance through a desk review left gaps that could not be addressed about the relationship of activities and performance. There were critical characteristics of program design that made it contextually appropriate; however, it was difficult to identify clear links between AIN-C and malnutrition indicators. Regarding the logic model, several categories were too broad (e.g., technical support, context) and some aspects of AIN-C did not fit neatly in logic model categories (e.g., political commitment, equity, flexibility in implementation). The

Momenti nella vita di uno scienziato

CERN Document Server

Rossi, Bruno

1987-01-01

Nel giro di pochi decenni, la nostra visione del mondo fisico, dal mond subatomico al mondo del cosmo, ha subito una profonda evoluzione. In questo libro, uno degli scienziati che hanno contribuito a tale sviluppo narra la storia della sua vita e del suo lavoro.

Monsieur Philippe Galli Préfet de l’Ain France

CERN Multimedia

Maximilien Brice

2011-01-01

Photo 35: Le chef du département Physique P. Bloch, le porte-parole de la Collaboration CMS G. Tonelli,le Sous-Préfet de Gex O. Laurens-Bernard, le chef du département Technologie F. Bordry, le Péfet de l'Ain P. Galli et le Directeur-général R. Heuer. Photo 62: signature du livre d'or avec le Directeur de la recherche et de l'informatique S. Bertolucci.

Application of electrical geophysics to the release of water resources, case of Ain Leuh (Morocco

Directory of Open Access Journals (Sweden)

Zitouni A.

2018-01-01

In the present work, which concerns only the methodology of the electric resistivity, we treat the adopted methodological approach and the study of the case of application in the tray of Ajdir Ain Leuh.

Poemas: Uno Llega/ Lucy Cristina

OpenAIRE

Testa Garibaldo, Martín

2009-01-01

con sus hojas sueltas a la comparación un par de ideas testimonios denuncias amores todo el universal país que te ha costado alinearlo en papel uno llega con hojas sueltas su voz su mística en la mano con la que toca varias veces hasta que le abren entra toma asiento a la primera señal se levanta lee relee

Mida sina täna õppisid? / Veikko Täär, Ain Aaviksoo, Ingrid Tõniste ... [jt.

Index Scriptorium Estoniae

2012-01-01

Oma õppimistest ja tulevikuplaanidest räägivad näitleja ja ettevõtja Veikko Täär, tervishoiuteadlane Ain Aaviksoo, tegevjuht Ingrid Tõniste, TV3 avalike suhete juht ja uudisteankur Anneli Adermann, arenduskonsultant Anu Puusaag, personaaltreener Katrin Pärt ja loodusarst Tiina Keldrima

Ain't Gonna Study War No More? Explorations of War through Picture Books

Science.gov (United States)

Crawford, Patricia A.; Roberts, Sherron Killingsworth

2009-01-01

At the height of the Vietnam War, Down by the Riverside was transformed from a traditional folk song to a popular anti-war anthem. The raucous and repetitive chorus, "I ain't gonna study war no more ...," became a rallying cry for those who wanted nothing to do with the war and the pain and controversy that surrounded it. Although it seems…

Modelling rainfall runoff relations using HEC-HMS in a semi-arid region: Case study in Ain Sefra watershed, Ksour Mountains (SW Algeria)

OpenAIRE

Derdour Abdessamed; Bouanani Abderrazak; Babahamed Kamila

2018-01-01

Ain Sefra is one of the Algerian cities that had been experienced several devastating floods during the past 100 years. The purpose of this study is to simulate runoff in the semi-arid region of Ain Sefra watershed through the employing of the Hydrologic Engineering Center – Hydrologic Modelling System (HEC-HMS). In this paper, the frequency storm is used for the meteorological model, the Soil Conservation Service – curve number (SCS-CN) is selected to calculate the loss rate and Soil Conserv...

Contribution to the hydrogeological, geochemical and isotopic study of Ain El Beidha and Merguellil (Kairouan plain) aquifers: Implication for the dam-aquifer relationship

International Nuclear Information System (INIS)

Ben Ammar, Safouan

2007-01-01

In the semiarid central part of Tunisia the water resources are becoming increasingly rare because of the scarcity and irregularity of the precipitation and a steadily growing need for fresh water. This study addresses the use of geochemical and isotopic data to analyze the relationship between the El Haouareb dam and the Ain El Beidha and the Kairouan alluvial plain aquifers systems for durable groundwater management. In the Ain El Beidha basin the hydrogeological and geochemical investigations showed that: - The general direction of the groundwater flow is mainly from the SW to the NE, i.e. towards the hydraulic sill of El Haouareb which allows the connection between the Ain El Beidha basin and the Kairouan plain, - The salinity distribution displays a zonation in apparent relationship with the lithological variation of the aquifer formation, - Mineral exchange between groundwater and the aquifer matrix is the dominant process in determining groundwater salinity. The isotopic data confirm the flow directions of groundwater and shows that the recharge of Ain El Beidha aquifers takes place from the floods of the Khechem and Ben Zitoun wadies and also by preferential infiltration of runoff at the front of hill slopes area. Close to preferential recharge areas, groundwater 3H contents reflect a recent input of surface water, whereas the radiocarbon data indicate a longer residence time downstream. The isotopic characteristics of Ain El Beidha groundwater (small space and temporal changes) authorize the use of averaged values for the dam-aquifer water exchange. Under natural conditions, groundwater recharge of the alluvial aquifer of Kairouan plain occurs by infiltration of the Merguellil floods and from the Ain el Beidha groundwater flow close the karstic hydraulic sills. Since the construction of the El Haouareb dam, these natural mechanisms have been strongly modified: the dam waters infiltrate into the karst, mix with the Ain el Beidha groundwater, and feed the

T his article is m ainly about using sim ple trigonom etric identities ...

Indian Academy of Sciences (India)

T his article is m ainly about using sim ple trigonom etric identities and basic calculus to deduce som e new and interesting series. In particular, I use basic aspects of. G am m a and B eta integrations to deduce these series. T hese lead to interesting series for ¼ or functions of ¼ . O ne form ofbeta integration w hich is often ...

Lo uno y lo diverso

Directory of Open Access Journals (Sweden)

José Rojas Bez

2015-01-01

Full Text Available El arte no solo tiene ese poder para agudizar las miradas Toda creación, apreciación y educación artística está vinculada a una observación y comprensión más incisiva y honda del hombre y del mundo. Al arte y a la educación estética corresponde, pues, un importante papel en esta rica dialéctica entre lo singular y lo universal, en la creación y apreciación de lo uno en lo diverso y de la diversidad en la unidad.

Organization of multidimensnonal measurements on the UNO-4096-90 analyzer

International Nuclear Information System (INIS)

Zajtsev, M.Yu.; Regushevskij, V.I.

1984-01-01

Organization of multidimensional analysis on the UNO-4096-90 analyzer and VECTOR system units is described. Analyzer for displacement of spectrometric units possesses a special frame of input units in which each unit is assinged to its own place. Development of the UNO-4096-90 analyzer and VECTOR system converters enabled to organize the multidimensional analysis under one of the following regimes: amplitude-amplitude, time-amplitude, time-time, amplitude-time with the use of time expander, multitransducer amplitude or time. Mentioned regimes were tested in operation, and gained experience enables to note that organized multidimensional regimes of analysis satisfy the experiment requirements

Pima Community College Planning Grant for Autonomous Intelligent Network of Systems (AINS) Science, Mathematics and Engineering Education Center

National Research Council Canada - National Science Library

2006-01-01

.... The Center was to be funded by the Department of Defense, Office of Naval Research (ONR). The TDRI AINS Center's objectives were to advance ONR's technologies and to improve exposure and participation in science, math, and engineering (SME...

Feasibility of a next generation underground water Cherenkov detector: UNO

International Nuclear Information System (INIS)

Jung, Chang Kee

2000-01-01

The feasibility of a next generation underground water Cherenkov detector is examined and a conceptual design (UNO) is presented. The design has a linear detector configuration with a total volume of 650 kton which is 13 times the total volume of the Super-Kamiokande detector. It corresponds to a 20 times increase in fiducial volume for physics analysis. The physics goals of UNO are to increase the sensitivity of the search for nucleon decay by a factor of ten and to make precision measurements of the solar and atmospheric neutrino properties. In addition, the detection sensitivity for supernova neutrinos will reach as far as the Andromeda galaxy

The determination of molar volumes of uranous nitrate and nitric acid in systems of U(NO3)4-HNO3-H2O and U(NO3)4-HNO3-30% TBP kerosene

International Nuclear Information System (INIS)

Tao Chengying

1986-01-01

The data of molar volumes of uranous nitrate and nitric acid are necessary for the calculation of the changes in phase volume during the extraction in U(NO 3 ) 4 -HNO 3 /30%TBP-kerosene system. However, the data of the partial molar volume of U(NO 3 ) 4 are not available in literature. In the present work, the molar volumes of U(NO 3 ) 4 and HNO 3 are calculated by linear fitting of the experimental data. The result of the molar volume of HNO 3 is consistent with those in literature

Isotope hydrological investigation of Moghra and Ain El-Sharip environment, north western desert, Egypt

International Nuclear Information System (INIS)

Aly, A.I.M.; Nada, A.; Awad, M.; Salman, A.B.; Hamza, M.S.

1991-01-01

Groundwater samples collected from some localities in the vicinity of Moghra and Ain El-Sharip in the north western desert were subjected to chemical and to isotopic analyses. The combination of the hydrochemical data with the isotopic compositions of deuterium, oxygen-18 and tritium shows that the groundwater in this region represents a mixture of water recharged from different sources including : Nile, sea and paleo-waters.5 fig.,2 tab

Pärleid vanapaberi hulgast : kohtumisi inimeste ja vanaraamatuga / Uno Schultz

Index Scriptorium Estoniae

Schultz, Uno, 1956-

2010-01-01

Bibliofiil Uno Schultzi vanaraamatute kogu kujunemisest ning inimestest, kellega haruldaste raamatute leidmisel kohtutud, sh Kyra Robertist, Voldemar Millerist, Trivimi Vellistest, Oskar Kuningast, Helene Kulpast, Erik Tederist jt.

Carta al editor en relación al artículo: “Estrategia de uno en uno para mejorar la técnica correcta de higiene de manos”

Directory of Open Access Journals (Sweden)

Antonella Carpio Rodríguez

2018-01-01

Full Text Available Hemos leído con interés el artículo titulado: “Estrategia de uno en uno para mejorar la técnica correcta de higiene de manos” de Orozco Hernández y colaboradores, publicado en el volumen 38, número 5.1 Aunque consideramos que el estudio puede ser importante en la búsqueda de estrategias para mejorar la técnica de lavado de manos en personal de salud, nos gustaría expresarle algunas dudas que surgen y que requieren clarificación.

Teaduskeskus Ahhaa = Ahhaa Science Centre / Vilen Künnapu, Ain Padrik, Malle Jürgenson, Tea Tammelaan ; intervjueerinud Margit Mutso

Index Scriptorium Estoniae

2012-01-01

Tartus Sadama 1 auva Ahhaa teaduskeskuse arhitektuurist ja sisearhitektuurist. Arhitektid: Ain Padrik ja Vilen Künnapu, kaasa töötasid Kristjan Tõlk, Kristiin Keernik, Siim Tuksam, Hannes Tilk (Künnapu & Padrik). Sisearhitektid: Tea Tammelaan, Krista Lepland ja Malle Jürgenson (Laika, Belka & Strelka). Infograafika: Alar Pikkorainen

Evaluation of XRI-UNO CdTe detector for nuclear medical imaging

International Nuclear Information System (INIS)

Jambi, L.K.; Lees, J.E.; Bugby, S.L.; Alqahtani, M.S.; Tipper, S.; Perkins, A.C.

2015-01-01

Over the last two decades advances in semiconductor detector technology have reached the point where they are sufficiently sensitive to become an alternative to scintillators for high energy gamma ray detection for application in fields such as medical imaging. This paper assessed the Cadmium-Telluride (CdTe) XRI-UNO semiconductor detector produced by X-RAY Imatek for photon energies of interest in nuclear imaging. The XRI-UNO detector was found to have an intrinsic spatial resolution of <0.5mm and a high incident count rate capability up to at least 1680cps. The system spatial resolution, uniformity and sensitivity characteristics are also reported

Gamma ray spectroscopy with Arduino UNO

Science.gov (United States)

Lavelle, C. M.

2018-05-01

We review a simple gamma ray spectrometer constructed on a solderless breadboard. The spectrometer's detector consists of a CsI(Tl) scintillator and silicon photomultiplier (SiPM) and its readout is facilitated by an Arduino UNO. The system is low cost and utilizes a minimum of components while still achieving satisfactory charge linearity and noise levels. This instrument can be used in instructional laboratories to introduce both radiation detection and analog signal processing concepts. We also expect it will be of interest to those seeking to introduce gamma spectroscopy to the expanding ecosystem of Arduino hardware.

The impact of weathering on the uranium-bearing phosphates of Ain Laylon in the Syrian coast, using radon and gamma ray surveys

International Nuclear Information System (INIS)

Jubeli, Y.; Al-Hilal, M.; Al-Ali, A.

1998-06-01

A combination of several exploration techniques was carried out at the main phosphatic outcrop of Ain Laylon in the Syrian coastal region. The survey was extended along an E-W profile parallel to Wadi Al-Mzeraa over a distance of about 23 km from Ain Laylon site towards the shoreline of the Mediterranean Sea. The techniques used in this survey included soil radon emanometry, gamma ray spectrometry and soil geochemistry, with the purpose of evaluating the effects of weathering and erosion on the uranium-hearing phosphate formations in the study ares. Soil radon concentration and gamma ray total count rates found to be ranging between 115-472 pCi/l and 52-520 cps over the main phosphate deposit of Ain Layton and between 16-241 pCi/l and 15-300 cps along the profile of Wadi Al-Mzeraa - Rwemiyeh respectively. Some suitable elements such as U, Zn, Pb, Cr, Fe and Sr were also analyzed to trace the dispersion pattern of uranium and its controls throughout the area. The results showed that the distribution of both radon emission and gamma ray activity, in accordance with chemical uranium and some associated trace elements, were almost identical over the study area. The anomalously high values in all cases were basically found to be related to the main phosphatic outcrop and to the reprecipitation processes at their vicinity following the alteration of the phosphates. The prevailing topographic conditions of the drainage system has probably played a crucial role in carrying the uraniferous solutions from its phosphatic source down to the nearby sedimentary environment. This appears to be sufficient enough to produce an anomalous halo resulting in the detection of some relatively high radon and gamma values of about 7 and 15 times the background respectively, especially close to the main phosphate outcrop. A notable gradual decrease was then observed at the following sampling sites along the pathway west of Ain Laylon site approaching the background level at a distance of

Ludovico Zorzi. Profilo di uno studioso inquieto

Directory of Open Access Journals (Sweden)

Stefano Mazzoni

2014-12-01

Full Text Available The works of one of the most authoritative historians and insightful critics in Early Modern theatre studies, are reappraised here in the light of both co-textual and contextual evaluations, as well as on the basis of updated methodological knowledge.Le opere e i giorni di uno dei più acuti storici dello spettacolo rinascimentale e di Antico regime sono ricostruiti e interpretati nel loro contesto, anche sulla base di documenti inediti, e si saldano a una riflessione metodologica su temi e problemi della Storia dello spettacolo. 

Estrategia de uno en uno para mejorar la técnica correcta de higiene de manos

Directory of Open Access Journals (Sweden)

Hilda Guadalupe Hernández-Orozco

2017-08-01

Full Text Available INTRODUCCIÓN: la higiene de las manos es considerada la estrategia más importante para prevenir infecciones asociadas con la atención de la salud. En nuestra institución, un estudio previo mostró que 93% del personal del hospital dijo conocer la técnica de higiene de manos, pero las observaciones de vigilancia activa no reflejaban estos resultados.   OBJETIVO: mejorar la técnica de higiene de manos apropiada a través de una estrategia de "uno a uno". MATERIAL Y MÉTODOS: estudio comparativo de antes y después, prospectivo, longitudinal, realizado entre 2012-2013, con personal de enfermería de cinco servicios. El estudio se realizó en tres etapas: la primer etapa consistió en observar la realización de higiene de manos reforzando verbalmente si era incorrecta; en la segunda etapa se pidió que se realizara la higiene de manos, si era incorrecta se pidió se repitiera realizándola al mismo tiempo con el observador; la tercera etapa fue la evaluación final de higiene de manos, después de al menos 15 días de la segunda etapa. Analizamos frecuencias de eventos correctos y realizamos comparaciones entre grupos por McNemar para evaluar si el efecto de la intervención se sostenía a pesar del tiempo; se evaluaron las mismas variables un año después del inicio del estudio. RESULTADOS: la prueba de McNemar mostró diferencias estadísticamente significativas entre la realización de la higiene de manos correcta entre la etapa 1 en comparación con las siguientes 35 versus 85%; p < 0.001.   CONCLUSIONES: se confirmó que la intervención dirigida logra mayor cooperación por parte del personal e incrementa la técnica correcta de higiene de manos a  orto plazo.

Implementasi Prototype Alat Uji Flight Control Actuator Pesawat Berbasis Mikrokontroller Arduino Uno

Directory of Open Access Journals (Sweden)

NANDANG TARYANA

2017-07-01

Full Text Available ABSTRAKFlight control system merupakan suatu sistem di pesawat udara yang digunakan untuk manuver dari satu kondisi terbang ke kondisi terbang lainnya. Alat uji flight control actuator pesawat ini dirancang berupa prototype yang dikendalikan dengan menggunakan mikrokontroller arduino uno, yang terdiri dari input dan output. Input tersebut adalah sensor load cell yang berfungsi untuk mengetahui beban yang diterima dari aktuator pesawat, serta input sensor ping berfungsi untuk mengetahui jarak ataupun sudut dari pergerakan aktuator pesawat. Sedangkan output yang dihasilkan berupa data dari hasil pembacaan sensor load cell dan sensor ping. Alat uji flight control sistem aktuator pesawat yang telah direalisasikan mampu menggerakkan 2 buah double acting cylinder untuk bekerja naik dan turun secara bergantian serta mampu menggerakkan motor servo dengan jarak pergerakkan 3 cm – 4 cm.Kata kunci: Flight control system, Arduino Uno, double acting cylinder, Sensor Ping, Load Cell, Motor ServoABSTRACTFlight control system is a system in which aircraft are used to maneuver from one condition to fly to other flight conditions. Testing instruments aircraft flight control actuator designed a prototype of which is controlled by using microcontroller arduino uno, which consists of input and output. The input is a load cell sensor that serves to determine the load received from aircraft actuators, as well as ping sensor input is used to determine the distance or angle of the aircraft actuator movement . While the output of the data from the load cell sensor readings and sensor ping . Test equipment aircraft flight control actuator system that has been realized is able to move two pieces of double acting cylinder to work up and down alternately and able to drive the servo motor with the movement distance of 3 cm – 4 cm . Keywords: Flight control system , Arduino Uno , double acting cylinder , Ping Sensor, Load Cell, Servo Motor 

Implementasi Prototype Alat Uji Flight Control Actuator Pesawat Berbasis Mikrokontroller Arduino Uno

Directory of Open Access Journals (Sweden)

NANDANG TARYANA

2018-02-01

Full Text Available ABSTRAK Flight control system merupakan suatu sistem di pesawat udara yang digunakan untuk manuver dari satu kondisi terbang ke kondisi terbang lainnya. Alat uji flight control actuator pesawat ini dirancang berupa prototype yang dikendalikan dengan menggunakan mikrokontroller arduino uno, yang terdiri dari input dan output. Input tersebut adalah sensor load cell yang berfungsi untuk mengetahui beban yang diterima dari aktuator pesawat, serta input sensor ping berfungsi untuk mengetahui jarak ataupun sudut dari pergerakan aktuator pesawat. Sedangkan output yang dihasilkan berupa data dari hasil pembacaan sensor load cell dan sensor ping. Alat uji flight control sistem aktuator pesawat yang telah direalisasikan mampu menggerakkan 2 buah double acting cylinder untuk bekerja naik dan turun secara bergantian serta mampu menggerakkan motor servo dengan jarak pergerakkan 3 cm – 4 cm. Kata kunci: Flight control system, Arduino Uno, double acting cylinder, Sensor Ping, Load Cell, Motor Servo ABSTRACT Flight control system is a system in which aircraft are used to maneuver from one condition to fly to other flight conditions. Testing instruments aircraft flight control actuator designed a prototype of which is controlled by using microcontroller arduino uno, which consists of input and output. The input is a load cell sensor that serves to determine the load received from aircraft actuators, as well as ping sensor input is used to determine the distance or angle of the aircraft actuator movement . While the output of the data from the load cell sensor readings and sensor ping . Test equipment aircraft flight control actuator system that has been realized is able to move two pieces of double acting cylinder to work up and down alternately and able to drive the servo motor with the movement distance of 3 cm – 4 cm . Keywords: Flight control system , Arduino Uno , double acting cylinder , Ping Sensor, Load Cell, Servo Motor

Kuniichi Uno: um pensamento filosófico além do dualismo Oriente/Ocidente

Directory of Open Access Journals (Sweden)

Ana Amélia C. Genioli

2012-12-01

Full Text Available Este livro inédito do filósofo japonês Kuniichi Uno apresenta 11 ensaios sobre o corpo, a dança, o teatro, o cinema e a biopolítica com reflexões que tomam como referência obras de Nijinsky, Tanaka Min, Hijikata, Artaud, Beckett, Genet e Deleuze. A dança e os escritos de bailarinos japoneses inspiraram-no para pensar sobre o corpo a partir do movimento. O encontro desse corpo, pelos autores trazidos por Uno, não se dará de maneira “positiva”, mas pela “transgressão” da razão, pela crueldade do pensamento, pelos interstícios, pelas fissuras, pela realidade que excede o texto. O que interessa a Uno nos autores franceses é a forma como desestabilizam os aspectos mais cartesianos e dogmáticos da filosofia da razão europeia, ou seja, é aquilo que os aproxima do Oriente.

Eripedagoogid ootavad poliitilisi otsuseid / Plado, Kaja; Karlep, Karl; Ostrat, Ain; Maila, Meelika; Binsol, Hene; Kontor, Ana; küsitlenud Martin Krõlov

Index Scriptorium Estoniae

2007-01-01

Eripedagoogide vestlusringis osalevad: Tartu Ülikooli eripedagoogika osakonna juhataja Kaja Plado, emeriitdotsent pedagoogikadoktor Karl Karlep, Tartu Kroonuaia Kooli direktor Ain Ostrat ja õppealajuhataja Meelike Maila, Tartu Hiie Kooli õppealajuhataja Hene Binsol ning Tartu Nõustamis- ja õpiabi keskuse juhataja Ana Kontor

Use of tritium for estimation of groundwater mean residence time, a case study of the Ain Al-Samak Karst springs (Central Syria)

International Nuclear Information System (INIS)

Kattan, Z.

2003-01-01

This work is an attempt to estimate the mean residence time of groundwater in the Ain Al-Tanour and Ain-Samak, which are the major karst springs in the Upper Orontes Basin (Central Syria). This estimate, which consists on the application of a mathematical modeling approach, was based on the use of tritium, as a natural radioisotope tracer and a tool for ground water age dating. By adopting a completely mixed reservoir model, linked with exponential time distribution function, the mean residence time (turnover time) of these two springs was evaluated to be about 50 years. This result is in good agreement with previous estimation obtained for the Figeh main spring, which belongs to the same aquifer (Cenomanian-Turonian complex) in the Damascus Basin. On the basis of this evaluation, a value of about 800 million m 3 was obtained for the maximum groundwater reservoir size

Independent working place on the base of the DVK-2M computer and UNO-4096 analyzer

International Nuclear Information System (INIS)

Zajtsev, M.Yu.; Balandin, A.F.

1987-01-01

Independent working place on the base of the DVK-2M microcomputer and UNO-4096-90 analyzer, designated for investigations of the field of reactor and protection physics is described. Two ways of the analyzer connection with the DVK-2M microcomputer are suggested : by means of CAMAC system or direct connection of UNO-analyzer with the DVK-2M processor

Academic Advising at UNO. Report of the 1991 Student Survey.

Science.gov (United States)

Crawford, A. E.

1991-01-01

A study was done of student perception of academic advising at the University of Nebraska, Omaha (UNO). The study surveyed 638 students who participated in the early registration process for the Fall 1991 semester. Of those students, 269 were men and 369 were women and 8.3 percent were members of a minority group. The study instrument was the…

Comparative experimental evaluation of the efficacy of Prostamol Uno and Samprost on rat model of chronic aseptic prostate inflammation.

Science.gov (United States)

Pahomova, A V; Borovskaja, T G; Fomina, T I; Ermolaeva, L A; Vychuzhanina, A V; Rumpel, O A; Granstrem, O K; Baranova, O V

2011-11-01

Comparative experimental evaluation of the efficiency of prostatotropic drugs Prostamol Uno and Samprost on the model of the chronic aseptic prostate inflammation in rats was performed. It was established that peptide drug Samprost decelerates sclerotic processes in the prostate gland to a greater extent than herbal preparation Prostamol Uno. Both products equally stimulate secretory activity of the gland. Prostamol Uno, unlike Samprost, prevents the development of reduced sexual motivation, one of the complications of chronic prostatitis.

Kas uus töölepingu seaduse eelnõu on õnnestunud? / Olga Aasav, Arno Arukask, Ain Tammvere...[jt.] ; interv. Martin Pau

Index Scriptorium Estoniae

2008-01-01

Vastavad restoranklubi Atlantis tegevjuht Olga Aasav, ametiühingute keskliidu osakonnajuhataja Arno Arukuusk, AS Estiko Investeeringud juhataja Ain Tammvere, Tartu Ülikooli ametiühingu esimees Aleksander Jakobson, AS Samelin tegevdirektor Leida Kikka, AS Enics Eesti tegevjuht Kalle Kuusik, personalispetsialist Lea Oras ja Tartu Tarbijate Kooperatiivi juhatuse esimees Tarmo Punger

Overexploitation and cumulative drought trend effect on Ras El Ain karstic spring discharge (Khabour Sub-basin, Syria)

Science.gov (United States)

Abou Zakhem, Boulos; Kattaa, Bassam

2017-10-01

The effects of climate change and overexploitation are being strongly perceived in the studied area and the springs discharge is obviously affected. In this paper, Ras El Ain spring discharge and precipitation were analyzed by normalized methods on an yearly timescale. The deficit of Ras El Ain spring discharge due to overexploitation factors and drought effects was estimated. Cumulative drought analyses were carried out using SPI10 and SQI10. Finally, the decreasing trends of the spring discharge due to the deficiency in rainfall were analyzed. The main results reveal that the annual mean deficit of Ras El Ain spring discharge due to overpumping was between 32 and 45%, whereas, annual mean deficit related to drought was between 22 and 35% on average, during the last 30 years (post-1984). The moving averages of SPI and SQI delineate very well the drought periods during last three decades. The cumulative droughts using SPI10 and SQI10 reveal that wet period (pre-1984) with positive values was characterized by high precipitation and spring discharge. Overexploitation period (1984-1989) is distinguished by decreasing SQI10 values whereas, SPI10 is almost stable. The response of the karst system to the precipitation signal has been changed, during the drought period (1990-2000), and the spring behaviour has been modified due to the first overexploitation period. Finally, overexploitation period (2001-2008) is related to the second phase of groundwater intensive pumping for irrigation purposes. Consequently, this period is completely catastrophic causing the drying up of the spring. The decreasing trends analyzed using DPI and DQI showed annual decreasing rates relative to the mean values of -0.268% and -0.105%, respectively. Thus, the results of theoretical model reveal that precipitation will decrease by about DPI = -20.7% and the discharge will decline by about -9.2% by 2050. Consequently, the declining discharge due to climatic variation under natural conditions as

Modelling rainfall runoff relations using HEC-HMS in a semi-arid region: Case study in Ain Sefra watershed, Ksour Mountains (SW Algeria

Directory of Open Access Journals (Sweden)

Derdour Abdessamed

2018-03-01

Full Text Available Ain Sefra is one of the Algerian cities that had been experienced several devastating floods during the past 100 years. The purpose of this study is to simulate runoff in the semi-arid region of Ain Sefra watershed through the employing of the Hydrologic Engineering Center – Hydrologic Modelling System (HEC-HMS. In this paper, the frequency storm is used for the meteorological model, the Soil Conservation Service – curve number (SCS-CN is selected to calculate the loss rate and Soil Conservation Service unit hydrograph method have been applied to simulate the runoff rate. After calibration and validation, the simulated peak discharges were very close with observed values. The Nash–Sutcliffe efficiency coefficient was 0.95, indicates that the hydrological modeling results are satisfactory and accepted for simulation of rainfall-runoff. The peak discharges obtained for the 10, 50, 100 and 1000 year storms are respectively 425.8, 750.5, 904.3 and 1328.3 m3∙s−1.

Comparative study of numerical schemes of TVD3, UNO3-ACM and optimized compact scheme

Science.gov (United States)

Lee, Duck-Joo; Hwang, Chang-Jeon; Ko, Duck-Kon; Kim, Jae-Wook

1995-01-01

Three different schemes are employed to solve the benchmark problem. The first one is a conventional TVD-MUSCL (Monotone Upwind Schemes for Conservation Laws) scheme. The second scheme is a UNO3-ACM (Uniformly Non-Oscillatory Artificial Compression Method) scheme. The third scheme is an optimized compact finite difference scheme modified by us: the 4th order Runge Kutta time stepping, the 4th order pentadiagonal compact spatial discretization with the maximum resolution characteristics. The problems of category 1 are solved by using the second (UNO3-ACM) and third (Optimized Compact) schemes. The problems of category 2 are solved by using the first (TVD3) and second (UNO3-ACM) schemes. The problem of category 5 is solved by using the first (TVD3) scheme. It can be concluded from the present calculations that the Optimized Compact scheme and the UN03-ACM show good resolutions for category 1 and category 2 respectively.

Analysis of Urban Expansion of the Resort City of Al Ain Using Remote Sensing and GIS

Science.gov (United States)

Issa, S.; Al Shuwaihi, A.

2009-12-01

The urban growth of AL Ain city has been investigated using remote sensing data for three different dates, 1972, 1990 and 2000. We used three Landsat images together with socio-economic data in a post-classification analysis to map the spatial dynamics of land use/cover changes and identify the urbanization process in Al Ain resort city, United Arab Emirates. Land use/cover statistics, extracted from Landsat Multi-spectral Scanner (MSS). Thematic Mapper (TM) and Enhanced Thematic Mapper plus (ETM +) images for 1972. 1990 and 2000 respectively, revealed that the built-up area has expanded by about 170.53km2. The city was found to have a tendency for major expansion in four different directions: along the Abu Dhabi highway, along Dubai highway, Myziad direction and Hafeet recreational area. Expansion in any direction was found to be governed by the availability of road network, suitability for construction, utilities, economic activities, geographical constraints, and legal factors (boundary with Sultanate of Oman). The road network in particular has influenced the spatial patterns and structure of urban development, so that the expansion of the built-up areas has assumed an accretive as well as linear growth along the major roads. The research concludes that the development is based on conservation of agricultural areas (oases) and reclamation of the desert for farming and agricultural activities. The integration of remote sensing and GIS was found to be effective in monitoring LULC changes and providing valuable information necessary for planning and research.

Implementation of TiAIN and CrN coatings and ion implantation in the modern plastics moulding industry

International Nuclear Information System (INIS)

Bienk, E.J.; Mikkelsen, N.J.

1997-01-01

Two methods of surface improvement widely used in the modern plastics industry are compared, with a view to improving productivity and product quality. Ion implantation of plastics and physical vapour deposition coatings both offer surface engineering advantages. Each method is described and evaluated with reference to plastics moulding. TiAIN coatings are used to protect hard bulk materials, subjected to evenly distributed loads. The more ductile CrN coatings are used for softer materials which give less support to the coatings. (UK)

Aine või toote ravimina määratlemine Eestis Euroopa Liidu õiguse valguses : [magistritöö] / Kaili Lellep ; Tartu Ülikool, õigusteaduskond ; juhendaja Ants Nõmper

Index Scriptorium Estoniae

Lellep, Kaili

2010-01-01

Aine või toote määratlemisest toiduna, kosmeetikatootena, meditsiiniseadmena, ravimina. Määratlustest Eestis ja nende vastavusest Euroopa Liidu õigusega, määratluste tagajärgedest, ettepanekutest vastuolulise õigusakti muutmiseks

Making Americans: UNO Charter Schools and Civic Education. Policy Brief 6

Science.gov (United States)

Feith, David

2013-01-01

This policy brief is the third in a series of in-depth case studies exploring how top-performing charter schools have incorporated civic learning in their school curriculum and school culture. The UNO Charter School Network includes 13 schools serving some 6,500 students across Chicago. Located in predominantly Hispanic neighborhoods, the…

Respuesta a la carta al editor en relación al artículo: “Estrategia de uno en uno para mejorar la técnica correcta de higiene de manos”

Directory of Open Access Journals (Sweden)

Hilda Guadalupe Hernández Orozco

2018-01-01

Full Text Available En respuesta a la carta enviada por Antonella Carpio-Rodríguez y Sofía Mercado-Gonzáles del trabajo: “Estrategia de uno en uno para mejorar la técnica correcta de higiene de manos”, publicado en el volumen 38, numero 5, le comentamos que el personal de la unidad de vigilancia epidemiológica se refiere a una enfermera del Comité, por lo cual no se requirió realizar concordancia y calibración del evaluador; sin embargo, su segundo comentario sobre el sesgo del observador no se controló. En el estudio se describe que el personal evaluador acude al servicio y observa la técnica en el personal en ese momento.

Evaluation of the clinical maxim: "If it ain't broke, don't fix it".

Science.gov (United States)

Howell-Duffy, Chris; Hrynchak, Patricia K; Irving, Elizabeth L; Mouat, Graham S V; Elliott, David B

2012-01-01

A significant number of patients return to optometric practice dissatisfied with their spectacles. An important question is whether any of these cases are preventable. There are several different clinical maxims that are used to modify the subjective refraction when determining the refractive prescription. These maxims aim to improve patient comfort and adaptation and thereby reduce patient dissatisfaction with new spectacles. They are not based on research evidence, but rather on expert opinion gained from clinical experience. The aim of this study was to retrospectively analyze a large number of case records of dissatisfied patients to assess the possible usefulness of the prescribing maxim "if it ain't broke, don't fix it." Three hundred eighteen non-tolerance cases from a university-based Canadian optometric clinic were categorized by a focus group of optometrists. Three prescribing categories were defined and comprised cases in which application of the proposed maxim may have prevented the recheck eye examination; a more limited application of the maxim for one working distance may have been appropriate; and finally scenarios in which the maxim did not work in that the practitioner was judged to have initially followed the maxim, yet patient dissatisfaction was still reported. The remaining unallocated records comprised prescribing situations outside the scope of this study. Approximately 32% of non-tolerance cases were judged to have been preventable by use of the proposed maxim. Furthermore, an additional 10% reduction in recheck cases may have been possible by a more liberal interpretation of the maxim. Conversely, 4% of cases were deemed to comprise scenarios in which the maxim was followed yet the patient returned later to report problems with their spectacles. The prescribing maxim "if it ain't broke, don't fix it" appears to have a role in reducing recheck eye examinations and improving patient satisfaction with new spectacles.

Impact of Dietary, Socioeconomic, and Physical Factors on Obese and Overweight Schoolchildren Living in Sidi-Bel-Abbes (West of Algeria and Ain Defla (Centre

Directory of Open Access Journals (Sweden)

Didaoui Hayat

2018-03-01

Full Text Available Background and aims: The aim of the current study was to assess the impact of environmental factors; food, socio-economic, and physical activity, on a group of obese children living in Ain-Defla (Center Algeria and Sidi-Bel-Abbes (West Algeria.

Automated hydroponics nutrition plants systems using arduino uno microcontroller based on android

Science.gov (United States)

Sihombing, P.; Karina, N. A.; Tarigan, J. T.; Syarif, M. I.

2018-03-01

Technological developments today make the combination of science is very common, including in Computer Science and Agriculture to make both of science need each other. This paper aims to develop a control tool for the flow of nutrients of hydroponic plants automatically using Arduino microcontroller and controlled by smartphone. We use an Arduino Uno microcontroller to automatically control the flow of nutrient solution with logic if else. The microcontroller can also send data of fluid level (solution) and temperature around the plant to smartphone android of the owner of the hydroponics plant. The height of the nutrient solution (water) is detected by the Ultrasonic sensor HC-SR04 and the temperature is detected by the temperature sensor LM35. Data from the sensor will forward into Arduino Uno and displayed in liquid crystal display (LCD) then via wireless fidelity (WIFI) ESP8266 module will transmit the height of the nutrient solution and the temperature around of the plants to Android smartphone.

Mis tuleb

Index Scriptorium Estoniae

2005-01-01

Pärnu Uue Kunsti Muuseumis Uno Roosvaldi maalide ja graafika näitus "Mõttes Kihnus", Heino Lillepuu kollaazhide näitus "Kõik naised on inglid". Tartu Mänguasjamuuseumis jõuluehete näitus. Rahvusraamatukogu fuajees Andy Horneri näitus "Terra Borealis". Eesti Rahva Muuseumis näitus "Põhjamaine tunnetus", mis tutvustab Sleipneri stipendiumi saanud noorte kunstnike valiktöid. Iisaku muuseumis jõulupostkaartide näitus. Eesti Tarbekunsti- ja Disainimuuseumis näitus "Klaashelmed maailma rahvaste kultuuris" (suur osa helmeist ja helmetikandeist on Torben Sode kogust). Rottermanni soolalaos näitus "Kodu, kallis kodu". Viljandi muuseumis on väljas EKA nahakunsti osakonna tööd aastaist 1917-2004 "Mälu ja mäng", Eesti lapitööseltsi näitus, Viljandi maagümnaasiumi kunstistuudio näitus "Jõulusokk". Eesti Meremuuseumis näitus"Klaas, fajanss ja portselan uppunud laevadelt"

Fracaso renal agudo secundario a combinación de inhibidores del sistema renina-angiotensina, diuréticos y AINES. “La Triple Whammy”1

Directory of Open Access Journals (Sweden)

Rosa Maria Garcia Camin

2015-03-01

Conclusiones: El tratamiento con IECA, ARA II, diuréticos y/o AINES presenta elevada incidencia de ingreso por FRA, siendo los diuréticos en monoterapia, doble y triple terapia combinada los que ocasionan la mayor incidencia. El FRAETW supone elevados costes sanitarios y muertes evitables.

TEM and XANES study of MOVPE grown InAIN layers with different indium content

International Nuclear Information System (INIS)

Kret, S; Wolska, A; Klepka, M T; Letrouit, A; Ivaldi, F; Szczepańska, A; Carlin, J-F; Kaufmann, N A K; Grandjean, N

2011-01-01

We present structure and spatially resolved composition studies by TEM (Transmission Electron Microscopy) and XANES (X-ray Absorption Near Edge Structure) of InAIN MOVPE (Metal-Organic Vapor Phase Epitaxy) epilayers containing 16-27 at% of indium. Investigations of the In L 3 edge by synchrotron radiation absorption show a significant change of the post-edge structure depending on the indium content. We attribute this to the solubility limit and phase separation in this system. Our measurements suggest that the critical composition is 18% for our growth conditions. HRTEM cross-sectional and EDX investigations confirm such phase separation as well as the changing of the structure from 2D growth to columnar like growth for the sample with the highest indium content.

Detection of Lock on Radar System Based on Ultrasonic US 100 Sensor And Arduino Uno R3 With Image Processing GUI

Science.gov (United States)

Baskoro, F.; Reynaldo, B. R.

2018-04-01

The development of electronics technology especially in the field of microcontroller occurs very rapidly. There have been many applications and useful use of microcontroller in everyday life as well as in laboratory research. In this study used Arduino Uno R3 as microcontroller-based platform ATMega328 as a sensor distance meter to know the distance of an object with high accuracy. The method used is to utilize the function Timer / Counter in Arduino UNO R3. On the Arduino Uno R3 platform, there is ATMEL ATmega328 microcontroller which has a frequency generating speed up to 20 MHz, 16-bit enumeration capability and using C language as its programming. With the Arduino Uno R3 platform, the ATmega328 microcontroller can be programmed with Arduino IDE software that is simpler and easier because it has been supported by libraries and many support programs. The result of this research is distance measurement to know the location of an object using US ultrasonic wave sensor US 100 with Arduino Uno R3 based on ATMega328 microcontroller which then the result will be displayed using Image Processing.

El Cambio de Actitudes hacia Uno Mismo en el Contexto Organizacional: El Efecto del Formato de Pensamiento

OpenAIRE

Beatriz Gandarillas; Pablo Briñol

2010-01-01

La visión que tienen las personas de sí mismas influye sobre distintos comportamientos organizacionales. Por tanto, resulta esencial entender cómo se pueden modificar las actitudes hacia uno mismo tanto en el contexto personal como el organizacional. El cambio de actitudes depende fundamentalmente de la dirección (favorable o desfavorable) de los pensamientos con respecto a uno mismo. En el presente trabajo se propone estudiar, además de la dirección, también el formato de dichos pensamientos...

Management of toxic cyanobacteria for drinking water production of Ain Zada Dam.

Science.gov (United States)

Saoudi, Amel; Brient, Luc; Boucetta, Sabrine; Ouzrout, Rachid; Bormans, Myriam; Bensouilah, Mourad

2017-07-01

Blooms of toxic cyanobacteria in Algerian reservoirs represent a potential health problem, mainly from drinking water that supplies the local population of Ain Zada (Bordj Bou Arreridj). The objective of this study is to monitor, detect, and identify the existence of cyanobacteria and microcystins during blooming times. Samples were taken in 2013 from eight stations. The results show that three potentially toxic cyanobacterial genera with the species Planktothrix agardhii were dominant. Cyanobacterial biomass, phycocyanin (PC) concentrations, and microcystin (MC) concentrations were high in the surface layer and at 14 m depth; these values were also high in the treated water. On 11 May 2013, MC concentrations were 6.3 μg/L in MC-LR equivalent in the drinking water. This study shows for the first time the presence of cyanotoxins in raw and treated waters, highlighting that regular monitoring of cyanobacteria and cyanotoxins must be undertaken to avoid potential health problems.

Central and South America GPS geodesy - CASA Uno

Science.gov (United States)

Kellogg, James N.; Dixon, Timothy H.

1990-01-01

In January 1988, scientists from over 25 organizations in 13 countries and territories cooperated in the largest GPS campaign in the world to date. A total of 43 GPS receivers collected approximately 590 station-days of data in American Samoa, Australia, Canada, Colombia, Costa Rica, Ecuador, New Zealand, Norway, Panama, Sweden, United States, West Germany, and Venezuela. The experiment was entitled CASA Uno. Scientific goals of the project include measurements of strain in the northern Andes, subduction rates for the Cocos and Nazca plates beneath Central and South America, and relative motion between the Caribbean plate and South America. A second set of measurements are planned in 1991 and should provide preliminary estimates of crustal deformation and plate motion rates in the region.

CASA Uno GPS orbit and baseline experiments

Science.gov (United States)

Schutz, B. E.; Ho, C. S.; Abusali, P. A. M.; Tapley, B. D.

1990-01-01

CASA Uno data from sites distributed in longitude from Australia to Europe have been used to determine orbits of the GPS satellites. The characteristics of the orbits determined from double difference phase have been evaluated through comparisons of two-week solutions with one-week solutions and by comparisons of predicted and estimated orbits. Evidence of unmodeled effects is demonstrated, particularly associated with the orbit planes that experience solar eclipse. The orbit accuracy has been assessed through the repeatability of unconstrained estimated baseline vectors ranging from 245 km to 5400 km. Both the baseline repeatability and the comparison with independent space geodetic methods give results at the level of 1-2 parts in 100,000,000. In addition, the Mojave/Owens Valley (245 km) and Kokee Park/Ft. Davis (5409 km) estimates agree with VLBI and SLR to better than 1 part in 100,000,000.

Antiinflamatorios no esteroideos (AINES.: Consideraciones para su uso estomatológico

Directory of Open Access Journals (Sweden)

Andrés A. Pérez Ruiz

2002-08-01

Full Text Available Se realiza una revisión extensa y actualizada sobre los antiinflamatorios no esteroideos (AINEs, con el fin de actualizar al estomatólogo en su uso. Para ello se revisan aspectos importantes del proceso inflamatorio en estructuras de la boca que como las pulpitis, presentan sus peculiaridades. Se identifica a una de las 2 familias de autacoides provenientes de los fosfolípidos de membrana celular, es decir, los eicosanoides derivados a partir de algunos ácidos grasos polisaturados, en particular, ácido araquidónico, que tras la acción de enzimas da lugar a la formación de prostaglandinas, prostaciclinas, tromboxeno A2 y leucotrienos. Conocidos estos antecedentes, nos ocupamos de fármacos usados para combatir los síntomas y signos de la inflamación. Casi todos los antiinflamatorios no esteroideos utilizados en la actualidad, casi todos, inhiben las actividades de la ciclooxigenasa 1 constitutiva y la ciclooxigenasa 2, inducida en el sitio de la inflamación y con ello, la síntesis de prostaglandinas y tromboxanos. Se alude a la ventaja terapéutica de los inhibidores de la COX-2 que aparecen hoy en el mercado. Se expone las dosis y frecuencias de los AINEs, sus interacciones, así como las reacciones adversas al medicamento y contraindicaciones, y se proponen aquellos que son de interés en la práctica estomatológica.Non-steroidal anti-inflammatory drugs. Considerations about their dental use. An extensive updated review of non-steroidal anti-inflammatory agents (NSAIN was made to give an updated information to the dentist about their use. To this purpose, important aspects of the inflammatory process in mouth structures like pulpitis that present with their own peculiarities are reviewed. We identified one of the two autacoid families from cell membrane phospholipids, that is, eicosanoids derived from some polysaturated fatty acids, in particular, arachidonic acid, which, after the action of enzymes, give rise to the formation of

Stacking up against Alternative Conceptions: Using Uno Cards to Introduce Discourse and Argumentation

Science.gov (United States)

Dunac, Patricia S.; Demi, Kadir

2013-01-01

We engaged secondary science students in a teacher and student constructed Uno card game (UCG) to change their conceptual understanding of the various energy transformations. The paper outlines how we incorporated Toulmin's argumentation pattern (Toulmin 1958 "The Uses of Argument"(Cambridge: Cambridge University Press)) in the UCG,…

Behaviors, Attitudes and Knowledge of UNO Students Regarding Drugs, Alcohol and Tobacco: 1989.

Science.gov (United States)

Hunnicutt, David; Davis, Joe

1989-01-01

This report describes alcohol, tobacco, and other drug use among 715 University of Nebraska at Omaha (UNO) students. The report focuses on drug use at the higher frequency levels, rather than reporting proportions who have ever used various drugs. The separate classes of drugs distinguished are alcohol, tobacco, cocaine, marijuana, and…

El Número Uno, una Retrospectiva Conceptual.

Directory of Open Access Journals (Sweden)

Alejandro Garciadiego Dantan

2012-02-01

Full Text Available The objective of this essay is to show how the concept of number ‘one’ has changed, from its initial formal definition in Euclid’s The Elements until very recently. Some of these changes are mathematical, others are philosophical, and others are historical in character. This retrospective of the concept of number ‘one’ implies that the history of mathematics is much more complex and rich than that which is suggested by our intuition when we limit ourselves to a unique, lineal and continuous mathematics. El objetivo de este ensayo es mostrar cómo es que el concepto de número ‘uno’ ha cambiado, desde que se definió de manera formal en Los Elementos de Euclides hasta hace relativamente unos cuantos años. Algunos de estos cambios son de naturaleza matemática, otros filosófica y otros histórica. Esta retrospectiva del concepto de número ‘uno’ implica que la historia de las matemáticas es mucho más compleja y rica que la que nuestra intuición nos sugiere, cuando nos limitamos a una matemática única, lineal y continua.

Pengenalan dan Analisis Ucapan pada Sistem Kontrol Perangkat Listrik Menggunakan Arduino Uno

Directory of Open Access Journals (Sweden)

Dania Eridani

2018-01-01

Full Text Available This study aims to develop an electrical device control system using speech recognition and perform the analysis factors that affect the accuracy of speech recognition. The system used the Arduino Uno as the main control board of the system, an Elechouse's voice recognition module as speech processing device and several output devices such as relays, LEDs and an LCD. This research resulted in 92,7% accuracy of speech recognition at the ideal condition and 66,85% at the noise condition. This study shows that the frequency, amplitude, slow tempo and timbre of command speech greatly affect the success of speech recognition. Penelitian ini bertujuan untuk mengembangkan sistem pengendali perangkat listrik menggunakan pengenalan ucapan dan melakukan analisis faktor yang mempengaruhi akurasi dari pengenalan ucapan. Sistem menggunakan papan Arduino Uno sebagai pusat kendali sistem, modul pengenal ucapan dari Elechouse dan beberapa perangkat keluaran seperti relay, LED dan LCD. Penelitian ini menghasilkan akurasi pengenalan ucapan sebesar 92,7% pada kondisi ideal dan 66,85% pada kondisi berderau. Penelitian ini menunjukkan bahwa frekuensi, amplitudo, tempo yang lambat dan timbre ucapan perintah sangat mempengaruhi pengenalan ucapan.

Toidutööstus panustab detsembris jõulutoodetele. Pühad toovad käibelisa / Ain Alvela, Ketlin Rauk ; kommenteerinud Ruth Roht, Marek Viilol, Simmo Kruustük, Imre Sokk

Index Scriptorium Estoniae

Alvela, Ain, 1967-

2011-01-01

Spetsiaalsed jõulutooted aitavad aasta lõpul suurendada toiduainetööstuste käivet. ASi Atria Eesti müügi- ja turundusdirektori Margus Masingu, ASi Fazer Eesti juhatuse esimehe Kristjan Kongo ja ASi Salvest turundusdirektori Ain Nõlvaku kommentaare

Madame Olga Givernet, Députée de la 3ème circonscription de l’Ain, République française, vendredi 16 février 2018

CERN Multimedia

Caraban Gonzalez, Noemi

2018-01-01

Madame Olga Givernet Députée 3ème circonscription de l’Ain. Participants CERN, Signature du livre d’or. M. Frédérick Bordry Directeur des accélérateurs et de la technologie Mme Fabiola Gianotti Directrice générale

Those Who Graduate: A Brief Look at the UNO Graduating Class of 1986.

Science.gov (United States)

Crawford, A. E.

1989-01-01

The University of Nebraska at Omaha (UNO) conducted a study of 1,358 bachelor's degree graduates of the class of 1986 to examine two factors: (1) age at entrance and graduation, and (2) length of time required for graduation from several specified beginning points. The study required four sets of data: demographic, age related data, time-frame…

Narkootilise ja psühhotroopse aine suures koguses ebaseaduslik käitlemine suure varalise kasu saamise eesmärgil : [magistritöö] / Kerli Lepik ; Tartu Ülikool, õigusteaduskond ; juhendaja: Jaan Ginter

Index Scriptorium Estoniae

Lepik, Kerli, 1989-

2013-01-01

Suures koguses narkootilise ja psühhotroopse aine käsitlemisest, suure varalise kasu saamise eesmärgist, võrdlus teiste Euroopa riikidega (EL, Läti, Leedu, Soome, Norra, Tšehhi), suurest varalisest kasust kui koosseisutunnusest ja alternatiividest

Application of electrical geophysics to the release of water resources, case of Ain Leuh (Morocco)

Science.gov (United States)

Zitouni, A.; Boukdir, A.; El Fjiji, H.; Baite, W.; Ekouele Mbaki, V. R.; Ben Said, H.; Echakraoui, Z.; Elissami, A.; El Maslouhi, M. R.

2018-05-01

Being seen needs in increasing waters in our contry for fine domestics, manufactures and agricultural, the prospecting of subterranean waters by geologic and hydrogeologic classic method remains inaplicable in the cases of the regions where one does not arrange drillings or polls (soundings) of gratitude (recongnition) in very sufficient (self-important) number. In that case of figure, the method of prospecting geophysics such as the method of nuclear magnetic resonance (NMR) and the method of the geophysics radar are usually used most usually because they showed, worldwide, results very desive in the projects of prospecting and evaluation of the resources in subterranean waters. In the present work, which concerns only the methodology of the electric resistivity, we treat the adopted methodological approach and the study of the case of application in the tray of Ajdir Ain Leuh.

Through Education into the World of Work. Uno Cygnaeus, the Father of Technology Education.

Science.gov (United States)

Kantola, Jouko; Nikkanen, Pentti; Kari, Jouko; Kananoja, Tapani

More than 100 years have passed since the death of Uno Cygnaeus (1810-1888), the father of Finnish folk schools and pioneer of educational arts and crafts. His accomplishments include design and organization of the folk school system, initiation of high class teacher training, and emphasis on the importance of women's education. Although his…

Water-rock interaction and geochemistry of groundwater from the Ain Azel aquifer, Algeria.

Science.gov (United States)

Belkhiri, Lazhar; Mouni, Lotfi; Tiri, Ammar

2012-02-01

Hydrochemical, multivariate statistical, and inverse geochemical modeling techniques were used to investigate the hydrochemical evolution within the Ain Azel aquifer, Algeria. Cluster analysis based on major ion contents defined 3 main chemical water types, reflecting different hydrochemical processes. The first group water, group 1, has low salinity (mean EC = 735 μS/cm). The second group waters are classified as Cl-HCO(3)-alkaline earth type. The third group is made up of water samples, the cation composition of which is dominated by Ca and Mg with anion composition varying from dominantly Cl to dominantly HCO(3) plus SO(4). The varifactors obtained from R-mode FA indicate that the parameters responsible for groundwater quality variations are mainly related to the presence and dissolution of some carbonate, silicate, and evaporite minerals in the aquifer. Inverse geochemical modeling along groundwater flow paths indicates the dominant processes are the consumption of CO(2), the dissolution of dolomite, gypsum, and halite, along with the precipitation of calcite, Ca-montmorillonite, illite, kaolinite, and quartz. © Springer Science+Business Media B.V. 2011

UnoHop: Efficient Distributed Hash Table with O(1 Lookup Performance

Directory of Open Access Journals (Sweden)

Herry Sitepu

2008-05-01

Full Text Available Distributed Hash Tables (DHTs with O(1 lookup performance strive to minimize the maintenance traffic which required for propagating membership changes information (events. These events distribution allows each node in the peer-to-peer network maintains accurate routing tables with complete membership information. We present UnoHop, a novel DHT protocol with O(1 lookup performance. The protocol uses an efficient mechanism to distribute events through a dissemination tree that constructed dynamically rooted at the node that detect the events. Our protocol produces symmetric bandwidth usage at all nodes while decreasing the events propagation delay.

Jõekääru Jazz täitis eesmärgi nii korraldajate, esinejate kui publiku poolelt / Allan Liik, Hedvig Hanson, Andre Maaker, Ain Agan...[jt.] ; foto ja küsitl. Kaire Tensuda

Index Scriptorium Estoniae

2007-01-01

Jõekääru Jazz'ile järgneval nädalal tõi ürituse peakorraldaja Allan Liik toimetusse seal esinenud muusikud. Vestlusringis olid: Allan Liik, Hedvig Hanson, Andre Maaker, Ain Agan, Raivo Tafenau ja Sergio Bastos

Il De uno alla luce dell’Exemplum tractatus de iustitia universali, sive de fontibus iuris di Francis Bacon

Directory of Open Access Journals (Sweden)

Romana Bassi

2016-11-01

Full Text Available [Reading “De uno” in light of Francis Bacon’s “Exemplum tractatus de iustitia universali, sive de fontibus iuris”]. Although Vico was admittedly disappointed by Bacon’s Exemplum tractatus, a parallel reading of this text and De uno can provide insights as to how Vico ended up having to confront a series of issues: how does the universal law project itself into history? Where does the law stem from? Is there a link between law, occasion, and utility? What are the sources and the scope of authority? How does violence affect the law? What role for religion and piety? How to devise a philology for the laws and ancient fables? Bacon’s scattered aphorisms offer glimpses into problems which find a solution in the all-encompassing order of De uno.

Modeling And Simulation Of Electrical Prevenion System Using Arduino Uno,Gsm Modem, And Acs712 Current Sensor

Science.gov (United States)

Khair, Ummul; Jabbar Lubis, Abdul; Agustha, Indra; Dharmawati; Zulfin, M.

2017-12-01

The current electricity needs is very primary, all objects including electronics require power, it encourages people not to be able to save electricity so the theft of electric power would be done. The use of ACS712 current sensor as the sensor with arduino uno would find out the power consumption continuously and prevent the theft of electricity because of the use of electricity which has been determined by PLN and the people fetl that it is not enough for every house, so the author made a tool for prevention of theft of electric power by using the arduino uno, buzzer, ACS712 current sensor, lcd, and relay then the power usage can be controlled according to the use to prevent the occurrence of theft of electricity so the use can be seen directly on the lcd 16x2and GSM modem to give information to employees of PLN so that it can reduceelectrical theft by the public.

Missugustes virtuaalsetes võrgustikes sina kaasa lööd? / Johanna Helin, Mart Laanpere, Uno Traat ... [jt.

Index Scriptorium Estoniae

2008-01-01

Küsimusele vastavad maailmahariduse projekti "Vaata ja muuda!" juht Johanna Helin, TLÜ haridustehnoloogia keskuse juhataja Mart Laanpere, Sisekaitse Akadeemia kriminoloogia õppejõud Uno Traat, TLÜ Haapsalu kolledži direktor Eve Eisenschmidt, Kose Gümnaasiumi saksa keele õpetaja Astrid Sildnik, TÜ füüsika instituudi dotsent Toomas Plank

Evaluation of the impact of water harvesting techniques on the evolution of piezometric head of Ain El Bidha groundwater in Kairouan at the Central part of Tunisia

Science.gov (United States)

Mechergui, M. Mohamed; Henda Saoudi, Mme

2016-04-01

This study aims to assess the impact of water harvesting constructed hydraulic structures (big and small dams, terraces, seuils for recharge…) on the evolution of piezometric head of Ain El Beidha groundwater table. The measurements of depth of water table, taken at the end of rain season and at the end of irrigation season, in many piezometers and monitoring wells, for a long period of observation before and after implementation of all the hydraulic structures, were used with the cumulative rain to the highest water table to diagnostic the effect of natural recharge and constructed hydraulic structures. According to the analysis of curves illustrating the evolution of piezometric head and rainfall over time, it was shown that despite the fact that the same amount of rain fall on the total area in the limits of Ain El Beidha groundwater table, the piezometers respond differently. This is because there are many sources of recharge and many factors affecting the recharge. First of all, the aquifer is divided in four compartments (the calcareous formation of Djebel El Houyareb, the plio-quaternary formation, the Miocene formation: Baglia and Saouaf). All those respond differently to the recharge by their capacity of infiltration and their hydrodynamic characteristics. The recharge of the groundwater table was increased by the implementation of small soil and water conservation structures, artificial lakes, El Haouareb Dam, run off in the natural Oued bads and seuils for recharge installed in the bads of oueds. The different piezometric drown maps were used to determine the flow direction and hydraulic gradient in order to identify the recharge areas, while tracking maps for three equal piezometric heads 210 m 300 m and 370 m established over different years made it possible to assess the impact of hydraulic structures, namely the effect of SWC and Ben Zitoun Lake. To illustrate the impact of El Houareb dam on the groundwater, the piezometric maps and local values

Climate change and their consequences on coastal zone of Ain el Turck in Oran

Directory of Open Access Journals (Sweden)

Mohammed Tewfik Bouroumi

2017-12-01

Full Text Available Algeria does not escape the problem of the climate change, its geographical position in zone of transition, and its dry and semi-arid climate, in fact a very vulnerable space. In Algeria, approximately two thirds of the population is concentrated on the coast which represents only 4 % of the territory. The Mediterranean coast, in particular in Algeria, is subjected to pressures: financial stakes, climatic risks, pollutions and conservation of the water. It is on the basis of the critical and objective report with regard to a wild urbanization of the Algerian coast as well as the influence of the demographic pressure that the choice of the search for this article was held. This publication has for objective to raise (to draw up a current situation (inventory of fixtures of the sector of the environment in Algeria and to present through the case of the coastal city of Oran the consequences of climate change. We propose, to review the situation through the case of the municipality of Ain El Türck, by basing itself on data relative to the evolution of the temperatures and the sea level.

Instrumental Develovement of 50 Meters Free Style Swimming Speed Measurement Based on Microcontroller Arduino Uno

Science.gov (United States)

Badruzaman; Rusdiana, A.; Gilang, M. R.; Martini, T.

2017-03-01

This study is purposed to make a software and hardware instrument in controlling the velocity of 50 meters free style swimming speed measurement based on microcontroller Arduino Uno. The writer uses 6 participants of advanced 2015 college students of sport education. The materials he uses are electronical series of microcontroller Arduino Uno base, laser sensors shone on light dependent resistor, laser receiver functions as a detector of laser cutting block, cables as connector transfering the data. This device consist of 4 installable censors in every 10 meters with the result of swimming speed showed on the monitors using visual basic 6.0 software. This instrument automatically works when the buzzer is pushed and also runs the timer on the application. For the procedure, the writer asks the participants to swim in free style along 50 meters. When the athlete swims, they will cut the laser of every censors so that it gives a signal to stop the running timer on the monitoring application. The output result the writer gets from this used instrument is to know how fast a swimmer swim in maximum speed, to know the time and distance of acceleration and decelaration that happens. The result of validity instrument shows 0,605 (high), while the reliability is 0,833 (very high).

Estudio biofarmacéutico de geles antiinflamatorios no esteroideos (AINES

Directory of Open Access Journals (Sweden)

Margarita Restrepo

2000-02-01

Full Text Available

Los antiinflamatorios no esteroideos (AINES son un grupo heterogéneo de compuestos con actividad analgésica, antipirética y antiinflamatoria que comparten efectos secundarios indeseables, tales como: ulceración gástrica e intestinal, anemia, bloqueo de la agregación plaquetaria, inhibición de la motilidad uterina e hipersensibilidad. Los AINES se utilizan por vía tópica con el fin de aliviar lesiones en tejidos blandos a los cuales puede llegarse directamente a través de la piel, evitando así los efectos colaterales indeseables.

Actualmente para la gran mayoría de los medicamentos se exige valorar la Biodisponibilidad como criterio de calidad. Biodisponibilidad se define como la cantidad de fármaco que llega a sangre o plasma después de la administración del medicamento que lo contiene y la velocidad a la cual este proceso ocurre; esta determinación de Biodisponibilidad no resulta útil en el caso de medicamentos que se administran a través de la piel y no alcanzan circulación sistémica; la biodisponibilidad relativa o Bioequivalencia es la comparación de las biodisponibilidades de dos medicamentos para determinar si son similares en su comportamiento farmacocinético dentro del organismo.

El presente trabajo pretende estandarizar y validar un método que permita determinar concentraciones de fármaco en tejidos, en este tipo de medicamentos administrados por vía tópica, que no alcanzan circulación sistémica y por lo tanto no pueden ser cuantificados en sangre o plasma; además pretendemos que esta metodología pueda ser propuesta como una técnica para determinar biodisponibilidad y/o bioequivalencia para este tipo de productos. Para lograr estos objetivos, inicialmente, se induce la inflamación a un grupo

Basic instinct / Marju Lepajõe

Index Scriptorium Estoniae

Lepajõe, Marju, 1962-

2011-01-01

Arvustus: Franz Kafka. Kirjad Milenale : [autori kirjad M. Jesenskale]. Tallinn : Perioodika, 1996. (Loomingu raamatukogu ; 1996, 27/30) ; Juhan Liiv. Mu kallis Liisi : [kirjad Liisa Goldingule]. Tartu : Ilmamaa, 1996

Vitamin D deficiency among healthy adolescents in Al Ain, United Arab Emirates

Science.gov (United States)

2013-01-01

Background Although vitamin D deficiency has been studied in various adult populations, there are few data on the prevalence of this nutritional deficiency among healthy adolescents in the United Arab Emirates (UAE). This study was conducted to determine the prevalence of vitamin D deficiency and to examine its correlates in adolescents aged 15 to 18 years. Methods This was a cross-sectional study in urban schools. Healthy adolescents (N=315) from a sample of 8 schools were randomly selected from the 142 schools in Al Ain, Abu Dhabi Emirate. Outcomes measured included serum concentrations of 25-hydroxy vitamin D (25OHD), plasma lipids, blood sugar, blood pressure and anthropometric data, nutrition and lifestyle variables. Results Fourty-one participants (19.7%) were vitamin D deficient (serum 25OHD level ≤15 ng/mL [≤37.5 nmol/L]. Using a cutoff level of 25(OH) D of ≤20 ng/ml [≤50 nmol/l] 143 participants (45.4%) were vitamin D insufficient. Overall 65.1% of study participants were either vitamin D deficient or insufficient. The prevalence of vitamin D deficiency varied between boys (10%) and girls (28%). In a final multivariate model, serum 25(OH) D concentrations were inversely correlated with female gender, consumption of fast food per week, and body mass index and positively correlated with physical activity scores after adjustment for age. Conclusions Vitamin D deficiency and insufficiency were highly prevalent in adolescents, and more common in girls. PMID:23311702

Application of a TiAIN coating for the increase wear resistance of a passage floodgate manufactured in steel T9; Aplicacion de un recubrimiento de TiAIN para el incremento de la resistencia al desgaste de una compuerta de paso fabricada en acero T9

Energy Technology Data Exchange (ETDEWEB)

Montes de Oca, J.; Gonzalez, H. J. [Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada, IPN, Unidad Altamira, Km. 14.5 Carretera Tampico-Puerto industrial Altamira, 89600 Altamira, Tamaulipas (Mexico); Solis, E. [Hy-Teck Fluid Power, Blvd. A. Lopez Mateos No. 310, Col. Nuevo Aeropuerto, 89337 Tampico, Tamaulipas (Mexico); Moreno, J. [Departamento de Ingenieria Metalurgica, Escuela Superior de Ingenieria Quimica e Industrias Extractivas, IPN, UPALM Unidad Zacatenco, 07730 Mexico D. F. (Mexico); Munoz S, J. [Centro de Investigacion y de Estudios Avanzados, Unidad Queretaro, Libramiento Norponiente No. 2000, Fracc. Real de Juriquilla, 76230 Santiago de Queretaro, Queretaro (Mexico)], e-mail: jmontedeocav@ipn.mx

2009-07-01

The present work reports a study to increase wear resistance of a ball passage floodgate (steel type T9) trough the application of a thick film (coating). This study have included a material and process selection, synthesis of the coating on steel plates as substrates and spherical device, assembling of the coated floodgate on the ball valves, and finally an evaluation of the valves in the process of a thermoelectric power station. Taking into account the different requirements, a TiAIN coating prepared by cathodic arc evaporation was finally retained. The crystal structure, morphology and chemical composition of the coating were evaluated by x-ray diffraction (XRD) and scanning electron microscopy equipped with an energy dispersive spectrometer (SEM-EDS). Finally, mechanical properties such as hardness and Young modulus were determined by nano indentation. (Author)

I Giochi del Mediterraneo. Uno strumento per una possibile integrazione sociale e culturale?

Directory of Open Access Journals (Sweden)

Gian Luigi Corinto

2015-11-01

Full Text Available Uno spazio geopolitico importante per le relazioni estere dell'Italia è senza dubbio ilMediterraneo (de Leonardis 2003, anche se la contrapposizione tra vocazioneeuropea e mediterranea, europeismo e mediterraneismo, è una costante della politicaestera italiana (Varsori 2003. Tale situazione duale deriva non soltanto dalla posizionegeografica ma anche dal fatto che l'area mediterranea è stata instabile e carica ditensione fino al secondo dopoguerra e lo è rimasta dalla fine del mondo bipolare(Colombo 2003. Il Sud si è trasformato nel luogo principe di improbabili e imminentisfide alla sicurezza del dopo Guerra fredda, così come di instabilità politica e di conflittilocali causati da movimenti estremisti sorti nei paesi delle sponde orientale emeridionale (Pizzigallo 2010. Il Mediterraneo è anche una sorta di zona franca, un antimondoche gioca ruoli complessi e spesso deregolati nel contesto globale (Farinelli2007.Uno spazio geopolitico importante per le relazioni estere dell'Italia è senza dubbio ilMediterraneo (de Leonardis 2003, anche se la contrapposizione tra vocazioneeuropea e mediterranea, europeismo e mediterraneismo, è una costante della politicaestera italiana (Varsori 2003. Tale situazione duale deriva non soltanto dalla posizionegeografica ma anche dal fatto che l'area mediterranea è stata instabile e carica ditensione fino al secondo dopoguerra e lo è rimasta dalla fine del mondo bipolare(Colombo 2003. Il Sud si è trasformato nel luogo principe di improbabili e imminentisfide alla sicurezza del dopo Guerra fredda, così come di instabilità politica e di conflittilocali causati da movimenti estremisti sorti nei paesi delle sponde orientale emeridionale (Pizzigallo 2010. Il Mediterraneo è anche una sorta di zona franca, un antimondoche gioca ruoli complessi e spesso deregolati nel contesto globale (Farinelli2007.

R-skeemil polnud lootust kunagi kohtusse jõuda / Norman Aas ; intervjueerinud Kadri Paas

Index Scriptorium Estoniae

Aas, Norman, 1975-

2010-01-01

Riigi peaprokuröri sõnul ei ole erakondade liikmete kampaaniate rahastamise kohta karistusseadustikus sõnagi. Korruptsioon on varasemast keerulisemaks muutunud ja korruptsioonikuritegu on väga kallis uurida

Application of a TiAIN coating for the increase wear resistance of a passage floodgate manufactured in steel T9

International Nuclear Information System (INIS)

Montes de Oca, J.; Gonzalez, H. J.; Solis, E.; Moreno, J.; Munoz S, J.

2009-01-01

The present work reports a study to increase wear resistance of a ball passage floodgate (steel type T9) trough the application of a thick film (coating). This study have included a material and process selection, synthesis of the coating on steel plates as substrates and spherical device, assembling of the coated floodgate on the ball valves, and finally an evaluation of the valves in the process of a thermoelectric power station. Taking into account the different requirements, a TiAIN coating prepared by cathodic arc evaporation was finally retained. The crystal structure, morphology and chemical composition of the coating were evaluated by x-ray diffraction (XRD) and scanning electron microscopy equipped with an energy dispersive spectrometer (SEM-EDS). Finally, mechanical properties such as hardness and Young modulus were determined by nano indentation. (Author)

MACROINVERTEBRADOS ASOCIADOS A LAS RAÍCES SUMERGIDAS DEL MANGLE ROJO (Rhizophora mangle EN LAS BAHÍAS TURBO Y EL UNO, GOLFO DE URABÁ (CARIBE COLOMBIANO

Directory of Open Access Journals (Sweden)

GARCÍA PADILLA JESÚS MARÍA

2010-05-01

Full Text Available Con el fin de establecer el comportamiento de la salinidad y las características de la fauna de macroinvertebrados asociados a las raíces de Rhizophora mangle en las Bahías de Turbo y El Uno, se realizaron cuatro muestreos entre septiembre del 2004 y febrero del 2005, en tres sectores de las Bahías. Los valores de salinidad experimentaron cambios muy importantes en el tiempo y fluctuaron entre 2 y 32 unidades. En total, se cuantificaron 26 especies en Bahía Turbo y 28 en Bahía El Uno. Mientras la diversidad en la Bahía Turbo varió entre 0,77 en septiembre y 2,22 noviembre, en Bahía El Uno, los valores fluctuaron entre 1,14 en noviembre y 1,95 en septiembre. La mayoría de las especies son frecuentes en las raíces de mangle de la región caribe y poseen un carácter eurihalino.

Modernistliku ehitatud keskkonna kujunemine (1955-1960.aastad) / Mart Kalm

Index Scriptorium Estoniae

Kalm, Mart, 1961-

2013-01-01

Akademismist modernismini ehk ehitaja võit arhitekti üle. Liialduste likvideerimine. Uuseestiaegsuse laine 1950. aastate keskel. Moodne loomulikkus. Uued tarindid. Tüüpprojektid. Eriprojektiga kooperatiivkorter - kallis mugavus. Sirgete joonte arhitektuur. Kolhoosiarhitektuur

Väikeste värviliste asjade ajastu = The Era of Small Colourful Things / Gabriel Verilaskja

Index Scriptorium Estoniae

Verilaskja, Gabriel

2003-01-01

Uutest suundadest valgustuses, tarkvaraga lampidest, valgustite muutumisest väiksemaks, imetillukestest valgustitest, mille sisse on ehitatud võimalus muuta värvi. Illustratsiooniks neli Gabriel Verilaskja ja Kalli Seina disainitud valgustit

El Cambio de Actitudes hacia Uno Mismo en el Contexto Organizacional: El Efecto del Formato de Pensamiento

Directory of Open Access Journals (Sweden)

Beatriz Gandarillas

2010-01-01

Full Text Available La visión que tienen las personas de sí mismas influye sobre distintos comportamientos organizacionales. Por tanto, resulta esencial entender cómo se pueden modificar las actitudes hacia uno mismo tanto en el contexto personal como el organizacional. El cambio de actitudes depende fundamentalmente de la dirección (favorable o desfavorable de los pensamientos con respecto a uno mismo. En el presente trabajo se propone estudiar, además de la dirección, también el formato de dichos pensamientos. Se llevaron a cabo dos experimentos en los que se pidió a los participantes que pensaran sobre sus fortalezas o debilidades (manipulación de la dirección del pensamiento de forma continua o dicotómica (manipulación del formato. Los resultados indican que la dirección de los pensamientos influyó de forma directa o inversa sobre la auto-estima según el formato. Se ofrecen distintas interpretaciones de estos resultados destacando la posibilidad de que el pensamiento dicotómico resultara difícil en este contexto de alta relevancia. Finalmente, se sugieren implicaciones potenciales de los resultados para el comportamiento organizacional.

"Etica ed Estetica sono tutt’uno" Riflessioni su TLP 6.421

Directory of Open Access Journals (Sweden)

Gabriele Tomasi

2011-01-01

Full Text Available Per il primo Wittgenstein etica ed estetica erano tutt’uno. Scopo del saggio è fornire un’interpretazione di questa concezione. Esaminando il modo in cui è proposta nel Tractatus e considerando alcune annotazioni dei Quaderni 1914-1916 si evidenzia che l’unità di etica ed estetica è in un modo di vedere il mondo per cui esso non appare come fonte di limitazione. L’etica è un’estensione al mondo - alla vita - della capacità di conferire significato che nell’arte si realizza nei riguardi di oggetti particolari. Affermando l’unità di etica ed estetica Wittgenstein attira l’attenzione sul fatto che la radice dell’etica è in un certo modo di vedere le cose, in un atteggiamento verso la vita. Si tratta della prospettiva di un valore non connesso a come il mondo è e che è evocato dalla meraviglia per l’esistenza del mondo.

EXIGENCES TECHNIQUES DANS LA CONSTRUCTION ET REGLEMENTATION : ETUDE D’UN EXEMPLE DE LOGEMENT COLLECTIF A AIN-SMARA (ALGERIE

Directory of Open Access Journals (Sweden)

B BENRACHI

2002-12-01

Full Text Available La construction d’un édifice de qualité standard et répondant aux exigences techniques est   obtenue grâce au développement du savoir-faire et au respect des règles de l’art et de la réglementation en vigueur.  Une étude détaillée sur les  exigences techniques et le respect de la réglementation  d’un logement en collectif  nouvellement construit et inhabité à Ain-Smara, nous a montré  qu’il y a une satisfaction pour certaines d'entre-elles et une non-conformité pour d’autres. Il en résulte que le degré de satisfaction de ce logement est inférieur à celui recommandé dans le cadre de la réglementation, ce qui diminue sa qualité par rapport au standard exigé.

Salud y trabajo de docentes de instituciones educativas distritales de la localidad uno de bogotá

OpenAIRE

García Castro, Constanza María; Muñoz Sánchez, Alba Idaly

2014-01-01

Las instituciones educativas constituyen un escenario importante para la promoción de la salud de docentes, estudiantes, personal administrativo e, incluso, las familias; pero para utilizarlo eficazmente, en particular para el caso de los(as) docentes, es necesario conocer sus condiciones de trabajo y salud. Objetivo: describir algunas de las condiciones de trabajo y salud del personal docente que labora en las Instituciones Educativas Distritales de la Localidad uno (I) de Usaquén, Bogotá, e...

Süüdistus: Professor pettis Tehnikaülikoolilt välja 35 000 eurot / Tarmo Vahter

Index Scriptorium Estoniae

Vahter, Tarmo, 1970-

2015-01-01

Bioinformaatika professor Madis Metsis müüs Tallinna Tehnikaülikoolile kalli seadme, mida polnud olemaski. Praegu töötab Madis Metsis Tallinna ülikoolis matemaatika ja loodusteaduste instituudis bioloogia professorina

The effect of tracking network configuration on GPS baseline estimates for the CASA Uno experiment

Science.gov (United States)

Wolf, S. Kornreich; Dixon, T. H.; Freymueller, J. T.

1990-01-01

The effect of the tracking network on long (greater than 100 km) GPS baseline estimates was estimated using various subsets of the global tracking network initiated by the first Central and South America (CASA Uno) experiment. It was found that best results could be obtained with a global tacking network consisting of three U.S. stations, two sites in the southwestern Pacific, and two sites in Europe. In comparison with smaller subsets, this global network improved the baseline repeatability, the resolution of carrier phase cycle ambiguities, and formal errors of the orbit estimates.

Perancangan Sistem Kendali Otomatis pada Smart Home menggunakan Modul Arduino Uno

Directory of Open Access Journals (Sweden)

Danny Kurnianto

2016-10-01

Full Text Available Efficiency, effectiveness and electrical energy saving have become topics of research that attracts many researchers today. Model of technology has been widely proposed to improve effectiveness and energy saving for the livelihood of the peoples. One of example is a model of a Smart Home technology. Smart Home models proposed in this research is controlled centrally by an Arduino Uno microcontroller. Microcontroller detect output from the two magnetic sensors installed in the entrance. Microcontroller response to the two outputs of magnetic sensors in the form of control of room lighting. fan, mosquito repellent and LCD. The system will work automatically when someone inside the house. Room lights will turn on automatically, the fan will work in accordance with the room temperature conditions and mosquito repellent device will work automatically. The test results show that the proposed model of a Smart Home can work well according design with a success rate of 100%.

Associations of cardiovascular risk factors in Al Ain- United Arab Emirates

Directory of Open Access Journals (Sweden)

Nazirudeen Mohammad K

2009-04-01

Full Text Available Abstract Background Over the last 30 years the citizens of the United Arab Emirates have experienced major changes in life-style secondary to increased affluence. Currently, 1 in 5 adults have diabetes mellitus, but the associations (clustering among risk factors, as well as the relevance of the concept of the metabolic syndrome, in this population is unknown. Aim To investigate the prevalence and associations among cardiovascular risk factors in this population, and explore to what extent associations can be explained by the metabolic syndrome according to ATP-III criteria. Method A community based survey, of conventional risk factors for cardiovascular disease was conducted among 817 national residents of Al Ain city, UAE. These factors were fasting blood sugar, blood pressure, lipid profile, BMI, waist circumference, smoking, or CHD family history. Odds ratios between risks factors, both unadjusted and adjusted for age and sex as well as adjusted for age, sex, and metabolic syndrome were calculated. Results Various risk factors were positively associated in this population; associations that are mostly unexplained by confounding by age and sex. For example, hypertension and diabetes were still strongly related (OR 2.5; 95% CI 1.7–3.7 after adjustment. An increased waist circumference showed similar relationship with hypertension (OR 2.3; 95% CI 1.5–3.5. Diabetes was related to an increased BMI (OR 1.5; 96% CI 1.0–2.3. Smoking was also associated with diabetes (OR 1.9, 95% CI 1.0–3.3. Further adjustment for metabolic syndrome reduced some associations but several remained. Conclusion In this population risk-factors cluster, but associations do not appear to be explained by the presence/absence of the ATP-III metabolic syndrome. Associations provide valuable information in planning interventions for screening and management.

Associations of cardiovascular risk factors in Al Ain- United Arab Emirates

Science.gov (United States)

Baynouna, Latifa M; Revel, Anthony D; Nagelkerke, Nico JD; Jaber, Tariq M; Omar, Aziza O; Ahmed, Nader M; Nazirudeen, Mohammad K; Al Sayed, Mamdouh F; Nour, Fuad A; Abdouni, Sameh

2009-01-01

Background Over the last 30 years the citizens of the United Arab Emirates have experienced major changes in life-style secondary to increased affluence. Currently, 1 in 5 adults have diabetes mellitus, but the associations (clustering) among risk factors, as well as the relevance of the concept of the metabolic syndrome, in this population is unknown. Aim To investigate the prevalence and associations among cardiovascular risk factors in this population, and explore to what extent associations can be explained by the metabolic syndrome according to ATP-III criteria. Method A community based survey, of conventional risk factors for cardiovascular disease was conducted among 817 national residents of Al Ain city, UAE. These factors were fasting blood sugar, blood pressure, lipid profile, BMI, waist circumference, smoking, or CHD family history. Odds ratios between risks factors, both unadjusted and adjusted for age and sex as well as adjusted for age, sex, and metabolic syndrome were calculated. Results Various risk factors were positively associated in this population; associations that are mostly unexplained by confounding by age and sex. For example, hypertension and diabetes were still strongly related (OR 2.5; 95% CI 1.7–3.7) after adjustment. An increased waist circumference showed similar relationship with hypertension (OR 2.3; 95% CI 1.5–3.5). Diabetes was related to an increased BMI (OR 1.5; 96% CI 1.0–2.3). Smoking was also associated with diabetes (OR 1.9, 95% CI 1.0–3.3). Further adjustment for metabolic syndrome reduced some associations but several remained. Conclusion In this population risk-factors cluster, but associations do not appear to be explained by the presence/absence of the ATP-III metabolic syndrome. Associations provide valuable information in planning interventions for screening and management. PMID:19371412

Karjamaa, pilved... Franz Liiv ja Juhan Kafka / Toomas Raudam

Index Scriptorium Estoniae

Raudam, Toomas, 1947-

1998-01-01

Varem ilmunud: Postimees, 1996, 7.sept. Rets. rmt.: Kafka, Franz. Kirjad Milenale / tlk. Tiiu Relve. Tallinn : Perioodika, 1996. (Loomingu Raamatukogu ; 27-30, 1996; Liiv, Juhan. Mu kallis Liisi / koost. Aarne Vinkel. Tartu : Ilmamaa, 1996

PR-teenuse hind tõuseb 20% / Eda-Liis Kann

Index Scriptorium Estoniae

Kann, Eda-Liis, 1979-

2004-01-01

Suhtekorraldusfirmad prognoosivad aasta teiseks pooleks PR-teenuste 20protsendilist hinnatõusu. Kommenteerivad Kersti Luha, Maren Pärn, Ingrid Eha, Maria Raudsepp, Heidi Pihlak ja Rein Meripõld. Lisa: Väikefirmale on PR-teenus kallis

Análisis, en perspectiva, de los contenidos deportivos de noticias uno: ¿un camino hacia la calidad informativa en televisión?

Directory of Open Access Journals (Sweden)

Lizandro ANGULO RINCÓN

2015-06-01

Full Text Available Este artículo analiza las rutinas periodísticas y contenidos deportivos de Noticias Uno, noticiero de televisión colombiano, con el fin de determinar si su información deportiva cumple con criterios de calidad. Asimismo, se consulta a expertos para conocer su opinión sobre lo que es hoy y debería ser un periodismo deportivo de excelencia. Para ello, se entrevista en profundidad a los reporteros de deportes del informativo y al grupo de expertos, y se analizan los contenidos de 306 de los segmentos de Noticias Uno, correspondientes a los años 2012 y 2013. Los resultados apuntan a que la información atlética y competitiva cumple con algunos indicadores de calidad como la confrontación de fuentes y la contextualización, lo cual contribuye a que Noticias Uno sea un referente de un buen periodismo. De hecho, este medio ha ganado el premio India Catalina al mejor noticiero del país desde el 2010 hasta el 2015. Sin embargo, la información deportiva debe avanzar la definición de otros indicadores de calidad como la variedad temática y de enfoque para narrar deportes minoritarios y mayoritarios.

Burnout en Uruguay: Unos aportes para los resultados de Añon et al. (2012.

Directory of Open Access Journals (Sweden)

Cesar Merino Soto

2013-05-01

Full Text Available La presente carta pone de relieve algunas preguntas que podrían desafiar la validez de los resultados presentados por Añón et al. (2012, respecto a sus descripciones del nivel de burnout en un hospital público de Montevideo. Su estudio es importante para el aporte descriptivo local del burnout en trabajadores en Uruguay, y de la prevalencia del mismo en un plano internacional. Aparentemente, es uno de los pocos estudios publicados sobre el síndrome de burnout en Uruguay. Pero hay aspectos relacionados con la validez de las interpretaciones de sus resultados, que no han tomado en cuenta.

Bravocom süüdistab Tele2 ja EMT-d alatus konkurentsivõitluses / Kristiina Viiron

Index Scriptorium Estoniae

Viiron, Kristiina, 1971-

2007-01-01

Kallines Tele2 ja EMT võrgust Bravocomi mobiilinumbritele helistamise minutihind. Bravocomi juhatuse esimees Peep Põldsamm peab nii kalli hinna - 4.50 minut - kehtestamist konkurentsivõitluseks. Tabelid: Hinnavõrdlus. Lisa: Tele2 ja EMT kommentaarid

Ravimid, risk, raha & tervis / Inge Pitsner

Index Scriptorium Estoniae

Pitsner, Inge

2008-01-01

Ravimifirma Roche Eesti OÜ tegevjuht Kadri Mägi selgitab ravimiäri toimemehhanisme ning põhjuseid, miks ravimitööstus on riskantne ja kallis valdkond. Lisa: Mis on farmakoökonoomika?; Roche Eesti kontor

Hooajal asutatud toitlustaja kaob turult / Eda-Liis Kann

Index Scriptorium Estoniae

Kann, Eda-Liis, 1979-

2003-01-01

Eesti catering-teenuste turg ning ettevõtted. Tabelid: Toitlustusteenus võrdne kalli restorani hindadega - ürituste hinnad; Tuntumad toitlustusfirmad. Kommenteerivad Riho Rasmann ja Hede Kerstin Luik. Frens pakub kõige maitsvamaid suupisteid - catering-firmade pimetesti tulemused

Vastased üritavad koos Haloneni lüüa / Erkki Bahovski

Index Scriptorium Estoniae

Bahovski, Erkki, 1970-

2006-01-01

Soome presidendivalimistel teise vooru mitte pääsenud Koonderakonna kandidaat Matti Vanhanen, Rootsi rahvapartei kandidaat Henrik Lax ja kristlike demokraatide kandidaat Bjarne Kallis toetavad teise vooru pääsenud Koonderakonna kandidaati Sauli Niinistöd

Road of death to remain lethal / Kairi Kurm

Index Scriptorium Estoniae

Kurm, Kairi

2005-01-01

Majandus- ja kommunikatsiooniministeeriumi teatel ei rajata Tartu ja Tallinna vahele neljarealist maanteed, kuna selle ehitus oleks kallis. Maanteeameti väitel ei ole olukord Tallinn-Tartu maanteel halb ning hukkunuid pole piisavalt, et oleks vajalik teed laiendada

Some tests of wet tropospheric calibration for the CASA Uno Global Positioning System experiment

Science.gov (United States)

Dixon, T. H.; Wolf, S. Kornreich

1990-01-01

Wet tropospheric path delay can be a major error source for Global Positioning System (GPS) geodetic experiments. Strategies for minimizing this error are investigted using data from CASA Uno, the first major GPS experiment in Central and South America, where wet path delays may be both high and variable. Wet path delay calibration using water vapor radiometers (WVRs) and residual delay estimation is compared with strategies where the entire wet path delay is estimated stochastically without prior calibration, using data from a 270-km test baseline in Costa Rica. Both approaches yield centimeter-level baseline repeatability and similar tropospheric estimates, suggesting that WVR calibration is not critical for obtaining high precision results with GPS in the CASA region.

Eestlased ametis Iirimaal / Silva Männik

Index Scriptorium Estoniae

Männik, Silva, 1974-

2003-01-01

Eestist Iirimaale tööle siirdunud inimeste arv kasvab. Kaks Iirimaal töötavat eestlast vahendavad oma kogemusi. Vt. samas: Esimene ešelon eestlasi lendab Kerry Foodsi septembri lõpus; Elu Iirimaal on eestlasele kallis

Relojes Circadianos y Premio Nobel: hora de tomarse unos minutos para hablar de ritmos biológicos

Directory of Open Access Journals (Sweden)

Luis Fernando Larrondo Castro

2018-01-01

Full Text Available El Nobel 2017 en Fisiología o Medicina recayó en la descripción molecular de los relojes circadianos. A pocas semanas de haberse hecho el anuncio, uno de los recipientes de esta distinción, Michael Rosbash, visitó Chile. En estas breves páginas comentamos parte de su charla y destacamos la importancia que tienen los ritmos circadianos en la biología de los organismos, así como su impacto en salud y enfermedad.

LA VERSATILIDAD DEL PRONOMBRE UNO PARA EXPRESAR POSICIONAMIENTO FRENTE A LO ENUNCIADO EN EL ESPAÑOL DE BARRANQUILLA, COLOMBIA

Directory of Open Access Journals (Sweden)

Luz Marcela Hurtado

2016-01-01

Full Text Available Los estudios comunicativo–funcionales han considerado los mecanismos de impersonalización como una brecha en la deixis, o como desfocalizadores del centro deíctico. Sin embargo, este trabajo se inspira en planteamientos previos sobre la impersonalidad como extensión de la deixis. Consiste en un estudio variacionista de los diferentes grados de generalidad expresados mediante uno en la variedad caribeña de Barranquilla, Colombia. Con base en los conceptos de deíxis textual, discursiva y social, incorpora factores lingüísticos asociados con los grados de impersonalización (interpretación referencial, tipo de discurso y clase semántica del verbo, y factores pragmáticos afines con las relaciones de poder y solidaridad (polaridad, tipo de interacción, formas de tratamiento y relaciones entre los interactuantes. Los resultados proporcionan evidencia estadística acerca de un uso personal de uno con las funciones deícticas de yo : predomina cuando el hablante expresa su posicionamiento frente a lo enunciado, es decir, su centro deíctico, sus experiencias personales, conocimientos, evaluaciones y sentimientos.

A. H. Tammsaare park 112 / Andri Ksenofontov

Index Scriptorium Estoniae

Ksenofontov, Andri, 1962-

2005-01-01

Rotermanni soolalaos avatud näituse "Kodu, kallis kodu" installatsioonist "Kast" A. H. Tammsaare pargis. Autorid Kämbu, Raskolnikova, Dragon ja AsmaRaa. Saelaudadest kastide autorid on Tabasalu ühisgümnaasiumi ja Vääna põhikooli poisid

Tudengid tahavad enam ühekohalisi ühikatube / Jüri Saar

Index Scriptorium Estoniae

Saar, Jüri, 1973-

2002-01-01

Tartu Ülikooli mitusada ühiselamujärjekorras ootavat tudengit eelistaks ühekohalist ja odavat tuba, ühiselamute remondiprogramm toob aga juurde eelkõige kahekohalisi tube, mille üliõpilased kalli hinna pärast ära põlgavad.

Prii internet pakub lisaväärtust / Kristjan Otsmann

Index Scriptorium Estoniae

Otsmann, Kristjan, 1971-

2005-01-01

Tasuta internetiühendusest erinevates avalikes kohtades, mis paljude ettevõtete juhtide arvates annab kohale lisaväärtust. Lisa: Korduma kippuvad küsimused. Vt. samas: Eesti härra WiFi; Mobiil-internet on kallis ja aeglane

Pediatric and youth traffic-collision injuries in Al Ain, United Arab Emirates: a prospective study.

Science.gov (United States)

Grivna, Michal; Eid, Hani O; Abu-Zidan, Fikri M

2013-01-01

To study the mechanism of road traffic collisions (RTC), use of safety devices, and outcome of hospitalized pediatric and youth RTC injured patients so as to give recommendations regarding prevention of pediatric RTC injuries. All RTC injured children and youth (0-19-year-olds) who were admitted to Al Ain City's two major trauma centers or who died after arrival to these centers were prospectively studied from April 2006 to October 2007. Demography of patients, road-user and vehicle types, crash mechanism, usage of safety devices, injured body regions, injury severity, Revised Trauma Score, Glasgow Coma Scale, intensive care unit admissions, hospital stay and mortality were analyzed. 245 patients were studied, 69% were vehicle occupants, 15% pedestrians, 9% motorcyclists and 5% bicyclists. 79% were males and 67% UAE citizens. The most common mechanism of RTC was rollover of vehicle (37%) followed by front impact collision (32%). 32 (13%) of vehicle occupants were ejected from car. 63% of ejected occupants and 70% of motorcyclists sustained head injuries. Only 2% (3/170) vehicle passengers used seatbelts and 13% (3/23) motorcyclists a helmet. Male drivers and UAE nationals were at high risk of RTC as drivers and as motorcyclists. Ejection rate was high because safety restraint use was extremely low in our community. More education and law enforcement focusing especially on car/booster seat use is needed.

Deformation history of the Neoproterozoic basement complex, Ain Shams area, Western Arabian Shield, Saudi Arabia

Science.gov (United States)

El-Fakharani, Abdelhamid; Hamimi, Zakaria

2013-04-01

Ain Shams area, Western Arabian Shield, Saudi Arabia, is occupied by four main rock units; gneisses, metavolcanics, metasediments and syn- to post-tectonic granitoids. Field and structural studies reveal that the area was subjected to at least three phases of deformation (D1, D2 and D3). The structural features of the D1 are represented by tight to isoclinal and intrafolial folds (F1), axial plane foliation (S1) and stretching lineations (L1). This phase is believed to be resulted from an early NW-SE contractional phase due to the amalgamation between Asir and Jeddah tectonic terranes. D2 deformation phase progressively overprinted D1 structures and was dominated by thrusts, minor and major F2 thrust-related overturned folds. These structures indicate a top-to-the-NW movement direction and compressional regime during the D2 phase. Emplacement of the syn-tectonic granitoids is likely to have occurred during this phase. D3 structures are manifested F3 folds, which are open with steep to subvertical axial planes and axes moderately to steeply plunging towards the E, ENE and ESE directions, L3 is represented by crenulation lineations and kink bands. These structures attest NE-SW contractional phase, concurrent with the accretion of the Arabian-Nubian Shield (ANS) to the Saharan Metacraton (SM) and the final assembly between the continental blocks of East and West Gondwana.

Rancang Bangun Sistem Monitoring Listrik Prabayar dengan Menggunakan Arduino Uno

Directory of Open Access Journals (Sweden)

Diah Risqiwati

2016-08-01

Full Text Available Abstrak Kebutuhan akan listrik akan terus meningkat dari tahun ke tahun, hal ini dikarenakan pembuatan produk yang menggunakan listrik sebagai energi nya juga gencar dikeluarkan oleh produsen sehingga kebutuhan akan listrik sudah menjadi kebutuhan yang sangat vital untuk masing-masing individu. Saat ini di negara kita telah dikembangkan listrik prabayar disamping listrik pasca bayar yang telah berjalan, fungsi dari listrik prabayar ini adalah untuk dapat mengontrol penggunaan dari listrik itu sendiri. Namun, penggunaan listrik prabayar tidak sepenuhnya digunakan secara optimal oleh pelanggan, dikarenakan pelanggan tidak mengetahui beban dari alat listrik yang digunakan sehingga tidak dapat melakukan kontrol dari pulsa listrik yang dibeli. Dari permasalahan itu peneliti mengusulkan untuk membuat suatu alat kontrol dengan menggunakan arduino uno sehingga pemilik dapat mengontrol penggunaan listriknya secara real time. Board Arduino berfungsi sebagai sistem kontrol pengambilan data, sebelum data tersebut di olah pada server. Terdapat sistem sensor berfungsi untuk pengambilan data ampere yaitu sensor AC712-20A dan modul relay sebagai saklar elektrik berfungsi untuk memutus daya listrik ketika pulsa tidak mencukupi. Dari hasil pengujian yang telah dilakukan, terdapat kesalahan pengukuran rata-rata sensor ACS712-20A dengan multitester sebesar 26%, sedangkan untuk pengukuran billing listrik prabayar terdapat kesalahan sebesar 6%.

LA SITUACIÓN DE UNO CONTRA UNO EN MINIBASKET FEMENINO: ANÁLISIS COMPARATIVO ENTRE DOS UBICACIONES DIFERENTES DE LA LÍNEA DE TRES PUNTOS

Directory of Open Access Journals (Sweden)

J.L. Arias

2010-09-01

Full Text Available

RESUMEN

El objetivo de este trabajo fue analizar de forma comparativa en Minibasket el número de situaciones de un atacante contra un defensor que se producían al jugar con la línea que define la zona del área restringida como línea de tres puntos con respecto a una línea de tres puntos rectangular. Participaron 67 jugadoras (edad: M = 10.39 años, SD = 0.67, de seis equipos diferentes. De estas jugadoras se obtuvieron 1642 posesiones de balón en un primer campeonato y 1669 posesiones de balón en un segundo. Se utilizó la metodología observacional. Tras formar a cuatro observadores, la fiabilidad del registro obtenida a través del coeficiente de correlación mediante el estadístico de Pearson, alcanzó valores entre .83 y .93. Las diferencias significativas encontradas entre los dos campeonatos (p = .019, revelaron que al jugar con la línea de tres puntos delimitada por la zona restringida se consiguen un 3.9% más situaciones de un atacante contra un defensor, lo que puede favorecer en mayor medida el desarrollo de la inteligencia ante la toma de decisión. No obstante, el número de situaciones de uno contra uno en ambos campeonatos se considera escaso. A partir de los resultados, se indican una serie de recomendaciones sobre el reglamento.
Palabras Clave: Capacidad cognitivo-motriz, toma de decisión, minibasket, línea de tres puntos.

ABSTRACT

The purpose of this study was to analyze the number of situations of one versus one in Mini-basketball, on playing with a three-point line delimited by the area of the restricted zone compared with a three-point line delimited by the rectangular area. Sixty seven Mini-basketball female

Me suudame ajaga kaasas käia / interv. Ene Riet

Index Scriptorium Estoniae

2003-01-01

Eesti raamatukoguhoidjate VIII kongressi (9.-10. juuni 2002) delegaatitelt küsiti arvamust Eesti raamatukogunduse kohta, vastasid: Kalli Kuhi, Sirje Okapuu, Toomas Liivamägi, Sirje Lauring-Vaska, Helve Sreiberg, Irina Kruusla, Ädu Neemre, Tiit Margna, Valentina Brovina, Asko Tamme, Meeli Veskus

Pediatric and youth traffic-collision injuries in Al Ain, United Arab Emirates: a prospective study.

Directory of Open Access Journals (Sweden)

Michal Grivna

Full Text Available AIM: To study the mechanism of road traffic collisions (RTC, use of safety devices, and outcome of hospitalized pediatric and youth RTC injured patients so as to give recommendations regarding prevention of pediatric RTC injuries. METHODS: All RTC injured children and youth (0-19-year-olds who were admitted to Al Ain City's two major trauma centers or who died after arrival to these centers were prospectively studied from April 2006 to October 2007. Demography of patients, road-user and vehicle types, crash mechanism, usage of safety devices, injured body regions, injury severity, Revised Trauma Score, Glasgow Coma Scale, intensive care unit admissions, hospital stay and mortality were analyzed. RESULTS: 245 patients were studied, 69% were vehicle occupants, 15% pedestrians, 9% motorcyclists and 5% bicyclists. 79% were males and 67% UAE citizens. The most common mechanism of RTC was rollover of vehicle (37% followed by front impact collision (32%. 32 (13% of vehicle occupants were ejected from car. 63% of ejected occupants and 70% of motorcyclists sustained head injuries. Only 2% (3/170 vehicle passengers used seatbelts and 13% (3/23 motorcyclists a helmet. CONCLUSIONS: Male drivers and UAE nationals were at high risk of RTC as drivers and as motorcyclists. Ejection rate was high because safety restraint use was extremely low in our community. More education and law enforcement focusing especially on car/booster seat use is needed.

Un film très nonchalant / Kristiina Davidjants

Index Scriptorium Estoniae

Davidjants, Kristiina, 1974-

2001-01-01

Mängufilm "Hüvasti, kallis kodu" ("Adieu, plancher des vaches") : rezžissöör Otar Iosseliani : Prantsusmaa - Šveits - Itaalia 1999. Lisa : A. Ermeli koostatud režissööri lühielulugu ja filmograafia. Kokkuvõte inglise keeles lk. 96

Suhtesõlmed kire vastu / Aita Kivi

Index Scriptorium Estoniae

Kivi, Aita, 1954-

2002-01-01

Sisu : Linn Ullmann. Enne kui sa uinud; Josie Lloyd, Emlyn Rees. Saame kokku; Deborah Moggach. Tulbipalavik; Victoria Clayton. Armastusest loobuja; Rosamunde Pilcher: Kaksikute tähtkujus; Hailey North. Kallis Armastuse Doktor; August Gailit. Muinasmaa; Aidi Vallik. Mis teha, Ann?; A. E. Hotchner. Papa Hemingway

Utilization of GSM Module (Sim 900 Based Arduino-Uno for Alarm System and Remote Automatic Door Locking

Directory of Open Access Journals (Sweden)

Fauzi Fauzi

2018-01-01

Full Text Available Sebuah sistem alarm dan pengunci pintu otomatis jarak jauh untuk keamanan rumah telah dibuat. Otomatisasi kunci pintu rumah ini beroperasi dengan menggunakan perintah yang dikirimkan oleh pemilik rumah melalui pesan singkat melalui handphone sehingga keamanan rumah akan tetap dapat dikendalikan meski dari jarak yang jauh. Penelitian ini bertujuan untuk membangun otomatisasi rumah pintar yang mampu melakukan dua hal yakni mengunci pintu dan menyalakan alarm dengan menggunakan mikrokontroler Arduino-uno dan modul GSM. Pengontrolan secara otomatis tersebut cukup kompleks dan memerlukan berbagai komponen yang terintegrasi dengan kemampuan pembacaan masukan, pemrosesan data dan pengontrolan keluaran secara bersamaan dan terprogram.  A remote door automatic alarm and door lock system for home security has been designed. This home door lock automation operates using commands sent by homeowners via short messages from handphone so that home security will remain controllable even from a long distance. This study aims to build smart home automation that can do two things: lock the door and turn on the alarm by using Arduino-uno microcontroller and GSM module. The automatic control is quite complex and requires a variety of integrated components with the ability to read input, data processing and control the output simultaneously and programmed.   Keywords: Arduino, GSM, Automatic Doors, SMS Rerefences Depari, G.S. (1985. Belajar Teori dan Keterampilan Elektronika. Bandung: Armico Daryanto, 2005. Pengetahuan Teknik Elektronika. Erlangga. Jakarta. Session, Kendall Webster, 2003. 1001 Rangkaian Elektronika. PT. Elek Media Komputindo Kelompok Gramedia, Jakarta. Sustrisno, 1986, Elektronika Teori dan penerapanya. Penerbit ITB, Bandung

Kinerja Prototipe Sistem Elektronis Berbasis Mikrokontroler Arduino Uno R3 Untuk Pemantauan Analogi Instalasi Listrik

Directory of Open Access Journals (Sweden)

Arief Goeritno

2016-12-01

Full Text Available Pada penelitian ini dirancang prototipe sistem elektronis berbasis mikrokontroler untuk pemantauan analogi instalasi listrik, berupa sistem terintegrasi dalam satu paket modul berbasis mikrokontroler Arduino Uno R3.  Sistem terintegrasi terdiri atas (1 analogi instalasi listrik; (2 sistem elektronis berupa (i subsistem sensor-transduser, (ii subsistem mikrokontroler, dan (iii subsistem Liquid Crystal Display (LCD; dan (3 catu daya. Setiap fase dipasang sensor untuk pemantauan keberadaan tegangan melalui pengubahan parameter tegangan bolak-balik (alternating current, ac ke parameter tegangan arus searah (direct current, dc melalui sistem sensor-transduser.  Keluaran sistem sensor-transduser diproses pada mikrokontroler dan hasil pemantauan ditampilkan pada LCD. Pengukuran kinerja sistem dilakukan terhadap lima kondisi akibat pemberian asumsi perubahan pada MCB dan pemantauan jalur instalasi untuk ruang khusus.

Doce magnos oradores: Breves consideraciones biográficas e intento de acercamiento a uno de sus discursos

OpenAIRE

JOSELYN CORREDOR TAPIAS

2012-01-01

Este artículo ofrece una visión general sobre la vida de doce grandes oradores. En primera instancia, se presentan unas consideraciones teóricas sobre su biografía; posteriormente, se da a conocer uno de los discursos más famosos de algunos de los oradores escogidos. En el caso de otros, solo se presenta un fragmento; luego, se exponen algunas de sus frases célebres. Respecto de dos oradores, infortunadamente, no se presenta el texto del discurso debido a que no se halló –al menos hasta el mo...

Klaas ja mõis / Maie-Ann Raun

Index Scriptorium Estoniae

Raun, Maie-Ann, 1938-

2007-01-01

Klaasikunstinäitus "Ringkäik" Albu mõisas, kuraatorid Virve Kiil, Kati Kerstna, Kairi Orgusaar. Eksponeeritakse Tiina Sarapu, Mare Saare, Eeva Käsperi, Kai Kiudsoo-Värvi, Pilvi Ojamaa, Merle Bukoveci, Kalli Seina, Viivi-Ann Keerdo, Liisi Junolaineni, Kristiina Uslari, Ivo Lille töid

Berlinale terad / Kadri Kõusaar

Index Scriptorium Estoniae

Kõusaar, Kadri

2006-01-01

56. Berliini festivali filme - Jasmila Zhbanici "Grbavica", Michael Winterbottomi, Mat Whitecrossi "Teekond Guantanamosse", tailase Pen-ek Ratanaruangi "Nähtamatud lained", John Hillcoati "Ettepanek" (stsenarist ja muusika autor Nick Cave), Bennett Milleri "Capote" (nimiosas P.S. Hoffman), Yang Yong-hi dokfilm "Kallis Pyongyang", Tomer Heymanni dokfilm "Pabernukud"

Intersubjectivity in a digital genre: the Spanish indefinite pronoun uno (“one”) and person deixis in Yahoo Questions&Answers

OpenAIRE

Rasson, Marie; De Cock, Barbara; 14th International Pragmatics Conference

2015-01-01

In this paper, we study various mechanisms to create intersubjectivity in a digital genre, namely Yahoo Questions and Answers (YQA). More concretely, we focus on the Spanish indefinite strategy uno (“one”) and its interaction with deictic person pronouns. YQA aims to provide assistance to users, who can ask other users questions on topics of all types. The other users respond by giving advice - often by referring to their personal experience - or their opinion on a given issue (Placencia, 201...

Tallinna Sadama kallis kingitus / Airi Ilisson

Index Scriptorium Estoniae

Ilisson, Airi, 1980-

2006-01-01

Riho Rasmann ja Jaan Toots sõlmisid Tallinna Sadama juhtidega lepingu, mis võimaldab transiidiärimehel Sandu Hubanil ja Vene transiidigigandil Severstalil küsida ettevõttelt üle 30 miljoni krooni. Vt. samas: Sandu Huban ja Severstal said pihta tulusale lepingule; Sandaal ja Lipinski teevad ühisäri juba kümmekond aastat; Riigikontroll taunib maa tasuta äraandmist; Sandu Hubani kuldne tehing. Kommenteerib Jaan Toots

Kallis surm, odav vanadus / Nicholas Timmins

Index Scriptorium Estoniae

Timmins, Nicholas

2004-01-01

Vananemisest tingitud kulude puhul tuleks lisaks pensionisüsteemi maksumusele rääkida veel tervishoiu ja vanurite hoolekandega seotud kulutustest. Vanurite osakaalu kasv toob kaasa tervishoiukulude tõusu, mis ei ole katastroofiliselt suur. Diagrammid: Keskmine vanus; Sündivus; Vananemine

Administraatori lubatähega parteris / Mihkel Mutt

Index Scriptorium Estoniae

Mutt, Mihkel, 1953-

1996-01-01

Anthony Shafferi 'Mõrvar' Eesti Draamateatris (lav. Mati Unt); David Lee Coburni 'Džinnimäng' (loominguline ühendus 'Teine laine', lav. Allan Kress); Anton Tšehhovi 'Kajakas' (lavakunstikooli 17. lennu diplomilavastus, lav. Kalju Komissarov); Oskar Lutsu - Toomas Kalli 'Tagahoovis' (Eesti Draamateatri ja Vanalinnastuudio ühislavastus, lav. Eino Baskin)

"Georgicat" näeb USA-s Californias

Index Scriptorium Estoniae

2000-01-01

Sulev Keeduse mängufilm "Georgica" linastub Berkeley kinos Fine Arts Cinema. Edasi läheb film Poola eesti filmi päevadele 6.-10. novembrini. Seal näidatakse ka V. Kuigi lühimängufilmi "Lurjus" ja R. Heidmetsa lastefilmi "Kallis härra Q"

Características de las dispensaciones de omeprazol en una farmacia comunitaria

Directory of Open Access Journals (Sweden)

Ezquieta MF

2010-06-01

Full Text Available INTRODUCCIÓN Omeprazol es uno de los principios que más se dispensa en la farmacia comunitaria. Pertenece al grupo de los inhibidores de la bomba de protones (IBP y actúa inhibiendo la secreción de H+ al estómago, disminuyendo en consecuencia los síntomas derivados de una excesiva acidez gástrica. OBJETIVOS Estudiar las características de la utilización de omeprazol 20 mg por los pacientes en una farmacia comunitaria, tratando de investigar las causas de la elevada prevalencia de uso de este medicamento entre dicha población. RESULTADOS La primera prescripción fue del médico de familia en un 59% de los casos y del especialista en el 41%. Un 61% de los pacientes dejó de tomarlo y tuvo que volver por sentir molestias gástricas. Un 44% no sabe hasta cuándo tiene que tomarlo y un 35% cree que debe tomarlo siempre. Un 55% lo toma por estar tomando al mismo tiempo un AINE. DISCUSIÓN Este estudio se encuentra limitado por el reducido número de encuestas en una sola farmacia comunitaria. Los resultados apuntan a que las causas de la elevada utilización de omeprazol pueden ser varias: el uso de AINE durante largos periodos de tiempo en dosis elevadas, el envejecimiento de la población que necesita utilizar un AINE como antiagregante o toma varios medicamentos, el uso en indicaciones poco precisas o el empleo para afecciones gástricas menores y la gastroprotección en pacientes polimedicados sin factores de riesgo. Otro factor que también podría influir es el posible rebote ácido tras la supresión del tratamiento, que deriva en la utilización crónica del medicamento.

Near field communication (NFC) model for arduino uno based security systems office system

Science.gov (United States)

Chairunnas, A.; Abdurrasyid, I.

2018-03-01

Currently, many offices or companies that start growing rapidly in a company or office should have a very limited room to enter only people entitled to enter the room and use the facilities contained in it, for example, Files in it must have many files and documents very important because to reduce the abuse of files and irresponsible person. Because it will be made room door security system by using Near Field Communication on android smartphone. Software used is Arduino IDE. The tools used in this system are Arduino Uno R3, NFC shield, pear sensor, bell, led, servo, 16 × 2 LCD, and Near Field Communication (NFC) in android smartphone. This system runs based on 2 inputs of a new technology that is Near Field Communication (NFC) in android smartphone. And also use pear sensor to detect unauthorized person entering the room. If the correct password is entered then the door will open and the pear sensor will light off if wrong then the bell will light up.

UnoViS: the MedIT public unobtrusive vital signs database.

Science.gov (United States)

Wartzek, Tobias; Czaplik, Michael; Antink, Christoph Hoog; Eilebrecht, Benjamin; Walocha, Rafael; Leonhardt, Steffen

2015-01-01

While PhysioNet is a large database for standard clinical vital signs measurements, such a database does not exist for unobtrusively measured signals. This inhibits progress in the vital area of signal processing for unobtrusive medical monitoring as not everybody owns the specific measurement systems to acquire signals. Furthermore, if no common database exists, a comparison between different signal processing approaches is not possible. This gap will be closed by our UnoViS database. It contains different recordings in various scenarios ranging from a clinical study to measurements obtained while driving a car. Currently, 145 records with a total of 16.2 h of measurement data is available, which are provided as MATLAB files or in the PhysioNet WFDB file format. In its initial state, only (multichannel) capacitive ECG and unobtrusive PPG signals are, together with a reference ECG, included. All ECG signals contain annotations by a peak detector and by a medical expert. A dataset from a clinical study contains further clinical annotations. Additionally, supplementary functions are provided, which simplify the usage of the database and thus the development and evaluation of new algorithms. The development of urgently needed methods for very robust parameter extraction or robust signal fusion in view of frequent severe motion artifacts in unobtrusive monitoring is now possible with the database.

Preclinical Evaluation to Specifically Target Ovarian Cancer with Folic Acid-Conjugated Nanoceria

Science.gov (United States)

2014-08-01

28: 3567-72. 5. Elnakat H, Ratnam M (2006). Role of folate receptor genes in reproduction and related cancers. Front Biosci 11: 506-19. 6. Kalli...Cancer Res 67: 10823- 10830. 13. Kumar A, Babu S, Karakoti AS, Schulte A, Seal S (2009). Luminescence properties of europium- doped cerium oxide

The UNOS renal transplant registry.

Science.gov (United States)

Cecka, J M

2001-01-01

The shortage of cadaver kidneys relative to increasing demand for transplantation has lead to a remarkable rise in transplantation from living donors. Based upon data reported to UNOS, the number of living donor kidneys transplanted in 2000 (5,106) nearly equaled the number of cadaver kidneys from preferred donors aged 6-50. HLA-mismatched siblings, offspring, spouses and other genetically unrelated donors accounted for nearly 80% of increased living donor transplantation during 1994-2000. Despite the increased use of poorly HLA-matched living donor kidneys, the actuarial 10-year graft survival rates for transplants between 1988-2000 were clustered between 53-57% for HLA-mismatched living donor grafts, except for offspring-to-parent transplants (49%) when the recipients were generally older. The 10-year survival rate for 96,053 cadaver grafts was 38% during the same period. The 5-year graft survival rates for more recent (1996-2000) cadaver donor transplants were 66%, 62% and 56% for recipients of first, second and multiple grafts, respectively (p < 0.001). The comparable results among recipients of living donor kidneys were 67%, 66% and 59% (p = ns). The 5-year graft survival rates for HLA-matched first grafts were 7% higher than those for HLA-mismatched transplants when the kidney was from a living or cadaver donor. HLA-identical sibling transplants provided the best long-term graft survival (85% at 5 years and a 32 year half-life). Even with improved crossmatch tests and stronger immunosuppression, sensitization was associated with 8% lower graft survival at 5 years and with a higher rate of late graft loss among first cadaver kidney recipients. Sensitization also was associated with an increase in delayed graft function from 22% of unsensitized first transplant recipients to as much as 36% among multiply retransplanted patients. Recipient race was a key factor in long-term graft survival of both living and cadaver donor kidneys. The rate of late graft loss was

[Stinging nettle root extract (Bazoton-uno) in long term treatment of benign prostatic syndrome (BPS). Results of a randomized, double-blind, placebo controlled multicenter study after 12 months].

Science.gov (United States)

Schneider, T; Rübben, H

2004-03-01

Phytotherapy of BPS has a long tradition in Germany; nevertheless, data referring to single phytotherapeutic agents are rare. We therefore performed a randomized, double-blind, placebo-controlled multicenter study for 1 year with Bazoton uno (459 mg dry extract of stinging nettle roots) with 246 patients. The IPSS decreased on average from 18.7+/-0.3 to 13.0+/-0.5 with a statistically significant difference compared to placebo (18.5+/-0.3 to 13.8+/-0.5; p=0.0233). The median Q(max) increased by 3.0+/-0.4 ml/s in comparison to 2.9+/-0.4 ml/s (placebo), thus not statistically significantly different, as well as the median volume of residual urine, which changed from 35.5+/-3.4 ml before therapy to 20.0+/-2.8 ml and from 40.0+/-4.0 ml to 21.0+/-2.9 ml under placebo application. The number of adverse events (29/38) as well as urinary infections etc. (3/10 events) was smaller under Bazoton uno therapy compared to placebo. Treatment with Bazoton uno can therefore be considered a safe therapeutic option for BPS, especially for reducing irritative symptoms and BPS-associated complications due to the postulated antiphlogistic and antiproliferative effects of the stinging nettle extract. A strong increase of Q(max) or reduction of residual urine are not to be expected.

Eesti piloodid Afganistanis täitsid ülesande

Index Scriptorium Estoniae

2012-01-01

Afganistanis teenivad Eesti õhuväe kopteripiloodid kapten Rene Kallis ja kapten Martin Noorsalu täitsid oma esimese teenistusülesande, lennates UH-60 Black Hawk tüüpi kopteritega. Ülesanne oli meedikute transport Camp Bastioni välihospidali. Pärast tutvumislende hakkavad piloodid lendama meditsiinilise evakuatsiooni üksuse koosseisus

Perancangan Alat Ukur Digital untuk Tinggi dan Berat Badan dengan Output Suara berbasis Arduino UNO

Directory of Open Access Journals (Sweden)

MUHAMMAD AFDALI

2018-03-01

Full Text Available ABSTRAK Alat pengukur tinggi badan dan penimbang berat badan yang sekaligus memberikan informasi berat badan ideal akan sangat bermanfaat bagi para pengguna. Oleh karena itu, dalam penelitian ini, dirancang dan direalisasikan suatu alat ukur yang sekaligus dapat mengukur tinggi badan dan berat badan serta memberikan informasi ideal atau tidaknya berat badan yang terukur. Alat ukur ini menggunakan Arduino Uno sebagai otaknya, sensor ultrasonik untuk mengukur tinggi badan, dan sensor strain gauge untuk mengukur berat badan. Data dari kedua sensor tersebut diolah oleh Arduino untuk mendapatkan indeks massa tubuh (IMT dan berat badan ideal (BBI. Nilai tinggi badan, berat badan, dan berat badan ideal akan ditampilkan pada LCD. Selanjutnya, informasi suara menyangkut kondisi berat badan yaitu ideal, gemuk, atau kurus akan dikeluarkan oleh speaker. Berdasarkan hasil pengujian dan analisis data maka diperoleh nilai persentase keberhasilan rata-rata pada pengukuran tinggi badan adalah 96,80% dan pada pengukuran berat badan adalah 99,04%. Sedangkan tingkat keberhasilan penampilan informasi suara adalah 95%. Kata kunci: Alat ukur digital, tinggi badan, beratbadan, Arduino, output suara. ABSTRACT An instument for measuring height and weight while providing information ideal weight for users will be very helpful. Therefore, in this study, it was designed and realized a measuring instrument which can simultaneously measure the height and weight as well as providing the ideal information whether or not the weight measured. This instrument uses an Arduino Uno as the brain, the ultrasonic sensor to measure the height and strain gauge sensor for measuring weight. Data from the sensors is processed by the Arduino to get a body mass index and ideal weight. The values of height, weight, and ideal weights will display on LCD. Furthermore, voice information regarding the ideal conditions of weight, namely ideal, fat, or thin will be emitted by a speaker. Based on test

Pilt ja heli koos räägivad artisti kohta palju / Ove Musting ; intervjueerinud Margus Haav

Index Scriptorium Estoniae

Musting, Ove

2010-01-01

Intervjuu režissööri ja produtsendi Ove Mustinguga, kelle uut lühimängufilmi "Kallis sõber, Sind austan" näidatakse 4. veebruaril 2010 Viljandi klubis Puhas Kuld. Räägitakse ka filmis üht peaosa kehastavast Jaan Pehkist alias Orelipoisist, kelle uue albumi "Õnn" esitluskontsert samas toimub

Moessbauer spectrometer based on UNO-4096-90 accumulator and Elektronika D3-28 microcomputer for simultaneous recording of four spectra

International Nuclear Information System (INIS)

Romanov, E.S.; Ivoilov, N.G.

1986-01-01

A buffer memory unit and an interface for the UNO-4096-90 accumulator with an Elektronika D3-28 microcomputer are described that allow simultaneous recording of four Moessbauer spectra with zero dead time. For complete elimination of dead time, the pulses from each detector are fed to two buffer counters units, which operate alternately in the write and interrogate modes. This organization of the buffer memory also completely eliminates the effect of the sensors on one another. The use of these circuits does not require any modifications of the computer or accumulator

Arduino Uno Microcontroller with Commercially Available Sensors Towards Generating Student Accessible Raw Meteorological Data

Science.gov (United States)

Henson, Gabrielle; Tanner, Meghan; Senevirathne, Indrajith

Microcontroller systems can be a boon to cost - effective techniques that can be used to enhance teaching at college level. We have used Arduino microcontroller coupled with commercially available sensors to systematically measure, record and analyze temperature, humidity and barometric pressure and to upload the real time raw data to cloud. Corresponding data will be available in classroom settings for predictions, analysis and simple weather forecasting. Setup was assembled via breadboard, wire and simple soldering with an Arduino Uno ATmega328P microcontroller connected to a PC. The microcontroller was programmed with Arduino Software while the bootloader was used to upload the code. Commercial DHT22 humidity and temperature sensor and BMP180 barometric pressure sensor were used to obtain relative humidity, temperature and the barometric pressure. System was mounted inside a weather resistant enclosure and data measurements were obtained and were uploaded onto the PC and then to cloud. Cloud data can be accessed via a shared link in a General Education class for multitude of purposes.

Spatial and temporal variability in sedimentation rates associated with cutoff channel infill deposits: Ain River, France

Science.gov (United States)

Piégay, H.; Hupp, C.R.; Citterio, A.; Dufour, S.; Moulin, B.; Walling, D.E.

2008-01-01

Floodplain development is associated with lateral accretion along stable channel geometry. Along shifting rivers, the floodplain sedimentation is more complex because of changes in channel position but also cutoff channel presence, which exhibit specific overflow patterns. In this contribution, the spatial and temporal variability of sedimentation rates in cutoff channel infill deposits is related to channel changes of a shifting gravel bed river (Ain River, France). The sedimentation rates estimated from dendrogeomorphic analysis are compared between and within 14 cutoff channel infills. Detailed analyses along a single channel infill are performed to assess changes in the sedimentation rates through time by analyzing activity profiles of the fallout radionuclides 137Cs and unsupported 210Pb. Sedimentation rates are also compared within the channel infills with rates in other plots located in the adjacent floodplain. Sedimentation rates range between 0.65 and 2.4 cm a−1 over a period of 10 to 40 years. The data provide additional information on the role of distance from the bank, overbank flow frequency, and channel geometry in controlling the sedimentation rate. Channel infills, lower than adjacent floodplains, exhibit higher sedimentation rates and convey overbank sediment farther away within the floodplain. Additionally, channel degradation, aggradation, and bank erosion, which reduce or increase the distance between the main channel and the cutoff channel aquatic zone, affect local overbank flow magnitude and frequency and therefore sedimentation rates, thereby creating a complex mosaic of sedimentation zones within the floodplain and along the cutoff channel infills. Last, the dendrogeomorphic and 137Cs approaches are cross validated for estimating the sedimentation rate within a channel infill.

MR imaging findings of anterior interosseous nerve lesions

Energy Technology Data Exchange (ETDEWEB)

Dunn, Andrew J. [Royal Liverpool University Hospital, Department of Medical Imaging, Liverpool (United Kingdom); Salonen, David C. [University of Toronto, Toronto Western Hospital, Department of Medical Imaging, Toronto, Ontario (Canada); Anastakis, Dimitri J. [University of Toronto, Toronto Western Hospital, Division of Plastic Surgery, Toronto, Ontario (Canada)

2007-12-15

To study and characterise the MR imaging findings of lesions of the anterior interosseous nerve (AIN). Magnetic resonance imaging (MRI) findings of the forearm of ten patients referred to our institution with suspected AIN lesions were retrospectively studied. Five healthy volunteers with normal forearm MRI findings formed a control group. Two musculoskeletal radiologists assessed the forearm musculature for oedema in the distribution of the AIN, median, posterior interosseous and radial nerves on T2-weighted (T2W) fat-saturated sequences. T1-weighted (T1W) images were assessed and graded for the presence of muscle atrophy and fatty involution. Six patients had undergone surgical exploration; five of these had surgically confirmed AIN compression. Four patients had diagnoses other than AIN compression made on imaging features. Of the cases of proven AIN compression, oedema within the pronator quadratus (PQ) muscle was identified in all cases. PQ atrophy and fatty involution were seen in three (43%) surgically confirmed cases. Cases 2 and 3 also demonstrated oedema in the flexor digitorum profundus (FDP)1 and FDP2 muscles. These cases also showed oedema in the flexor-carpi radialis (FCR) and FDP3/FDP4 muscles, respectively. The four cases of non-AIN compression demonstrated muscle oedema patterns that were atypical for the AIN distribution. They included a rupture of the flexor pollicis longus (FPL) tendon, brachial neuritis, amyotrophic lateral sclerosis and compression of the proximal median nerve. MRI is a useful investigation in the diagnostic workup of AIN syndrome. AIN syndrome is likely when there is diffuse oedema of AIN innervated muscles on T2W fat-saturated images. The most reliable sign of an AIN lesion is oedema within the PQ. Oedema in the flexor carpi radialis, FDP3 and FDP4, although not in the classical distribution of the AIN, does not preclude the diagnosis of AIN syndrome. (orig.)

MR imaging findings of anterior interosseous nerve lesions

International Nuclear Information System (INIS)

Dunn, Andrew J.; Salonen, David C.; Anastakis, Dimitri J.

2007-01-01

To study and characterise the MR imaging findings of lesions of the anterior interosseous nerve (AIN). Magnetic resonance imaging (MRI) findings of the forearm of ten patients referred to our institution with suspected AIN lesions were retrospectively studied. Five healthy volunteers with normal forearm MRI findings formed a control group. Two musculoskeletal radiologists assessed the forearm musculature for oedema in the distribution of the AIN, median, posterior interosseous and radial nerves on T2-weighted (T2W) fat-saturated sequences. T1-weighted (T1W) images were assessed and graded for the presence of muscle atrophy and fatty involution. Six patients had undergone surgical exploration; five of these had surgically confirmed AIN compression. Four patients had diagnoses other than AIN compression made on imaging features. Of the cases of proven AIN compression, oedema within the pronator quadratus (PQ) muscle was identified in all cases. PQ atrophy and fatty involution were seen in three (43%) surgically confirmed cases. Cases 2 and 3 also demonstrated oedema in the flexor digitorum profundus (FDP)1 and FDP2 muscles. These cases also showed oedema in the flexor-carpi radialis (FCR) and FDP3/FDP4 muscles, respectively. The four cases of non-AIN compression demonstrated muscle oedema patterns that were atypical for the AIN distribution. They included a rupture of the flexor pollicis longus (FPL) tendon, brachial neuritis, amyotrophic lateral sclerosis and compression of the proximal median nerve. MRI is a useful investigation in the diagnostic workup of AIN syndrome. AIN syndrome is likely when there is diffuse oedema of AIN innervated muscles on T2W fat-saturated images. The most reliable sign of an AIN lesion is oedema within the PQ. Oedema in the flexor carpi radialis, FDP3 and FDP4, although not in the classical distribution of the AIN, does not preclude the diagnosis of AIN syndrome. (orig.)

Eesti luuletaja päris oma prantsuse luuleraamat. August Sanga, Jaan Krossi ja Ain Kaalepi loomingust 1960. aastail / An Estonian Poet’s Own Book of French Poetry. About the Works of August Sang, Jaan Kross and Ain Kaalep in the 1960s

Directory of Open Access Journals (Sweden)

Katre Talviste

2013-12-01

Full Text Available This article positions the translations of French verse works (plays and selected collections of individual poets that August Sang, Jaan Kross and Ain Kaalep made in the 1960s, onto the background of their own original works. At that time, August Sang translated four plays by Molière (The Misanthrope, Tartuffe, The School for Wives in 1961; Amphitryon in 1961, which have already been discussed in relation to the tradition of translating the French syllabic verse into Estonian, because these translations form a considerable part of the body of Estonian translations of French verse poetry. For Jaan Kross and Ain Kaalep, the wider context is created by the so-called free verse battles in the 1950s, to which we can link Kross’ translation of a selected collection of Éluard (Veel enne kostma peab, 1969 and Kaalep’s translation of a selected collection of Prévert (Kuidas portreteerida lindu, 1965. One of the two remaining translations by Kross, (Rostand’s Cyrano de Bergerac, 1964, can also be examined in relation to the problems of translating verse, but the other, (Béranger’s Laulud, 1963, should be discussed in the framework of intellectual and cultural resistance, a part of which was also the struggle put up for the existence of free verse in the 1950s and 1960s. Of August Sang’s original work, the article examines his collection of poems Võileib suudlusega (1963, written simultaneously with his translations of Molière’s plays and published right after them. Both the translations and the collection of original poems have attracted critics’ attention with their remarkable lack of linguistic constraint and simplicity. Although Sang has rarely voiced theoretical ideas about translation or explained his method, both his poetic image, outlined in the collection Võileib suudlusega, and his search for right words, reflected in the drafts of his translations, let us believe that the simplicity of expression and the avoidance of marked

Lapsepõlve igavesed armid / Aita Kivi

Index Scriptorium Estoniae

Kivi, Aita, 1954-

2001-01-01

Sisu : Tiia Kriisa. Võõras; Tove Ditlevsen. Lapsepõlve tänav; Tiina Tamman. Õie teekond; Elizabeth Kim. Kümme tuhat muret; Charles Bukowski. Postkontor; Charles Bukowski. Naised; Aarne Ruben. Volta annab kaeblikku vilet; Robyn Sisman. Lihtsalt sõbrad; Charlotte Bingham. Tähetolm; Spencer Johnson. Kes näppas minu juustu?; Jean Webster. Kallis vaenlane; Christoph Gann. Raoul Wallenberg

Maakonna tegu – Käsitööplahvatus

Index Scriptorium Estoniae

2016-01-01

Eesti Rahvakunsti ja Käsitöö Liidu juhatus andis teist korda välja auhinda “Maakonna tegu”, mille pälvis Pärnu Muuseumi näitus “Käsitöö plahvatus” 6.10.2015- 24.01.2016, mis koosnes kolmest alanäitusest “Loomast loodud”, “Puulased” ja “Helmes, sina kallis väike helmes ...”

Designing using Lego and Uno-Stacko: A Playful Architecture for an Integrated Kindergarten and Elementary School

Science.gov (United States)

Muthmainnah, K.; Aryanti, T.; Ardiansyah, A.

2017-03-01

The integrated kindergarten and elementary school is a public educational facility used for early age and elementary education. Designated for children at 4-12 years of age, the design should meet the standards and requirements, while considering children’s needs in their development phase. This paper discusses the design of an integrated kindergarten and elementary school using the playful theme. Design was explored using LEGO and UNO-STACKO to create spaces that accommodate material exploration for children. The design takes the play concept as a medium of child’s learning in order to improve their ability and awareness of the surrounding environment. The design translates the playful theme into imaginary dimension, constructive-deconstructive shapes, and glide circulations concept. The spatial pattern is applied by considering children’s behavior in the designated ages to trigger their creativity improvement. The design is expected to serve as a model of an integrated kindergarten and elementary school architecture.

Moessbauer spectrometer on the base of the UNO-4096-90 storage and Electronica D3-28 microcomputer for four spectra simultaneous registering

International Nuclear Information System (INIS)

Romanov, E.S.; Ivojlov, N.G.

1986-01-01

Basic circuits of buffer storage and equpment for interfacing the UNO-4096-90 storage with the ''Ehlektronika D3-28'' microcomputer, permitting to register simultaneously four Moessbauer spectra with zero dead time, are described. To eliminate completely the dead time, pulses from each detector enter two buffer counters, operating in turn in the regimes of registering and survey. Due to such performance of buffer storage mutual effect of counters is also excluded. The use of the circuits does not require any alterations in the computer and storage device

Educazione all'igiene orale ed eradicazione della carie dentale nellíinfanzia. Risultati finali di uno studio in un campione di popolazione infantile di Ferrara

OpenAIRE

M. Bergamini; P. Simioli; A. Stefanati; A. Grilli; P. Gregorio

2003-01-01

Introduzione: poichè nel 1985 l’O.M.S. collocò l’eradicazione della carie infantile fra gli obiettivi epidemiologici da raggiungere nella regione europea entro l’anno 2000, è stato effettuato uno screening microbiologico finalizzato all’isolamento di germi cariogeni nel cavo orale dei bambini.

Materiali e metodi: secondo le procedure correnti, sono stati eseguiti tamponi gengivo-coronali in 476 bambini delle ...

Syntheses, structural variants and characterization of AInM′S4 (A=alkali metals, Tl; M′ = Ge, Sn) compounds; facile ion-exchange reactions of layered NaInSnS4 and KInSnS4 compounds

International Nuclear Information System (INIS)

Yohannan, Jinu P.; Vidyasagar, Kanamaluru

2016-01-01

Ten AInM′S 4 (A=alkali metals, Tl; M′= Ge, Sn) compounds with diverse structure types have been synthesized and characterized by single crystal and powder X-ray diffraction and a variety of spectroscopic methods. They are wide band gap semiconductors. KInGeS 4 (1-β), RbInGeS 4 (2), CsInGeS 4 (3-β), TlInGeS 4 (4-β), RbInSnS 4 (8-β) and CsInSnS 4 (9) compounds with three-dimensional BaGa 2 S 4 structure and CsInGeS 4 (3-α) and TlInGeS 4 (4-α) compounds with a layered TlInSiS 4 structure have tetrahedral [InM′S 4 ] − frameworks. On the other hand, LiInSnS 4 (5) with spinel structure and NaInSnS 4 (6), KInSnS 4 (7), RbInSnS 4 (8-α) and TlInSnS 4 (10) compounds with layered structure have octahedral [InM′S 4 ] − frameworks. NaInSnS 4 (6) and KInSnS 4 (7) compounds undergo facile topotactic ion-exchange, at room temperature, with various mono-, di- and tri-valent cations in aqueous medium to give rise to metastable layered phases. - Graphical abstract: NaInSnS 4 and KInSnS 4 compounds undergo, in aqueous medium at room temperature, facile topotactic ion-exchange with mono, di and trivalent cations. Display Omitted - Highlights: • Ten AInM′S 4 compounds with diverse structure types were synthesized. • They are wide band gap semiconductors. • NaInSnS 4 and KInSnS 4 compounds undergo facile topotactic ion-exchange at room temperature.

Sotsiaalselt pime ja poliitiliselt impotentne teater / Alvar Loog

Index Scriptorium Estoniae

Loog, Alvar

2006-01-01

Poliitilisest ja sotsiaalsest teatrist Eestis 2005. aasta lavastuste põhjal : Pip Upponi "Adolf" Tartu Püssirohukeldris, lavastaja Ervin Õunapuu; Merle Karusoo "Misjonärid" Rakvere Teatris; Alistair Beatoni "Õnnetunne" Ugalas, lavastaja Jaak Allik; Toomas Kalli " Viimane sent" Vana Baskini Teatris, lavastaja Eino Baskin; George Orwelli "Loomade farm" Tallinna Linnateatris, lavastaja Mart Koldits; Kai Henseli "Klammi sõda" VAT Teatris, lavastaja Aare Toikka

"Monokliga" maailma vaadates / Eteri Kekelidze

Index Scriptorium Estoniae

Kekelidze, Eteri, 1944-

2001-01-01

1.-8. märtsini toimus Peterburis III monolavastuste festival "Monokkel 2001" deviisi all "Tema Kõrgus näitleja". Peaauhind jäeti välja andmata, selle asemel määrati kaks esimest auhinda. Eestit esindas Vene Draamateatri näitleja Ljubov Agapova "Ma ootan sind, kallis!" Autasu näitleja ei saanud, aga publik võttis näitlejanna soojalt vastu

Heino Harak : biodiislikütus paisataks Eesti tanklatesse 2006. aasta lõpuks / Heino Harak ; interv. Toivo Tänavsuu

Index Scriptorium Estoniae

Harak, Heino, 1941-

2005-01-01

Firma Biodiesel suuromanik vastab küsimustele, mis puudutavad biodiislikütuse tehase rajamist, kütuse müüki, tavalise diislikütuse ja biodiislikütuse hinna vahet, Werol Tehaste kava müüa oma osalus Biodieselis, biodiislikütuse võimalikku vabastamist aktsiisimaksust. Diagrammid: Biodiislikütus on aktsiisiga liiga kallis. Lisad: Biodiislikütusest on puudu kogu Euroopas; Kes ta on?

High performance W-AIN cermet solar coatings designed by modelling calculations and deposited by DC magnetron sputtering

Energy Technology Data Exchange (ETDEWEB)

Qi-Chu Zhang [The University of Sydney (Australia). School of Physics; Shen, Y.G. [City University of Hong Kong (Hong Kong). Department of Manufacturing Engineering and Engineering Management

2004-01-25

High solar performance W-AIN cermet solar coatings were designed using a numerical computer model and deposited experimentally. In the numerical calculations aluminium oxynitride (AlON) was used as ceramic component. The dielectric functions and then complex refractive index of W-AlON cermet materials were calculated using the Sheng's approximation. The layer thickness and W metal volume fraction were optimised to achieve maximum photo-thermal conversion efficiency for W-AlON cermet solar coatings on an Al reflector with a surface AlON ceramic anti-reflection layer. Optimisation calculations show that the W-AlON cermet solar coatings with two and three cermet layers have nearly identical solar absorptance, emittance and photo-thermal conversion efficiency that are much better than those for films with one cermet layer. The optimised calculated AlON/W-AlON/Al solar coating film with two cermet layers has a high solar absorptance of 0.953 and a low hemispherical emittance of 0.051 at 80{sup o}C for a concentration factor of 2. The AlN/W-AlN/Al solar selective coatings with two cermet layers were deposited using two metal target direct current magnetron sputtering technology. During the deposition of W-AlN cermet layer, both Al and W targets were run simultaneously in a gas mixture of argon and nitrogen. By substrate rotation a multi-sub-layer system consisting of alternating AlN ceramic and W metallic sub-layers was deposited that can be considered as a macro-homogeneous W-AlN cermet layer. A solar absorptance of 0.955 and nearly normal emittance of 0.056 at 80{sup o}C have been achieved for deposited W-AlN cermet solar coatings. (author)

18 octobre 2013 - Le Préfet de l’Ain L. Touvet signe le livre d'or avec le Directeur général du CERN R. Heuer et le Chef du Département Technologie F. Bordry. Photo de groupe, de gauche à droite: T. Kupisz, Secrétaire général de la sous préfecture de Gex; L. Miralles, Chef du Département Infrastructure et services généraux; F. Eder, Délégué aux Relations avec les Etats hôtes; S. Donnot, Sous-préfet de Gex; L. Touvet, Préfet de l'Ain; E. Sches, Sous-préfète de Nantua; E.Gröniger-Voss, Conseiller juridique du CERN; R. Heuer, Directeur général; F. Bordry, Chef du Département Technologie et P. Bloch, Chef du Département Physique.

CERN Multimedia

Anna Pantelia

2013-01-01

18 octobre 2013 - Le Préfet de l’Ain L. Touvet signe le livre d'or avec le Directeur général du CERN R. Heuer et le Chef du Département Technologie F. Bordry. Photo de groupe, de gauche à droite: T. Kupisz,\tSecrétaire général de la sous préfecture de Gex; L. Miralles, Chef du Département Infrastructure et services généraux; F. Eder, Délégué aux Relations avec les Etats hôtes; S. Donnot, Sous-préfet de Gex; L. Touvet, Préfet de l'Ain; E. Sches, Sous-préfète de Nantua; E.Gröniger-Voss, Conseiller juridique du CERN; R. Heuer, Directeur général; F. Bordry, Chef du Département Technologie et P. Bloch, Chef du Département Physique.

La transición de un modelo individualista e internista a uno más social y colaborativo en la formación universitaria

Directory of Open Access Journals (Sweden)

Luis Ángel Piedra García

2010-10-01

Full Text Available En el siguiente documento abordaremos el tema de los procesos de transición de una formación universitaria abundante en argumentos internistas, individualistas y competitivos por uno más social y colaborativo que nos aproxima al modo natural de enseñar y aprender en nuestra especie. Para ello hacemos un análisis general de algunos elementos claves en la formación universitaria analógica que rechaza la idea de que somos procesadores de información.

Gli infortuni lavorativi in minori: risultati di uno studio multicentrico italiano

Directory of Open Access Journals (Sweden)

G. Aggazzotti

2003-05-01

Full Text Available

Obiettivi: gli infortuni lavorativi, in particolare quelli subiti da minorenni, rappresentano un problema di notevole importanza sociale: in Italia, da dati INPS, risultano lavorare circa 68 adolescenti su 1000. L’obiettivo di questo studio è stato quello di raccogliere informazioni sugli infortuni lavorativi avvenuti a minori (14-17 anni in 14 città italiane nel periodo gennaio-giugno 2000. Metodi: si tratta di uno studio epidemiologico descrittivo, basato sulle informazioni raccolte consultando direttamente le cartelle cliniche presso centri di Pronto Soccorso (PS attivi nelle città coinvolte. Sono stati presi in considerazione tutti gli infortuni avvenuti a minori: tra questi sono stati considerati come lavorativi quelli accaduti nel corso di attività descritta come lavorativa e quelli occorsi “in itinere”. Le analisi statistiche sono state condotte con SPSS; è stata effettuata una cluster analysis per evidenziare eventuali sottogruppi omogenei. Risultati: la popolazione residente nelle aree indagate di età tra 14 e 17 anni è stata stimata in circa 850.000 soggetti, pari al 31% della popolazione italiana della stessa età: gli infortuni totali sono risultati 13423 di cui 317 lavorativi (2.4%. I soggetti di sesso maschile, diciassettenni, impiegati nel comparto industriale sono risultati il gruppo maggiormente coinvolto: la prognosi è risultata per lo più inferiore a 8 giorni. Sono apparse due diverse tipologie di infortunio: una riguarda i casi avvenuti in itinere, con caratteristiche molto simili agli incidenti stradali, e un’altra, più specifica, riguarda gli eventi sul posto di lavoro, dove si registrano lesioni al polso, alle mani, al capo e agli occhi con frequenza superiore rispetto agli infortuni in genere.

Conclusioni: il fenomeno è risultato non trascurabile, soprattutto tenendo conto del fatto che si riferisce solamente al lavoro minorile regolarmente

Differential Diagnosis of Malaria on Truelab Uno®, a Portable, Real-Time, MicroPCR Device for Point-Of-Care Applications.

Directory of Open Access Journals (Sweden)

Chandrasekhar Bhaskaran Nair

Full Text Available Sensitive and specific detection of malarial parasites is crucial in controlling the significant malaria burden in the developing world. Also important is being able to identify life threatening Plasmodium falciparum malaria quickly and accurately to reduce malaria related mortality. Existing methods such as microscopy and rapid diagnostic tests (RDTs have major shortcomings. Here, we describe a new real-time PCR-based diagnostic test device at point-of-care service for resource-limited settings.Truenat® Malaria, a chip-based microPCR test, was developed by bigtec Labs, Bangalore, India, for differential identification of Plasmodium falciparum and Plasmodium vivax parasites. The Truenat Malaria tests runs on bigtec's Truelab Uno® microPCR device, a handheld, battery operated, and easy-to-use real-time microPCR device. The performance of Truenat® Malaria was evaluated versus the WHO nested PCR protocol. The Truenat® Malaria was further evaluated in a triple-blinded study design using a sample panel of 281 specimens created from the clinical samples characterized by expert microscopy and a rapid diagnostic test kit by the National Institute of Malaria Research (NIMR. A comparative evaluation was done on the Truelab Uno® and a commercial real-time PCR system.The limit of detection of the Truenat Malaria assay was found to be <5 parasites/μl for both P. falciparum and P. vivax. The Truenat® Malaria test was found to have sensitivity and specificity of 100% each, compared to the WHO nested PCR protocol based on the evaluation of 100 samples. The sensitivity using expert microscopy as the reference standard was determined to be around 99.3% (95% CI: 95.5-99.9 at the species level. Mixed infections were identified more accurately by Truenat Malaria (32 samples identified as mixed versus expert microscopy and RDTs which detected 4 and 5 mixed samples, respectively.The Truenat® Malaria microPCR test is a valuable diagnostic tool and

Differential Diagnosis of Malaria on Truelab Uno®, a Portable, Real-Time, MicroPCR Device for Point-Of-Care Applications.

Science.gov (United States)

Nair, Chandrasekhar Bhaskaran; Manjula, Jagannath; Subramani, Pradeep Annamalai; Nagendrappa, Prakash B; Manoj, Mulakkapurath Narayanan; Malpani, Sukriti; Pullela, Phani Kumar; Subbarao, Pillarisetti Venkata; Ramamoorthy, Siva; Ghosh, Susanta K

2016-01-01

Sensitive and specific detection of malarial parasites is crucial in controlling the significant malaria burden in the developing world. Also important is being able to identify life threatening Plasmodium falciparum malaria quickly and accurately to reduce malaria related mortality. Existing methods such as microscopy and rapid diagnostic tests (RDTs) have major shortcomings. Here, we describe a new real-time PCR-based diagnostic test device at point-of-care service for resource-limited settings. Truenat® Malaria, a chip-based microPCR test, was developed by bigtec Labs, Bangalore, India, for differential identification of Plasmodium falciparum and Plasmodium vivax parasites. The Truenat Malaria tests runs on bigtec's Truelab Uno® microPCR device, a handheld, battery operated, and easy-to-use real-time microPCR device. The performance of Truenat® Malaria was evaluated versus the WHO nested PCR protocol. The Truenat® Malaria was further evaluated in a triple-blinded study design using a sample panel of 281 specimens created from the clinical samples characterized by expert microscopy and a rapid diagnostic test kit by the National Institute of Malaria Research (NIMR). A comparative evaluation was done on the Truelab Uno® and a commercial real-time PCR system. The limit of detection of the Truenat Malaria assay was found to be <5 parasites/μl for both P. falciparum and P. vivax. The Truenat® Malaria test was found to have sensitivity and specificity of 100% each, compared to the WHO nested PCR protocol based on the evaluation of 100 samples. The sensitivity using expert microscopy as the reference standard was determined to be around 99.3% (95% CI: 95.5-99.9) at the species level. Mixed infections were identified more accurately by Truenat Malaria (32 samples identified as mixed) versus expert microscopy and RDTs which detected 4 and 5 mixed samples, respectively. The Truenat® Malaria microPCR test is a valuable diagnostic tool and implementation should be

Kaberla kalmistu 12.-13. sajandi klaashelmed / Irita Kallis

Index Scriptorium Estoniae

Kallis, Irita

2010-01-01

Kaberla kalmistult leitud klaashelmestest, põhitähelepanu on 12.-13. saj. matuste inventari hulka kuulunud leiumaterjalil. Ülevaade helmeste esimemisvariatsioonidest helmekeedes, võimalikust tähendusest ja väärtusest ning samatüübiliste helmeste dateeringutest naaberaladel

Unistuste Rail Baltic - ilus ja kallis / Mikk Salu

Index Scriptorium Estoniae

Salu, Mikk, 1975-

2011-01-01

Rail Balticu puhul on tähtsaim küsimus, kas uut raudteeühendust on üldse vaja, mitte aga see, kas tee läheb läbi Tartu või Pärnu. Konsutatsioonifirma AECOM koostatud raportist Rail Balticu tasuvuse kohta

Design prototype detection tools of Porous Tree using microcontroller Arduino Uno R3 and piezoelectric sensor

Science.gov (United States)

Sujadi, H.; Bastian, A.; Tira

2018-05-01

In the city, many trees are found uprooted and cause accidents and many losses. No exception in the area of Majalengka Regency of West Java Province which can also anytime an accident or disaster caused by fallen trees, where in Majalengka district is logging trees on the street and public places are not done regularly. Based on the above problems, the need for tools that can detect a porous tree, to assist in the sorting of trees which should be felled and not felled by the party who has the authority of the general management of BMCK. Previously created tools to detect porous trees imported from Hungary and Germany, namely Arbosonic3D and Sonic Tomography. This design uses piezoelectric sensors to detect how much pressure is received by fragile and fragile trees, of course the fragile and fragile strength of trees will be different when exposed to the same pressure given the fragile density of fragile and fragile trees, then the data sent to Arduino Uno R3 to be processed into an information. This research produces a means of detecting the loss of a tree for early detection and no falling trees.

Download this PDF file

African Journals Online (AJOL)

Professor of Genetics (Cytogenetics), Faculty of Medicine, Ain Shams University, Cairo, Egypt. Hosam A Abdel-Ghany. Consultant of Medical Human Genetics, Medical Genetic Center, Ain Shams University, Cairo, Egypt. Nermin S Elsayed. Consultant of Medical Human Genetics, Medical Genetics Center, Ain Shams ...

Concilier développement agricole et usage pérenne des eaux souterraines : un dialogue multi-acteurs dans la zone d’Ain Timguenay (province de Séfrou

Directory of Open Access Journals (Sweden)

Issam Sellika

2016-10-01

Full Text Available Au Maroc, l’utilisation des eaux souterraines pour l’irrigation a permis un développement agricole rapide dans de nombreuses régions, mais a aussi fait émerger des situations de baisse des niveaux piezométriques des nappes qui menacent la durabilité de cette agriculture irriguée. L’article présente une action de recherche portant sur la conception d’un projet de territoire agricole durable alliant développement agricole et usage pérenne des ressources en eau souterraine. L’étude a eu lieu dans la zone d’Ain Timguenay (province de Séfrou, qui connait un fort développement de la production de pommes et de prunes depuis une quinzaine d’années. Le programme de recherche a impliqué les agriculteurs, la commune rurale d’Ain Timguenay, les institutions du Ministère de l’Agriculture et l’Agence de bassin hydraulique du Sébou. Une analyse des dynamiques agricoles locales et des tendances nationales a servi de support aux discussions. L’étude de l’aquifère et de ses usages a permis d’établir un bilan sommaire et un ordre de grandeur des surfaces qui pourraient encore être plantées sans que les consommations en eau soient supérieures à la recharge de l’aquifère en année pluviométrique moyenne. Une réflexion prospective menée avec les agriculteurs a mis en évidence deux scénarios possibles à l’échelle locale: 1 un scénario où les difficultés économiques que rencontrent actuellement les exploitations de la zone se renforcent, conduisant à un ralentissement des nouvelles plantations, d’où une pression limitée sur la nappe ; 2 un scénario où les exploitations réussissent à faire face aux défis actuels de production et de commercialisation et de ce fait continuent à planter, ce qui conduit à une consommation en eau bien supérieure à la recharge de la nappe. L’ensemble des acteurs impliqués a participé à l’élaboration d’un troisième scénario permettant de concilier d

Näitus "Sajand eesti puugravüüri klotsidel" / Jüri Hain

Index Scriptorium Estoniae

Hain, Jüri, 1941-

2007-01-01

Eesti Rahvusraamatukogus 15. I-3. II eksponeeritud ja rahvusraamatukogu kollektsioonist koostatud näitusest "Sajand eesti puugravüüri klotsidel: 1840-1940". Järgmistest kunstnikest ja nende töödest: Aleksander Otto Gern, Bogdan Gottlieb Friedrich Kally, August Daugell, Hermann Eduard Hartmann, Eduard Magnus Jakobson, Mart Pukits, Andres Kuusk, Karl Friedrich Schnell, Anton Suurkask (1873-1965), Arkadio Laigo, Hando Mugasto, Eduard Järv, Richard Kaljo, Ott Kangilaski, Ants Puks (1918-?), Salome Trei

Illusiooni võitlus igavusega ehk Kes teatris ei käi, see ise on / Andrus Laansalu, Margus Kasterpalu

Index Scriptorium Estoniae

Laansalu, Andrus

1996-01-01

Dialoog. Draamateatri külalisetendused Tartus: Oskar Lutsu - Toomas Kalli 'Tagahoovis' (lav. Eino Baskin); William Shakespeare'i 'Eksituste komöödia' (lav. Evald Hermaküla); Pierre Corneille' 'Näitaja näitab ja vaataja vaatab ehk Illusioon' (lav. Mati Unt); Arthur Milleri 'Vaade sillalt' (Mikk Mikiver); Peter Shafferi 'Leekrüübe' (Priit Pedajas) ja 'Amadeus' (Kalju Komissarov); Alan Ayckbourni 'Intiimsed tehingud' ja Noel Cowardi 'Heinapalavik' (mõlemad Ivo Eensalu)

La conservación de la energía: un principio de toda la física. Una propuesta y unos resultados

OpenAIRE

Solbes Matarredona, Jordi; Tarín, Francisco

2004-01-01

Resumen. La conservación de la energía es uno de los conceptos más importantes de la física porque unifi ca todos los fenómenos. En este artículo presentamos algunos resultados de una investigación sobre el proceso de enseñanza-aprendizaje del concepto de energía y su conservación realizado en el nivel de la educación secundaria española. El análisis de los datos pone de manifiesto que la conservación de la energía se introduce en mecánica y termodinámica pero no en todos los campos de la fís...

La conservación de la energía : un principio de toda la física : una propuesta y unos resultados

OpenAIRE

Solbes Matarredona, Jordi

2004-01-01

La conservación de la energía es uno de los conceptos más importantes de la física porque unifica todos los fenómenos. En este artículo presentamos algunos resultados de una investigación sobre el proceso de enseñanza-aprendizaje del concepto de energía y su conservación realizado en el nivel de la educación secundaria española. El análisis de los datos pone de manifiesto que la conservación de la energía se introduce en mecánica y termodinámica pero no en todos los campos de la física. Los r...

Metal nitride coatings by physical vapor deposition (PVD) for a wear resistant aluminum extrusion die.

Science.gov (United States)

Lee, Su Young; Kim, Sang Ho

2014-12-01

The purpose of this study is to investigate the friction and wear behaviors of CrN, TiN, CrAlN, and TiAIN coated onto SKD61 for application to Al 7000 series extrusion dies. On the wear test, the experimental parameters are the load and the counter material's temperature. The results showed that the friction coefficient increased with load but decreased with the counter material's temperature, and the friction coefficients of CrN and CrAIN were lower than the friction coefficients of TiAIN and TIN, especially at a higher temperature. The wear track with different coatings identified different wear behaviors; the wear behavior of CrAIN was found to be abrasive, but the wear behavior of TiN, CrN, and TiAIN was adhesive. Therefore, CrAIN showed the least wear loss with a lower friction coefficient and less adhesion with counter materials at the highest range of wear load and temperature. This resulted in the easy formation of aluminum oxide in the wear track and less Al adhesion; moreover during the hard second phase, AIN dispersed in the film during deposition.

Manejo del embarazo gemelar cuando muere uno de los fetos Conservative management of twin gestation after death of one fetus

Directory of Open Access Journals (Sweden)

Ómar Armando Méndez Gallo

1992-02-01

Full Text Available

Se presenta un caso de embarazo gemelar manejado en forma conservadora después de la muerte de uno de los fetos. Con base en él, y en una revisión bibliográfica, se hacen recomendaciones para el seguimiento y el manejo del gemelo sobreviviente y énfasis sobre las posibles complicaciones materno-fetales.

We report on the case of a twin gestation that was conservatively managed after the death of one of the fetuses. Based on this experience and on a bibliographic review on the subject, we make recommendations for the follow-up and the care of these situations, with emphasis on maternal and fetal complications.

Valutazione della qualitá dei dati in uno studio post marketing

Directory of Open Access Journals (Sweden)

D. D’Alessandro

2003-05-01

Full Text Available

Obiettivo: misurare l'affidabilita nella segnalazione
di eventi avversi a vaccino nell'ambito di uno studio post-marketing sulla tollerabilita della vaccinazione antipneumococcica (AP in associazione con la vaccinazione antinfluenzale (AI nella popolazione anziana.

Metodi: e stato predisposto un modello di regressione
logistica per stimare gli OR tra la segnalazione di almeno un effetto collaterale locale (y ed alcune variabili individuali dei vaccinati (x1: eta .75 anni; x2: sesso; x3: allergie; x4: associazione AI+AP; x5: vivere solo; x6: patologie croniche. I medici aderenti al progetto (229 sono stati stratificati in cinque categorie in funzione dellfincidenza media di eventi avversi da loro registrata: 0% (29, 1-5%
(68, 6-10% (50, 11-50% (72, .50% (10. Lo stesso modello di regressione e stato applicato ai quattro
sotto-gruppi di vaccinati afferenti alle categorie di medici che hanno segnalato sintomi, per valutare la coerenza degli OR registrati nei gruppi.

Risultati: tra i 29.086 vaccinati, l'f11,3% (3.278 ha segnalato almeno un evento avverso locale nelle
72 ore successive alla vaccinazione: 9,9% tra i soggetti vaccinati con AI e 13,9% tra i vaccinati con
AI+AP. I fattori significativamente associati all'faumento di rischio sono: AI+AP (OR 1,4; allergie (OR 1,3; patologie croniche (OR 1,3. L' applicazione del modello di regressione ai sotto-gruppi di vaccinati ha mostrato un trend negli OR per le categorie di medici che hanno segnalato dall'f1-5% fino all'f11- 50%, mostrando un'effettiva differenza di rischio dei pazienti.

Tale coerenza non si e evinta nell'ultima categoria (.50%, dove tali fattori appaiono addiritura protettivi nei riguardi dei sintomi (AI+AP: OR 0,5; allergie: OR 0,7, o non associati
(patologie croniche: OR 1,0.

Conclusioni: il 4,3% dei medici arruolati nello studio (10 su 229 ha

Puugravüüriklotsid kõnelevad / Jüri Hain

Index Scriptorium Estoniae

Hain, Jüri, 1941-

2007-01-01

Näitus "Sajand eesti puugravüüri klotsidel Eesti Rahvusraamatukogu kollektsioonist" rahvusraamatukogus 15. I - 3. II. Näitusel on vanim klots aastast 1842, noorim 1941. aastast. Kunstnikest (Aleksander Otto Gern, Bogdan Gottlieb Friedrich Kally, August Daugell, Eduard Magnus Jakobson, Mart Pukits, Andres Kuusk, Anton Suurkask, Arkadio Laigo, Hando Mugasto, Eduard Järv, Paul Liivak, Salome Trei, Ott Kangilaski), töödest. Näitust täiendavad Eduard Wiiralti "Tüdruku pea" (1919) kaks linoollõikeplaati

Aeg on Soome ja Rootsi töösturid kinni püüda / Taivo Paju, Kärt Blumberg

Index Scriptorium Estoniae

Paju, Taivo, 1968-

2008-01-01

Ettevõtete edutegurite üle arutlevad Arengufondi juhatuse liige Heido Vitsur, Balti Uuringute Instituudi juhatuse esimees Marek Tiits, TTÜ mehhaanikateaduskonna professor Rein Küttner. Vt. samas: Ketlin Priilinn. Metsikult kallis küll, kuid seda väärt; Merike Teder. Uute seadmeteta oleksime kadunud (ilmunud ka Molodjozh Estonii : Biznes Sreda 16. apr. lk. 8); Taivo Paju. Pelmeenikuningas Ivan Zakotei (ilmunud ka Molodjozh Estonii : Biznes Sreda 30. apr. lk. 11); Poolteist kuud ja tehas töökorras

Allergic Interstitial Nephritis Manifesting as a Striated Nephrogram

Directory of Open Access Journals (Sweden)

Irfan Moinuddin

2015-01-01

Full Text Available Allergic interstitial nephritis (AIN is an underdiagnosed cause of acute kidney injury (AKI. Guidelines suggest that AIN should be suspected in a patient who presents with an elevated serum creatinine and a urinalysis that shows white cells, white cell casts, or eosinophiluria. Drug-induced AIN is suspected if AKI is temporally related to the initiation of a new drug. However, patients with bland sediment and normal urinalysis can also have AIN. Currently, a definitive diagnosis of AIN is made by renal biopsy which is invasive and fraught with risks such as bleeding, infection, and hematoma. Additionally, it is frequently unclear when a kidney biopsy should be undertaken. We describe a biopsy proven case of allergic interstitial nephritis which manifested on contrast enhanced Magnetic Resonance Imaging (MRI as a striated nephrogram. Newer and more stable macrocyclic gadolinium contrast agents have a well-demonstrated safety profile. Additionally, in the presentation of AKI, gadolinium contrast agents are safe to administer in patients who demonstrate good urine output and a downtrending creatinine. We propose that the differential for a striated nephrogram may include AIN. In cases in which the suspicion for AIN is high, this diagnostic consideration may be further characterized by contrast enhanced MRI.

Risk Factors for the presence of anal intraepithelial neoplasia in HIV+ men who have sex with men

NARCIS (Netherlands)

Richel, Olivier; de Vries, Henry J. C.; Dijkgraaf, Marcel G. W.; van Noesel, Carel J. M.; Prins, Jan M.

2013-01-01

Anal Intraepithelial Neoplasia (AIN) is present in the majority of HIV+ men who have sex with men (MSM) and routine AIN-screening is subject of discussion. In this study we analysed a wide range of potential risk factors for AIN in order to target screening programs. We screened 311 HIV+ MSM by high

Anterior interosseous nerve syndrome diagnosis and intraoperative findings: A case report

Directory of Open Access Journals (Sweden)

Abdulla Aljawder

2016-01-01

Conclusion: Clinical suspicion should arise in the presence of isolated paralysis of the AIN-supplied muscles. MRI and electrodiagnostic studies will confirm the diagnosis and identify the etiology. The optimal treatment of AIN syndrome has not been established. We recommend surgical intervention in confirmed AIN syndrome from compression neuropathy, refractive to conservative therapy.

Jebel Hafit and the Al Ain oases (Eastern Abu Dhabi, United Arab Emirates): an integrative approach of a cultural landscape through the scope of geodiversity

Science.gov (United States)

Giusti, Christian; Louchet, André; Beuzen-Waller, Tara; Ragala, Rachid; Pavlopoulos, Kosmas; Fouache, Éric; Cohen, Marianne; Desruelles, Stéphane; Gramond, Delphine

2015-04-01

human settlements and occupation, it is possible to characterize a threefold transition: first, the former transition between the pre-Islamic prehistoric societies and the development of Muslim societies; second, the more recent transition between the traditional historical society (farmers) and the contemporary society, characterized by the growth of urbanization, the creation of modern transport infrastructure and the concomitant growth of tourist flows; third, the current transition between the yesterday and tomorrow Al Ain City, due to the transformation of a local town centred on national economics all along the second half of the twentieth century, into an international town more open to the wider world with the management of a possible increased 20 % of tourist flow because of the inscription of Cultural Sites of Al Ain on the UNESCO's World Heritage List. It is not possible to completely ignore the fact that the Jebel Hafit and its foothills are partly crossed by an international boundary. In case of political tensions, this may cause some difficulties for the management of this territory, with contradictory requirements between security, tourism, traditional land use, and scientific research.

Acute interstitial nephritis with acetaminophen and alcohol intoxication

Directory of Open Access Journals (Sweden)

Alexopoulou Iakovina

2011-04-01

Full Text Available Abstract Drug-induced acute interstitial nephritis (AIN represents a growing cause of renal failure in current medical practice. While antimicrobials and non-steroidal anti-inflammatory drugs are typically associated with drug-induced AIN, few reports have been made on the involvement of other analgesics. We report our experience in managing a 17-year-old female with AIN and subsequent renal injury following an acetaminophen overdose in conjunction with acute alcohol intoxication. It is well established that acetaminophen metabolism, particularly at high doses, produces reactive metabolites that may induce renal and hepatic toxicity. It is also plausible however, that such reactive species could instead alter renal peptide immunogenicity, thereby inducing AIN. In the following report, we review a possible mechanism for the acetaminophen-induced AIN observed in our patient and also discuss the potential involvement of acute alcohol ingestion in disease onset. The objective of our report is to increase awareness of healthcare professionals to the potential involvement of these commonly used agents in AIN pathogenesis.

Syntheses, structural variants and characterization of AInM′S{sub 4} (A=alkali metals, Tl; M′ = Ge, Sn) compounds; facile ion-exchange reactions of layered NaInSnS{sub 4} and KInSnS{sub 4} compounds

Energy Technology Data Exchange (ETDEWEB)

Yohannan, Jinu P.; Vidyasagar, Kanamaluru, E-mail: kvsagar@iitm.ac.in

2016-06-15

Ten AInM′S{sub 4} (A=alkali metals, Tl; M′= Ge, Sn) compounds with diverse structure types have been synthesized and characterized by single crystal and powder X-ray diffraction and a variety of spectroscopic methods. They are wide band gap semiconductors. KInGeS{sub 4}(1-β), RbInGeS{sub 4}(2), CsInGeS{sub 4}(3-β), TlInGeS{sub 4}(4-β), RbInSnS{sub 4}(8-β) and CsInSnS{sub 4}(9) compounds with three-dimensional BaGa{sub 2}S{sub 4} structure and CsInGeS{sub 4}(3-α) and TlInGeS{sub 4}(4-α) compounds with a layered TlInSiS{sub 4} structure have tetrahedral [InM′S{sub 4}]{sup −} frameworks. On the other hand, LiInSnS{sub 4}(5) with spinel structure and NaInSnS{sub 4}(6), KInSnS{sub 4}(7), RbInSnS{sub 4}(8-α) and TlInSnS{sub 4}(10) compounds with layered structure have octahedral [InM′S{sub 4}]{sup −} frameworks. NaInSnS{sub 4}(6) and KInSnS{sub 4}(7) compounds undergo facile topotactic ion-exchange, at room temperature, with various mono-, di- and tri-valent cations in aqueous medium to give rise to metastable layered phases. - Graphical abstract: NaInSnS{sub 4} and KInSnS{sub 4} compounds undergo, in aqueous medium at room temperature, facile topotactic ion-exchange with mono, di and trivalent cations. Display Omitted - Highlights: • Ten AInM′S{sub 4} compounds with diverse structure types were synthesized. • They are wide band gap semiconductors. • NaInSnS{sub 4} and KInSnS{sub 4} compounds undergo facile topotactic ion-exchange at room temperature.

[Economic impact of etanercept and adalimumab biosimilars on hospitals scale covered by PharmAlp'Ain, a hospitals grouping of orders for health products].

Science.gov (United States)

Berreur, B; Guerin, F; Christophe, B; Limido, G; Paubel, P

2018-01-01

To evaluate the economic impact of future prescriptions of etanercept and adalimumab biosimilars at the territorial scale covered by PharmAlp'Ain, a hospitals grouping of orders for health products. Determination of the number and status of patients (naive or in continuation of treatment) from the National Database "Datamart de Consommation Inter-Régimes" of health insurance, concerned by a dispensation in a pharmacy of etanercept or adalimumab in 2015. Calculation of potential savings in case of biosimilar requirements according to 3 hypotheses: 63% (rate observed in a previous study) of initiations are treated with biosimiliaries and the others by princeps (H 1 ); all initiations under biosimilars and continuation therapy with the princeps (H 2 ) or all patients are treated with biosimilars (H 3 ). The annual savings are estimated at 237,000 € with the H 1 hypothesis. In the case of H 2 , the expected savings would be 376,200 € per year. In the case of H 3 , savings for the community could reach almost 1,282,800 € per year. The arrival of biosimilars allows significant savings for medicines market. According to the French recommendations in 2016, the expected savings are between the H 1 and H 2 hypothesis. The rate of penetration of biosimilars depends on many factors such as the involvement of health professionals, patient adherence, or health authority recommendations. Copyright © 2017 Académie Nationale de Pharmacie. Published by Elsevier Masson SAS. All rights reserved.

Trimethoprim-sulfamethoxazole induced acute interstitial nephritis in renal allografts; clinical course and outcome.

LENUS (Irish Health Repository)

Garvey, J P

2009-11-01

Acute interstitial nephritis (AIN) secondary to trimethoprim-sulfamethoxazole (TMP-SMX) is well documented as a cause of acute renal failure in native kidneys. TMP-SMX is the standard prophylactic agent against pneumocystis carinii (PCP) used in the early post-transplant period, however, it has to date only been indirectly associated with AIN in renal allografts. DESIGN, SETTING, PARTICIPANTS AND MEASUREMENTS: We describe eleven renal transplant patients with acute allograft dysfunction in whom a transplant biopsy demonstrated primary histopathologic features of allergic AIN, all of whom were receiving TMP-SMX in addition to other medications known to cause AIN.

Numero Uno.

Science.gov (United States)

Palmaffy, Tyce

1998-01-01

Describes the Ysleta School District, El Paso (Texas), which has, despite high poverty and a constant inflow of immigrants with limited English skills, the best test scores of any urban district in Texas. In spite of the district's accomplishments, the school board seems determined to oust the current superintendent. (SLD)

An analysis of pancreas transplantation outcomes based on age groupings--an update of the UNOS database.

Science.gov (United States)

Siskind, Eric; Maloney, Caroline; Akerman, Meredith; Alex, Asha; Ashburn, Sarah; Barlow, Meade; Siskind, Tamar; Bhaskaran, Madhu; Ali, Nicole; Basu, Amit; Molmenti, Ernesto; Ortiz, Jorge

2014-09-01

Previously, increasing age has been a part of the exclusion criteria used when determining eligibility for a pancreas transplant. However, the analysis of pancreas transplantation outcomes based on age groupings has largely been based on single-center reports. A UNOS database review of all adult pancreas and kidney-pancreas transplants between 1996 and 2012 was performed. Patients were divided into groups based on age categories: 18-29 (n = 1823), 30-39 (n = 7624), 40-49 (n = 7967), 50-59 (n = 3160), and ≥60 (n = 280). We compared survival outcomes and demographic variables between each age grouping. Of the 20 854 pancreas transplants, 3440 of the recipients were 50 yr of age or above. Graft survival was consistently the greatest in adults 40-49 yr of age. Graft survival was least in adults age 18-29 at one-, three-, and five-yr intervals. At 10- and 15-yr intervals, graft survival was the poorest in adults >60 yr old. Patient survival and age were found to be inversely proportional; as the patient population's age increased, survival decreased. Pancreas transplants performed in patients of increasing age demonstrate decreased patient and graft survival when compared to pancreas transplants in patients age. © 2014 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

Non-native acylated homoserine lactones reveal that LuxIR quorum sensing promotes symbiont stability

Science.gov (United States)

Ho, Jessica S.; Geske, Grant D.; Blackwell, Helen E.; Ruby, Edward G.

2014-01-01

SUMMARY Quorum sensing, a group behavior coordinated by a diffusible pheromone signal and a cognate receptor, is typical of bacteria that form symbioses with plants and animals. LuxIR-type acyl homoserine-lactone (AHL) quorum sensing is common in Gram-negative proteobacteria, and many members of this group have additional quorum-sensing networks. The bioluminescent symbiont Vibrio fischeri encodes two AHL signal synthases: AinS and LuxI. AinS-dependent quorum sensing converges with LuxI-dependent quorum sensing at the LuxR regulatory element. Both AinS- and LuxI-mediated signaling are required for efficient and persistent colonization of the squid host, Euprymna scolopes. The basis of the mutualism is symbiont bioluminescence, which is regulated by both LuxI- and AinS-dependent quorum sensing, and is essential for maintaining a colonization of the host. Here, we used chemical and genetic approaches to probe the dynamics of LuxI- and AinS-mediated regulation of bioluminescence during symbiosis. We demonstrate that both native AHLs and non-native AHL analogs can be used to non-invasively and specifically modulate induction of symbiotic bioluminescence via LuxI-dependent quorum sensing. Our data suggest that the first day of colonization, during which symbiont bioluminescence is induced by LuxIR, is a critical period that determines the stability of the V. fischeri population once symbiosis is established. PMID:24191970

Views and experiences of mental health nurses working with undergraduate assistants in nursing in an acute mental health setting.

Science.gov (United States)

Cleary, Michelle; Horsfall, Jan; O'Hara-Aarons, Maureen; Mannix, Judy; Jackson, Debra; Hunt, Glenn E

2012-04-01

Undergraduate nurses are employed as assistants in nursing (AIN) in inpatient mental health settings; however, there is a paucity of published research exploring registered nurses' (RN) views about the AIN role in these settings. This qualitative study documents the views and experiences of RN working with undergraduate AIN. Fifty structured face-to-face interviews were analysed, and the results are discussed in three sections. The first section outlines RN perceptions of qualities and skills required of AIN in mental health, and the responses primarily focus on communication skills, initiative, and willingness to learn. The second section targets factors in the workplace that might enhance the interest of AIN in a mental health nursing career; the responses emphasize their need to work with experienced staff. The last section outlines RN expectations of AIN, most of which are met and involve physical observations and technical tasks; less fulfilled activities primarily cluster around interactions with patients. Findings highlight the advantages and disadvantages of drawing on undergraduate nursing students as AIN in mental health settings. Communication skills, personal initiative, safety training to prevent violence, and education to increase knowledge and awareness about mental illness, diagnosis, and mental status-related skills were all important concerns articulated by RN. © 2011 The Authors. International Journal of Mental Health Nursing © 2011 Australian College of Mental Health Nurses Inc.

Epidemiology of acute poisoning in children presenting to the poisoning treatment center at Ain Shams University in Cairo, Egypt, 2009-2013.

Science.gov (United States)

Azab, Sonya M S; Hirshon, Jon Mark; Hirshon, John Mark; Hayes, Bryan D; El-Setouhy, Maged; Smith, Gordon S; Sakr, Mahmoud Lotfy; Tawfik, Hany; Klein-Schwartz, Wendy

2016-01-01

Pediatric poisonings represent a major and preventable cause of morbidity and mortality throughout the world. Epidemiologic information about poisoning among children in many lower- and middle-income countries is scarce. This study describes the epidemiology of acute poisonings in children presenting to Ain Shams University's Poisoning Treatment Center (ASU-PTC) in Cairo and determines the causative agents and characteristics of acute poisoning in several pediatric age groups. This retrospective study involved acutely poisoned patients, 0-18 years of age, who presented to the ASU-PTC between 1 January 2009 and 31 December 2013. Data were extracted from electronic records maintained by the ASU-PTC. Collected data included demographics, substance of exposure, circumstances of the poisoning, patient disposition, and outcome. During the 5-year study period, 38 470 patients meeting our criteria were treated by the ASU-PTC; 19 987 (52%) were younger than 6 years of age; 4196 (11%) were 6-12 years; and 14 287 (37%) were >12 years. Unintentional poisoning accounted for 68.5% of the ingestions, though among adolescents 84.1% of ingestions were with self-harm intent. In all age groups, the most frequent causative drugs were non-opioid analgesics, antipyretics, and antirheumatics. The most common nonpharmaceutical agents were corrosives in preschool children and pesticides in adolescents. Most patients had no/minor effects (29 174 [75.8%]); hospitalization rates were highest among adolescents. There were 119 deaths (case fatality rate of 0.3), primarily from pesticide ingestion. Poisoning in preschool children is mainly unintentional and commonly due to nonpharmaceutical agents whereas poisoning in adolescents is mainly intentional (self-harm). Pesticides, mainly organophosphorous compounds and carbamates, were the most frequent agents leading to morbidity and mortality.

Time Management and Its Relation To Students’ Stress, Gender and Academic Achievement Among Sample of Students at Al Ain University of Science and Technology, UAE

Directory of Open Access Journals (Sweden)

Ahmad Saleh Al Khatib

2014-05-01

Full Text Available The objective of the present study was to investigate the relationship between time management, perceived stress, gender and academic achievement among United Arab Emirates college students. The respondents were 352 college students from Al Ain University of Science and Technology. The sample was stratified by sex. Among the respondents, 52.5% were female students and 47.5% were male students. The mean age of the sample was 23.4 years ranging from 18 to 39. Time management was measured by Time Management Questionnaire” developed by Britton and Tesser (1991, while perceived stress was measured by The Perceived Stress Scale developed by Cohen (1985. The findings of the study showed that there was statistically significant negative relationship between time management and perceived stress. Females reported higher time management compared to their males counter mates. Higher time management and lower perceived stress were associated with high levels of academic achievement. However, time management was the most significant predictor of academic achievement accounting for 26 % of the variance while perceived stress accounted for an additional 11.2% of the variance in academic achievement. All three predictors explained 29.4% (R = .543 of total variance. The implications and limitations are reviewed as are the suggestions for future research.   Keywords: Time management, perceived stress, academic achievement, college students.

Colonic aberrant crypt formation accompanies an increase of opportunistic pathogenic bacteria in C57BL/6 mice fed a high-fat diet.

Science.gov (United States)

Zeng, Huawei; Ishaq, Suzanne L; Liu, Zhenhua; Bukowski, Michael R

2018-04-01

The increasing worldwide incidence of colon cancer has been linked to obesity and consumption of a high-fat Western diet. To test the hypothesis that a high-fat diet (HFD) promotes colonic aberrant crypt (AC) formation in a manner associated with gut bacterial dysbiosis, we examined the susceptibility to azoxymethane (AOM)-induced colonic AC and microbiome composition in C57/BL6 mice fed a modified AIN93G diet (AIN, 16% fat, energy) or an HFD (45% fat, energy) for 14 weeks. Mice receiving the HFD exhibited increased plasma leptin, body weight, body fat composition and inflammatory cell infiltration in the ileum compared with those in the AIN group. Consistent with the gut inflammatory phenotype, we observed an increase in colonic AC, plasma interleukin-6, tumor necrosis factor-α, monocyte chemoattractant protein-1 and inducible nitric oxide synthase in the ileum of the HFD-AOM group compared with the AIN-AOM group. Although the HFD and AIN groups did not differ in bacterial species number, the HFD and AIN diets resulted in different bacterial community structures in the colon. The abundance of certain short-chain fatty acid (SCFA) producing bacteria (e.g., Barnesiella) and fecal SCFA (e.g., acetic acid) content were lower in the HFD-AOM group compared with the AIN and AIN-AOM groups. Furthermore, we identified a high abundance of Anaeroplasma bacteria, an opportunistic pathogen in the HFD-AOM group. Collectively, we demonstrate that an HFD promotes AC formation concurrent with an increase of opportunistic pathogenic bacteria in the colon of C57BL/6 mice. Published by Elsevier Inc.

Kallis müügitrikk laste arvel / Priit Pullerits

Index Scriptorium Estoniae

Pullerits, Priit, 1965-

2010-01-01

Piret Raua digitaalsest pildiraamatust lastele "Emma roosad asjad" (Suurbritannia : WingedChariot, 2010), mida on võimalik kasutada Apple´i elektroonikatoodetes iPad, iPhone ja iPod (eesti, inglise ja jaapani keeles)

Pikad pühad ja kallis propaganda / Endel Rihvk

Index Scriptorium Estoniae

Rihvk, Endel

2007-01-01

Ilmunud ka: Kesknädal, 5. dets. 2007, lk. 4. Autor kritiseerib Eesti Vabariigi 90. aastapäeva aastapikkust tähistamist ja sellega seotud kulutamist ning kampaaniat Tallinna linnavõimu ettevõtmiste näitamist kõverpeeglis

"Kurja lillede" kuus ärakeelatud luuletust / Charles Baudelaire ; saatesõna: Marek Tamm

Index Scriptorium Estoniae

Baudelaire, Charles

2000-01-01

Sisu: Kalliskivid / tlk. Ain Kaalep ; Lethe / tlk. Märt Väljataga ; Temale, kes on liiga rõõmus / tlk. Ain Kaalep ; Lesbos / tlk. Ilmar Laaban ; Äraneetud naised (Delphine ja Hyppolyte) / tlk. Ain Kaalep ; Vampiiri metamorfoosid / tlk. August Sang. Orig.: Les Bijoux ; Le Léthé ; A celle qui est trop gaie ; Lesbos ; Femmes damnées. Delphine et Hippolyte ; Les Métamorphoses du vampire

El lado siniestro de la metáfora “nativos” versus “inmigrantes” digitales: El caso de unos profesores de escuela media de Misiones

Directory of Open Access Journals (Sweden)

Laura Siri

2010-03-01

Full Text Available Se analizan las actitudes y creencias de unos docentes de escuela media acerca del uso de internet. Especialmente, cómo legitiman, o deslegitiman, su propia autoridad en función del “alfabetismo digital” atribuido a sus alumnos. La hipótesis es que, tras una preocupación manifiesta por las actividades online de los jóvenes, subyace otra referida a las propias supuestas limitaciones cognitivas y de acceso físico a las tecnologías de la información y la comunicación (TIC. Asimismo, se plantea que intentar explicar esta  percepción en términos de nativos vs. inmigrantes digitales naturaliza una autodescalificación socialmente construida.

Lääne pensionärid suunavad ravimitööstust üle maailma / Violetta Riidas

Index Scriptorium Estoniae

Riidas, Violetta

2008-01-01

Ravimitootjate Liidu juhatuse esimees ja Glaxosmithkline Eesti juht Akshay Mody sõnul tahetakse arendada võimalikult häid ravimeid, kuid samas tuleb arvestada, et ollakse kasumit teeniv ettevõte, kes peab aktsionäridele raha tooma. Ravimiameti peadirektori asetäitja Alar Irs arvates on halb, et varem perefirmadena tegutsenud ettevõtted on muutunud rahvusvahelisteks kontsernideks, mis on orienteeritud eelkõige kasumlikkusele. Vt. samas: Ligi poole ravimiturust hõlmas Põhja-Ameerika; Violetta Riidas. Personaliseeritud ravi on veel kallis; Akshay Mody. Ravimiarendus sõltub baasteadusest

Fractal dimension and image statistics of anal intraepithelial neoplasia

International Nuclear Information System (INIS)

Ahammer, H.; Kroepfl, J.M.; Hackl, Ch.; Sedivy, R.

2011-01-01

Research Highlights: → Human papillomaviruses cause anal intraepithelial neoplasia (AIN). → Digital image processing was carried out to classify the grades of AIN quantitatively. → The fractal dimension as well as grey value statistics was calculated. → Higher grades of AIN yielded higher values of the fractal dimension. → An automatic detection system is feasible. - Abstract: It is well known that human papillomaviruses (HPV) induce a variety of tumorous lesions of the skin. HPV-subtypes also cause premalignant lesions which are termed anal intraepithelial neoplasia (AIN). The clinical classification of AIN is of growing interest in clinical practice, due to increasing HPV infection rates throughout human population. The common classification approach is based on subjective inspections of histological slices of anal tissues with all the drawbacks of depending on the status and individual variances of the trained pathologists. Therefore, a nonlinear quantitative classification method including the calculation of the fractal dimension and first order as well as second order image statistical parameters was developed. The absolute values of these quantitative parameters reflected the distinct grades of AIN very well. The quantitative approach has the potential to decrease classification errors significantly and it could be used as a widely applied screening technique.

Mecanismos de cardiotoxicidad: antineoplásicos, anti-inflamatorios no esteroideos, antipsicóticos, cocaetileno y simpaticomiméticos

Directory of Open Access Journals (Sweden)

Lukas Salazar, MD

2011-03-01

Full Text Available La interacción constante del organismo humano con diferentes sustancias, que incluso en muchas ocasiones se consideran inofensivas, tiene un alto impacto sobre todos los sistemas, siendo el cardiovascular uno de los más afectados. Por lo tanto, es vital reconocer los mecanismos por los cuales estas sustancias ejercen su efecto tóxico sobre este sistema, bien sea afectando la estabilidad de membrana y la función contráctil o generando disfunción de organelos intracelulares y estrés oxidativo. Numerosos estudios han descubierto efectos lesivos de sustancias, como la clozapina y las catecolaminas, que han tenido amplio uso durante largos años. En la actualidad aún se realizan investigaciones que buscan esclarecer los mecanismos cardiotóxicos de medicamentos de formulación común, entre ellos antineoplásicos y anti-inflamatorios no esteroideos (AINE, así como de sustancias de uso habitual que causan adicción, tales como alcohol, cocaína y cocaetileno, su metabolito activo.

Influência de frações da parede celular de levedura (Saccharomyces cerevisiae sobre os índices séricos de glicose e lipídios, microbiota intestinal e produção de ácidos graxos voláteis (AGV de cadeias curtas de ratos em crescimento Influence of yeast (Saccharomyces cerevisiae cell wall fractions on serum indexes of glucose and lipids, intestinal microbiota and production of short-chain volatile fatty acids (VFA in growing rats

Directory of Open Access Journals (Sweden)

Saula Goulart Chaud

2007-06-01

Full Text Available Os índices séricos de glicose e lipídios, a microbiota intestinal e a produção de ácidos graxos voláteis de cadeias curtas (AGV foram determinados em ratos Wistar submetidos às dietas: padrão (AIN-P, padrão modificada (AIN-M e às dietas contendo frações de parede celular de levedura: glicana insolúvel (GI, manana (M e glicana mais manana (G+M, como única fonte de fibra alimentar. O fracionamento da parede celular (PC foi realizado por processos físicos e químicos de extração, centrifugação e secagem em "spray dryer". Os índices séricos foram dosados através de "kits" comerciais. A microbiota e a produção de AGV foram determinadas nos conteúdos intestinais, incluindo cólon, ceco e reto. Considerando os níveis de colesterol no tempo (T0 e no tempo 28 (T28, as dietas AIN-P, AIN-M e M apresentaram efeito hipocolesterolêmico, tendo em vista que a composição das dietas eram de natureza hipercolesterolêmica. Em relação à glicose sérica, no tempo (T0 observou-se uma elevação geral da glicemia, sugerindo um efeito hiperglicêmico das dietas estudadas. A dieta G+M foi a que apresentou valores significantemente mais elevados de lipídios séricos no tempo T14, e os níveis mais baixos foram observados na dieta M e na dieta GI no T14 e nas dietas AIN-M e AIN-P. A dieta AIN-P foi a que apresentou valor significantemente mais elevado de triacilgliceróis nos tempos T14 e T28. Os níveis mais baixos nos tempos T14 foram constatados para as dietas G+M e GI e no tempo T28 para as dietas AIN-M e M. De um modo geral, não houve modificações significativas na microbiota intestinal dos animais em nenhuma das dietas. Dentre os AGV, o ácido acético foi o predominante, seguido do propiônico e do butírico, em todas as dietas estudadas.The blood serum indexes of glucose and lipids, the intestinal microbiota and the production of volatile fatty acids (VFA were determined in Wistar rats which were fed a standard (AIN-P diet, a

Production of biosurfactant on crude date syrup under saline conditions by entrapped cells of Natrialba sp. strain E21, an extremely halophilic bacterium isolated from a solar saltern (Ain Salah, Algeria).

Science.gov (United States)

Kebbouche-Gana, Salima; Gana, Mohamed Lamine; Ferrioune, Imen; Khemili, Souad; Lenchi, Nesrine; Akmouci-Toumi, Sihem; Bouanane-Darenfed, Nabila Amel; Djelali, Nacer-Eddine

2013-11-01

A bacterial strain E21 was isolated from a sample of water collected in the salt lake located close to Ain Salah, Algeria. The analysis of 16S rRNA gene sequence had indicated that the strain had 93 % sequence similarity with the genus Natrialba sp. strain E21 (GenBank, FR750525.1) and was considered extremely halophilic. Production of biosurfactant by the strain E21 with free and entrapped cells was investigated using soluble starch in the saline conditions. Biosurfactant synthesis was followed by measuring the surface tension and emulsifying index 9 days under optimal conditions (40 °C, pH 7). Some diffusional limitations in alginate and agar beads affected the kinetics of biosurfactant production when compared to that obtained with free cells culture. The minimum values of surface tension were 27 and 30 mN m(-1) achieved after 9 days with free and immobilized cells, respectively, while the corresponding maximum E24 values were 65.3 and 62.3 %, respectively. The re-use of bacterial cells along with the limited cell losses provided by the immobilized system might lead to significant reduction of the biosurfactant production cost.

Cuando uno más uno es mayor que dos

Directory of Open Access Journals (Sweden)

Iv Villanueva

2017-12-01

Full Text Available Los ingenieros requieren de creatividad e ingenio para encontrar soluciones eficaces, eficientes y costo efectivas a los problemas que afectan a la humanidad. El trabajo interdisciplinario o colaborativo ha sido una forma exitosa para ofrecer soluciones factibles. En el caso de encontra soluciones al aumento de la resistencia de los microbios a los antibióticos, el enfoque colaborativo está mostrando buenos resultados. La resistencia a los antibióticos y a los antimicrobianos en general, es un problema (http://www.who.int/mediacentre/factsheets/antibiotic-resistance/es/ [1] con múltiples causas. De otro lado, las soluciones también pueden ser múltiples. La ingeniería y las ciencias de la salud se complementan para crear la sinergia necesaria para proponer unas de estas soluciones. En el laboratorio de investigación del Dr. Julián Davies en el Departamento de Microbiología e Inmunología de la Universidad de British Columbia en Vancouver, Canadá  se ha puesto en práctica este enfoque para atacar la resistencia a los antibióticos desde los aspectos de la prevención de la propagación de la resistencia y de la búsqueda de nuevos agentes antimicrobianos. En el caso de prevención, los departamentos de Ingeniería Civil y Mecánica junto con Microbiología han investigado el proceso de tratamiento de aguas residuales como un foco de concentración y distribución de bacterias resistentes a antibióticos. Como resultado, se han propuestos cambios operacionales en las plantas de tratamiento de agua como por ejemplo, respecto al duración de retención de lodos. En el caso de nuevos agentes, el departamento de Microbiología ha estudiado las arcillas medicinales como agentes antimicrobianos [2]. Sin embargo, para poder obtener y analizar este tipo de arcillas, se requiere la participación de los departamentos de Ingeniería Minera y Civil para estudiar depósitos, buscar formas para extracción del material, así como para realizar estudios físicos y químicos de arcillas. Además, los recursos Bioinformáticos hacen posible analizar las comunidades bacterianas presentes en el ambiente y su relación con los componentes del depósito y sus propiedades medicinales [3]. Ingeniería, informática y microbiología se juntan para proponer solución al problema. Ahora podemos preguntarnos cómo desarrollar una visión interdisciplinaria durante el proceso formativo que pueda transferirse más tarde al ejercicio profesional. Se pueden destacar por lo menos tres aspectos importantes. Primero, desarrollar un deseo por ampliar nuestro entendimiento de los problemas que más afectan nuestro entorno y meditar en sus causas y plantearnos alternativas de soluciones. Segundo,  esforzarnos por estar actualizados en los avances y nuevos desarrollos en nuestra área de interés, muchas veces implica tener una rutina de lectura regular de artículos tecnológicos y científicos, y de asistencia a seminarios o charlas. Por último, proponer y participar en proyectos de investigación que involucren la colaboración con otros departamentos dentro de la universidad, aprendiendo y participando activamente en la creación de soluciones. El factor común entre estos aspectos es nuestro interés por ser hacedores, innovadores y líderes de la búsqueda de alternativas para dar soluciones a los problemas del mundo en que vivimos y como se ha visto, ¡es posible!

Cuando uno más uno es mayor que dos

OpenAIRE

Iv Villanueva

2017-01-01

Los ingenieros requieren de creatividad e ingenio para encontrar soluciones eficaces, eficientes y costo efectivas a los problemas que afectan a la humanidad. El trabajo interdisciplinario o colaborativo ha sido una forma exitosa para ofrecer soluciones factibles. En el caso de encontra soluciones al aumento de la resistencia de los microbios a los antibióticos, el enfoque colaborativo está mostrando buenos resultados. La resistencia a los antibióticos y a los antimicrobianos en general, ...

Microstructure of Nitrided Aluminum Alloys Using an Electron-Beam-Excited-Plasma (EBEP)

Institute of Scientific and Technical Information of China (English)

L. Liu; A. Yamamoto; T. Hishida; H. Shoyama; T. Hara; T. Hara

2004-01-01

Nitriding of surface of aluminum alloys was carried out with using an electron-beam-excited-plasma (EBEP)technique. The EBEP is sustained by electron impact ionization with energetic electron beam. Two kinds of substrates,aluminum alloys AA5052 and AA5083, were exposed to the down flow of EBEP source at 843 K for 45min. The specimens were characterized with respect to following properties: crystallographic structure (XRD), morphology (SEM) and the cross sectional microstructures of the nitrided layer was observed using a scanning electron microscopy (SEM). There are some Al2O3 particles on the surface of the nitrided AA5052 and AA5083. The AIN layers were formed on the substrates with the thickness of 4.5 μ m for AA5052 and 0.5 μ m for AA5083. A relatively uniform nitrided surface layer composed of AIN can be observed on the AA5052 substrate. The grains size near the interfaces between the substrate and AIN layer were smaller than that near the surface. On the surface of AIN layer, the concentration of nitrogen was high and in the middle of AIN layer it had a constant concentration like the aluminum and the concentration was decreased with approaching to the interface. On the surface of nitrided AA5083, a uniform AIN layer was not formed as the reason for the high nitriding temperature.

Epidemiology of acute poisoning in children presenting to the poisoning treatment center at Ain Shams University in Cairo, Egypt, 2009–2013

Science.gov (United States)

Azab, Sonya M. S.; Hirshon, Jon Mark; Hayes, Bryan D.; El-Setouhy, Maged; Smith, Gordon S.; Sakr, Mahmoud Lotfy; Tawfik, Hany; Klein-Schwartz, Wendy

2016-01-01

Introduction Pediatric poisonings represent a major and preventable cause of morbidity and mortality throughout the world. Epidemiologic information about poisoning among children in many lower- and middle-income countries is scarce. This study describes the epidemiology of acute poisonings in children presenting to Ain Shams University's Poisoning Treatment Center (ASU-PTC) in Cairo and determines the causative agents and characteristics of acute poisoning in several pediatric age groups. Methods This retrospective study involved acutely poisoned patients, 0 to 18 years of age, who presented to the ASU-PTC between 1/1/2009 and 12/31/2013. Data were extracted from electronic records maintained by the ASU-PTC. Collected data included demographics, substance of exposure, circumstances of the poisoning, patient disposition, and outcome. Results During the 5-year study period, 38,470 patients meeting our criteria were treated by the ASU-PTC; 19,987 (52%) were younger than 6 years of age; 4,196 (11%) were 6 to 12 years; and 14,287 (37%) were >12 years. Unintentional poisoning accounted for 68.5% of the ingestions, though among adolescents 84.1% of ingestions were with self-harm intent. In all age groups, the most frequent causative drugs were non-opioid analgesics, antipyretics, and antirheumatics. The most common nonpharmaceutical agents were corrosives in preschool children and pesticides in adolescents. Most patients had no/minor effects (29,174 [75.8%]); hospitalization rates were highest among adolescents. There were 119 deaths (case fatality rate of 0.3), primarily from pesticide ingestion. Conclusion Poisoning in preschool children is mainly unintentional and commonly due to nonpharmaceutical agents while poisoning in adolescents is mainly intentional (self-harm). Pesticides, mainly organophosphorous compounds and carbamates, were the most frequent agent leading to morbidity and mortality. PMID:26653953

In situ EELS and TEM observation of Al implanted with nitrogen ions

International Nuclear Information System (INIS)

Hojou, K.; Furuno, S.; Kushita, K.N.; Otsu, H.; Izui, K.

1995-01-01

Formation processes of Aluminum nitride (AIN) in Aluminum (AI) implanted with nitrogen were examined by in situ EELS and TEM observations during nitrogen ion implantation in an electron microscope at room temperature and 400 deg C. AIN phase was identified both by EDP and EELS after nitrogen ion implantation to 6 x 10 20 (N + )/m 2 . The observed peak (20.8 eV) in EELS spectra was identified as plasmon loss peak of AIN formed in AI. The binding energy of N ls in AI was found to shift by about 4 eV to the lower side with increasing nitrogen-ion fluence. Unreacted AI was also found to remain in the AIN films after high fluence implantation both at room temperature and 400 deg C. (authors). 11 refs., 5 figs., 2 tabs

Teatrilugu nendest, kes teatris ei käi / Tuuli Koch

Index Scriptorium Estoniae

Koch, Tuuli

2000-01-01

Nr. 52/1999. Martin McDonaghi "Mägede iluduskuninganna" Vanemuises, lavastaja Ain Mäeots. Esietendus oli 5. nov. Ka Ain Mäeotsa ja näitlejate Liina Tennosaare ning Margus Jaanovitsi arvamusi näidendist

Effect of donor ethnicity on kidney survival in different recipient pairs: an analysis of the OPTN/UNOS database.

Science.gov (United States)

Callender, C O; Cherikh, W S; Traverso, P; Hernandez, A; Oyetunji, T; Chang, D

2009-12-01

Previous multivariate analysis performed between April 1, 1994, and December 31, 2000 from the Organ Procurement Transplant Network/United Network for Organ Sharing (OPTN/UNOS) database has shown that kidneys from black donors were associated with lower graft survival. We compared graft and patient survival of different kidney donor-to-recipient ethnic combinations to see if this result still holds on a recent cohort of US kidney transplants. We included 72,495 recipients of deceased and living donor kidney alone transplants from 2001 to 2005. A multivariate Cox regression method was used to analyze the effect of donor-recipient ethnicity on graft and patient survival within 5 years of transplant, and to adjust for the effect of other donor, recipient, and transplant characteristics. Results are presented as hazard ratios (HR) with the 95% confidence limit (CL) and P values. Adjusted HRs of donor-recipient patient survival were: white to white (1); and white to black (1.22; P = .001). Graft survival HRs were black to black (1.40; P recipients. The graft and patient survival rates for Asian and Latino/Hispanic recipients, however, were not affected by donor ethnicity. This analysis underscores the need for research to better understand the reasons for these disparities and how to improve the posttransplant graft survival rates of black kidney recipients.

Eesti Vabariigi põhiseadus : kommenteeritud väljaanne / toimetuskolleegium: Eerik-Juhan Truuväli, Oliver Kask, Lasse Lehis, Heiki Lindpere, Uno Lõhmus, Ülle Madise, Kalle Merusk, Raul Narits, Vallo Olle, Jüri Põld, Heinrich Schneider

Index Scriptorium Estoniae

2002-01-01

Kommentaaride autorid ja sisu: Sissejuhatus / Raul Narits, Heinrich Schneider, Lauri Madise. [Preambul] / Heinrich Schneider. I ptk. / Kalle Merusk, Taavi Annus, Madis Ernits, Heiki Lindpere, Lauri Madise. II ptk. / Uno Lõhmus, Taavi Annus, Madis Ernits, Oliver Kask, Eerik Kergandberg, Rait Maruste, Peeter Roosma. III ptk. / Oliver Kask. IV ptk. / Jüri Põld, Lauri Madise, Aaro Mõttus. V ptk. / Eerik-Juhan Truuväli, Ülle Madise, Jüri Põld, Urmas Reinsalu. VI ptk. / Kalle Merusk, Jüri Põld. VII ptk. / Eerik-Juhan Truuväli, Jüri Põld. VIII ptk. / Lasse Lehis. IX ptk. / Heiki Lindpere, Kristi Land, Lauri Madise, Heiki Pisuke. X ptk. / Oliver Kask, Enn Markvart, Jüri Põld. XI ptk. / Heinrich Schneider. XII ptk. / Raul Narits, Aare Reenumägi, Peeter Roosma, Enn Markvart. XIII ptk. / Uno Lõhmus, Madis Ernits, Jüri Põld. XIV ptk. / Vallo Olle, Arno Almann, Ülle Madise, Jüri Liventaal. XV ptk. / Eerik-Juhan Truuväli, Aaro Mõttus. Eesti Vabariigi põhiseaduse rakendamise seadus / Raul Narits, Peeter Roosma, Oliver Kask. Märksõnastik / koost. Ülle Madise, Peep Pruks. Kasutatud õigusaktide lühendid / koost. Virgo Saarmets. Eesti Vabariigi põhiseadus 1990-2002 : bibliograafia / koost. Maia Ruttu

Città/Fabbrica. Uno Studio di Prosperità Inaspettata / Factory/City. A Study in Unexpected Prosperity

Directory of Open Access Journals (Sweden)

Mei Lun Xue

2015-01-01

Full Text Available Prato rappresenta uno studio di come la crescita industriale nella produzione tessile possa influenzare la condizione architettonica. Negli anni del dopoguerra, i pratesi hanno sviluppato metodi di specializzazione in una rete di PMI familiari. L’industria tessile del territorio si è ristretta negli ultimi anni, alla fine soccombendo alle forze della produzione di massa. La stessa città ha visto un aumento degli immigranti cinesi, che trovano lavoro nella fiorente industria di indumenti “fast fashion”. Un rogo in una fabbrica nel dicembre del 2013 ha rivelato tensioni e la colpevolezza del grande pubblico. Ciò nonostante, il successo storico di Prato e le sue necessità urgenti richiedono un esame e un confronto. La disaggregazione fisica della fabbrica e della città dà indizi su ciò che si può salvare e rinnovare. / Prato is a study of industrial growth in textile production, coming to bear on an architectural condition. In the years after World War II, the Pratese developed methods of specialization in a network of small- to medium-sized family owned firms. The local textile industry has contracted in recent years, finally falling to the forces of mass production. The city itself has seen an increase in Chinese immigrants, who find work in the burgeoning ‘fast fashion’ garment industry. A factory fire in December 2013 exposed the tensions and culpability of the population at large. Yet Prato’s historical success and urgent needs beg for examination, and comparison. The physical disaggregation of factory and city give clues as to what can be retrieved, and made anew.

Comparison of imiquimod, topical fluorouracil, and electrocautery for the treatment of anal intraepithelial neoplasia in HIV-positive men who have sex with men: an open-label, randomised controlled trial.

Science.gov (United States)

Richel, Olivier; de Vries, Henry J C; van Noesel, Carel J M; Dijkgraaf, Marcel G W; Prins, Jan M

2013-04-01

Anal cancer is an increasing issue in HIV-positive men who have sex with men (MSM). Screening for its precursor, anal intraepithelial neoplasia (AIN), is subject of discussion. Current treatment options are suboptimum and have not been compared in a prospective trial. We compared efficacy and side-effects of imiquimod, topical fluorouracil, and electrocautery for the treatment of AIN. In this open-label randomised trial, we included HIV-positive MSM older than 18 years visiting the HIV outpatient clinic of the Academic Medical Center, Amsterdam, Netherlands. Patients with histologically confirmed AIN were randomly assigned to receive either 16 weeks of imiquimod (three times a week), 16 weeks of topical fluorouracil (twice a week), or monthly electrocautery for 4 months. Randomisation was done with random block sizes of three and six, stratified for AIN grade (AIN grades 1, 2, or 3) and AIN location (peri-anal or intra-anal). Participants were assessed by high-resolution anoscopy 4 weeks after treatment. Responding patients returned for follow-up 24 weeks, 48 weeks, and 72 weeks after treatment. The primary endpoint was histological resolution of AIN measured 4 weeks after treatment and AIN recurrence at week 24, week 48, and week 72 after treatment. The primary analysis was done in a modified intention-to-treat population, including all patients who had received their assigned treatment at least once. The trial is registered at the Netherlands Trial Register, number NTR1236. Between Aug 12, 2008, and Dec 1, 2010, we screened 388 HIV-positive MSM for AIN by high resolution anoscopy. Of the 246 (63%) patients who had AIN, 156 (63%) were randomly assigned to either receive imiquimod (54 patients), topical fluorouracil (48 patients), or electrocautery (46 patients) following withdrawing of consent by eight patients. Modified intention-to-treat analysis showed a complete response in 13 (24%, 95% CI 15-37) patients in the imiquimod group, eight (17%, 8-30) of patients

Determination of aluminium nitride or free nitrogen in low carbon steel

International Nuclear Information System (INIS)

Guetaz, V.; Soler, M.; Massardier, V.; Merlin, J.; Ravaine, D.

2001-01-01

As the aluminium nitrides play an important role in the manufacturing of steel sheets, a specific methodology was developed based on the thermoelectric power (TEP) technique, in order to determine the AIN nitrogen by an indirect method. The free nitrogen was determined and then the AIN nitrogen was calculated by the difference between the total nitrogen and the free nitrogen. Indeed, it is easier to determine the dissolved nitrogen, the content of which gradually decreases during the AIN precipitation, than the AIN nitrogen. A low carbon aluminium killed steel was employed with 580 ppm of aluminium and 50 ppm of nitrogen. A comparison of the results obtained by TEP with those obtained by other techniques (hot hydrogen extraction, electrochemical dissolution followed by a mineralization, electrochemical dissolution followed by a sodic decomposition and the Beeghly method) was conducted, in order to determine a reliable technique likely to quantify the amount of aluminium nitrides in aluminium killed steels. With these techniques, it is possible to determine either free nitrogen or precipitated nitrogen. From an experimental point of view, the precipitation kinetics of AIN was followed during an annealing performed at 973 K (700 C) by TEP and then different precipitation states of AIN were investigated to compare the different techniques: three annealing states (when no nitrogen, half the nitrogen and the total nitrogen has precipitated) and two soaking states (1403 and 1523 K). Thus, it was possible to compare states where the AIN precipitates are in various forms (different shapes, crystallographic structures, sizes, distributions in the matrix). This work showed that the quantification by TEP, hot hydrogen extraction and electrochemical dissolution followed by a mineralization seem reliable whereas the Beeghly method gives good results only for the precipitates formed at high temperatures. In contrast, the quantification by electrochemical dissolution followed by

GW182-Free microRNA Silencing Complex Controls Post-transcriptional Gene Expression during Caenorhabditis elegans Embryogenesis.

Directory of Open Access Journals (Sweden)

Guillaume Jannot

2016-12-01

Full Text Available MicroRNAs and Argonaute form the microRNA induced silencing complex or miRISC that recruits GW182, causing mRNA degradation and/or translational repression. Despite the clear conservation and molecular significance, it is unknown if miRISC-GW182 interaction is essential for gene silencing during animal development. Using Caenorhabditis elegans to explore this question, we examined the relationship and effect on gene silencing between the GW182 orthologs, AIN-1 and AIN-2, and the microRNA-specific Argonaute, ALG-1. Homology modeling based on human Argonaute structures indicated that ALG-1 possesses conserved Tryptophan-binding Pockets required for GW182 binding. We show in vitro and in vivo that their mutations severely altered the association with AIN-1 and AIN-2. ALG-1 tryptophan-binding pockets mutant animals retained microRNA-binding and processing ability, but were deficient in reporter silencing activity. Interestingly, the ALG-1 tryptophan-binding pockets mutant phenocopied the loss of alg-1 in worms during larval stages, yet was sufficient to rescue embryonic lethality, indicating the dispensability of AINs association with the miRISC at this developmental stage. The dispensability of AINs in miRNA regulation is further demonstrated by the capacity of ALG-1 tryptophan-binding pockets mutant to regulate a target of the embryonic mir-35 microRNA family. Thus, our results demonstrate that the microRNA pathway can act independently of GW182 proteins during C. elegans embryogenesis.

Wireless intelligent network: infrastructure before services?

Science.gov (United States)

Chu, Narisa N.

1996-01-01

The Wireless Intelligent Network (WIN) intends to take advantage of the Advanced Intelligent Network (AIN) concepts and products developed from wireline communications. However, progress of the AIN deployment has been slow due to the many barriers that exist in the traditional wireline carriers' deployment procedures and infrastructure. The success of AIN has not been truly demonstrated. The AIN objectives and directions are applicable to the wireless industry although the plans and implementations could be significantly different. This paper points out WIN characteristics in architecture, flexibility, deployment, and value to customers. In order to succeed, the technology driven AIN concept has to be reinforced by the market driven WIN services. An infrastructure suitable for the WIN will contain elements that are foreign to the wireline network. The deployment process is expected to seed with the revenue generated services. Standardization will be achieved by simplifying and incorporating the IS-41C, AIN, and Intelligent Network CS-1 recommendations. Integration of the existing and future systems impose the biggest challenge of all. Service creation has to be complemented with service deployment process which heavily impact the carriers' infrastructure. WIN deployment will likely start from an Intelligent Peripheral, a Service Control Point and migrate to a Service Node when sufficient triggers are implemented in the mobile switch for distributed call control. The struggle to move forward will not be based on technology, but rather on the impact to existing infrastructure.

Eesti-Rootsi koostöös valmib kallis dokfilm Kuubal

Index Scriptorium Estoniae

2004-01-01

Režissöör Michel Miglis, kes on ka bändide mänedžer, filmib Kuubas dokfilmi "Cubaton". Film räägib Kuubas levinud muusikast reggaeton. Eestipoolne tootja on Film Tower, produtsent Margus Õunapuu

Rapsist diislikütus : kallis ja tõrjutud / Heiki Raudla

Index Scriptorium Estoniae

Raudla, Heiki, 1975-

2008-01-01

Paldiski Lõunasadamas avatud Biodiesel Paldiski AS tehas loodab tulevikus täisvõimsuse juures toota 100 000 tonni biodiislikütust aastas, praegu eksporditakse kogu toodang peamiselt Lääne-Euroopasse ja Skandinaaviasse. Eesti tarbijale biodiislikütuse tootmist takistab peamiselt tooraine kõrge hind ning vähene nõudlus. Küsimusele vastavad Kai Realo ja Indrek Kaju

Asociación entre el consumo de antiinflamatorios no esteroideos y la aparición o descompensación de insuficiencia cardíaca congestiva : estudio de casos y controles

OpenAIRE

Rodríguez Bernardino, Ángel

2003-01-01

La insuficiencia cardiaca congestiva (ICC) es una patología con una alta prevalencia en nuestro medio. Se ha establecido una posible relación entre la acción de los antiinflamatorios no esteroideos (AINEs) sobre la síntesis de prostaglandinas y la aparición de ICC en individuos susceptibles. Nuestro objetivo fue evaluar la asociación entre el ingreso hospitalario por ICC y el consumo previo de AINEs, estimado la contribución individual de los distintos de AINEs. Se realizó un estudio multicén...

Resonance April Cover Pg TP

Indian Academy of Sciences (India)

Admin

word possibly having its origin in Sanskrit). W hat is ... History and Some Perspectives on Intermolecular Forces. E Arunan. Keywords van der Waals forces, hydrogen bonding. ... A tom s have rem ained a dom ain of physics, rather than.

Uno, Duo, Trio?

DEFF Research Database (Denmark)

Jensen, Mads Christian Dagnis; Nedergaard, Peter

2014-01-01

The trio Presidency function entails that Member States in groups of three are responsible for drawing up a common programme for the Council for a period of 18 months and for assisting each other. This article contributes new knowledge by focusing on the variation between four different trio Pres...

Ex Uno Plures.

Science.gov (United States)

Ravitch, Diane

2001-01-01

Argues that school choice runs counter to the common culture taught in most American public schools until the late 1960s. Discusses reasons why schools no longer teach a common culture. States that if the public schools returned to teaching a common American culture, school choice would be less compelling. (PKP)

Pono tibi istam: “Tu curris”.Uno sguardo alla teoria medievale delle obbligazioni

Directory of Open Access Journals (Sweden)

Riccardo Strobino

2008-12-01

intreccio delle differenti motivazioni sopra esposte: potrebbe trattarsi di uno strumento che viene sviluppato tanto per la risoluzione di sophismata e insolubilia quanto per indagare il rapporto tra linguaggio e metalinguaggio o altre questioni teoriche. Altri studiosi hanno infine sostenuto  che lo scopo della teoria delle obbligazioni consisterebbe nell’elaborazione di un metodo adatto alla costruzione e alla discussione di esperimenti mentali e che questo costituirebbe una sorta di metametodologia della scienza medievale sulla linea del ragionamento secundum imaginationem.

Pärast kõike / intervjueerinud Veiko Märka

Index Scriptorium Estoniae

1998-01-01

Vestlusring: Ain Mäeots, Merle Jääger, Helena Merzin, Margus Jaanovits, Riho Kütsar. Madis Kõivu võrukeelse näidendi 'Omavahelisi jutuajamisi tädi Elliga' lavastamisest Vanemuise teatris, lavastaja Ain Mäeots. Ka Kauksi Ülle kommentaar

Eeslid / Ain Kaalep

Index Scriptorium Estoniae

Kaalep, Ain, 1926-

2003-01-01

Sisu: Eeslid ; Luuletaja Koghazi ; Elav kuningas ; Neli legendi : Mungasuudlus ; Dorzhiin ; Legend meister Albrechtist ; Aafrika muld. Ballaad kombaini armastusest ; Kuningakatse ; Rapsoodiad : Draakoni talveuni ; Klaassepa poeg. Kaks indiaani metamorfoosi : Roti metamorfoos ; Ahvnaine. Paani surm ; Valgjärve legend ; Katsikõsõ'

Turundusteenistus / Ain Kaljurand

Index Scriptorium Estoniae

Kaljurand, Ain, 1965-

2004-01-01

Ilmunud ka: 2003 : annual report : [Eesti Raudtee]. - Tallinn, 2004, lk. 15-20; 2003 : godovoi ottshjot : [Eesti Raudtee]. - Tallinn, 2004, lk. 15-20. Ülevaade AS-i Eesti Raudtee 2003. a. kaubaveost veomahtude ja kaubagruppide järgi, turundusteenistusest, hinnapoliitikast

Spirochete della malattia di Lyme nelle zecche raccolte in uno studio di campo nell’Italia centrale (Regione Marche

Directory of Open Access Journals (Sweden)

Ilaria Pascucci

2010-06-01

Full Text Available La malattia di Lyme è la più diffusa malattia trasmessa da zecche in Italia. La provincia di Pesaro ed Urbino per le sue caratteristiche ecologiche può essere considerata area rischio per la patologia. Ciò nonostante, non sono ancora disponibili dati di campo per questa area, sebbene la malattia sia presente nei territori limitrofi. Al fine di indagare la presenza del ciclo della borreliosi di Lyme, è stato condotto, nell’area di interesse, uno studio di un anno durante il quale sono state raccolte zecche da cervidi selvatici, uomo e dall’ambiente, successivamente identificate e analizzate mediante PCR. Le zecche appartenenti alla specie Ixodes ricinus (la specie più frequente in tutte le raccolte sono state testate mediante tre diverse PCR per la ricerca di Borrelia burgdorferi s.l. Inoltre, per identificare le genospecie di Borrelia burgdorferi s.lcoinvolte, è stato amplificato e sequenziato un frammento della regione intergenica spaziatrice 5S-23S dell’ RNA ribosomiale. Il sequenziamento ha permesso di identificare due differenti genospecie: B. burgdorferi s.s. e B. lusitaniae, precedentemente coinvolte in casi umani di malattia di Lyme. Le informazioni riguardo le relazioni tra ospite, zecca e genospecie di B. burgdorferi s.l., confermando le notizie già presenti in letteratura per il bacino del Mediterraneo, mostrano come nell’area di interesse siano presenti le condizioni favorevoli allo sviluppo del ciclo della borreliosi di Lyme.

Exegi monumentum ehk palee Tallinnas / Siim Sultson

Index Scriptorium Estoniae

Sultson, Siim

2007-01-01

Tallinnas Narva mnt. 7 endisest Tsentrosojuzprojektist ümber ehitatud Triumph Plazast (arhitektid Vilen Künnapu ja Ain Padrik). Maja kavandati 1981. a. büroohooneks (arhitektid Olga Bruns ja Mart Kalling). Kommenteerivad Mart Port, Dmitri Bruns, Kristiina Möldre ja Ain Padrik

Automating the AFROTC Four-Year Scholarship Program.

Science.gov (United States)

1986-04-01

ATCH 2 b1 C -d C4 4" %C N 0" cl4 es C4 CN 1 onin %DG C1 06 0 -0 40 V 44-4 LIU-4- c4 A: U. -4 La 4 E vt a-’ iv El "l 04 0 0.I t b U El 4 V do v 0 CoU. -4...CEEB CLAS~S BOARD 1ST 2ND DCF QEP/ STRT,"’ HWFADC CfI3; PEL SCORES SCORE COMP SCOPE STAND RAMK".,H~DC ’ PREF PREF RACE PREY" rTL B1 = 46/1 C hiroms...A/N 88 Fencing 4 AIN 89 La Crosse 4 AIN 90 Rifle/Pistol 4 AIN 91 Rugby 4 AIN 92 Track 4 A/N 93 Wrestling 4 A/N 94 Others (Name and Codes) 15 A/N 95

Värsse / Rudolf Rimmel

Index Scriptorium Estoniae

Rimmel, Rudolf, 1937-2003

2008-01-01

Sisu: "Elan Eestis ja selge on see..." ; "Eesti Vabariigi ajaloo lisana..." ; "ma ütlen lause Eesti vabaduse hinnast..." ; "Õiglust ja kõlblust üksainuski sõõm..." ; "Euroopa Liit on rahvuste kalmistu..." ; "meie jalge alt müüakse maad...." ; "teab setu ja soomegi hõim..." ; "poliitikas ei ole Eestis diletante..." ; "Pean salmi looma ma..." ; "Kord tuleb aeg, kui mõtte kaotab seadus..." ; "äriideid - olen päri..." ; "vanapapi kallis eestiaegses kukrus..." ; "sul häbelikkust olgu kasvõi raas..." ; "Hea lahe Eesti Vabariik on lukuta...". Rudolf Rimmeli seniavaldamata luulet saatis Kesknädalale Malle Rimmel

Secretory leukocyte protease inhibitor expression and high-risk HPV infection in anal lesions of HIV positive patients

Science.gov (United States)

NUOVO, Gerard J.; GRINSZTEJN, Beatriz; FRIEDMAN, Ruth K.; VELOSO, Valdiléa G.; CUNHA, Cynthia B.; COUTINHO, José R.; VIANNA-ANDRADE, Cecilia; OLIVEIRA, Nathalia S.; WOODHAM, Andrew W.; DA SILVA, Diane M.; KAST, W. Martin

2016-01-01

Objective The aim of the current study was to evaluate secretory leukocyte protease inhibitor (SLPI) expression in anal biopsies from HIV-positive (HIV+) individuals, and compare that to anal intraepithelial neoplasia (AIN) diagnoses and human papillomavirus (HPV) status. Design This is a cross-sectional study of a cohort of 54 HIV+ (31 males and 23 females) from an AIDS clinic in Rio de Janeiro, Brazil. Methods The study material consisted of anorectal tissue biopsies obtained from HIV+ subjects, which were used to construct tissue microarray paraffin blocks for immunohistochemical analysis of SLPI expression. Biopsies were evaluated by an expert pathologist and classified as low-grade anal intraepithelial neoplasia (AIN1), high-grade anal intraepithelial neoplasia (AIN2/3), or normal squamous epithelium. Additionally, DNA from the biopsies was extracted and analyzed for the presence of low- or high-risk HPV DNA. Results Histologically normal squamous epithelium from the anorectal region showed strong positive SLPI staining in 17/20 (85%) samples. In comparison, 9/17 (53%) dysplastic squamous epithelial samples from AIN1 patients showed strong SLPI staining, and only 5/17 (29%) samples from AIN2-3 patients exhibited strong SPLI staining, which both were significantly fewer than those from normal tissue (p=0.005). Furthermore, there was a significantly higher proportion of samples in which oncogenic high-risk HPV genotypes were detected in low SLPI expressing tissues than that in tissues with high SLPI expression (p=0.040). Conclusion Taken together these results suggest that low SLPI expression is associated with high-risk HPV infections in the development of AIN. PMID:27149102

One lesion, one virus: individual components of high-grade anal intraepithelial neoplasia in HIV-positive men contain a single HPV type

NARCIS (Netherlands)

Richel, Olivier; Quint, Koen D.; Lindeman, Jan; van Noesel, Carel J. M.; de Koning, Maurits N. C.; van den Munckhof, Henk A. M.; de Vries, Henry J. C.; Prins, Jan M.; Quint, Wim G. V.

2014-01-01

High-grade anal intraepithelial neoplasia (AIN) is present in many human immunodeficiency virus (HIV)-positive men who have sex with men. The major etiologic factor is infection with an oncogenic human papillomavirus (HPV) genotype. We investigated whether individual components of high-grade AIN are

Las modalidades deficientes de la relación consigo mismo: reconstrucción y análisis de la existencia ética en O lo uno o lo otro de Kierkegaard

Directory of Open Access Journals (Sweden)

Rodríguez, Pablo Uriel

2017-07-01

Full Text Available Este artículo se propone reconstruir la teoría de la elección del sí mismo en O lo uno o lo otro (Segunda Parte de Kierkegaard. La teoría ética de la auto-elección contiene (1 una crítica de la auto-comprensión del individuo moderno y (2 describe las patologías de la vida individual. Kierkegaard distingue dos modelos incorrectos de auto-relación, que implican un tipo de autocosificación existencial: (1 auto-creación y (2 auto-conocimiento.

Avaliação do perfil antiinflamatório e analgésico, e dos efeitos colaterais da administração oral de meloxicam em equinos: avaliação física, laboratorial e gastroscópica

OpenAIRE

Veronezi, Regina de Cássia [UNESP

2007-01-01

Os antiinflamatórios não esteroidais (AINEs) são rotineiramente usados na medicina eqüina como analgésicos e antiinflamatórios, sendo potentes controladores da dor. Entretanto, estes fármacos provocam alguns efeitos indesejáveis, como por exemplo, lesões renais e gastrointestinais. Os efeitos adversos dos AINEs ocorrem com a inibição da COX-1, enquanto os efeitos benéficos são observados com a inibição da enzima COX-2. Com o surgimento dos AINEs seletivos para COX-2, os efeitos adversos são c...

Graphene–poly(5-aminoindole) composite film as Pt catalyst support for methanol electrooxidation in alkaline medium

International Nuclear Information System (INIS)

Yue, Ruirui; Zhang, Qiang; Wang, Caiqin; Du, Yukou; Yang, Ping; Xu, Jingkun

2013-01-01

Highlights: • Electropolymerization of 5-aminoindole (AIn) in the presence of graphene (GE). • Significant catalytic effect of GE on the polymerization of AIn. • PAIn/GE/GC used as Pt catalyst support. • The enhanced catalytic activity of Pt/PAIn/GE/GC for methanol electrooxidation. -- Abstract: 5-Aminoindole (AIn) was electropolymerized on graphene (GE) modified glass carbon (GC) electrode in 0.5 M H 2 SO 4 aqueous solution containing 0.01 M AIn. Because of the catalytic effect of GE, the polymerization efficiency of AIn and the electrochemical activity of as-formed poly(5-aminoindole) (PAIn) were significantly improved on GE/GC electrode as compared to that on the bare GC electrode. The prepared PAIn/GE/GC electrode was used as substrate for Pt particle electrodeposition. SEM, EDX and Raman spectral were used to characterize the prepared electrodes. Electrocatalytic experiments demonstrate that the Pt/PAIn/GE/GC electrode possesses high catalytic activity toward methanol electrooxidation in alkaline medium, due to the good dispersion of Pt particles on PAIn/GE/GC and the electronic interactions between the metal particles and the polymer matrixes. Thus, PAIn can be a promising alternative for polymeric catalyst support in direct alcohol fuel cells

Trends in incidence of anal cancer and high-grade anal intraepithelial neoplasia in Denmark, 1978-2008

DEFF Research Database (Denmark)

Nielsen, Ann; Plum, Christian Edinger Munk; Kjaer, Susanne K

2012-01-01

The aim of the study was to determine the incidences of anal cancer and high-grade anal intraepithelial neoplasia (AIN2/3) over time in Danish women and men. Describing the burden of anal cancer and AIN may be valuable in future evaluations of the human papillomavirus (HPV) vaccine. We included all...... anal cancers in the Danish Cancer Register in the period 1978-2008 and all cases of AIN2/3 in the Danish Registry of Pathology. Overall and age-, period- and histology-specific incidence rates were estimated. During the 30-year period, 2187 anal cancers were identified, two thirds of which were...... in women. Between 1978-1982 and 2003-2008, the age-standardized incidence rate of anal cancer increased from 0.68 to 1.48 per 100 000 person-years in women and from 0.45 to 0.80 per 100 000 person-years in men. Although there is no systematic screening for AIN in Denmark, we nevertheless identified 608...

Surface morphology of Al0.3Ga0.7N/Al2O3-high electron mobility transistor structure.

Science.gov (United States)

Cörekçi, S; Usanmaz, D; Tekeli, Z; Cakmak, M; Ozçelik, S; Ozbay, E

2008-02-01

We present surface properties of buffer films (AIN and GaN) and Al0.3Gao.zN/Al2O3-High Electron Mobility Transistor (HEMT) structures with/without AIN interlayer grown on High Temperature (HT)-AIN buffer/Al2O3 substrate and Al2O3 substrate. We have found that the GaN surface morphology is step-flow in character and the density of dislocations was about 10(8)-10(9) cm(-2). The AFM measurements also exhibited that the presence of atomic steps with large lateral step dimension and the surface of samples was smooth. The lateral step sizes are in the range of 100-250 nm. The typical rms values of HEMT structures were found as 0.27, 0.30, and 0.70 nm. HT-AIN buffer layer can have a significant impact on the surface morphology of Al0.3Ga0.7N/Al2O3-HEMT structures.

Tunable magnetic properties by interfacial manipulation of L1(0)-FePt perpendicular ultrathin film with island-like structures.

Science.gov (United States)

Feng, C; Wang, S G; Yang, M Y; Zhang, E; Zhan, Q; Jiang, Y; Li, B H; Yu, G H

2012-02-01

Based on interfacial manipulation of the MgO single crystal substrate and non-magnetic AIN compound, a L1(0)-FePt perpendicular ultrathin film with the structure of MgO/FePt-AIN/Ta was designed, prepared, and investigated. The film is comprised of L1(0)-FePt "magnetic islands," which exhibits a perpendicular magnetic anisotropy (PMA), tunable coercivity (Hc), and interparticle exchange coupling (IEC). The MgO substrate promotes PMA of the film because of interfacial control of the FePt lattice orientation. The AIN compound is doped to increase the difference of surface energy between FePt layer and MgO substrate and to suppress the growth of FePt grains, which takes control of island growth mode of FePt atoms. The AIN compound also acts as isolator of L1(0)-FePt islands to pin the sites of FePt domains, resulting in the tunability of Hc and IEC of the films.

Pap smears for men: a vision of the future?

LENUS (Irish Health Repository)

Oon, S F

2012-02-01

BACKGROUND: Anal intraepithelial neoplasia (AIN) rarely receives as much publicity as its neighbouring orifice, the cervix. As in the cervix, intraepithelial neoplasias are precursors to cancer in the anal canal. AIN and cervical interstitial neoplasia (CIN) undergo dysplasia as a consequence of human papillomavirus (HPV) infection. Since the advent of screening with the Pap smear in CIN, cervical cancer has plummeted to a fifth of its initial incidence. Anal cancer, however, has been rising, with a predilection for human immunodeficiency virus-infected men. HPV causes a squamous epithelial dysplasia and converts healthy tissue into AINs of increasing severity until anal cancer manifests. CLINICAL CASE: This article describes a clinical case of anogenital HPV infection refractory to medical and surgical therapy. It also describes an effective surgical excision technique associated with a good cosmetic outcome. CONCLUSIONS: The paper concludes by briefly discussing the implications of a national screening programme against AIN in the future.

Hypothyroidism could be the only manifestation of mitochondrial ...

African Journals Online (AJOL)

Hoda Tomoum

2012-11-24

Nov 24, 2012 ... Hypothyroidism could be the only manifestation of mitochondrial T8993C mutation in Leigh syndrome. Hoda Tomoum a. , Solaf M. Elsayed b,. *, Elizabeth Berry-Kravis c a Department of Pediatrics, Ain Shams University, Cairo, Egypt b Genetics Unit, Department of Pediatrics, Ain Shams University, Cairo, ...

AVALIAÇÃO DA DISPENSAÇÃO DE FÁRMACOS PARCIALMENTE SELETIVOS PARA COX-2

Directory of Open Access Journals (Sweden)

Cícero Cardoso VALLE FILHO

2015-12-01

Full Text Available Uma pesquisa foi realizada com o objetivo de avaliar um potencial aumento na venda de fármacos anti-inflamatórios não esteroidais (AINEs parcialmente seletivos para a COX-2 durante o período de julho de 2009 a junho de 2011, em uma drogaria localizada no município de Itaperuna, estado do Rio de Janeiro. Durante o período estudado foi dispensado um total de 802 AINEs parcialmente seletivos para a COX-2, dentre os quais 59,85% foram de nimesulida, 5,74% de etodolaco e 34,41% de meloxicam.   No primeiro semestre avaliado a dispensação total de AINEs parcialmente seletivos foi equivalente a 92, no segundo semestre a dispensação total foi equivalente a 159, no terceiro semestre a dispensação total foi de 219 AINEs parcialmente seletivos para COX-2 e no quarto semestre foram dispensados 332.  Os resultados indicaram maior dispensação dos medicamentos desta classe no mês de abril de 2011 sendo que tanto a nimesulida, quanto o meloxicam e o etodolaco foram mais dispensados no último semestre do estudo. De acordo com a metodologia utilizada pode-se concluir que a dispensação dos AINEs parcialmente seletivos vem crescendo a cada ano e que a nimesulida apresenta o maior índice de crescimento; a maior indicação da nimesulida tem sido para crianças; os meses correspondentes ao período de inverno apresentam maior dispensação de AINEs parcialmente seletivos para a COX-2.

Hydrogeological and isotopic studies for selected springs in Sinai Peninsula

Energy Technology Data Exchange (ETDEWEB)

Hamza, M S; Awad, M A; El-gamal, S A [Atomic Energy Authority, Cairo Egypt and Middle Eastern Regional Radioisotope Center for The Arab Countries, Dokki, 12311, Cairo (Egypt); Hammad, F A [Desert Research Centre, Materia, Cairo, (Egypt)

1995-10-01

This paper deals with the hydrogeology and isotopic composition of water samples collected from selected spring in sinai (e.g. Algudierate, Alqusiema, qidis and Isram) in order to identify their genesis, their interaction with the host rocks and mixing trend. Results of isotopic composition have indicated the similarity in the hydrogeologic situation of Ain qidis and Ain-al-gudierate, while Ain Isram has shown a marked difference in its stable isotope and this could be due to evaporation effect. The isotopic and hydrochemical constituents of the studied springs reflect eater of a meteoric origin with a possible contamination from surficial materials (evaporates) and deeper aquifers. 6 figs., 2 tabs.

Risk of tumor transmission after thoracic allograft transplantation from adult donors with central nervous system neoplasm-A UNOS database study.

Science.gov (United States)

Hynes, Conor F; Ramakrishnan, Karthik; Alfares, Fahad A; Endicott, Kendal M; Hammond-Jack, Katrina; Zurakowski, David; Jonas, Richard A; Nath, Dilip S

2017-04-01

We analyzed the UNOS database to better define the risk of transmission of central nervous system (CNS) tumors from donors to adult recipients of thoracic organs. Data were procured from the Standard Transplant Analysis and Research dataset files. Donors with CNS tumors were identified, and recipients from these donors comprised the study group (Group I). The remaining recipients of organs from donors who did not have CNS tumors formed the control group (Group II). Incidence of recipient CNS tumors, donor-related malignancies, and overall survival were calculated and compared in addition to multivariable logistic regression. A cohort of 58 314 adult thoracic organ recipients were included, of which 337 received organs from donors who had documented CNS tumors (Group I). None of these recipients developed CNS tumors at a median follow-up of 72 months (IR: 30-130 months). Although overall mortality in terms of the percentage was higher in Group I than Group II (163/320=51% vs 22 123/52 691=42%), Kaplan-Meier curves indicate no significant difference in the time to death between the two groups (P=.92). There is little risk of transmission of the common nonaggressive CNS tumors to recipients of thoracic organs. © 2017 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

La legge regionale lombarda e la libertà di religione: storia di un culto (non ammesso e di uno (non? ammissibile

Directory of Open Access Journals (Sweden)

Francesca Oliosi

2016-01-01

SOMMARIO: 1. Il sonno della Costituzione genera mostri. Una piccola premessa - 2. Libertà religiosa e luoghi di culto nelle fonti: dalla Costituzione al mosaico regionale, un bipolarismo imperfetto - 3. Il tassello lombardo: perseveranza o amnesia del legislatore? Il contesto: risultanze di una ricerca sul campo - 4. La legge n. 12 del 2005 della Regione Lombardia: il problema, aggirato ma non risolto, della destinazione d'uso degli edifici - 5. La nuova legge regionale: profili di palese incostituzionalità – 6. Le confessioni religiose (non sono egualmente libere davanti alla legge: art. 1, comma 1°, lettera a, l.r. n. 2 del 2015 – 7. La “supercompetenza” lombarda: art. 1 comma 1°, lettera b, della l.r. n. 2 del 2015 - 8. La derubricazione del diritto di libertà religiosa a interesse legittimo: dall'obbligo alla facoltà dei Comuni secondo l’art. 1, comma 1°, lett. c, della l.r. n. 2 del 2015 - 9. Quando la “sicurezza” vince sulla “libertà”: ancora sull'art. 1, comma 1°, lett. c - 10. Il nuovo tempio di Scientology a Milano: l’imponente luogo di culto per going clear - 11. Per non concludere: uno spettro si aggira per l’Europa.

Confiabilidad de la detección de problemas de desarrollo mediante el semáforo de la prueba de Evaluación del Desarrollo Infantil: ¿es diferente un resultado amarillo de uno rojo?

OpenAIRE

Rizzoli-Córdoba, Antonio; Ortega-Ríosvelasco, Fernando; Villasís-Keever, Miguel Ángel; Pizarro-Castellanos, Mariel; Buenrostro-Márquez, Guillermo; Aceves-Villagrán, Daniel; O'Shea-Cuevas, Gabriel; Muñoz-Hernández, Onofre

2014-01-01

Introducción: La prueba Evaluación del Desarrollo Infantil (EDI) es un instrumento de tamizaje de problemas en el desarrollo diseñado y validado en México. La calificación obtenida se expresa como semáforo. Se consideran positivos tanto el resultado amarillo como el rojo, aunque se plantea una intervención diferente para cada uno. El objetivo de este trabajo fue evaluar la capacidad de la prueba EDI para discriminar entre los niños identificados con semáforo amarillo y los identificados con r...

Ressources et partage de l'eau dans l'oasis de Kenadsa (Sud-Ouest Algerien; approche historique et constat

Directory of Open Access Journals (Sweden)

YOUCEF BENMOUSSA

2015-07-01

Full Text Available Resources And Water Sharing In The Oasis Of Kenadsa (Southwest Algeria; Historical Approach And Findings. Kenadsa, a peaceable oasis in southwestern Algeria, with the discovery and exploitation of coal (1917 - 1956, underwent graft of Western models for its development. That has cleared the oasis of the spatial dimension and tr ansformed into a mining village by excellence. These networks of foggaras draining groundwater, enclosed in a multilayer aquifer, which becomes free on the northern border of the Ksar. There were 25 foggaras of sources (Ain, each of which had its own drai nage channels to downstream gardens of Ksar. The distribution of water from these sources was ensured by a complex network, fed by drainage galleries that meander the alleys of Ksar and gives place to access points for domestic uses. The right to water is generally private property; one could dispose of according to modes of transmission of a property. It’s sharing for irrigation is governed by the volume and time. Currently, only some ten foggaras of sources that are still alive (Ain Sidi Mbarek, Ain Dir, Belkaid Ain, Ain Sheikh ..... These waters are characterized by mediocre quality (pH 7.31, CE: 4.88 ms / cm, RS 2420 mg / l Ca ++: 288.2 mg / l, SO4 -- : 468 83 mg / l..

Bulletin of Materials Science | Indian Academy of Sciences

Indian Academy of Sciences (India)

Laboratoire de Physique Fondamentale et Applique (LPFA), Faculté des Sciences Ain Chock, Université Hassan II, B.P. 5366 Mâarif, Casablanca, Maroc; Laboratoire de Physique des Matériaux, Micro-électronique, Automatique et Thermique (LPMMAT), Faculté des Sciences Ain Chock, Université Hassan II, B.P. 5366 ...

Proposta di uno studio multicentrico per la valutazione del fenomeno delle infezioni correlate a pratiche assistenziali in residenze socioassistenziali in Italia

Directory of Open Access Journals (Sweden)

S. Brusaferro

2003-05-01

Full Text Available

Razionale dello studio proposto In contesti come le Residenze Sanitarie Assistenziali (RSA, le Residenze Protette (RP, l’Assistenza Domiciliare Integrata (ADI la letteratura e le prime esperirne italiane evidenziano come il problema ICPA sia importante e, pur variando le tipologie di infezione prevalenti, i costi individuali, sociali ed economici ad esse collegati rimangono molto elevati.

In questo scenario diventa importante che i Comitati per il Controllo delle Infezioni Ospedaliere (CIO aziendali affrontino il problema del controllo delle infezioni in ambito extraospedaliero e comincino a strutturare modelli organizzativi in grado di operare efficacemente. Il dimensionamento del problema, ovvero l’attività di sorveglianza epidemiologica, anche in questo caso è tra le prime attività necessarie di provata efficacia.

Obiettivo dello studio: una prima valutazione della dimensione del problema ICPA nelle strutture RSA presenti nelle diverse regioni italiane attraverso uno studio di prevalenza nazionale. Materiali e metodi: l progetto prevede una prima fase con l’individuazione dei centri partecipanti e dei rispettivi referenti medici ed infermieristici. Successivamente si procederà, utilizzando la metodologia già testata in uno studio pilota, alla formazione del personale sull’uso degli strumenti. Saranno arruolati tutti i pazienti degenti da oltre 48 ore nelle RSA partecipanti, escludendo quelli in dimissione o in trasferimento nel giorno di rilevazione. I rilevatori, esterni alla struttura, raccoglieranno i dati consultando il quaderno infermieristico, il quaderno terapia, il diario clinico, la cartella clinica ed esaminando ciascun paziente per validare la eventuale presenza di “devices” e confermare sintomi e segni rientranti nelle definizioni di caso. Laddove necessario verrà consultato il personale medico ed infermieristico della struttura. Le variabili raccolte saranno centrate su dati

A Strong Impact of Genetic Background on Gut Microflora in Mice

Directory of Open Access Journals (Sweden)

R. Steven Esworthy

2010-01-01

Full Text Available Genetic background affects susceptibility to ileocolitis in mice deficient in two intracellular glutathione peroxidases, GPx1 and GPx2. The C57BL/6 (B6 GPx1/2 double-knockout (DKO mice have mild ileocolitis, and 129S1/Sv (129 DKO mice have severe inflammation. We used diet to modulate ileocolitis; a casein-based defined diet with AIN76A micronutrients (AIN attenuates inflammation compared to conventional LabDiets. Because luminal microbiota induce DKO ileocolitis, we assessed bacterial composition with automated ribosomal intergenic-spacer analysis (ARISA on cecal DNA. We found that mouse strain had the strongest impact on the composition of microbiota than diet and GPx genotypes. In comparing AIN and LabDiet, DKO mice were more resistant to change than the non-DKO or WT mice. However, supplementing yeast and inulin to AIN diet greatly altered microflora profiles in the DKO mice. From 129 DKO strictly, we found overgrowth of Escherichia coli. We conclude that genetic background predisposes mice to colonization of potentially pathogenic E. coli.

Kalli ajaloosarja esikfilm jõuab ETVsse / Kiur Aarma ; interv. Andri Maimets

Index Scriptorium Estoniae

Aarma, Kiur, 1975-

2005-01-01

6-osalise ajaloodokumentaalide sarja "Kuum külm sõda" esimesena valminud, sisuliselt kolmas film "Haukka grupp" : stsenaristid Kiur Aarma, Tiit Pruuli : režissöör Rene Vilbre : Ruut Pictures 2005. Esilinastus 08.05. kinos "Sõprus"

Presentación de algunos conceptos básicos del cálculo infinitesimal a partir de unos principios no estándar

Directory of Open Access Journals (Sweden)

de la Torre Cuesta, C.

1999-01-01

Full Text Available En el artículo “A NEW APPROACH TO NONSTANDARD ANALYSIS” del profesor Manuel Suárez Fernández, se dan unos principios no estándar compatibles con los axiomas de la teoría de conjuntos ZFC . Estos principios son: PRINCIPIO 1 : Existe algún número natural no estándar. PRINCIPIO 2: Si n, m son números naturales, n estándar y m no estándar entonces n

Análisis coste-efectividad del empleo de celecoxib en el tratamiento de la artrosis

Directory of Open Access Journals (Sweden)

Moreno A.

2003-01-01

Full Text Available Antecedentes: Los antiinflamatorios no esteroideos (AINE, utilizados en el tratamiento de la artrosis, pueden producir reacciones adversas gastrointestinales (GI graves. Celecoxib, un inhibidor específico de la ciclooxigenasa 2 (COX-2, ha demostrado una eficacia equivalente a los AINE convencionales con un mejor perfil de tolerabilidad y seguridad. Objetivo: La finalidad de este estudio ha sido realizar un análisis coste-efectividad sobre el uso de celecoxib frente a los AINE clásicos en el tratamiento de la artrosis. Material y métodos: El análisis coste-efectividad se ha diseñado mediante un modelo farmacoeconómico, definiéndose como unidad de efectividad a cada año de vida ganado tras la toma de celecoxib o AINE. La probabilidad de que aparezcan los diferentes resultados clínicos se ha obtenido de artículos publicados y de asunciones incorporadas. Sólo se han valorado los costes directos médicos (medicación, hospitalización, pruebas complementarias, analíticas, visitas extras, etc., sin haberse incluido otros costes. La perspectiva del estudio ha sido la del Sistema Nacional de Salud y el horizonte temporal elegido ha sido de 6 meses. Resultados: El coste adicional por cada año de vida ganado secundario al uso de celecoxib frente a los AINE clásicos asciende a 8.017 ? (1.333.834 ptas.. El análisis de sensibilidad muestra cómo estos valores son sensibles a la modificación del coste de AINE y gastroprotector, así como a la inclusión de grupos poblacionales con edades más bajas. Conclusiones: Celecoxib puede ser considerado como una opción coste-efectiva en el tratamiento de la artrosis, ya que va a evitar muertes y a ganar años de vida para los pacientes con un coste adicional razonable y moderado, cuando se compara con los AINE. Su eficiencia aumenta a medida que se utiliza en poblaciones con menor edad media y, probablemente, en aquellas con mayor riesgo de desarrollar complicaciones GI.

Há uma associação entre anti-inflamatórios não-esteroides e nefropatia induzida por contraste?

Directory of Open Access Journals (Sweden)

Luciano Passamani Diogo

Full Text Available FUNDAMENTO: A associação entre o uso de anti-inflamatórios não-esteroides (AINEs e insuficiência renal aguda ou crônica é bem documentada, mas evidências sobre a associação entre AINEs e nefropatia induzida por contraste (NIC não são encontradas na literatura. OBJETIVO: Avaliar uma possível associação entre AINEs e NIC. MÉTODOS: Em um estudo de coorte, através da entrevista clínica de pacientes que foram submetidos à cateterização cardíaca, analisamos o uso de AINEs e sua associação com desenvolvimento de NIC, através da alteração dos níveis de creatinina sérica ou taxa de filtração glomerular em 48 ou 72 horas. RESULTADOS: No período de julho de 2005 a julho de 2006, 236 pacientes foram incluídos no estudo, dos quais 29 foram posteriormente excluídos. A incidência de NIC foi 10,37% (20 de 207 e 42% dos pacientes estavam recebendo AINEs até o momento da avaliação. Não houve associação entre o uso de AINEs e o desenvolvimento de NIC com OR de 1,293; IC95% (0,46-4,2. O estudo detectou fatores de risco conhecidos para o desenvolvimento de NIC, tais como diabete, com OR de 2,77; IC95% (1,05-7,47 e insuficiência renal crônica com OR de 3,48; IC95% (1,1-11,07 e também sugeriu uma ação protetora da hidratação com solução salina com OR de 0,166; IC95% (0,03-0,92. CONCLUSÃO: Com base nos dados obtidos, concluímos que não houve associação entre NIC e uso prévio de AINEs, pelo menos com um OR > 2,85, o qual nossa amostra detectou.

Indrek Saar kehastub Pilistveres Rasputiniks / Aarne Mäe

Index Scriptorium Estoniae

Mäe, Aarne, 1967-

2008-01-01

7. aug. esietendub Pilistvere vanas rehehoones Ain Saviaugu kirjutatud ja lavastatud suvetükk "Rasputin". Suvelavastuse tõi välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas mängib näitlejast riigikogulane Indrek Saar. Lisaks lühike intervjuu lavastajaga "Lavastaja Ain Saviauk : "Ajalugu on karm" ja fakte Rasputinist - "Grigori Jefimovitsh Rasputin-Novõhh"

Pose de la première pierre du bâtiment SMA18 du Cern

CERN Multimedia

CERN Press Office. Geneva

1999-01-01

On 30 April 1999, Jean Pépin, Sénateur for the Department of the Ain and President of the Conseil Général, and Professor Luciano Maiani the Director-General of CERN will lay the foundation stone of Building SMA18, financed by the Department of the Ain in the framework of France's special contribution to CERN's Large Hadron Collider (LHC) project.

Hirm, raha ja armastus / Margot Visnap, Kadi Herkül, Immo Mihkelson

Index Scriptorium Estoniae

Visnap, Margot, 1959-

1999-01-01

Teleteatri aastaringist - ETV kaheksa lavastust seitsmelt lavastajalt : Toomas Hussar/Ervin Õunapuu "Linnapea ehk Hirmu põhivormid". Rezh. T. Hussar. Eetris 1. jaan. 1998; A.H. Tammsaare/Ain Prosa "Ma armastasin sakslast". Rezh. A. Prosa. Eetris 24. veebr. 1998; Dennis Potter "Sa oled koor minu kohvis". Rezh. Vilja Palm. Eetris 1. jaan. 1999; Ain Prosa/Karl Ristikivi "lihtne lugu, lõpuga". Rezh. Ain Prosa. Eetris 28. nov. 1998; Betti Alver/Margus Kasterpalu "Tuulearmuke". Rezh. Elo Selirand. Eetris 23. mail 1998; Faama Filmi ja ETV teleteatri koostöö "Isa", sts. ja rezh. Mart Kivastik. Eetris 28. märtsil 1998; "Lilled Leale", sts. ja rezh. Olle Mirme Toomas Vindi novelli põhjal; Rein Saluri "Andke neile andeks", lav. Talvo Pabut. Eetris 19. okt. 1998

Rahvusvaheline turismikonverents / Ain Hinsberg

Index Scriptorium Estoniae

Hinsberg, Ain

2011-01-01

Radisson Blu Hotel Olümpias 28. aprillil korraldatud konverentsist "Läänemere regiooni turismiteadmuse toetus turismimajandusele ja -ettevõtlusele 2011-2026", millega tähistati Eesti Hotelli- ja Turismikõrgkooli EHTE 15. sünnipäeva. Thomas Mielke, Maritta Hiltuneni, Kristian Sieversi, Pauli Santala, Inese Šīrava, Maija Rozite ja Kestutis Ambrozaitise konverentsil peetud ettekannetest ja paneeldiskussioonist

Consent ain't anything

DEFF Research Database (Denmark)

Di Nucci, Ezio

2016-01-01

I argue against various versions of the 'attitude' view of consent and of the 'action' view of consent: I show that neither an attitude nor an action is either necessary or sufficient for consent. I then put forward a different view of consent based on the idea that, given a legitimate epistemic ...

Keelatud ained / Ave Oit

Index Scriptorium Estoniae

Oit, Ave

2012-01-01

Öko- ja looduskosmeetikas keelatud või piirangutega lubatud koostisainetest: silikoonid, etoksüleeritud emulgaatorained (PEG-ühendid), toorõli baasil valmistatud rasvained ja emulgaatorid s.h mineraalõlid ja -vahad

Salud y trabajo de docentes de instituciones educativas distritales de la localidad uno de Bogotá

Directory of Open Access Journals (Sweden)

Constanza María García Castro

2013-07-01

Full Text Available Las instituciones educativas constituyen un escenario importante para la promoción de la salud de docentes, estudiantes, personal administrativo e, incluso, las familias; pero para utilizarlo eficazmente, en particular para el caso de los(as docentes, es necesario conocer sus condiciones de trabajo y salud. Objetivo: describir algunas de las condiciones de trabajo y salud del personal docente que labora en las Instituciones Educativas Distritales de la Localidad uno (I de Usaquén, Bogotá, en el 2010. Metodología: Estudio de abordaje cuantitativo, descriptivo transversal. Se inició después de la obtención de la autorización por parte de las directivas de las instituciones y del aval del Comité de Ética de la Facultad de Enfermería de la Universidad Nacional; posteriormente se procedió a la presentación del estudio ante los docentes directivos de estas Instituciones, se inició la recolección de información. El tamaño de la muestra fue de 230 docentes. Resultados: El 68.7% del personal docente era de sexo femenino; el 51.7% realizaba extensión del trabajo docente; 37.8% reportó presencia del ruido dentro del aula, situación que les exigía elevar el volumen de la voz para lograr la atención de los estudiantes. En relación con las condiciones de salud, refirieron que la causa de mayor frecuencia en la consulta médica era el estrés, con un 40.9%; seguido de los problemas vasculares y várices en miembros inferiores, con un 29.1%; de colon irritable, 28.3, y disfonías o afonías, con un 27.8%. Conclusiones: En este contexto se ratifica la necesidad de comprender la actividad docente como un proceso laboral de interés para el área de la salud y seguridad en el trabajo, por el alto valor social que representa y el fuerte impacto que tiene en el desarrollo de la sociedad. Se plantea la necesidad de continuar con estudios de intervención en la población que participó del estudio.

Estudio farmacoepidemiológico de uso de antiinflamatorios no esteroideos en pacientes de alto riesgo cardiovascular

Directory of Open Access Journals (Sweden)

Jorge Enrique Machado-Alba

Full Text Available Con el objetivo de determinar la frecuencia de uso prolongado de antiinflamatorios no esteroideos (AINES en pacientes colombianos de alto riesgo cardiovascular (ARC se desarrolló un estudio retrospectivo en el cual se identificaron pacientes de ARC que usaron AINES por más de cinco meses continuos entre enero de 2011 y marzo de 2013. Se identificó a los pacientes que recibían crónicamente nitratos, digitálicos, y clopidogrel y ácido acetil salicílico (ASA, quienes fueron identificados como de ARC. Se realizó un análisis de frecuencias de uso según la comedicación recibida. Se encontró uso concomitante de AINES en el 0,35% de los consumidores de nitratos (tiempo promedio: 9,5 ± 4,4 meses, en el 0,36% de los consumidores de clopidogrel y ASA (tiempo promedio: 9,3 ± 3,4 meses, y en el 0,4% de los consumidores de digitálicos (10,2 ± 4,6 meses. Se concluye que existe una baja proporción de uso de AINES de manera crónica en pacientes de alto riesgo cardiovascular.

Immune profile and Epstein-Barr virus infection in acute interstitial nephritis: an immunohistochemical study in 78 patients.

LENUS (Irish Health Repository)

Mansur, Abdurrezagh

2011-01-01

Acute interstitial nephritis (AIN) is a common cause of acute kidney injury and is characterised by a dense interstitial cellular infiltrate, which has not been well defined. Previous studies have demonstrated a correlation between Epstein-Barr virus (EBV) infection and AIN. The purpose of our study was to define the nature of the interstitial immune infiltrate and to investigate the possibility of renal infection with EBV.

Efecto de la precipitación de nitruros de aluminio en la recristalización de aceros de bajo carbono recocidos convencionalmente

Directory of Open Access Journals (Sweden)

Monsalve, A.

2005-10-01

Full Text Available An important feature of aluminium killed steels is the strong influence that aluminium nitride precipitates produce in both the mechanical properties and the final microstructural characteristics of the steel. This influence is related to the different stages of the fabrication process. This paper deals with a study of the effects of aluminium nitrides on the kinetics of recrystallisation. Different heat treatments were carried out, in one case to dissolve AIN, and in the other in order to precipitate AIN. These steels were subjected to cold rolling, followed by a batch annealing process. The recrystallised fraction was measured, thus obtaining the kinetic curves. The activation energy for recrystallisation was computed in each case. The results showed that AIN precipitation during recrystallisation produces a delay in recrystallisation kinetics through a change in the activation energy value.

Los aceros calmados con aluminio presentan como característica importante, la gran influencia que ejercen los nitruros de aluminio en las propiedades mecánicas y características microestructurales finales. Esta influencia está, a su vez, relacionada con cada una de la etapas del proceso de fabricación. En el presente trabajo se ha abordado el estudio del efecto de los nitruros de aluminio sobre la cinética de recristalización. Para ello, se han llevado a cabo diversos tipos de tratamientos térmicos, con el objeto de disolver todo el AIN y, en el otro caso, de precipitar todo el AIN. A continuación, los aceros estudiados se deformaron en frío y se les realizó un recocido convencional. Se midió la fracción recristalizada evaluando la energía de activación para la recristalización. Los resultados mostraron que la precipitación de AIN durante la recristalización produce un retraso en la cinética de recristalización, a través del cambio en el valor de la energía de activación

HIGHER EDUCATION AND PARTICIPATION IN THE FRAME OF THE IMPLEMENTATION OF THE PARTICIPATIVE BUDGET IN THE COMMUNE 1 IN MEDELLIN. EDUCACIÓN SUPERIOR Y PARTICIPACIONEN EL MARCO DE LA IMPLEMENTACION DEL PRESUPUESTO PARTICIPATIVO EN LA COMUNA UNO DE MEDELLÍN

Directory of Open Access Journals (Sweden)

Alfonso Insuasty Rodríguez

2010-12-01

Full Text Available This text is the product of the developments of the project entitled: "Evaluation and Monitoring of the Social and Community Work of the Beneficiaries of the Participatory Budget Fund Aimed At Pursuing Higher Education Studies Belonging to Commune One, Medellin," in Partnership with the Secretariat of Education in the City of Medellin. It is aimed at going beyond an assessment of procedures, objectives, and outcomes, and in doing so; explore some dimensions of citizen participation in decision making and community benefits that this brings to the specific case of the Higher Education Project in the Commune One.RESUMEN:Este texto es un producto de los desarrollos del proyecto “Evaluación y seguimiento al trabajo social y comunitario de los beneficiarios del fondo de presupuesto participativo destinado a cursar estudios de educación superior “Comuna Uno, Medellín”, en asocio con la Secretaría de Educación de la ciudad de Medellín, el cual pretende ir más allá de una evaluación de procedimientos, objetivos y resultados y profundizar en algunas dimensiones de la participación ciudadana, en la toma de decisión y beneficios comunitarios que esto trae para el caso específico del proyecto de Educación superior en la comuna Uno.

Teatriekspressiga Äksist Põltsamaale / Riina Mägi

Index Scriptorium Estoniae

Mägi, Riina, 1957-

2007-01-01

Jõgevamaa harrastus- ja projektitruppide vabaõhulavastuste esietendustest 2006. aastal : Priit Aimla "Saadjärve saamise lugu" (Tabivere Harrastusteater, lavastaja Tõnis Lepp), Oskar Lutsu loomingust inspireeritud Veiko Märka "Sabani sõlmes Luts" (Palamuse Amatöörteater, lavastaja Raivo Adlas), Marina Carri "Kassirabal" projektitrupi esituses, lavastaja Ain Saviauk, Mati Tiku "Legend" (Saare Valla Metsateater, lavastaja autor), Ain Saviaugu "Ulm ehk Unistus Liivimaast" (Põltsamaa teater Ellunäod, lavastaja autor)

AnAnalytical Study of Chinese Salt (MSG: Is it Halal or Haram (Urdu

Directory of Open Access Journals (Sweden)

Dr. Junaid Akbar

2017-01-01

Full Text Available Monosodium Glutamate is the scientific name of Chinese salt, which also called Ajinomoto. Monosodium Glutamate was first discovered by the Japanese chemist Ikeda Kibunae in 1908. The MSG was firstly derived from seaweed. Later on MSG was got from meat, gluten,and vegetables etc. It can be derived from Najasul‘ain and GherNajasul‘ain things. If it was got from Najasul ‘ain, then there is a question about MSG that is it Halal(permissible/ lawful or Haram(non-permissible/unlawful. This research in this article is concluded that if the culture of MSG is Halal or the properIsti Halah has been done in Najas; MSG will be Halal(permissible/ lawful. However, where no such details are available about the culture of MSG, it should be avoid, although it cannot be declared Haram as per Islamic Jurisprudence rules

"Sinu nimi ..." = "Ditt namn ..." : [luuletused] / Indrek Hirv ; tlk. rootsi keelde Kalli Klement

Index Scriptorium Estoniae

Hirv, Indrek, 1956-

2003-01-01

Sisu: "Sinu nimi ..." = "Ditt namn ..."; "Lind erutub su laulust ..." = "Fågeln blir uppeggad av din sång ..."; "Magasin kogu öö ..." = "Jag sov hela natten ..."; "Seisime saunalävel ..." = Vi stod på tröskeln till bastun ..."; "Sinu uks avab mind ..." = "Din dörr öppnar mig ..."; "Kogun sinusse ..." = "I dig samlar jag ..."; "signeerid mu päeva ..." = "du signerar min dag ..."

LA SCRITTURA COLLABORATIVA: LO STATO DELLA RICERCA INTERNAZIONALE E UNO STUDIO DI CASO

Directory of Open Access Journals (Sweden)

Debora Bellinzani

2014-07-01

Full Text Available Negli ultimi venti anni l’attività didattica di scrittura di testi in lingua seconda (L2 e lingua straniera (LS si è arricchita di nuove possibilità. In primo luogo da abilità che può essere appresa e sviluppata dopo l’acquisizione di solide basi linguistiche nella lingua target, la scrittura si è affermata anche come strumento per imparare la lingua utilizzabile fin dalle fasi iniziali dell’apprendimento. In secondo luogo da abilità individuale e introspettiva, la scrittura è oggi considerata un’attività che può essere svolta anche in modo collaborativo, a coppie o in gruppi, cooperando all’ideazione, alla stesura e alla revisione del testo da produrre. Nella prima parte di questo lavoro sono analizzati gli studi sulla scrittura collaborativa presenti nella letteratura scientifica con lo scopo di ottenere un quadro completo e aggiornato delle sue caratteristiche e della sua efficacia, con un’attenzione particolare alle indicazioni utili per l’insegnante che desideri proporre questo tipo di attività. Nella seconda parte del lavoro è presentato uno studio di caso, ossia un’attività di scrittura di un particolare tipo di testo, definito come “descrittivo/espressivo”, svolta a coppie da studenti universitari nell’ambito di un corso intensivo per l’apprendimento dell’italiano L2. L’attività ha preso le mosse dalla descrizione di due immagini-stimolo con differente potere evocativo. Obiettivi della sperimentazione sono stati la verifica dell’efficacia delle immagini come stimolo alla scrittura, della possibilità di scrivere congiuntamente di emozioni e dell’efficacia del testo “descrittivo/espressivo” nella scrittura collaborativa.   Collaborative writing: the state of art of international research and a case study  Debora Bellinzani Over the past twenty years, the teaching of writing texts in a second language (L2 and  a foreign language (LS has been enhanced with new possibilities. In the

Dual-sided electrosurgery handpiece for simultaneous tissue cutting and coagulation: first report on a conceptual design validated by an animal experiment

OpenAIRE

Tawfik, Hatem A; Fouad, Yousef A; Hafez, Rashad

2015-01-01

Hatem A Tawfik,1 Yousef A Fouad,2 Rashad Hafez3 1Department of Ophthalmology, Oculoplastics Service, Ain Shams University, 2Faculty of Medicine, Ain Shams University, 3Eye Subspecialty Centre, Cairo, Egypt Objective: To introduce and evaluate the safety of a novel dual-sided electrosurgery handpiece design for simultaneous tissue cutting and coagulation. Methods: We designed a prototype double-sided handpiece allowing automatic switching between two electrodes with a simple handpiece flip. T...

Relevancia clínica de las interacciones medicamentosas entre antiinflamatorios no esteroideos y antihipertensivos

Directory of Open Access Journals (Sweden)

Juan Villa

2014-11-01

Conclusiones: Algunos AINE pueden disminuir la efectividad del tratamiento antihipertensivo cuando se utilizan simultáneamente con antihipertensivos, en especial con inhibidores de la enzima conversora de angiotensina, diuréticos, bloqueadores beta y antagonistas de los receptores de angiotensina. No se encontró evidencia de la modificación del efecto de los antagonistas de los canales de calcio, especialmente dihidropiridínicos, por el uso simultáneo con AINE.

The Impact of Socioeconomic Status on Patients Supported with a Left Ventricular Assist Device: An Analysis of the UNOS Database

Science.gov (United States)

Clerkin, Kevin J.; Garan, A. Reshad; Wayda, Brian; Givens, Raymond C.; Yuzefpolskaya, Melana; Nakagawa, Shunichi; Takeda, Koji; Takayama, Hiroo; Naka, Yoshifumi; Mancini, Donna M.; Colombo, Paolo C.; Topkara, Veli K.

2016-01-01

Background Low socioeconomic status (SES) is a known risk factor for heart failure, mortality among those with heart failure, and poor post heart transplant (HT) outcomes. This study sought to determine if SES is associated with decreased waitlist survival while on LVAD support and after HT. Methods and Results 3,361 adult patients bridged to primary HT with an LVAD between May 2004 and April 2014 were identified in the UNOS database. SES was measured using the AHRQ SES index using data from the 2014 American Community Survey. In the study cohort, SES did not have an association with the combined endpoint of death or delisting on LVAD support (p=0.30). In a cause-specific unadjusted model, those in the top (HR 1.55, 95% CI 1.14–2.11, p=0.005) and second greatest SES quartile (HR 1.50, 95% CI 1.10–2.04, p=0.01) had an increased risk of death on device support compared to the lowest SES quartile. Adjusting for clinical risk factors mitigated the increased risk. There was no association between SES and complications. Post-HT survival, both crude and adjusted, was decreased for patients in the lowest quartile of SES index compared to all other SES quartiles. Conclusions Freedom from waitlist death or delisting was not impacted by SES. Patients with a higher SES had an increased unadjusted risk of waitlist mortality during LVAD support, which was mitigated by adjusting for increased comorbid conditions. Low SES was associated with worse post-HT outcomes. Further study is needed to confirm and understand a differential effect of SES on post-transplant outcomes that was not seen during LVAD support prior to HT. PMID:27758810

Synthesis of TiCuAg thick film inks for glass frit free metallization of aluminium nitride

International Nuclear Information System (INIS)

Adlassnig, A.; Schuster, J. C.; Smetana, W.; Reicher, R.

1997-01-01

A glas frit free screen printing ink for metallization of AIN was developed. Bonding to the substrate is achieved by active metal additives. The metallic component consists of Cu and Ag powder synthesized from inorganic salts by the polyol process, and Cu-Ti powder synthesized by arc melting, milling and ultracentrifugation. This ternary powder mixture was introduced to a specifically developed organic vehicle and screen printed onto AIN. The detailed development process and the results will be presented. (author)

P-type doping of GaN

International Nuclear Information System (INIS)

Wong, R.K.

2000-01-01

After implantation of As, As + Be, and As + Ga into GaN and annealing for short durations at temperatures as high as 1500 C, the GaN films remained highly resistive. It was apparent from c-RBS studies that although implantation damage did not create an amorphous layer in the GaN film, annealing at 1500 C did not provide enough energy to completely recover the radiation damage. Disorder recovered significantly after annealing at temperatures up to 1500 C, but not completely. From SIMS analysis, oxygen contamination in the AIN capping layer causes oxygen diffusion into the GaN film above 1400 C. The sapphire substrate (A1203) also decomposed and oxygen penetrated into the backside of the GaN layer above 1400 C. To prevent donor-like oxygen impurities from the capping layer and the substrate from contaminating the GaN film and compensating acceptors, post-implantation annealing should be done at temperatures below 1500 C. Oxygen in the cap could be reduced by growing the AIN cap on the GaN layer after the GaN growth run or by depositing the AIN layer in a ultra high vacuum (UHV) system post-growth to minimize residual oxygen and water contamination. With longer annealing times at 1400 C or at higher temperatures with a higher quality AIN, the implantation drainage may fully recover

P-type doping of GaN

Energy Technology Data Exchange (ETDEWEB)

Wong, Raechelle Kimberly [Univ. of California, Berkeley, CA (United States)

2000-04-01

After implantation of As, As + Be, and As + Ga into GaN and annealing for short durations at temperatures as high as 1500 C, the GaN films remained highly resistive. It was apparent from c-RBS studies that although implantation damage did not create an amorphous layer in the GaN film, annealing at 1500 C did not provide enough energy to completely recover the radiation damage. Disorder recovered significantly after annealing at temperatures up to 1500 C, but not completely. From SIMS analysis, oxygen contamination in the AIN capping layer causes oxygen diffusion into the GaN film above 1400 C. The sapphire substrate (A1203) also decomposed and oxygen penetrated into the backside of the GaN layer above 1400 C. To prevent donor-like oxygen impurities from the capping layer and the substrate from contaminating the GaN film and compensating acceptors, post-implantation annealing should be done at temperatures below 1500 C. Oxygen in the cap could be reduced by growing the AIN cap on the GaN layer after the GaN growth run or by depositing the AIN layer in a ultra high vacuum (UHV) system post-growth to minimize residual oxygen and water contamination. With longer annealing times at 1400 C or at higher temperatures with a higher quality AIN, the implantation drainage may fully recover.

Detección temprana y solución de afecciones oftalmológicas en niños de uno a cinco años

Directory of Open Access Journals (Sweden)

Anna Cruz Betancourt

2015-03-01

Full Text Available Se realizó una intervención comunitaria, con el objetivo de realizar el diagnóstico precoz y el tratamiento oportuno de afecciones oftalmológicas en niños de uno a cinco años, residentes en el municipio de Cacocum, provincia de Holguín, Cuba; durante los años 2013 y 2014. El universo de estudio estuvo constituido por la población infantil menor de cinco años al inicio del año 2013 en el mencionado municipio (2817 niños. Para la etapa de diagnóstico la muestra quedó constituida por 2000 niños con edades de 1 a 5 años (70,99 % de la población infantil del municipio. De los niños examinados, 43 fueron diagnosticados con afecciones visuales, los que constituyeron la muestra de investigación en la etapa de tratamiento. Se constató que las afecciones visuales tuvieron una incidencia de 2,15 % de la muestra en el año de estudio. Los trastornos refractivos y alteraciones de la motilidad ocular fueron los más frecuentes. La solución quirúrgica y corrección con cristales fueron los tratamientos aplicados y resultaron efectivos en el 100 % de los casos

Polimorfismi nei geni metabolici come fattori dirischio per il carcinoma gastrico (GC: risultati preliminari di uno studio caso-controllo

Directory of Open Access Journals (Sweden)

S. Boccia

2003-05-01

Full Text Available

Obiettivi: valutare le frequenze dei principali geni metabolici in un campione di casi di GC (Carcinoma Gastrico e di controlli, per determinare se esiste un’associazione con il rischio di GC, e considerare le possibili associazioni tra i genotipi studiati ed alcuni parametri clinico-patologici.

Metodi: è stato condotto uno studio caso-controllo ospedaliero, tra novembre 1999 e maggio 2003 reclutando 48 pazienti con diagnosi di adenocarcinoma gastrico sottoposti a gastrectomia, e 48 controlli appaiati per sesso ed età presso il Policlinico Universitario “A. Gemelli” in Roma. Per genotipizzare gli individui rispetto ai geni GSTM1, NAT2, SULT1A1, CYP1A1, CYP2E1 (5’ flanking e introne 6, è stata usata la tecnica della PCR con analisi del profilo dei frammenti di restrizione (PCR-RFLP. L’analisi statistica ha previsto l’impiego di test non parametrici e della regressione logistica.

Risultati: le frequenze dei polimorfismi nei geni metabolici sono risultate in alcuni casi differenti nei casi rispetto ai controlli sebbene non si evidenzi una differenza statisticamente significativa. In particolare il genotipo GSMT1 null è più elevato nei pazienti rispetto ai controlli (63.8% vs. 51% e gli individui NAT2 acetilatori lenti risultano più frequenti nei casi rispetto ai controlli (69.6% vs. 57.45%. L’istotipo diffuso di GC è associato significativamente ai pazienti eterozigoti per l’allele SULT1A1 (c_= 8.216; p= 0.018, ed i pazienti NAT2 acetilatori lenti tendono ad avere un grading tumorale alto (c_= 7.425; p= 0.006.

Conclusioni: i risultati preliminari di questo studio evidenziano associazioni tra alcuni genotipi metabolici e parametri clinico-patologici, che se confermati potrebbero permettere di identificare sottogruppi con prognosi più sfavorevole di GC da indirizzare preventivamente verso trattamenti specifici.

Fumo attivo e passivo, consumo di caffè ed effetti sulla gravidanza: uno studio caso controllo in Italia

Directory of Open Access Journals (Sweden)

G. Fantuzzi

2003-05-01

Full Text Available

Obiettivi: alcune abitudini di vita possono influenzare lo sviluppo fetale durante il periodo di gravidanza. Lo scopo di questo studio è stato quello di indagare gli effetti di alcune abitudini voluttuarie sulle nascite premature e sul basso peso alla nascita.

Metodi: è stato condotto uno studio caso controllo nel periodo ottobre 1999 settembre 2000 in 9 città italiane (Genova, Udine, Modena, Parma, Siena, Roma, L’Aquila, Napoli e Catania. Sono stati identificati come casi 525 neonati pretermine (26ma, 38ma settimana di gravidanza e 317 neonati a termine ma con peso ‹ al 10° P. Sono stati arruolati come controllo 871 bambini nati a termine e normopeso. Le informazioni relative all’esposizione al fumo attivo e passivo e al consumo di caffè e i dati personali sono stati raccolti attraverso un apposito questionario.

Risultati: dai risultati dell’analisi univariata è emerso un maggior rischio di basso peso alla nascita nei bambini le cui madri avevano fumato durante l’ultimo trimestre di gravidanza, con un chiaro effetto dose risposta. (OR: 2.09, 95% CI:1.45 - 3.00 per 1 9 sigarette/giorno, e OR= 2.76, 95% CI: 1.67 - 4.45 per 10 ed oltre sigarette al giorno. Anche la nascita pretermine sembra influenzata dall’abitudine tabagica della madre anche se in modo meno evidente. OR: 1.47, 95% CI: 1.05 - 2.04 per 1 9 sigarette/giorno e un OR: 1,30 95% CI: 0.78 - 4.81 per 10 e più sigarette/giorno. Per quanto riguarda l’esposizione al fumo passivo (più di due fumatori nelle abitazioni è stata osservata una positiva associazione con il basso peso alla nascita (OR: 3.05, 95% CI: 1.19 - 7.79. Il consumo di caffè non sembra influenzare lo sviluppo fetale. La regressione logistica multipla ha confermato solo l’influenza del fumo attivo della madre sulla basso peso alla nascita. (AOR= 2.49, 95% CI: 1.74 - 3.56.

Conclusioni: questo studio conferma che

UNO STUDIO DI CASO SULL’ELABORAZIONE E L’UTILIZZO DEL FEEDBACK SCRITTO IN APPRENDENTI DI ITALIANO L2

Directory of Open Access Journals (Sweden)

Livia Alberti

2015-02-01

Full Text Available Attraverso uno studio di caso che coinvolge due studentesse di italiano L2 di livello elementare/intermedio, si prendono in esame alcuni dei fattori che possono influire sull’utilizzo del feedback scritto da parte degli apprendenti. La raccolta dei dati si è svolta in tre giornate: nella prima le partecipanti hanno scritto un testo collaborativo a partire da una storia per immagini; nella seconda i testi, corretti con un intervento di feedback implicito, sono stati riconsegnati e la coppia ha prima analizzato le segnalazioni ricevute e poi riscritto il testo; nella terza le apprendenti hanno prodotto testi individuali a partire dallo stesso stimolo visivo. Oltre a confrontare le diverse stesure del testo, si analizzano le interazioni avvenute tra le apprendenti durante il lavoro di coppia finalizzato a utilizzare il feedback per produrre il secondo testo collaborativo. I risultati mostrano da un lato che un elevato livello di coinvolgimento nell’elaborazione del feedback non ne garantisce un utilizzo efficace, dall’altro che hanno un peso non trascurabile anche fattori più “personali” come le convinzioni sulla lingua bersaglio e l’atteggiamento nei confronti del lavoro di coppia.  A case study on the development and use of written feedback in Italian L2 learners  Through a case study involving two female elementary/intermediate Italian L2 students, we examine some of the factors that may affect the use of written feedback by the learners. Data collection took place over three days: on the first day, the participants wrote a collaborative text from a picture story; on the second the texts, corrected using implicit feedback, were returned, and the students first analyzed the reports received and then rewrote the text; on the third day the learners produced individual texts from the same visual stimulus. In addition to comparing the various drafts of the text, we analyzed the interactions between the learners during pair work aimed

Há uma associação entre anti-inflamatórios não-esteroides e nefropatia induzida por contraste? ¿Hay una asociación entre antiinflamatorios no esteroides y nefropatía inducida por contraste? Is there an association between non-steroidal anti-inflammatory drugs and contrast nephropathy?

Directory of Open Access Journals (Sweden)

Luciano Passamani Diogo

2010-12-01

Full Text Available FUNDAMENTO: A associação entre o uso de anti-inflamatórios não-esteroides (AINEs e insuficiência renal aguda ou crônica é bem documentada, mas evidências sobre a associação entre AINEs e nefropatia induzida por contraste (NIC não são encontradas na literatura. OBJETIVO: Avaliar uma possível associação entre AINEs e NIC. MÉTODOS: Em um estudo de coorte, através da entrevista clínica de pacientes que foram submetidos à cateterização cardíaca, analisamos o uso de AINEs e sua associação com desenvolvimento de NIC, através da alteração dos níveis de creatinina sérica ou taxa de filtração glomerular em 48 ou 72 horas. RESULTADOS: No período de julho de 2005 a julho de 2006, 236 pacientes foram incluídos no estudo, dos quais 29 foram posteriormente excluídos. A incidência de NIC foi 10,37% (20 de 207 e 42% dos pacientes estavam recebendo AINEs até o momento da avaliação. Não houve associação entre o uso de AINEs e o desenvolvimento de NIC com OR de 1,293; IC95% (0,46-4,2. O estudo detectou fatores de risco conhecidos para o desenvolvimento de NIC, tais como diabete, com OR de 2,77; IC95% (1,05-7,47 e insuficiência renal crônica com OR de 3,48; IC95% (1,1-11,07 e também sugeriu uma ação protetora da hidratação com solução salina com OR de 0,166; IC95% (0,03-0,92. CONCLUSÃO: Com base nos dados obtidos, concluímos que não houve associação entre NIC e uso prévio de AINEs, pelo menos com um OR > 2,85, o qual nossa amostra detectou.FUNDAMENTO: La asociación entre el uso de antiinflamatorios no esteroides (AINEs e insuficiencia renal aguda o crónica está bien documentada, pero evidencias sobre la asociación entre AINEs y nefropatía inducida por contraste (NIC no son encontradas en la literatura. OBJETIVO: Evaluar una posible asociación entre AINEs y NIC. MÉTODOS: En un estudio de cohorte, a través de la entrevista clínica de pacientes que fueron sometidos a cateterismo cardíaco, analizamos el

Temira Pachmuss 75 / Uno Schultz

Index Scriptorium Estoniae

Schultz, Uno, 1956-

2003-01-01

24. dets. 2002 USA-s oma juubelit tähistanud rahvusvaheliselt tuntud baltisaksa päritolu kirjandusteadlase ja professori eluteest, õpingutest ning uurimistöödest, mille huvikeskmeks on põhiliselt Dostojevski ja välisvene kirjandus, sealhulgas vene kirjandus Eestis ja Soomes

Vaegkuuljate maailmakongressil Norras / Uno Taimla

Index Scriptorium Estoniae

Taimla, Uno

2012-01-01

Eesti Vaegkuuljate Liidu juhatuse esimehe reisikiri rahvusvahelise vaegkuuljate organisatsiooni IFHOH (International Federation of Hard of Hearing People) Ⅸ kongresilt, mis toimus 25.–28. juunini Norras Bergenis

SOS euroallutajate tagalas / Uno Silberg

Index Scriptorium Estoniae

Silberg, Uno, 1964-

2001-01-01

Autori arvates on tekkinud klassikaline revolutsioonieelne situatsioon, mille on kaasa toonud kasvav lõhe EL-i vastaste ja selle pooldajate vahel. Euroskeptitsism. Diagramm: Toetus Euroopa Liiduga liitumisele Baltimaades ning Kesk- ja Ida-Euroopa riikides

Impôts Français : CRDS - French version only

CERN Document Server

2003-01-01

Avis de dégrèvements IMPORTANT : Cette note d'information concerne uniquement : - les membres du personnel de nationalité française ou résidents permanents1 , domiciliés en France dans le département de l'Ain et rémunérés par le CERN (titulaires, boursiers, attachés payés et de projet) ; - Les anciens membres du personnel de l'Organisation, bénéficiaires de la Caisse de Pensions du CERN, domiciliés ou ayant été domiciliés en France dans le département de l'Ain. Ces personnes ont récemment reçu, ou sont sur le point de recevoir, un avis de dégrèvement émanant de la Direction des Services Fiscaux de l'Ain (DSFA) et portant sur la Contribution au Remboursement de la Dette Sociale (CRDS). I. Informations général...

Külmetav haigekassa / Ain Aaviksoo

Index Scriptorium Estoniae

Aaviksoo, Ain, 1974-

2008-01-01

Autori hinnangul on suur oht, et Eesti patsiente ootab ees Läti saatus, kus on 40-50% tervishoiukuludest patsientide endi kanda. Eesti ees seisvaid valikuid analüüsides oleks parim valik ravikindlustuse reservide läbimõeldud kasutuselevõtt, kuid eeldusel, et otsitakse ravikindlustuse rahastamisele pikaajalisi sisulisi lahendusi. Graafik: Haigekassa kulude suhteline muutus

Zamerzajushtshaja Bolnitshnaja kassa / Ain Aaviksoo

Index Scriptorium Estoniae

Aaviksoo, Ain, 1974-

2008-01-01

Autori hinnangul on suur oht, et Eesti patsiente ootab ees Läti saatus, kus on 40-50% tervishoiukuludest patsientide endi kanda. Eesti ees seisvaid valikuid analüüsides oleks parim valik ravikindlustuse reservide läbimõeldud kasutuselevõtt, kuid eeldusel, et otsitakse ravikindlustuse rahastamisele pikaajalisi sisulisi lahendusi

Lahesõjas viik / Ain Hinsberg

Index Scriptorium Estoniae

Hinsberg, Ain

2001-01-01

Helsingi ja Tallinna vahel liikuvate laevafirmade konkurents: Silja Line, Nordic Jet Line, Tallink ja Linda Line. Tabelid: reisijad laevaliinil Helsingi-Tallinn 1998-2001; Helsingi-Tallinna liinil kiirlaevade turuosad 1999-2000

Use of a non-linear method for including the mass uncertainty of gravimetric standards and system measurement errors in the fitting of calibration curves for XRFA freeze-dried UNO3 standards

International Nuclear Information System (INIS)

Pickles, W.L.; McClure, J.W.; Howell, R.H.

1978-05-01

A sophisticated nonlinear multiparameter fitting program was used to produce a best fit calibration curve for the response of an x-ray fluorescence analyzer to uranium nitrate, freeze dried, 0.2% accurate, gravimetric standards. The program is based on unconstrained minimization subroutine, VA02A. The program considers the mass values of the gravimetric standards as parameters to be fit along with the normal calibration curve parameters. The fitting procedure weights with the system errors and the mass errors in a consistent way. The resulting best fit calibration curve parameters reflect the fact that the masses of the standard samples are measured quantities with a known error. Error estimates for the calibration curve parameters can be obtained from the curvature of the ''Chi-Squared Matrix'' or from error relaxation techniques. It was shown that nondispersive XRFA of 0.1 to 1 mg freeze-dried UNO 3 can have an accuracy of 0.2% in 1000 s

Liver transplantation for chronic hepatitis C virus infection in the United States 2002-2014: An analysis of the UNOS/OPTN registry.

Directory of Open Access Journals (Sweden)

Georg Dultz

Full Text Available Chronic hepatitis C virus (HCV infection is a leading cause for orthotopic liver transplantation (OLT in the U.S. We investigated characteristics of HCV-infected patients registered for OLT, and explored factors associated with mortality. Data were obtained from the United Network for Organ Sharing and Organ Procurement and Transplantation network (UNOS/OPTN registry. Analyses included 41,157 HCV-mono-infected patients ≥18 years of age listed for cadaveric OLT between February 2002 and June 2014. Characteristics associated with pre- and post-transplant survival and time trends over the study period were determined by logistic and Cox proportional hazard regression analyses and Poisson regressions. Most patients were white (69.1% and male (70.8%. At waitlist registration, mean age was 54.6 years and mean MELD was 16. HCC was recorded in 26.9% of the records. A total of 51.2% of the patients received an OLT, 21.0% died or were too sick; 15.6% were delisted and 10.4% were still waiting. Factors associated with increased waitlist mortality were older age, female gender, blood type 0, diabetes, no HCC and transplant region (p<0.001. OLT recipient characteristics associated with increased risk for post OLT mortality were female gender, age, diabetes, race (p<0,0001, and allocation MELD (p = 0.005. Donor characteristics associated with waitlist mortality included age, ethnicity (p<0.0001 and diabetes (p<0.03. Waitlist registrations and OLTs for HCC significantly increased from 14.4% to 37.3% and 27.8% to 38.5%, respectively (p<0.0001. Pre- and post-transplant survival depended on a variety of patient-, donor-, and allocation- characteristics of which most remain relevant in the DAA-era. Still, intensified HCV screening strategies and timely and effective treatment of HCV are highly relevant to reduce the burden of HCV-related OLTs in the U.S.

Piperazine side-effects in a patient with pre-existing renal insufficiency

Directory of Open Access Journals (Sweden)

Majid Malaki

2014-01-01

Full Text Available Piperazine as an antihelminth has many adverse effects, especially on patients with renal insufficiency. We report the use of piperazine in a girl with a moderately severe kidney disease due to Biedl Bardet syndrome. She developed coma and acute kidney injury due to acute interstitial nephritis (AIN, anemia and thrombocytopenia. The presence of fever, proteinuria, acidosis, anemia, sterile pyuria and non-oliguric renal failure strongly suggested AIN. Her problems abated mostly by discontinuing of piperazine and supportive therapy, except anemia and thrombocytopenia.

Gene : CBRC-GGOR-01-1448 [SEVENS

Lifescience Database Archive (English)

Full Text Available ain Friedlin] 1e-79 49% MCLALGSAGTADDVKLHPVACADTARSTPGTSAPSTPGTSAPSTPGTSAPSTSGISAPSTSGTSAPSTLGTSAPSKPGTSAPSKPGISAPSTSGISAPSTSGTSA...PSTSGTSAPSTPGTSAPSKPGTSAPSKPGISAPYTPGTSAPSTLGTSAPSTPGTSAPSTPGTSAPSKPGTSAPSKPGTSA...PSTPGTSAPSTLGTSAPSTPGTTAPSTAGTSAPSTSGTSAPSTSGTSAPSKPTTSAPYTPGTSAPSIPGTSAPSTTGTSAPSTPGTSAPSTPGTSAPSKPGTSAPSTPGTSA...PSTLGTSAPSTPGTSAPSTPGTSAPSKPGTSAPSMSGTSAPSTPGTSVPSKAGTSAPVDPGVLWGLERPLTDTEGRWLPPYVLL

Aluminium nitrate ceramics: A potential UV dosemeter material

DEFF Research Database (Denmark)

Trinkler, L.; Bøtter-Jensen, L.; Berzina, B.

2002-01-01

The ceramic material AIN-Y2O3 is proposed as a potential ultraviolet radiation (UVR) dosemeter using optically stimulated luminescence (OSL) and thermally stimulated luminescence (TL). Experimental studies have shown that AIN ceramics exhibit attractive characteristics suitable for practical UV...... dosimetry applications. The features are: (1) the spectral sensitivity covers the 200-350 nm range, in the UV-B region it is similar to that of human skin: (2) the angular dependence of the incident radiation follows the cosine law; (3) high yields of both UVR-induced OSL and TL signals compared to those...

"Iz bõli i krassok vozniknut novõje babotshki..." : [luuletused] / Jaan Kaplinski ; tlk. Svetlan Semenenko,

Index Scriptorium Estoniae

Kaplinski, Jaan, 1941-

1999-01-01

Sisu: "Iz põli i krassok vozniknut novõje babotshki..." ; "Vertsingetorig skazal: Tsesar, tõ mozhesh..." ; "Tesnõm tõ stalo vremja..." ; "Daite mne vremeni vremeni..." ; "Lozh dorogo stoit lozh deshevo stoit..." ; "A ja hotshu vozduhhom bõt..." ; "Poetõ pust pishut stihhi a ja letutshaja..." ; "Net ni proshlogo ni budushtshego ni nastojashtshego..." ; "Legko trudnõm bõt..." ; "Ona pojot i ja govorju...". Orig.: "Tolmust ja värvidest saavad uued liblikad aga meid..." ; "Vercingetorix ütles: Caesar, sa võid..." ; "Ahtaks oled sa jäänud kaasaeg..." ; Andke mulle aega aega ; "Vale on kallis, vale on odav..." ; "Aga mina tahan õhk olla..." ; "Luuletajad luuletavad, mina olen kala kes tõuseb lendu..." ; "Ei ole minevikku tulevikku ega olevikku..." ; "Kerge on raske olla..." ; "Ta laulab ja mina räägin..."

System for Comparing Gamma Sources Varying by Ratios of up to 1:1000; Dispositivo Gamma que para Comparar Fuentes Difieren Hasta uno En Mil

Energy Technology Data Exchange (ETDEWEB)

Tejera Rivera, A.; Navarro Cuevas, D. [Universidad Nacional Autonoma de Mexico, Mexico D.F. (Mexico)

1967-03-15

, principalmente gamma y de un mismo radioisotopo, cuando difieren en una relacion del orden de uno a miL La utilidad inmediata de este dispositivo es la elaboracion de patrones gamma para la calibracion de camaras de ionizacion que requieren actividades del orden de milicuries de radioisotopos, como el {sup 60}Co o el {sup 131}I, a partir de patrones respectivos con actividades del orden del microcurie. El principio en que se basan los dispositivos construidos es restringir el paso de la luz emitida por el cristal de centelleo al tubo fotomultiplicador. En el primer dispositivo se enmascaro la mitad de la cara del cristal de centelleo, Nal (TI), y la mitad de la cara del foto-multiplicador de tal forma que haciendo girar el cristal se sobreponen las mascaras y se restringe la luz desde 50% hasta 0%. Con este dispositivo se ha conseguido en la practica comparar actividades de uno a veinte. En el segundo dispositivo se han dispuesto cinco diafragmas en un disco rotatorio que permiten el paso desde 100% de luz hasta 1%. Usando este dispositivo es posible comparar fuentes que difieren hasta mil veces en actividad, manteniendo dentro de 100 000 cuentas/min la lectura del escalador. Este procedimiento resulta ventajoso principalmente porque disminuye el error debido a diferencias del tiempo muerto instrumental para los recuentos realizados con fuentes de muy diferente actividad y permite, ademas, comparar estas muestras usando un blindaje de dimensiones reducidas. (author)

Effect of reproductive tract scoring on reproductive efficiency in beef heifers bred by timed insemination and natural service versus only natural service.

Science.gov (United States)

Gutierrez, K; Kasimanickam, R; Tibary, A; Gay, J M; Kastelic, J P; Hall, J B; Whittier, W D

2014-04-15

The objective was to determine the effects of reproductive tract score (RTS) on reproductive performance in beef heifers bred by timed artificial insemination followed by natural service (AI-NS) or by natural service only (NSO). Angus cross beef heifers (n = 2660) in the AI-NS group were artificially inseminated at a fixed time (5- or 7-day CO-Synch + controlled internal drug release protocol) once, then exposed to bulls 2 weeks later (bull-to-heifer ratio = 1:40-1:50) for the reminder of the 85-day breeding season. Angus cross beef heifers (n = 1381) in NSO group were submitted to bulls (bull-to-heifer ratio = 1:20-1:25) for the entire 85-day breeding season. Heifers were reproductive tract scored from 1 (prepubertal) to 5 (cyclic) 4 weeks before, and were body condition scored (BCS) from 1 (emaciated) to 9 (obese) at the beginning of breeding season. Pregnancy diagnosis was performed 70 days after AI for AI-NS group and 2 months after the end of breeding season for both groups. Heifers in both groups were well managed and of similar age (14.9 ± 0.4 [AI-NS] and 14.7 ± 0.8 [NSO] months). Pregnancy rates (PRs) and number of days to become pregnant were calculated using PROC GLIMMIX and PROC LIFETEST procedures of SAS. Adjusting for BCS (P = 0.07), expressed estrus (P < 0.05), year (P < 0.05), and BCS by year interaction (P < 0.05), the AI-PR was greater for heifers in AI-NS group with higher RTS (P < 0.0001; 40.7%, 48.3%, 57.6%, and 64.6% for RTS of 2 or less, 3, 4, and 5, respectively). Controlling for BCS (P < 0.05), year (P < 0.05) and the breeding season pregnancy rates (BS-PRs) were greater for heifers in the AI-NS group with higher RTS (P < 0.01; 81.2%, 86.5%, 90.4%, and 95.2% for RTS of 2 or less, 3, 4, and 5, respectively). Similarly, adjusting for BCS, year (P < 0.05), the BS-PR was greater for heifers in NSO group with higher RTS (P < 0.01; 79.7%, 84.3%, 88.4%, and 90.2% for RTS of 2 or less, 3, 4, and 5, respectively). Heifers with higher RTS

Low Median Nerve Palsy as Initial Manifestation of Churg-Strauss Syndrome.

Science.gov (United States)

Roh, Young Hak; Koh, Young Do; Noh, Jung Ho; Gong, Hyun Sik; Baek, Goo Hyun

2017-06-01

Anterior interosseous nerve (AIN) syndrome is typically characterized by forearm pain and partial or complete dysfunction of the AIN-innervated muscles. Although the exact etiology and pathophysiology of the disorder remain unclear, AIN syndrome is increasingly thought to be an inflammatory condition of the nerve rather than a compressive neuropathy because the symptoms often resolve spontaneously following prolonged observation. However, peripheral neuropathy can be 1 of the first symptoms of systemic vasculitis that needs early systemic immunotherapy to prevent extensive nerve damage. Churg-Strauss syndrome (CSS; eosinophilic granulomatosis with polyangiitis) is 1 type of primary systemic vasculitis that frequently damages the peripheral nervous system. CSS-associated neuropathy usually involves nerves of the lower limb, and few studies have reported on the involvement of the upper limb alone. We report on a rare case of low median nerve palsy as the initial manifestation of CSS. The patient recovered well with early steroid treatment for primary systemic vasculitis. Copyright © 2017 American Society for Surgery of the Hand. Published by Elsevier Inc. All rights reserved.

ORF Alignment: NC_003212 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ain Clip11262) ... Length = 200 ... Query: 88 ... NAGLIKIGISEPSASLVLPQILKQFLTDFP...KLMVNVSVDDANTCSQKLIDGEIDFAICGE 147 ... NAGLIKIGISEPSASLVLPQILKQFLTDFPKLMVNVSVDDANTCSQKLIDGEIDFAICGE Sbjct: 1 ... NAGLIKIGISEPS

Anti-inflamatórios não esteroides: Efeitos cardiovasculares, cérebro-vasculares e renais Antiinflamatorios no esteroides: efectos cardiovasculares, cerebrovasculares y renales Nonsteroidal anti-inflammatory drugs: cardiovascular, cerebrovascular and renal effects

Directory of Open Access Journals (Sweden)

Michel Batlouni

2010-04-01

Full Text Available Os anti-inflamatórios não esteroides (AINEs encontram-se entre os medicamentos mais prescritos em todo o mundo. Essa classe heterogênea de fármacos inclui a aspirina e vários outros agentes inibidores da ciclo-oxigenase (COX, seletivos ou não. Os AINEs não seletivos são os mais antigos, e designados como tradicionais ou convencionais. Os AINEs seletivos para a COX-2 são designados COXIBEs. Nos últimos anos, tem sido questionada a segurança do uso dos AINEs na prática clínica, particularmente dos inibidores seletivos da COX-2. As evidências sobre o aumento do risco cardiovascular com o uso de AINEs são ainda incompletos, pela ausência de ensaios randomizados e controlados com poder para avaliar desfechos cardiovasculares relevantes. Entretanto, os resultados de estudos clínicos prospectivos e de meta-análises indicam que os inibidores seletivos da COX-2 exercem importantes efeitos cardiovasculares adversos, que incluem aumento do risco de infarto do miocárdio, acidente vascular cerebral, insuficiência cardíaca, insuficiência renal e hipertensão arterial. O risco desses efeitos adversos é maior em pacientes com história prévia de doença cardiovascular ou com alto risco para desenvolvê-la. Nesses pacientes, o uso de inibidores da COX-2 deve ser limitado àqueles para os quais não há alternativa apropriada e, mesmo assim, somente em doses baixas e pelo menor tempo necessário. Embora os efeitos adversos mais frequentes tenham sido relacionados à inibição seletiva da COX-2, a ausência de seletividade para essa isoenzima não elimina completamente o risco de eventos cardiovasculares, de modo que todos os fármacos do largo espectro dos AINEs somente devem ser prescritos após consideração do balanço risco/benefício.Los antiinflamatorios no esteroides (AINEs se encuentran entre los medicamentos más prescriptos en todo el mundo. Esta clase heterogénea de fármacos incluye la aspirina y varios otros agentes

Diagnóstico y propuesta de plan de mejoramiento en el área financiera para el Sistema de Cooperativas de Ahorro y Crédito del Segmento Uno, reguladas por la Superintendencia de Economía Popular y Solidaria, durante el período 2011- 2014

OpenAIRE

Pacheco Guevara, Ximena Patricia

2016-01-01

La presente investigación se enfoca en una propuesta de mejora en el área financiera para el sistema de cooperativas de ahorro y crédito del segmento uno, reguladas por la Superintendencia de Economía Popular y Solidaria, durante el período 2011-2014. Bajo este contexto, se revisaron una serie de metodologías aplicadas a nivel internacional, definiendo la creada por el Consejo Mundial de Cooperativas de Ahorro y Crédito WOCCU como la más apropiada, al analizar específicamente cooperativas de ...

High Prevalence of Anal Human Papillomavirus-Associated Cancer Precursors in a Contemporary Cohort of Asymptomatic HIV-Infected Women.

Science.gov (United States)

Heard, Isabelle; Etienney, Isabelle; Potard, Valérie; Poizot-Martin, Isabelle; Moore, Catherine; Lesage, Anne-Carole; Ressiot, Emmanuelle; Crenn-Hebert, Catherine; Fléjou, Jean-François; Cubie, Heather; Costagliola, Dominique; Darragh, Teresa M

2015-05-15

Although human immunodeficiency virus (HIV)-infected women are at high risk for anal cancer, few data have been published on prevalence of and risk factors for anal precancer and potential screening strategies in this risk group. A cross-sectional anal screening study was nested in a gynecological cohort of HIV-infected women. Anal swab specimens were collected for cytology and human papillomavirus (HPV) testing. High-resolution anoscopy, with biopsy when indicated, was systematically performed. Among the 171 enrolled women, median age was 47.3 years and 98% were receiving combination antiretroviral therapy. Median CD4(+) count was 655 cells/µL and HIV load was associated with increased risk of HG-AIN+. Abnormal anal cytology and HPV-16 infection performed best as a screening strategy for HG-AIN+ histology, with positive likelihood ratios of 3.4 (95% CI, 2.3-5.1) and 4.7 (95% CI, 2.5-8.7) and negative likelihood ratios of 0.2 (95% CI, .07-.8) and 0.4 (95% CI, .2-.9), respectively. HIV-infected women with a history of HPV-associated cervical disease are at increased risk for HG-AIN+ and should be offered anal cancer screening. Anal cytology and HPV-16 genotyping had the best screening performance. Anal cytology is easy to perform routinely; it may be the best candidate for screening for HG-AIN among HIV-infected women. © The Author 2015. Published by Oxford University Press on behalf of the Infectious Diseases Society of America. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.

Abnormal structure and functional connectivity of the anterior insula at pain-free periovulation is associated with perceived pain during menstruation.

Science.gov (United States)

Dun, Wang-Huan; Yang, Jing; Yang, Ling; Ding, Dun; Ma, Xue-Ying; Liang, Feng-Li; von Deneen, Karen M; Ma, Shao-Hui; Xu, Xiao-Ling; Liu, Jixin; Zhang, Ming

2017-12-01

Neuroimaging studies have demonstrated the critical role of the insula in pain pathways and its close relation with the perceived intensity of nociceptive stimuli. We aimed to identify the structural and functional characteristics of the insula during periovulatory phase in women with primary dysmenorrhea (PDM), and further investigate its association with the intensity of perceived pain during menstruation. Optimized voxel-based morphometry and functional connectivity (FC) analyses were applied by using 3-dimensional T1-weighted and resting functional magnetic resonance imaging (fMRI) in 36 patients at the peri-ovulation phase and 29 age-, education-, and gender-matched healthy controls (HC). A visual analogue scale (VAS) was used to examine the intensity of the abdominal pain at periovulation and menstruation. In our results, PDM patients had significant higher VAS-rating during menstruaion than periovulation. Compared with the HC, PDM patients had lower gray matter density in the left anterior insula (aINS). Taken the left aINS as a seed region, we further found hypoconnectivity between aINS and medial prefrontal cortex (mPFC), which showed negative relation with the VAS during menstruation. As the aINS is a key site of the salience network (SN) and the mPFC is a critical region in the default mode network (DMN), it's implicated a trait-related central-alteration that communications between pain attention and perception networks were disrupted without the ongoing menstrual pain. Moreover, result of correlation analysis, at least in part, suggested a possible role of altered FC (pain-free period) in predicting pain perception (menstruation).

Clonixinato de lisina injetável intravenoso para o tratamento agudo das enxaquecas: um estudo piloto aberto

OpenAIRE

KRYMCHANTOWSKI, ABOUCH V.; BARBOSA, JACKELINE

1999-01-01

Alguns antinflamatórios não esteroidais (AINE) orais são eficientes para o tratamento dos ataques de migrânea ou enxaqueca. A despeito de sua eficiência para o tratamento destas cefaléias e de outras dores, existem comercialmente poucos antinflamatórios não esteroidais disponíveis para administração parenteral. O clonixinato de lisina (CL) é um AINE derivado do ácido nicotínico que foi comprovadamente eficiente em vários tipos de síndromes álgicas como cólica renal, dor de compressão nervosa,...

[Acute severe colitis with recto-vaginal fistula during treatment with non-steroidal anti-inflammatory agents].

Science.gov (United States)

Tissot, B; Lamy, A; Perraudeau, F; Manouvrier, J L; Imbert, Y

2002-07-13

We report the case of severe colitis occurring during treatment with non-steroid anti-inflammatories (NSAI). A 57 year-old woman was hospitalized for lumbar pain that had not been relieved by AINS, tramadol and then morphine. The patient presented with septic shock and peritonitis by rectal perforation, followed by acute rectorrhagia. The endoscopic aspect evoked Crohn's disease with a recto-vaginal fistula. Progression was further complicated by two episodes of collapse because of acute rectorrhagia, requiring hemostasis colectomy and abdominal-perineal amputation. The diagnosis retained was AINS-induced colitis complicated by acute colectasia on a fecaloma with recto-vaginal fistula.

ORF Alignment: NC_003212 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ain ... Clip11262) ... Length = 73 ... Query: 8 ... ASALLELIGGKENISSVTHCATRMRFV...LLDPDNADVEAIEDIPAVKGTFTQAGQFQVIIG 67 ... ASALLELIGGKENISSVTHCATRMRFVLLDPDNADVEAIEDIPAVKGTFTQAGQFQ...VIIG Sbjct: 1 ... ASALLELIGGKENISSVTHCATRMRFVLLDPDNADVEAIEDIPAVKGTFTQAGQFQVIIG 60 ...

"Ma vannun tema niuete kui paleuse nimel ..." : [luuletused] / tlk. Andres Ehin, tlk. Ly Seppel

Index Scriptorium Estoniae

2004-01-01

Sisu: "Ma vannun tema niuete kui paleuse nimel ..." ; "Ta on nagu kuu, kelle kuma kõik kummuli kukutab ..." ; "Kuu südaöösel ennustab me jäävat lahkujääma ..." ; "Ei hinda naisterahvas kasinuse mulli ..." ; "Ta nõtket kaela kutsun ligemale ..." ; "Meid ühte heitma tõmbab armuköis ..." ; "Meil kahel pole mõtet lahku minna ..." ; "Ei kuuga saa võrrelda sind, sest et kuu läheb looja ..." ; "Allah ise su ilude hoob on ja kang ..." ; "Kui meesterahvale läeb korda meesterahvas ..." ; "Ja kuis ka kiremöll tal südames ei hulla ..." ; "Teie jaoks ei ole minu võlurohke kallike ..." ; "Oli see vast poisike, nägu ilu täis ..." ; "Aeg tagasi kalli las toob, et mind suisa salvata ...". Tundmatute autorite kirjutatud luuletused jutukogust "1001 ööd" (9. - 10. saj)

Comparison of early versus delayed timing of left ventricular assist device implantation as a bridge-to-transplantation: An analysis of the UNOS dataset.

Science.gov (United States)

Kitada, Shuichi; Schulze, P Christian; Jin, Zhezhen; Clerkin, Kevin; Homma, Shunichi; Mancini, Donna M

2016-01-15

Placement of left ventricular assist devices (LVAD) as a bridge-to-heart transplantation (HTx) has rapidly expanded due to organ donor shortage. However, the timing of LVAD implantation is variable and it remains unclear if earlier implantation improves survival. We analyzed 14,187 adult candidates from the United Network of Organ Sharing database. Patients were classified by 3 treatment strategies including patients medically treated alone (MED, n=11,009), patients on LVAD support at listing (Early-LVAD, n=1588) and patients undergoing LVAD placement while awaiting HTx (Delayed-LVAD, n=1590). Likelihood of HTx and event-free survival were assessed in patients subcategorized by clinical strategies and UNOS status at listing. The device support strategy, despite the timing of placement, was not associated with increased likelihood of HTx compared to MED group. However, both LVAD implantation strategies showed better survival compared to MED group (Early-LVAD: HR 0.811 and 0.633, 95% CI 0.668-0.984 and 0.507-0.789, for 1A and 1B; p=0.034 and p<0.001, Delayed-LVAD: HR 0.553 and 0.696, 95% CI 0.415-0.736 and 0.571-0.847, for 1A and 1B; both p<0.001, respectively). Furthermore, there was no significant difference in survival between these LVAD implantation strategies in patients listed as 1B (p=0.500), although Early-LVAD implantation showed worse survival in patients listed as 1A (HR 1.467, 95% CI 1.076-2.000; p=0.015). LVAD support strategies offer a safe bridge-to-HTx. Those candidates who receive urgent upfront LVAD implantation for HTx, and improve to 1B status, would achieve competitive survival with those who receive elective LVAD implantation. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

EFFETS D’UN ALIMENT EXTRUDE SUR LES PERFORMANCES DE CROISSANCE DE LA TRUITE ARC-EN-CIEL (ONCORHYNCHUS MYKISS WALBAUM, 1792 ET SUR LA QUALITE DE L’EAU DE L’OUED OUM ER-RBIA (STATION AIN AGHBAL, AZROU-MAROC

Directory of Open Access Journals (Sweden)

Khadija OUAISSA

2017-05-01

Full Text Available The objective of our study is to test the efficacy of an extruded food on the growth performance of rainbow trout (Oncorhynchus mykiss Walbaum, 1792 at the fish farm Ain Aghbal in Azrou (Morocco. Generally, only the biochemical composition (percentages of moisture, proteins, lipids and carbohydrates and the (digestible and crude energies of the food are previously known, which is insufficient for the choice of the food in terms of growth performance and quality/environment. The rainbow trout breeding tanks used for this test are 222 days (15 June 2015 - 28 February 2016 are fed with water directly taken from the water of the Oum Er-Rbia sources according to an open circuit with a Renewal of water every half hour. The flow rate is 11.04m3/h. The initial breeding conditions, the density (Kg per volume 1.58kg/m3 and the initial charge with respect to the flow rate is 1.05 m3 / h. Fish are fed by ratios two to three times per day depending on the rearing stage. The frequency of sampling is biweekly where we measured the zootechnical performances of the fish and taken water samples for physicochemical analyzes in order to assess the quality of the waters of exit of the basins before their rejection in the Oum-Er-Rbia river. The results show that the test food shows a better growth of the rainbow trout and a conversion index not exceeding 0.9 for a size of 1043 g of trout.

Historia de unos cueros de ciervo

Directory of Open Access Journals (Sweden)

Luis Vidales

1965-01-01

Full Text Available Un día de 1903, el duque José Florimond de Loubat solicitó a Eduardo Seler que comentara el "Códice Borgia". Seler acababa de llegar de Yucatán, donde se apertrechó de conocimientos sobre el arte precolombino de la región y satisfizo de inmediato la invitación de su estimulante Mesenas. En agosto de 1904 concluyó en Steglitz y entregó "a su excelencia" el primer tomo de su exégesis sobre el códice de autos, "sin duda la más extraordinaria de todas las pictografías aún conservadas del México antiguo", según el decir del propio señor Seler.

Il tempo perturbante di uno sguardo

Directory of Open Access Journals (Sweden)

Piero Zanini

2010-06-01

Full Text Available Nell’autunno del 1973 Pier Paolo Pasolini viene invitato a partecipare ad una rubrica televisiva intitolata Io e …, nella quale intellettuali, poeti, registi, musicisti, scrittori sono chiamati a scegliere e a parlare di un’opera d’arte a cui tengono in modo particolare. Dopo un crescendo di ripensamenti intorno al tema da trattare (una pietra, un muretto, una fontana Pasolini sceglie infine di concentrare la sua attenzione sulla forma della città, a partire da due luoghi tanto a lui familiari quanto tra loro radicalmente diversi: la medievale Orte, la fascista Sabaudia. Il risultato della sua partecipazione alla trasmissione è una sorta di ‘scritto corsaro’ per immagini, Pasolini e… la forma della città1, un documento importante e complesso per comprendere la “sostanza di Pasolini” [Contini, 1988] in quel momento particolare della sua vita che sono i primi anni Settanta.

EL presidente, uno sentimento / Andrei Hvostov

Index Scriptorium Estoniae

Hvostov, Andrei, 1963-

2009-01-01

Euroopa Liidu presidendi ja välispoliitika juhi ameti sisu pole teada, autori hinnangul sõltub kõik sellest, mismoodi hakkavad konkreetsed isikud neis ameteis käituma. Eesti presidendi Toomas Hendrik Ilvese ja teiste kandidaatide võimalustest

Lo que uno pretende que sea

OpenAIRE

Da Pieve, Enzo

2017-01-01

Si bien la escritura es, de manera teórica, una manifestación de la actividad lingüística humana que posee ciertos rasgos de intencionalidad y contextualidad de lo verbal, es necesario obstinarse en una búsqueda más profunda de la importancia de la escritura. Es fundamental hacer un análisis minucioso, tanto de lo formal como de lo emocional, lo contextual, lo social, lo artístico. La escritura es un mundo por descubrir. Centro de Investigación en Lectura y Escritura (CILE)

Meta para unos, don para otros

Directory of Open Access Journals (Sweden)

Jorge H. Cadavid

1996-01-01

Full Text Available Manos ineptas. Carlos Héctor Trejos. Editorial Universidad de Amioquia, Medellín,1995, 100 págs. El libro de las cosas. Ómar Ortiz Forero. Editorial Universidad de Antioquia. Medellín, 1995. 111 págs. Espacios relojes y tiempo. Luz Amparo Palacios M. Editorial Feriva, Armenia. 1995, 43 págs.

Iiri referendum, Euroopa õnn? / Uno Silberg

Index Scriptorium Estoniae

Silberg, Uno, 1964-

2001-01-01

Iiri presidendi Mary MacAleese Eesti visiit ei ole juhus. Selle eesmärk on propageerida Eesti eurovastastele Iirimaa euroedukust ja summutada Iiri-sisest debatti 7. juunil Nizza lepingu ratifitseerimiseks. Eurosekptitsism

Anterior Interosseous Nerve Neuropraxia Secondary to Shoulder Arthroscopy and Open Subpectoral Long Head Biceps Tenodesis

Directory of Open Access Journals (Sweden)

Jeremiah T. Steed

2017-01-01

Full Text Available Arthroscopic rotator cuff tendon repair is a common elective procedure performed by trained orthopaedic surgeons with a relatively low complication rate. Specifically, isolated neuropraxia of the anterior interosseous nerve (AIN is a very rare complication of shoulder arthroscopy. An analysis of peer-reviewed published literature revealed only three articles reporting a total of seven cases that describe this specific complication following standard shoulder arthroscopic procedures. This article reports on three patients diagnosed with AIN neuropraxia following routine shoulder arthroscopy done by a single surgeon within a three-year period. All three patients also underwent open biceps tenodesis immediately following completion of the arthroscopic procedures. The exact causal mechanism of AIN neuropraxia following shoulder arthroscopy with biceps tenodesis is not known. This case report reviews possible mechanisms with emphasis on specific factors that make a traction injury the most likely etiology in these cases. We critically analyze our operating room setup and patient positioning practices in light of the existing biomechanical and cadaveric research to propose changes to our standard practices that may help to reduce the incidence of this specific postoperative complication in patients undergoing elective shoulder arthroscopy with biceps tenodesis.

Non-nitric oxide based metallovasodilators: synthesis, reactivity and biological studies.

Science.gov (United States)

Sá, Denise S; Fernandes, André F; Silva, Carlos D S; Costa, Paula P C; Fonteles, Manassés C; Nascimento, Nilberto R F; Lopes, Luiz G F; Sousa, Eduardo H S

2015-08-14

There is an increasing number of compounds developed to target one or more pathways involved in vasodilation. Some studies conducted with azaindole and indazole derivatives showed cardiovascular activity associated with these compounds. Fast and easy structural modification of these organic molecules can be achieved using metal complexes promoting a much larger spatial change than organic strategies, potentially leading to novel drugs. Here, we have prepared a series of complexes with a formula cis-[RuCl(L)(bpy)(2)]PF(6), where L = 7-azaindole (ain), 5-azaindole (5-ain), 4-azaindole (4-ain), indazole (indz), benzimidazole (bzim) or quinoline (qui), which were characterized by spectroscopic and electrochemical techniques (CV, DPV). These compounds showed reasonable stability exhibiting photoreactivity only at low wavelength along with superoxide scavenger activity. Cytotoxicity assays indicated their low activity preliminarily supporting in vivo application. Interestingly, vasodilation assays conducted in rat aorta exhibited great activity that largely improved compared to free ligands and even better than the well-studied organic compound (BAY 41-42272), with IC(50) reaching 55 nM. These results have validated this strategy opening new opportunities to further develop cardiovascular agents based on metallo-bicyclic rings.

Investorid on dilemma ees / Ain Kivisaar

Index Scriptorium Estoniae

Kivisaar, Ain, 1978-

2007-01-01

Keskmise kuupalga eest ei saa enam ruutmeetritki elamispinda ei meil ega mujal. Aktiivsel investoril pole muud teha, kui heita kõrvale tavatarkus ja usaldada enda sisetunnet. Diagramm: Keskmise kuupalga ja korteri ruutmeetri hinna suhe

Euroopa abiraha igatseb taotlejaid / Ain Alvela

Index Scriptorium Estoniae

Alvela, Ain, 1967-

2008-01-01

Aastatel 2007-2013 saab Eesti Euroopa Liidult toetusi 78 miljardit krooni, millele toetudes on võimalik rasked ajad üle elada. Vt. samas: Tuhahoidlast asula jäätmepunktini; Suurima toetuse saab keskkond. Kommenteerivad Antti Tooming ja Kai Niels Willadsen

Teacher Tenure "Ain't" the Problem.

Science.gov (United States)

Hansen, Kenneth; Ellena, William J.

The concept of "tenure," with all its clumsy and confusing burden of historic and current misinterpretation, will probably soon disappear. However, what tenure laws intended, and have failed to do, will almost surely be preserved in other forms of administrative procedure. To be effective, administrative procedures must be (1) clear and detailed,…

VJ annab muusikale visuaalsuse / Ain Kivesti

Index Scriptorium Estoniae

Kivesti, Ain

2008-01-01

Videograafikast. Video jockey ehk videokunstnik maalib kunstiteoseid piltide ja visuaalsete elementide abil, tehes seda muusika taustal, tavaliselt paralleelselt disco jockey'ga. Toomas Altnurme, Taavi Varmi, Sten Saluveeri ja Erki Kannuse kommentaare

Makita kalmistu antropoloogiline aines / Luule Heapost

Index Scriptorium Estoniae

Heapost, Luule

1993-01-01

Tabel : Makita koljude keskmised mõõtmed ; Tabel : 13.-15. sajandi Makita koljud ja võrdlusmaterjalid Eestist ; Tabel 3 : 13. -15. sajandi Makita koljud ning võrdlusandmeid soome-ugri hõimude asualadelt ; Tabel 4 : 15.- 17. sajandi Makita koljud ja võrdlusandmed ; Tabel 5 : Makita koljude võrdlusandmed (Pernose'i meetodil) ; Tabel 6 : Makita luustike pikkade luude keskmine pikkus ; Tabel 7 : Kehapikkuse võrdlusandmed

Globaalsus + lennundus = Star Alliance? / Ain Hinsberg

Index Scriptorium Estoniae

Hinsberg, Ain

2002-01-01

Erinevad koostöövormid lennufirmade vahel, alliansside teke ja areng maailmas. Maailma juhtivad lennundusalliansid ja nende poolt kaetud riigid ja sihtkohad. Kommenteerib Estonian Airi president Erki Urva

You ain't seen nothing yet

NARCIS (Netherlands)

Walhof, Gert

Omtrent technologiebedrijven konden we in december 2016 veel lezen over wat artificial intelligence, virtual reality, machine-to-machine automation, machine-to-machine learning en chatbots ons de komende jaren gaan brengen. Als inkoper zou je kunnen wachten tot duidelijk wordt wat de blijvertjes

Brain damage associated with apraxia of speech: evidence from case studies.

Science.gov (United States)

Moser, Dana; Basilakos, Alexandra; Fillmore, Paul; Fridriksson, Julius

2016-08-01

The site of crucial damage that causes acquired apraxia of speech (AOS) has been debated in the literature. This study presents five in-depth cases that offer insight into the role of brain areas involved in AOS. Four of the examined participants had a primary impairment of AOS either with (n = 2) or without concomitant mild aphasia (n = 2). The fifth participant presented with a lesion relatively isolated to the left anterior insula (AIns-L), damage that is rarely reported in the literature, but without AOS. Taken together, these cases challenge the role of the AIns-L and implicate the left motor regions in AOS.

Efecto de la histerectomía con preservación de uno o dos ovarios sobre la concentración de estradiol en mujeres premenopáusicas

Directory of Open Access Journals (Sweden)

Francisco Andrés Socola Cuzco

2009-04-01

Full Text Available Objetivo: Determinar el efecto de la histerectomía con preservación de uno o dos ovarios sobre el nivel de estradiol en mujeres premenopáusicas. Materiales y métodos: Se incluyeron en el estudio 40 mujeres premenopáusicas del Hospital Nacional Arzobispo Loayza; se les realizó una medición de estradiol antes de la histerectomía y la otra medición luego de un tiempo equivalente a tres ciclos menstruales después de la cirugía. Además se les realizó una encuesta de síntomas climatéricos en ambas oportunidades. Resultados: No hubo diferencia significativa entre los niveles de estradiol antes y después de la histerectomía. La comparación de estas medias respecto al tipo de histerectomía, número de ovarios conservados y al diagnóstico preoperatorio, no alcanzó valores estadísticamente significativos. No hubo diferencia estadísticamente significativa entre los síntomas climatéricos antes y después de la cirugía. Conclusiones: El tipo de histerectomía, el número de ovarios conservados y el diagnóstico preoperatorio no alterarían los niveles de estradiol luego de un tiempo equivalente a tres ciclos menstruales ni favorecerían la aparición de síntomas climatéricos.(Rev Med Hered 2009;20:185-190.

Data of evolutionary structure change: 1ONAD-2GDFC [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 1ONAD-2GDFC 1ONA 2GDF D C ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAK...WNMQNGKVGTAHIIYNSVDKRLSAVVSYPNADSATVSYDVDLDNVLPEWVRVGLSASTGLYKETNTILSWSFTSKLKT-NALHFMFNQFSKDQKDLILQGDATTGTDG...ain> 1ONA D 1ONAD

Data of evolutionary structure change: 1ONAD-2GDFA [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 1ONAD-2GDFA 1ONA 2GDF D A ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAK...WNMQNGKVGTAHIIYNSVDKRLSAVVSYPNADSATVSYDVDLDNVLPEWVRVGLSASTGLYKETNTILSWSFTSKLKT-NALHFMFNQFSKDQKDLILQGDATTGTDG...ain> 1ONA D 1ONAD

Impact of Socioeconomic Status on Patients Supported With a Left Ventricular Assist Device: An Analysis of the UNOS Database (United Network for Organ Sharing).

Science.gov (United States)

Clerkin, Kevin J; Garan, Arthur Reshad; Wayda, Brian; Givens, Raymond C; Yuzefpolskaya, Melana; Nakagawa, Shunichi; Takeda, Koji; Takayama, Hiroo; Naka, Yoshifumi; Mancini, Donna M; Colombo, Paolo C; Topkara, Veli K

2016-10-01

Low socioeconomic status (SES) is a known risk factor for heart failure, mortality among those with heart failure, and poor post heart transplant (HT) outcomes. This study sought to determine whether SES is associated with decreased waitlist survival while on left ventricular assist device (LVADs) support and after HT. A total of 3361 adult patients bridged to primary HT with an LVAD between May 2004 and April 2014 were identified in the UNOS database (United Network for Organ Sharing). SES was measured using the Agency for Healthcare Research and Quality SES index using data from the 2014 American Community Survey. In the study cohort, SES did not have an association with the combined end point of death or delisting on LVAD support (P=0.30). In a cause-specific unadjusted model, those in the top (hazard ratio, 1.55; 95% confidence interval, 1.14-2.11; P=0.005) and second greatest SES quartile (hazard ratio 1.50; 95% confidence interval, 1.10-2.04; P=0.01) had an increased risk of death on device support compared with the lowest SES quartile. Adjusting for clinical risk factors mitigated the increased risk. There was no association between SES and complications. Post-HT survival, both crude and adjusted, was decreased for patients in the lowest quartile of SES index compared with all other SES quartiles. Freedom from waitlist death or delisting was not affected by SES. Patients with a higher SES had an increased unadjusted risk of waitlist mortality during LVAD support, which was mitigated by adjusting for increased comorbid conditions. Low SES was associated with worse post-HT outcomes. Further study is needed to confirm and understand a differential effect of SES on post-transplant outcomes that was not seen during LVAD support before HT. © 2016 American Heart Association, Inc.

Tratamento com antiinflamatórios tópicos na osteoartrite de joelho Topical anti-inflammatory drugs in osteoarthritis of the knee

Directory of Open Access Journals (Sweden)

Helena Lúcia Alves Pereira

2006-06-01

Full Text Available Os antiinflamatórios não-esteroidais (AINEs orais são eficazes no alívio da dor na osteoartrite (OA, porém têm o risco de efeitos adversos sistêmicos. Para diminuir a toxicidade é necessário reduzir a concentração plasmática uma vez que os efeitos adversos são dose-dependentes. Os AINEs de uso tópico, em teoria, alcançam altas concentrações nos tecidos-alvo com concentrações plasmáticas baixas, sendo portanto uma alternativa terapêutica, especialmente para pacientes de risco. Nossa revisão dos ensaios clínicos randomizados mostrou que os AINEs tópicos foram mais efetivos que o placebo e tão eficazes quanto os AINEs orais. Porém, o pequeno número de ensaios e falhas na metodologia nos impossibilita de fazer conclusões definitivas, sendo necessários estudos bem desenhados e de maior duração.Oral non-steroidal anti-inflammatories drugs (NSAIDs are effective in pain relief in osteoarthritis (OA, but are also associated with risks of adverse systemic side effects. In order to reduce its toxicity, it would be desirable to decrease the plasmatic levels of NSAIDs since those side effects are dose-dependent. Topical NSAIDs would be a therapeutic alternative in theory, because while they reach high levels in local tissues, they also produce low plasmatic levels. Our review analyzed clinical randomized and shown that topical NSAIDs were superior to placebo and have similar efficacy to oral NSAIDs, but due a few number of trials and methodological weaknesses we can't make definitive conclusions. Further well designed, long term studies are required.

Anti-human neutrophil antigen-1a, -1b, and -2 antibodies in neonates and children with immune neutropenias analyzed by extracted granulocyte antigen immunofluorescence assay.

Science.gov (United States)

Onodera, Rie; Kurita, Emi; Taniguchi, Kikuyo; Karakawa, Shuhei; Okada, Satoshi; Kihara, Hirotaka; Fujii, Teruhisa; Kobayashi, Masao

2017-11-01

Anti-human neutrophil antigen (HNA) antibodies have been implicated in the development of neonatal alloimmune neutropenia (NAN) and autoimmune neutropenia (AIN). There are many conventional assay methods that detect anti-HNA antibodies. However, a method to measure multiple samples and detect several anti-HNA antibodies simultaneously is needed. We developed a new method, the extracted granulocyte antigen immunofluorescence assay (EGIFA), to analyze anti-HNA-1a, -1b, and -2 antibodies in sera. The results obtained by EGIFA were evaluated in comparison with those from several standard assay methods. Anti-HNA antibodies in serum samples from nine familial cases with suspected NAN (n = 19) and children with suspected AIN (n = 88) were also measured by EGIFA. The evaluation of nine serum samples with anti-HNA antibodies suggested that EGIFA demonstrated equivalent specificity and superior sensitivity to monoclonal antibody-specific immobilization of granulocyte antigens and had comparable sensitivity to the granulocyte indirect immunofluorescence test. EGIFA successfully detected anti-HNA-1a or -1b antibodies in seven of nine familial cases with suspected NAN. EGIFA detected anti-HNA antibodies in 40.9% of children with suspected AIN. Among them, isolated anti-HNA-1a or -1b antibody was detected in 4.5 or 12.5% of children, respectively, and anti-HNA-2 antibody was identified in 3.4% of children. The 30.8% (16 of 52) of children negative for anti-HNA antibody by EGIFA were positive for anti-HLA antibody. EGIFA facilitated the measurement of anti-HNA-1a, -1b, and/or -2 antibodies in sera. The prompt measurement of anti-HNA antibodies will improve the diagnosis and clinical management of patients with suspected NAN or AIN. © 2017 AABB.

Influence of diet with kale on lipid peroxides and malondialdehyde levels in blood serum of laboratory rats over intoxication with paraquat.

Science.gov (United States)

Sikora, Elżbieta; Bodziarczyk, Izabela

2013-01-01

Organism's lipid peroxidation is one of the most often examined and known physiological process evoked by free radicals. It concerns oxidation reaction of unsaturated fatty acid and/or other lipids leading to lipid oxidation products (LOP), which as a result of further changes generate among others the malondialdehyde molecules. The aim of the work was an estimation if raw or cooked kale addition to rat's diet influences antioxidant defense efficiency in their organisms in comparison to rats fed with standard AIN-93G diet. The experiment was conducted with 36 Wistar strain, male rats over 21 days. The rats were divided into 3 groups (each 12 stuck) which were fed with: standard diet AIN-93G (2 groups), AIN-93G diet with 10% addition of raw kale (2 groups), and AIN-93G with 10% addition of cooked lyophilised kale. The total content of polyphenols (FC method) and antioxidant activity (ABTS+•) were previously determined in raw and then in cooked kale. On the 20th day of experiment, half of rats (6 stuck) of each kind of the diet were injected intraperitoneally by the solution of paraquat (PQ) in physiological salt to evoke the oxidative stress. The next day animals were stunned and blood from their hearts was sampled. In the obtained serum, the levels of lipid oxidation products (LOP) and malondialdehyde (MDA) were assessed. It was observed that in blood serum of rats fed with modified diet with raw and cooked lyophilised kale addition the lipid oxides level was lower in comparison to control group fed with standard diet (p kale addition. Diet with kale, both raw and cooked, efficiently inhibited the lipid peroxidation process in rats' organisms, ongoing during natural metabolism and during evoked oxidative stress.

Drug-induced acute interstitial nephritis: A clinicopathological study and comparative trial of steroid regimens

Directory of Open Access Journals (Sweden)

R Ramachandran

2015-01-01

Full Text Available Steroids are used in the management of drug-induced acute interstitial nephritis (AIN. The present study was undertaken to compare the efficacy of pulse methyl prednisolone with oral prednisolone in the treatment of drug-induced AIN. Patients with biopsy-proven AIN with a history of drug intake were randomized to oral prednisolone (Group 1 1 mg/kg for 3 weeks or a pulse methyl prednisolone (Group II 30 mg/kg for 3 days followed by oral prednisolone 1 mg/kg for 2 weeks, tapered over 3 weeks. Kidney biopsy scoring was done for interstitial edema, infiltration and tubular damage. The response was reported as complete remission (CR (improvement in estimated glomerular filtration rate [eGFR] to ≥60 ml/min/1.73 m 2 , partial remission (PR (improvement but eGFR <60 ml/min/1.73 m 2 or resistance (no CR/PR. A total of 29 patients, Group I: 16 and Group II: 13 were studied. Offending drugs included nonsteroidal anti-inflammatory drugs, herbal drugs, antibiotics, diuretic, rifampicin and omeprazole. There was no difference in the baseline parameters between the two groups. The biopsy score in Groups I and II was 5.9 ΁ 1.1 and 5.1 ΁ 1.2, respectively. At 3 months in Group I, eight patients each (50% achieved CR and PR. In Group II, 8 (61% achieved CR and 5 (39% PR. This was not significantly different. Percentage fall in serum creatinine at 1 week (56% was higher in CR as compared to (42% those with PR. ( P = 0.14. Patients with neutrophil infiltration had higher CR compared to patients with no neutrophil infiltration ( P = 0.01. Early steroid therapy, both oral and pulse steroid, is equally effective in achieving remission in drug-induced AIN.

Kaks debüüti / Lilian Vellerand

Index Scriptorium Estoniae

Vellerand, Lilian, 1932-

1997-01-01

"Shakespeare'i kogutud teosed" ("The Complete Works of William Shakespeare") Rakvere Teatris, lavastaja Ain Prosa ja Friedebert Tuglase - Ingomar Vihmari "Hei, Luciani!" Ugalas, lavastaja Ingomar Vihmar

Physical and mental health: from youth to age in Ohio prisons.

Science.gov (United States)

Lynd, Alice

2014-01-01

Who cares about health care in prisons? You do if you have a son or a granddaughter in prison. Maybe you care anyway if you have had to wait a long time to see a doctor or if you could not have the treatment you needed because it cost too much. Maybe you have run into the attitude, "You ain't bleedin', you ain't needin'." Maybe you have found it hard to face the future with little or no hope that you could ever be in a better place. Or maybe you, like some older prisoners, have been able to develop new interests, new skills, to review your life and review it, and to redefine what matters.

Data of evolutionary structure change: 1ONAD-2D3PB [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 1ONAD-2D3PB 1ONA 2D3P D B ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAK...WNMQNGKVGTAHIIYNSVDKRLSAVVSYPNADSATVSYDVDLDNVLPEWVRVGLSASTGLYKETNTILSWSFTSKLKT------NALHFMFNQFSKDQKDLILQGDAT...ain> 1ONA D 1ONAD TR

Keratosis reduces sensitivity of anal cytology in detecting anal intraepithelial neoplasia.

Science.gov (United States)

ElNaggar, Adam C; Santoso, Joseph T; Xie, Huiwen Bill

2012-02-01

To identify factors that may contribute to poor sensitivity of anal cytology in contrast to the sensitivity of anoscopy in heterosexual women. We analyzed 324 patients with biopsy confirmed diagnosis of genital intraepithelial neoplasia (either vulva, vaginal, or cervical) from 2006 to 2011 who underwent both anal cytology and anoscopy. Cytology, anoscopy, and biopsy results were recorded. Biopsy specimens underwent independent analysis for quality of specimen. Also, biopsy specimens were analyzed for characteristics that may contribute to correlation, or lack thereof, between anal cytology and anoscopic directed biopsy. 133 (41%) patients had abnormal anoscopy and underwent directed biopsy. 120 patients with normal anal cytology had anoscopy directed biopsies, resulting in 58 cases of AIN (sensitivity 9.4%; 0.039-0.199). This cohort was noted to have extensive keratosis covering the entire dysplastic anal lesion. 18 patients yielded abnormal anal cytology. Of these patients, 13 had anoscopic directed biopsies revealing 6 with AIN and absent keratosis (specificity 88.6%; 0.78-0.95). The κ statistic for anal cytology and anoscopy was -0.0213 (95% CI=-0.128-0.086). Keratosis reduces the sensitivity of anal cytology. Furthermore, anal cytology poorly correlates with anoscopy in the detection of AIN (κ statistic=-0.0213). Copyright © 2011 Elsevier Inc. All rights reserved.

Impact of Diet Composition in Adult Offspring is Dependent on Maternal Diet during Pregnancy and Lactation in Rats

Directory of Open Access Journals (Sweden)

Megan C. Hallam

2016-01-01

Full Text Available The Thrifty Phenotype Hypothesis proposes that the fetus takes cues from the maternal environment to predict its postnatal environment. A mismatch between the predicted and actual environments precipitates an increased risk of chronic disease. Our objective was to determine if, following a high fat, high sucrose (HFS diet challenge in adulthood, re-matching offspring to their maternal gestational diet would improve metabolic health more so than if there was no previous exposure to that diet. Animals re-matched to a high prebiotic fiber diet (HF had lower body weight and adiposity than animals re-matched to a high protein (HP or control (C diet and also had increased levels of the satiety hormones GLP-1 and PYY (p < 0.05. Control animals, whether maintained throughout the study on AIN-93M, or continued on HFS rather than reverting back to AIN-93M, did not differ from each other in body weight or adiposity. Overall, the HF diet was associated with the most beneficial metabolic phenotype (body fat, glucose control, satiety hormones. The HP diet, as per our previous work, had detrimental effects on body weight and adiposity. Findings in control rats suggest that the obesogenic potential of the powdered AIN-93 diet warrants investigation.

Heat Transfer Characteristics in High Power LED Packaging

Directory of Open Access Journals (Sweden)

Chi-Hung Chung

2014-03-01

Full Text Available This study uses the T3Ster transient thermal resistance measuring device to investigate the effects to heat transfer performances from different LED crystal grains, packaging methods and heat-sink substrates through the experimental method. The experimental parameters are six different types of LED modules that are made alternatively with the crystal grain structure, the die attach method and the carrying substrate. The crystal grain structure includes the lateral type, flip chip type and vertical type. The die attach method includes silver paste and the eutectic structure. The carrying substrates are aluminum oxide (Alumina and aluminum nitride (AIN ceramic substrates and metal core PCB (MCPCB. The experimental results show that, under the conditions of the same crystal grain and die attach method, the thermal resistance values for the AIN substrate and the Alumina substrate are 2.1K/W and 5.1K/W, respectively and the total thermal resistance values are 7.3K/W and 10.8K/W. Compared to the Alumina substrate, the AIN substrate can effectively lower the total thermal resistance value by 32.4%. This is because the heat transfer coefficient of the AIN substrate is higher than that of the Alumina substrate, thus effectively increasing its thermal conductivity. In addition, under the conditions of the same crystal grain and the same substrate, the packaging methods are using silver paste and the eutectic structure for die attach. Their thermal resistance values are 5.7K/W and 2.7K/W, respectively, with a variance of 3K/W. Comparisons of the crystal grain structure show that the thermal resistance for the flip chip type is lower than that of the traditional lateral type by 0.9K/W. This is because the light emitting layer of the flip chip crystal grain is closer to the heat-sink substrate, shortening the heat dissipation route, and thus lowering the thermal resistance value. For the total thermal resistance, the crystal grain structure has a lesser

Meie igapäevane paanika / Ott Karulin

Index Scriptorium Estoniae

Karulin, Ott, 1980-

2007-01-01

Kahest Vanemuise teatri lavastusest Tartus - Saksa Kultuuri Instituudis etendunud Ingvar Ambjornseni-Axel Hellsteniuse "Elling" Ain Mäeotsa lavastuses ja Laura Cunninghami "Beautiful Bodies" Vanemuises, lavastaja Jüri Lumiste

Case C-182/15, Proceedings Relating to the Extradition of Aleksei Petruhhin / Filippo Fontanelli

Index Scriptorium Estoniae

Fontanelli, Fillippo

2017-01-01

Euroopa Kohtu lahendist, mis puudutab Venemaa ametiasutuste poolt Läti ametiasutustele saadetud Eesti kodaniku Aleksei Petruhhini väljaandmise taotlust seoses narkootilise aine turustamise süüteoga

Análisis de la situación de uno contra uno en baloncesto de formación

Directory of Open Access Journals (Sweden)

José Luis Arias Estero

2012-03-01

Full Text Available El objetivo de este estudio fue analizar el número de situaciones de 1 vs. 1 y su relación con los intentos de lanzamiento y el éxito de la posesión. Participaron 54 niños y 67 niñas (años: M = 10,40; DE = 0,32 de seis equipos masculinos y seis femeninos de minibásquet (9-11 años. La muestra consistió en 3.812 posesiones de balón de 24 partidos. Se utilizó un diseño nomotético, seguimiento, multidimensional. Se construyeron los instrumentos de observación y registro y se formó a ocho observadores que posteriormente visualizaron y registraron los partidos filmados. El valor medio del número de situaciones de 1 vs. 1 por posesión del balón fue de 0,62 (DE = 0,79. Los resultados reflejaron relaciones estadísticamente significativas entre la situación de 1 vs. 1 y ambos criterios, el intento de lanzamiento (χ2=59,456; p = ,000 y el éxito de la posesión (χ2= 5,729; p = ,017. En el juego de minibásquet se deberían favorecer las situaciones de 1 vs. 1

Õpetaja professionaalse rolli internaliseerimise hindamine õpetajakoolituse esmaõppe üliõpilaste hulgas / Äli Leijen, Katrin Kullasepp, Aivar Ots

Index Scriptorium Estoniae

Leijen, Äli, 1979-

2013-01-01

Aineõpetaja magistriõppe üliõpilaste seas läbi viidud uurimusest, milles vaadeldakse, kuidas üliõpilased koordineerivad personaalset ja professionaalset mina-positsiooni erialaste ambivalentsete olukordade kontekstis

Professional preparation of teachers - problems and possibilities. The Estonian case / Katrin Poom-Valickis, Ülle Saarits, Helle Sikka... [jt.

Index Scriptorium Estoniae

2008-01-01

Artikkel kirjeldab õpetajakoolituse olukorda Eestis aastal 2003. Aineõpetajate, klassiõpetajate ja koolieelsete lasteasutuste õpetajate ettevalmistusest Tallinna Ülikoolis ning nende karjääriperspektiive tööturul

Rector's office as of 31 December 2006

Index Scriptorium Estoniae

2007-01-01

Rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Birute Klaas, administratsioonidirektor prof. Mihkel Pärnoja, finantsdirektor Taimo saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit

Esteet Hartshenko contra mehed punases / Heili Vaus-Tamm

Index Scriptorium Estoniae

Vaus-Tamm, Heili, 1961-

2007-01-01

Tantsuetendustest Kumu Kunstimuuseumis: "Red ain't dead", koreograaf - lavastajad Kaarel Väli, Kristjan Rohioja; tantsuteatri Zick esituses "Piaf", koreograaf - lavastaja Dmitri Harchenko. Dominiiklaste kloostri klausuuris "Reisijuht", koreograaf - lavastaja Dmitri Harchenko

Stirlitzi leitmotiivist rõõmsalt süüdimatu jäneste lauluni / Jüri Aarma

Index Scriptorium Estoniae

Aarma, Jüri, 1951-

2010-01-01

Vene filmimuusika kontserdist "Seitseteist kevadist hetke", mis toimub Vanemuise kontserdimajas 2. aprillil, Jõhvi kontserdimajas 4. aprillil ja Estonia kontserdisaalis 6. aprillil, lavastaja Ain Mäeots. Näidatakse vastavaid filmilõike

Plaadid / Aivo Vahemets

Index Scriptorium Estoniae

Vahemets, Aivo

2006-01-01

Uutest heliplaatidest Waltari "Blood Sample", Anthony Hamilton "Ain't Nobody Worrying", Kismabande "Polüpale", Siiri Sisask "Kuu lõhn", Les Diamants "Fortune Fools", "The Voice Clubbin", Nits "Les Nuits"

Politicians spin attacks against methadone, syringe replacement / Milda Seputyte

Index Scriptorium Estoniae

Seputyte, Milda

2005-01-01

Leedu parlamendiliikmed osalevad kampaanias, millega võideldakse narkomaanidele tasuta süstalde jagamise ja sõltuvuse vastase aine metadooni vastu, kuna nende arvates need meetmed pigem süvendavad narkomaaniat

Kõnnivad köiel ja hoiavad kätt / Iir Hermeliin, Jaanus Vahtra ; intervju Sven Karja

Index Scriptorium Estoniae

Iir Hermeliin, pseud., 1973-

2000-01-01

Teatrikunstnikud Iir Hermeliin ja Jaanus Vahtra ning nende looming. Kunstnikud lavastajatest ja lavastajad Mati Unt ja Ain Mäeots koostööst kunstnikega lavastustes "Jacques ja tema isand"; "Laulatus"

Rektoraat seisuga 31.12.2006

Index Scriptorium Estoniae

2007-01-01

Rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Birute Klaas, administratsioonidirektor prof. Mihkel Pärnoja, finantsdirektor Taimo saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit

Ajutine juht - jube kallis, aga see-eest väga kasu(m)lik / Irja Rae

Index Scriptorium Estoniae

Rae, Irja

2005-01-01

Ajutise juhi (interim manager) ehk üleminekujuhi palkamisest ettevõttes. Vt. samas: Kus teda näha võib. Kommenteerib juhtimiskonsultatsioonide firma PW Partnersi vanemkonsultant Jana Võrk. Vt. samas: Keskpaik, Ivar. Eesti tuntuim üleminekujuht

CERN firemen share their expertise

CERN Multimedia

Maximilien Brice

2002-01-01

Firemen from local fire brigades have been coming to CERN to learn modern fire-fighting techniques. The CERN fire brigade has some unique training equipment for two particularly dangerous fire hazards, flashover and backdraft. Flashover occurs when a room that is on fire reaches a temperature of 400 to 500°. Beyond this point, a fully developed fire breaks out. This series of photos shows recruits from the fire services of Ain (Service Départemental Incendie et Secours (SDIS)) taking part in a flashover training exercise at CERN. Photo 01: Christopher Griggs, Chief Instructor of the CERN fire brigade (seated in the centre), explains the technique of using a fire-hose during a flashover to the recruits from the Ain SDIS.

Teater

Index Scriptorium Estoniae

2006-01-01

Vanemuise teatri draamanäitlejad tunnistasid möödunud aasta parimaks lavastuseks augustis Setumaal Obinitsas etendunud "Taarka", mille lavastas Ain Mäeots. Parimaks naispeaosatäitjaks valiti Merle Jääger, parimaks meespeaosatäitjaks Indrek Taalmaa, parimaks naiskõrvalosatäitjaks Karin Tammaru, parimaks meeskõrvalosatäitjaks Tanel Jonas. Eesti Draamateatri 2005. aasta Antsud ehk kolleegipreemiate laureaadid : Ingomar Vihmar (parim lavastaja), Ervin Õunapuu (parim kunstnik), Ülle Kaljuste (parim naisnäitleja), Ain Lutsepp (parim meesnäitleja), Väikesed Antsud pälvisid Elina Reinold ja Taavi Teplenkov, Abi-Antsuks kuulutati teatri kirjandusala juhataja Ene Paaver. Endla 2005. aasta kolleegipreemiad said Lii Tedre (parim naisnäitleja), Tambet Seling (parim meesnäitleja), Tiit Palu (parim lavastaja) ja Silver Vahtre (parim kunstnik)

Kummitusmaja ja fusion-köök = Haunted House and Fusion Cuisine / Kai Lobjakas

Index Scriptorium Estoniae

Lobjakas, Kai, 1975-

2003-01-01

Tallinnas Rataskaevu 16 asuva jaapani toitu pakkuva restorani "Sushihouse" kujundus, ruumide restaureermine. Sisekujundajad Ain Nurmela ja Liina Link. Projekt 2001-2003, valmis 2003. Kõige muinsusteadlikumalt restaureeritud maja 2002. a. 3 ill

Materjalide jagamisest võidavad kõik / Maarja Soone

Index Scriptorium Estoniae

Soone, Maarja

2011-01-01

Koolitusest Colchesteris - Content and Language Integrated Learning, mis tähendab võõrkeelset aineõpet, kus vajadusel võetakse kasutusele ka emakeel, mistõttu viidatakse sellele tihti kui kakskeelsele õppele

Märkmeid uusima Preisi tsensuuriinstruktsiooni kohta / Karl Marx

Index Scriptorium Estoniae

Marx, Karl

2000-01-01

Preisi uue (1841. aasta) tsensuuriinstruktsiooni tõusikliku vaimu vastuolust vana (1818. aasta) tsensuurimääruse ratsionalismiga. Moraali ja religiooni vastuolust. Vt. ka Ain Kaalepi artiklit "Veel Karl Marxist ja tsensuurist

Tallinn pokupajet zemlju dlja prokladki shosse Põhjaväil

Index Scriptorium Estoniae

2007-01-01

Seoses Russalkast Ahtri tänavani ulatuva tee-ehitusega seisab linnal ees 16 maaküsimuse lahendamine. Probleemidest seoses väila osaliselt merre ehitamisega. Kommenteerivad Alo Brandt ja Ain Valdmann

Disease: H00536 [KEGG MEDICUS

Lifescience Database Archive (English)

Full Text Available oencephalopathy (CADASIL) CADASIL is a chronic cerebrovascular disorder characterized by recurrent ischemic attacks and frequent migr...aines associated with diffuse white-matter abnormalities. CADASIL is caused by muta

AHHAA keskus Tartus = The Ahhaa Science Centre in Tartu / Triin Ojari

Index Scriptorium Estoniae

Ojari, Triin, 1974-

2011-01-01

2011. a. valminud AHHAA teaduskeskuse arhitektid on Ain Padrik ja Vilen Künnapu (AB Künnapu & Padrik), sisearhitektid Tea Tammelaan, Krista Lepland ja Malle Jürgenson (Laika, Belka & Strelka). Projekt: 2008

Vene elu hõng Pilistvere rehealuses / Margot Visnap

Index Scriptorium Estoniae

Visnap, Margot, 1959-

2008-01-01

Pilistvere rehehoones etendunud Ain Saviaugu kirjutatud ja lavastatud suvetükist "Rasputin". Suvelavastuse tõi välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas Indrek Saar

Vek lovi - vek utshis / Hillar Jõõts ; interv. Kalju Hook

Index Scriptorium Estoniae

Jõõts, Hillar

2005-01-01

Keskkonnainspektsiooni Pärnumaa osakonna juhtivspetsialist Hillar Jõõts keskkonnaministeeriumi kalavarude osakonna juhataja Ain Soome, Eesti Kalurite Liidu juhatuse esimehe Andres Variku ja Eesti Mereinstituudi direktori Toomas Saati kohtumisest Pärnumaa kaluritega

Yeast Interacting Proteins Database: YOR171C, YOR034C [Yeast Interacting Proteins Database

Lifescience Database Archive (English)

Full Text Available ain base phosphates, which function as signaling molecules, regulates synthesis of ceramide from exogenous l...chain base phosphates, which function as signaling molecules, regulates synthesis of ceramide from exogenous

Bez kota mõsham razdolje / Jevgeni Kapov

Index Scriptorium Estoniae

Kapov, Jevgeni

2004-01-01

Sillamäe linnapea Ain Kiviorgi ja Vaivara vallavanema Veiko Luhalaidi kohtumisest Politseiameti peadirektori Robert Antropovi ja Ida politseiprefekti Kalev Prillopiga, kus arutati seoses politseireformiga Sillamäe regioonis tekkinud korrakaitse probleeme

President Meri annetas aumärke

Index Scriptorium Estoniae

1996-01-01

Riigivapi I klassi orden Jaan Krossile ja Kalju Lepikule; Riigivapi III klassi orden Ain Kaalepile, Hilja Rüütlile (Aili Helm); Riigivapi IV klassi orden Voldemar Millerile, Juhan Peeglile ja Ants Viiresele

Partii Reform ne bezrazlitshna sudba russkogo obrazovanija / Sergei Ivanov

Index Scriptorium Estoniae

Ivanov, Sergei, 1958-

2005-01-01

Riigikogu liige vastab küsimustele, mis puudutavad Tallinna Pedagoogikaülikoolis algavat vene koolide jaoks aineõpetajate ettevalmistamist ja selleks ettenähtud rahasummat, vene akadeemilise keskuse loomiseks eraldatud raha kulutamist

Dgroup: DG01675 [KEGG MEDICUS

Lifescience Database Archive (English)

Full Text Available aine ... D01152 ... Oxethazaine (JP17/USAN); Oxetacaine (INN) ... D08311 ... Oxetacaine hydrochloride ... DG00801 ... Bupivacaine ... D07552 ... Bupiva...caine (USAN/INN) ... D01450 ... Bupivacaine hydrochloride (USP); Bupivacaine hydrochl

Biznes i obshtshestvo : Sillamäe võhodit iz desjatiletnei spjatshki / Artur Tooman

Index Scriptorium Estoniae

Tooman, Artur, 1971-

2006-01-01

Sillamäe linna eluolu, sadama mõju linna arengule. Arvamust avaldavad linnavolikogu liige Sergei Rjabkov, linnapea Ain Kiviorg ja kohalikud ettevõtjad. Lisa: diagrammid linna eelarve ja ettevõtluse kasvu kohta

Pop / Erkki Luuk

Index Scriptorium Estoniae

Luuk, Erkki, 1971-

2004-01-01

Heliplaatidest: Current 909 "The price for existence is eternal warfare", Aapo Ilves "Pilpaküla kontsert", Yello "The Eye", Maian Kärmas, Ain Agan, Riho Sibul, Arvo Haasma "Tuigutuled", Manatark "Chaos Engine"

Üliohtliku laadungiga rongid plaanitakse Tallinnast välja saata / Signe Kalberg

Index Scriptorium Estoniae

Kalberg, Signe, 1959-

2006-01-01

Valitsusele esitatakse kolm Tallinna raudteeümbersõidu varianti, analüüsi koostamisse kaasati AS Deloitte&Touche Eesti. Kaart: Tallinna raudteeümbersõit. Kommenteerivad: Raivo Uukkivi, Ain Kaljurand, Toomas Vitsut

Moroz i rozõ / Lev Livshits

Index Scriptorium Estoniae

Лившиц, Лев, 1924-2013

2006-01-01

Ain Järvega Kadrioru pargist. Kadrioru Lastepargi tekkimise ajaloost ja uue Lastepargi rajamisest. Ehitatakse uus Lastemuuseumi hoone kuhu kolib Kotzebue tänavalt Tallinna Nukumuuseum. Nukumuuseumist ja muuseumidest Kadriorus, ka KUMU hoonest

Koolialmanahh Poiste Hääl / Uno Liivaku

Index Scriptorium Estoniae

Liivaku, Uno, 1926-

2005-01-01

Marie Underi Poiste Häälele kirjutatud luuletusest "Soov" (1936, nr. 90/91), ka luuletuse tekst, lk. 144-145. V. Roopalu lühireportaaž "Tammsaare jutul", lk. 145-146. Lisad: Poiste Hääle toimetused : [koosseisud], lk. 150-151 ; Omalooming : [bibliograafia], lk. 151-152 ; Proosa : [bibliograafia], lk. 152-153. Autorist lk. 298

Italy, the UNO, and the International Crisis

Directory of Open Access Journals (Sweden)

Luciano Tosi

2011-01-01

Full Text Available En la Italia de post-guerra el rechazo al nacionalismo y a la aspiración a una política de cooperación internacional tanto a nivel europeo como mundial eran ampliamente compartidas. En la Conferencia de Potsdam Truman propuso la admisión de Italia en el seno de la ONU, pero se encontró con la oposición de la URSS. En el contexto de la Guerra Fría, Italia solo pudo entrar en 1955, junto con otros 15 países. En la ONU, la participación de Italia, por ejemplo en asuntos relativos a la descolonización, se veía condicionada por sus lazos con los EEUU, por su pertenencia al bloque Occidental y por sus intereses económicos. Italia reconoció a la China comunista solo en 1970 y en 1971 votó a favor de su admisión en la ONU. En 1969 el primer ministro Moro describió en la Asamblea General de la ONU su “estrategia para una paz global”, un manifiesto de distensión basado en la ONU y en la igualdad de los estados y no en un “concierto de potencias”. Tales ideas contrastaban con la distensión llevada a cabo por Nixon y Kissinger, basada más bien en una política tradicional de poder y en las relaciones bilaterales entre las superpotencias. En los años 70 el estatus internacional de Italia se veía seriamente limitado por su crisis interna. En el último periodo de la Guerra Fría, las Fuerzas Armadas italianas empezaron a participar en misiones en el extranjero con o sin mandato de la ONU Tales misiones tenían como objetivo dar apoyo a la seguridad internacional y reforzar el estatus internacional de Italia dentro y fuera de la ONU. Italia se opuso con éxito a los planes para incrementar el número de miembros permanentes del Consejo de Seguridad proponiendo a cambio una nueva categoría de miembros semi-permanentes. En 1999 y el 2000 Italia fue el quinto mayor contribuyente al presupuesto de la ONU y el tercero en contribuir con tropas en misiones de la ONU. En el 2006 fue nombrado por sexta vez miembro del Consejo de Seguridad

Infrastructure, logistics and regulation of transplantation: UNOS.

Science.gov (United States)

Heimbach, Julie K

2013-12-01

Organ transplantation has evolved into the standard of care for patients with end-stage organ failure. Despite considering increasingly complex transplant recipients for organs recovered from donors with increasing comorbid conditions, 1-year patient survival following kidney transplantation is 97% in the United States, whereas liver transplant recipient 1-year survival is 90%. There were 16,485 kidney recipients in the United States in 2012, and 6256 patients who underwent liver transplantation. The intent of this review is to highlight the logistics required for transplantation as well as reviewing the current oversight of transplantation. Copyright © 2013 Elsevier Inc. All rights reserved.

Spanish is Numero Uno for "Project Bright."

Science.gov (United States)

Larew, Leonor A.

1978-01-01

In New York State, the 24 brightest fifth and sixth graders from Avon, Caledonia, and York participated in a project funded by Title IV minigrants, distributed through BOCES. The children were bussed to a central point and permitted to study whatever they wished; Spanish was the first subject selected. (EJS)

Acustica con una Bic e uno smartphone

OpenAIRE

Galante, Lorenzo; Lombardi, Anna Maria

2014-01-01

A smartphone, with its integrated sensors and cpu, can aid experiments in many different areas of Physics. We show how the resonant frequencies of a pipe can be measured using a smartphone and a Bic pen.

Ahnus ajab Euroopa Liidu upakile / Uno Silberg

Index Scriptorium Estoniae

Silberg, Uno, 1964-

2002-01-01

Autori sõnul on EL-i ittalaienemise eesmärk seniste liikmesriikide heaolu suurendamine liituda soovivate maade arvel. Vanade ja uute liikmesriikide võrdset kohtlemist ei ole EL-il kavaski olnud. Euroskeptitsism

Toodangu maht sõltub impordist / Ain Alvela

Index Scriptorium Estoniae

Alvela, Ain, 1967-

2002-01-01

Saematerjali tootjate TOP 30. Käibe TOP 10. Käibe kasvu TOP 10. Kasumi TOP 10. Kasumi kasvu TOP 10. Rentaabluse TOP 10. Varade tootlikkuse TOP 10. Kahjumi TOP 5. Saematerjali tootjate finantsnäitajad. Saematerjali tootjate üldandmed. Tabelid

Terve mõistusega ahnuse vastu / Ain Aaviksoo

Index Scriptorium Estoniae

Aaviksoo, Ain, 1974-

2005-01-01

Dokumentaalfilm "Ülisuur mina" ("Super Size Me") : režissöör Morgan Spurlock : Ameerika Ühendriigid 2004. Turumajandusest, dieedist ja toitumisest, filmi hoiatavast osast eelkõige teistmelistele ja nende kasvatajatele

Rumsfeldi ei ole kunagi unustatud / Ain Lember

Index Scriptorium Estoniae

Lember, Ain

2004-01-01

Väljaandes Teheran Times ilmunud Kian Mokhtari artiklist, milles käsitletakse USA kaitseministri Donald Rumsfeldi poliitikukarjääri, tema süüdistamist Iraagile massihävitusrelvade ja nendega seotud tehnoloogia müümise soodustamises 1980-ndatel aastatel, Iraagi-poolset keemiarelva kasutamist Iraani vastu

Puti povõshenija effektivnosti proizvodstva / Ain Alvela

Index Scriptorium Estoniae

Alvela, Ain, 1967-

2008-01-01

Kulude kokkuhoid aitab saavutada kõrgemat tootlikkust. Vt. samas: Indeks rosta proizvoditelnosti za period 2000-2007gg., %. Kommenteerivad: Aleksandr Miina, Ants Pak, Kaul Aulasmägi, Veljo Haube ja Kuido Kuntro

Norma Maja astub kindlalt tulevikku / Ain Alvela

Index Scriptorium Estoniae

Alvela, Ain, 1967-

2000-01-01

AS Norma Maja saavutas kõrged kasumi ja kasumi kasvu näitajad töötajate koondamisega. Tabel: Norma Maja valdused, AS Norma Maja areng, AS ETK Majad areng. Arvamused: Ero Toom, Ivar Lahi ja Rein Loo

Extensive Degradation and Low Bioavailability of Orally Consumed Corn miRNAs in Mice

Directory of Open Access Journals (Sweden)

Haiqiu Huang

2018-02-01

Full Text Available The current study seeks to resolve the discrepancy in the literature regarding the cross-kingdom transfer of plant microRNAs (miRNAs into mammals using an improved miRNA processing and detection method. Two studies utilizing C57BL/6 mice were performed. In the first study, mice were fed an AIN-93M diet and gavaged with water, random deoxynucleotide triphosphates (dNTP or isolated corn miRNAs for two weeks (n = 10 per group. In the second study, mice were fed an AIN-93M diet, or the diet supplemented with 3% fresh or autoclaved corn powder for two weeks (n = 10 per group. Corn miRNA levels were analyzed in blood and tissue samples by real-time PCR (RT-PCR following periodate oxidation and β elimination treatments to eliminate artifacts. After removing false positive detections, there were no differences in corn miRNA levels between control and treated groups in cecal, fecal, liver and blood samples. Using an in vitro digestion system, corn miRNAs in AIN-93M diet or in the extracts were found to be extensively degraded. Less than 1% was recovered in the gastrointestinal tract after oral and gastric phases. In conclusion, no evidence of increased levels of corn miRNAs in whole blood or tissues after supplementation of corn miRNAs in the diet was observed in a mouse model.

Interpersonal violence in the United Arab Emirates.

Science.gov (United States)

Osman, Ossama T; Abbas, Alaa K; Eid, Hani O; Salem, Mohamed O; Abu-Zidan, Fikri M

2014-01-01

We aimed to study the anatomical distribution, severity and outcome of hospitalised interpersonal violence-related injured patients in Al-Ain, United Arab Emirates so as to give recommendations regarding the magnitude of this problem, its causes and priorities of prevention. Data were retrieved from Al-Ain Hospital Trauma Registry, which was prospectively collected over three years. There were 75 patients (males = 85.3%) having a mean age of 30 years. Eighty-one percent had blunt trauma. The estimated annual injury hospitalisation of interpersonal violence in Al-Ain city was 6.7 per 100,000 population. Females were significantly more injured by a family member (p = 0.02), at home (p = 0.005), and had more severe injuries (p = 0.003). There was a trend for children less than 18 years old to have more penetrating trauma (p = 0.06) and to be injured by a family member (p = 0.09). There was only one case of woman sexual assault and two cases of child abuse. The mean (SD) hospital stay was 7.87 (14.1) days. Less than 3% (n = 2) were admitted to the intensive care unit with no deaths. In conclusion, the majority of patients in our study had minor injuries. Nevertheless, the psychological impact may be major. This highlights the need to develop suitable mental health services in support of victims of interpersonal violence.

Structural and frequency dependencies of a.c. and dielectric ...

Indian Academy of Sciences (India)

6Thin Film Laboratory, Department of Physics, Faculty of Education, Ain Shams ... conductivity and its frequency exponents were interpreted in terms of correlated barrier hopping ... cations in high-electron-mobility and heterostructure bipolar.

Drug Allergy

African Journals Online (AJOL)

EL-HAKIM

Immunology Unit, Department of Pediatrics, Ain Shams University, Cairo ... the case with food allergies).7,8 The parentral route ..... molecular-weight agents. ... and lack positive controls. ..... Immunology; Joint Council of Allergy, Asthma and.

Ainevaldkond "Kehakultuur" / Leila Oja

Index Scriptorium Estoniae

Oja, Leila, 1966-

2006-01-01

Ainevaldkonnast "Kehakultuur" Tartu Ülikooli õppekava arenduskeskuses väljatöötatud põhikooli ja gümnaasiumi riiklikus õppekavas - ainevaldkonna kirjeldus, läbivad teemad, aineõpetuse struktuur ning vajalikud ressursid

R102G polymorphism of the complement component 3 gene in ...

African Journals Online (AJOL)

Nur Afiqah Mohamad

a Malaysian Research Institute on Ageing, Universiti Putra Malaysia, Serdang 43400, Selangor ... Peer review under responsibility of Ain Shams University. ..... b Student t-test, P < 0.01. ... The International ARM Epidemiological Study Group.

Analytical solutions for one-dimensional advection– dispersion ...

Indian Academy of Sciences (India)

Department of Mathematics, AinShams University, Cairo 0020, Egypt. ∗. Corresponding author. .... Applying Laplace transformation to equations (1 and 2) gives: D d2. ∼ ...... Land, Water & Environmental Management: Integrated. Systems for ...

ETV uus seriaal "Vistrik" kavatseb nime muuta / Anne Vetik

Index Scriptorium Estoniae

Vetik, Anne

2006-01-01

Toimuvad ETV uue krimisarja "Vistrik" võtted, stsenarist Mihkel Ulman, režissöör Ain Prosa, produtsent Raivo Suviste, kesksetes rollides Marko Matvere, Jaan Rekkor, Elisabet Tamm, tootjaks OÜ Balti Video

[Kirjandusetendusest "Meri kümnele häälele"] / Kätlin Kaldmaa ; küsinud D. K. [Doris Kareva

Index Scriptorium Estoniae

Kaldmaa, Kätlin, 1970-

2011-01-01

Luulelavastus sisaldab Álvaro de Campose (Fernando Pessoa) "Mereoodi" ning Ain Kaalepi, Kalju Kruusa, fs-i jt. eesti luuletajate tekste. Lavastaja Anne Türnpu, etendused toimuvad kinos Sõprus. Vt. ka kuulutust lk. 30

Ohtlikud lennud / Simo Meinert

Index Scriptorium Estoniae

Meinert, Simo

2006-01-01

ETV uus algupärane krimisari "Ohtlik lend" : stsenarist Mihkel Ulman : lavastaja Ain Prosa : produtsent Raivo Suviste : peaosades Elisabet Tamm, Marko Matvere : Balti Video. Sama ka : Teleleht nr. 38, lk. 6-7 : ill

Anal high-risk human papillomavirus infection and high-grade anal intraepithelial neoplasia detected in women and heterosexual men infected with human immunodeficiency virus

Directory of Open Access Journals (Sweden)

Gandra S

2015-01-01

Full Text Available Sumanth Gandra, Aline Azar, Mireya WessolosskyDivision of Infectious Disease and Immunology, University of Massachusetts Medical School, Worcester, MA, USABackground: Although anal high-risk human papillomavirus (HR-HPV infection and anal cytological abnormalities are highly prevalent among human immunodeficiency virus (HIV-infected men who have sex with men (MSM, there are insufficient data on these abnormalities among HIV-infected heterosexual men (HSM and women. In this study, we evaluated the prevalence of anal HR-HPV, cytological abnormalities, and performance of these screening tests in detecting high-grade anal intraepithelial neoplasia (AIN2+ among our cohort of HIV-infected MSM and non-MSM (HSM and women.Methods: A single-center, retrospective cohort study was conducted with HIV-infected individuals who underwent anal cancer screening with anal cytology and HR-HPV testing from January 2011 to January 31, 2013.Results: Screening of 221 HIV-infected individuals for both HR-HPV and anal cytology showed the presence of HR-HPV in 54% (abnormal anal cytology 48% of MSM, 28% (abnormal anal cytology 28% of HSM, and 27% (abnormal anal cytology 34% of women. Among 117 (53% individuals with abnormal results (HR-HPV-positive and/or cytology was atypical squamous cells of undetermined significance or above, 67 underwent high resolution anoscopy. Of these 67 individuals, 22 individuals had AIN2+ (17 MSM, four women, and one HSM. HR-HPV correlated better with AIN2+ than with anal cytology on biopsy in both MSM (r=0.29 versus r=0.10; P=0.05 versus P=0.49 and non-MSM (r=0.36 versus r=-0.34; P=0.08 versus P=0.09.Conclusion: Given the presence of AIN2+ in screened HIV-infected HSM and women, routine anal cancer screening in all HIV-infected individuals should be considered. HR-HPV merits further evaluation for anal cancer screening among non-MSM.Keywords: human immunodeficiency virus, anal human papillomavirus, heterosexual men, women, anal cancer

Evaluación in vitro de tabletas orales de complejos de cobre con antiinflamatorios no esteroideos

Directory of Open Access Journals (Sweden)

Julie Fernanda Benavides Arévalo

Full Text Available Introducción: los antiinflamatorios no esteroideos (AINES, son un grupo diverso y químicamente heterogéneo de fármacos analgésicos, antipiréticos y antiinflamatorios; sin embargo, su funcionamiento se ve afectado por su baja solubilidad acuosa y por la incidencia de efectos secundarios gastrointestinales. Como una alternativa a este problema, la formulación de tabletas orales con complejos de cobre con AINES muestra un adecuado comportamiento in vitro y podría tener efectos secundarios reducidos comparados con el fármaco antiinflamatorio no complejado. Objetivo: evaluar los procesos de desintegración y de disolución de tabletas orales de complejos de cobre con AINES. Métodos: luego de la síntesis y la caracterización instrumental de los complejos, se evaluó por microscopia óptica el efecto de la morfología, el tamaño de partícula y las características superficiales en el proceso de disolución; estos resultados fueron considerados para la formulación de los complejos y permitieron junto con la adecuada elección de un desintegrarte, un modificador de flujo, un lubricante y un aglutinante, la obtención de tabletas por compresión directa. Finalmente, en los comprimidos se evaluaron propiedades fisicomecánicas y los procesos de desintegración y disolución. Resultados: las tabletas de los complejos mostraron tiempos de desintegración entre 5 y 15 min y una liberación in vitro del 75 al 93 %. Conclusiones: la disolución de los AINES se vio favorecida por la formación de complejos, el menor tamaño de partícula, la presencia de poros y grietas en la superficie de las partículas y la inclusión de excipientes para la formulación de tabletas orales.

Kolhoosikeskus - oma ja võõras = Collective farm centre - familiar and alien / Liina Jänes ; tõlk. Liisi Ojamaa

Index Scriptorium Estoniae

Jänes, Liina, 1977-

2000-01-01

Eesti kolhoosikeskuste arhitektuurist. Vaadeldakse aastail 1957-1990 ehitatud 24 keskusehoonet. Arhitektid Nikolai Kusmin, Harri Kingo, Toomas Rein, Vilen Künnapu, Ain Padrik, Maara Metsal, Meeli Truu jt. 17 välisvaadet, 3 joon., kaart

Mis saab maaärist? / Ester Šank

Index Scriptorium Estoniae

Šank, Ester, 1956-

2000-01-01

Maaostu piirava seaduseelnõu Riigikogu menetlusest välja arvamist kommenteerib Vootele Hansen. Lisatud ka eelnõu autorite Jaanus Marrandi, Harri Õunapuu ja töörühma liikme Ain Kendra seisukohad

Intel Corporation osaleb Eesti koolitusprogrammis / Raivo Juurak

Index Scriptorium Estoniae

Juurak, Raivo, 1949-

2001-01-01

Haridusministeeriumis tutvustati infotehnoloogiaalast koolitusprogrammi, milles osaleb maailma suuremaid arvutifirmasid Intel Corporation. Koolituskursuse käigus õpetatakse aineõpetajaid oma ainetundides interneti võimalusi kasutama. 50-tunnised kursused viiakse läbi kõigis maakondades

Plaat

Index Scriptorium Estoniae

2008-01-01

Laseringi kauplustes müügilolevatest heliplaatidest: Compromise Blue "Loomad on lahti", Mari Boine "Remixed vol. 2 - It Ain't Necessarily Evil", Me, Myself and I "Aastaajad", Whitesnake "Good To Be Bad", Estelle "Shine"

Download this PDF file

African Journals Online (AJOL)

Pediatrics Department, Faculty of Medicine, Ain Shams University corresponding author: ..... imaging studies: The diagnosis of CMV pneumonia can be suggested by chest radiograph find- ... dictive value and can aid in identifying children who ...

Lugedes Pilve ja Pazi / Mathura

Index Scriptorium Estoniae

Mathura, pseud., 1973-

2007-01-01

Võrdlevalt Aare Pilve luulekogust "Näoline" (kirj. Tuum, 2007) ja Octavio Pazi luulekogust "Alati on olevik" (hispaania k. tlk. Ain Kaalep, Jaan Kaplinski, Asta Põldmäe ja Jüri Talvet, kirj. Perioodika, 1984)

The effects of composition and firing cycle on sintering of aluminium nitride

International Nuclear Information System (INIS)

Hewett, C.; Trigg, M.B.

1992-01-01

A central composite design was used to evaluate the relative effects of temperature, time and Y 2 O 3 content on the densification behaviour of a commercial aluminium nitride (AIN). Over the range of the independent variables studied, temperature was found to exert the dominate influence. Low levels of Y 2 O 3 were found to be effective for the densification of AIN. After firing, cubic 3Y 2 O 3.5 Al 2O3 (YAG) was detected for the lower levels of Y 2 O 3 addition. At the higher levels both YAG and 2Y 2 O 3 .Al 2 O 3 were detected. For a dense sample the values obtained for hardness and fracture toughness were comparable to those reported in the literature. 11 refs., 1 tab

Análisis coste-efectividad del empleo de celecoxib en el tratamiento de la artrosis Cost-effectiveness analysis of the use of celecoxib for the treatment of osteoarthritis

Directory of Open Access Journals (Sweden)

A. Moreno

2003-02-01

Full Text Available Antecedentes: Los antiinflamatorios no esteroideos (AINE, utilizados en el tratamiento de la artrosis, pueden producir reacciones adversas gastrointestinales (GI graves. Celecoxib, un inhibidor específico de la ciclooxigenasa 2 (COX-2, ha demostrado una eficacia equivalente a los AINE convencionales con un mejor perfil de tolerabilidad y seguridad. Objetivo: La finalidad de este estudio ha sido realizar un análisis coste-efectividad sobre el uso de celecoxib frente a los AINE clásicos en el tratamiento de la artrosis. Material y métodos: El análisis coste-efectividad se ha diseñado mediante un modelo farmacoeconómico, definiéndose como unidad de efectividad a cada año de vida ganado tras la toma de celecoxib o AINE. La probabilidad de que aparezcan los diferentes resultados clínicos se ha obtenido de artículos publicados y de asunciones incorporadas. Sólo se han valorado los costes directos médicos (medicación, hospitalización, pruebas complementarias, analíticas, visitas extras, etc., sin haberse incluido otros costes. La perspectiva del estudio ha sido la del Sistema Nacional de Salud y el horizonte temporal elegido ha sido de 6 meses. Resultados: El coste adicional por cada año de vida ganado secundario al uso de celecoxib frente a los AINE clásicos asciende a 8.017 € (1.333.834 ptas.. El análisis de sensibilidad muestra cómo estos valores son sensibles a la modificación del coste de AINE y gastroprotector, así como a la inclusión de grupos poblacionales con edades más bajas. Conclusiones: Celecoxib puede ser considerado como una opción coste-efectiva en el tratamiento de la artrosis, ya que va a evitar muertes y a ganar años de vida para los pacientes con un coste adicional razonable y moderado, cuando se compara con los AINE. Su eficiencia aumenta a medida que se utiliza en poblaciones con menor edad media y, probablemente, en aquellas con mayor riesgo de desarrollar complicaciones GI.Background: Non

Technical Progress Report for "Optical and Electrical Properties of III-Nitrides and Related Materials"

Energy Technology Data Exchange (ETDEWEB)

Jiang, Hongxing

2008-10-31

Investigations have been conducted focused on the fundamental material properties of AIN and high AI-content AIGaN alloys and further developed MOCVD growth technologies for obtaining these materials with improved crystalline quality and conductivities.

Sekulariseeruv sakraalarhitektuur / Piret Lindpere

Index Scriptorium Estoniae

Lindpere, Piret, 1963-

2002-01-01

Moodsatest kirikutest, sajandilõpu eesti sakraalarhitektuurist. Pikemalt Tallinna metodisti kirikust (Vilen Künnapu, Ain Padrik), Püha Brigitta keskusest (projekteerimist juhtis Ra Luhse) ja ehitama hakatavast Viimsi Püha Jaakobi kirikust (Erkki Ristoja, Martin Aunin)

Popmuusika / Valner Valme

Index Scriptorium Estoniae

Valme, Valner, 1970-

2006-01-01

Uutest heliplaatidest Graham Coxon "Love Travels At Illegal Speeds", Gabriel Rios "Ghostboy", "Sounds Of India", John Hughes "Wild Ocean", Ain Agan & Tallinn Chamber Orchestra/Toomas Vavilov, Ashanti "Collectables By Ashanti", Liv Kristine "Enter My Religion"

Itaalia seadustab ainuõige pitsa / Kaivo Kopli

Index Scriptorium Estoniae

Kopli, Kaivo

2004-01-01

Pizza Napolitana ained, valmistusviis ja tulemus peavad vastama nõuetele. Itaalia põllumajandusministeeriumis välja töötatud pitsareeglid on osa Itaalia pingutustest kaitsta oma kuulsat kööki. Lisaks: Pitsavalmistamise reeglid

Rector's office as of 31 December 2005

Index Scriptorium Estoniae

2006-01-01

TÜ rektoraadi koosseis: rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Tõnu Lehtsaar, prorektor prof. Jaak Kangilaski; administratsioonidirektor Mihkel Pärnoja, finantsdirektor Taimo Saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit

Sumerki klassitsizma / Iosef Kats

Index Scriptorium Estoniae

Kats, Iosef

2004-01-01

Tallinna Viru Keskuse juurde püstitatud Mare Mikofi kavandatud hiigelskulptuurist. Kuju on Mikofi versioon Weizenbergi "Hämarikust". Viru Keskuse arhitektide Vilen Künnapu ja Ain Padriku arvates peaks naiseskulptuur mahendama kaubakeskuse kubistlikku ja maskuliinset arhitektuuri

Plaadid / Aivo Vahemets

Index Scriptorium Estoniae

Vahemets, Aivo

2005-01-01

Uutest heliplaatidest The All-American Rejects "Move Along", Devendra Banhart "Criple Crow", Rod Stewart "Thank For The Memory", Him "Dark Light", Status Quo "the Party Ain't Over Yet", Ricky Martin "Life", Barbara Streisand "Guilty Pleasures"

Emajõe äärde kerkib Tartu tulevane sümbol : Kroodo-Tower / Nils Niitra

Index Scriptorium Estoniae

Niitra, Nils, 1975-

2005-01-01

ASi Linnaehitus nõukogu liige Alar Kroodo plaanib Emajõe äärde 23-korruselise kõrghoone ehitamist, mille ehitusmaksumuseks kujuneb 100 kuni 200 miljonit krooni. Kõrghoone on projekteerinud arhitektid Ain Padrik ja Vilen Künnapu

"Arvuti koolis" ja arvutiõpetus õppekavas / Helen Vanganen, Jevgeni Košelev

Index Scriptorium Estoniae

Vanganen, Helen

2002-01-01

Ligi 1500 aineõpetajat osales 2001/2002 õppeaastal kursusel "Arvuti koolis". Õpetajad tutvusid Oxfordi Ülikooli jätkukursusega - originaalprogramm kannab nime "Intelʼ Teach to the Future", mis on otseselt seotud infotehnoloogia rakendamisega õppekavas

Kes kaitseks Eesti ohvitsere NKVD-KGB laimu eest? / Peep Varju

Index Scriptorium Estoniae

Varju, Peep

2008-01-01

Autor polemiseerib Eesti Ekspressis ilmunud artiklitega Eesti endiste ohvitseride kohta, kus käsitletakse nende väidetavat koostööd KGBga. Vaatluse all on ohvitserid Ain Mere, Harald Nugiseks, Alfons Rebane ja Harald Riipalu

Nigel saak ähvardab kalureid pankrotiga / Jüri E Kukk

Index Scriptorium Estoniae

Kukk, Jüri E., 1961-

2004-01-01

Tänavune kalasaak Võrtsjärvest on jäänud väga kesiseks. Võrtsjärve Limnologiajaama juhataja Ain Järvalt peab kalade vähesuse põhjuseks heitlikke ilmastikuolusid. Lisa: Kalasaagid [1999-2003

Rektoraat seisuga 31.12. 2005

Index Scriptorium Estoniae

2006-01-01

TÜ rektoraadi koosseis: rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Tõnu Lehtsaar, prorektor prof. Jaak Kangilaski; administratsioonidirektor Mihkel Pärnoja, finantsdirektor Taimo Saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit

Construcción de tablas de vida dinámicas para uno o dos sexos = Construction of unisex or sex-distinct dynamic life tables

Directory of Open Access Journals (Sweden)

Ewa Dylewska

2012-03-01

Full Text Available Mientras que las tablas de vida tradicionales describen la mortalidad actual en un determinado periodo de tiempo, las tablas de vida dinámicas permiten una proyección de mortalidad futura. Además de la edad y el sexo, las tablas de vida dinámicas tienen también una tercera dimensión, que es el tiempo. Por lo tanto, permiten observar cambios en la mortalidad que resultan no solamente de cambios en la edad sino también de cambios que aparecen a lo largo del tiempo. Esto se refiere sobre todo a la tendencia de disminución de riesgo de mortalidad. Las tablas de vida dinámicas son, por lo tanto, muy útiles en la construcción de seguros de vida de larga duración y planes de pensiones. También pueden ser aplicadas en la construcción de tablas unisex (relacionado con el dictamen C-236/09 – Test -Achats. El objetivo del estudio es comprobar la diferencia en la esperanza de vida a la edad x en España calculada utilizando las tablas de vida estáticas (tradicionales y dinámicas, para uno o ambos sexos. Este fin se realiza aplicando el modelo de Lee-Carter para pronosticar la mortalidad futura.Traditional life tables describe a level of mortality at one and defined period of time whereas dynamic life tables allow for projection of future mortality. Apart from age and gender, dynamic life tables also have a third dimension, which is time. In that way, it is possible to observe changes of mortality over the years. This is especially reflected in a mortality reduction trend. Dynamic life tables are therefore very useful in pricing long-term life contracts and especially in pricing annuities. Moreover, dynamic life tables can also be used in constructing unisex life tables (in relation with decision C-236/09 – Test-Achats. The purpose of this paper is to demonstrate differences in life expectancy at age x in Spain calculated by using static (traditional and dynamic life tables, both unisex and sex-distinct. Mortality projection is done

Construcción de tablas de vida dinámicas para uno o dos sexos = Construction of unisex or sex-distinct dynamic life tables

Directory of Open Access Journals (Sweden)

Ewa Dylewska

2012-12-01

Full Text Available Mientras que las tablas de vida tradicionales describen la mortalidad actual en un determinado periodo de tiempo, las tablas de vida dinámicas permiten una proyección de mortalidad futura. Además de la edad y el sexo, las tablas de vida dinámicas tienen también una tercera dimensión, que es el tiempo. Por lo tanto, permiten observar cambios en la mortalidad que resultan no solamente de cambios en la edad sino también de cambios que aparecen a lo largo del tiempo. Esto se refiere sobre todo a la tendencia de disminución de riesgo de mortalidad. Las tablas de vida dinámicas son, por lo tanto, muy útiles en la construcción de seguros de vida de larga duración y planes de pensiones. También pueden ser aplicadas en la construcción de tablas unisex (relacionado con el dictamen C-236/09 – Test -Achats. El objetivo del estudio es comprobar la diferencia en la esperanza de vida a la edad x en España calculada utilizando las tablas de vida estáticas (tradicionales y dinámicas, para uno o ambos sexos. Este fin se realiza aplicando el modelo de Lee-Carter para pronosticar la mortalidad futura. Traditional life tables describe a level of mortality at one and defined period of time whereas dynamic life tables allow for projection of future mortality. Apart from age and gender, dynamic life tables also have a third dimension, which is time. In that way, it is possible to observe changes of mortality over the years. This is especially reflected in a mortality reduction trend. Dynamic life tables are therefore very useful in pricing long-term life contracts and especially in pricing annuities. Moreover, dynamic life tables can also be used in constructing unisex life tables (in relation with decision C-236/09 – Test-Achats. The purpose of this paper is to demonstrate differences in life expectancy at age x in Spain calculated by using static (traditional and dynamic life tables, both unisex and sex-distinct. Mortality projection is done

Changes in the internal resistance of a single chamber microbial fuel cell associated with architectural changes and inoculation; Cambios en la resistencia interna de una celda de combustible microbiana de una camara asociados a cambios de arquitectura y tipo de inoculo

Energy Technology Data Exchange (ETDEWEB)

Vazquez Larios, A.L.; Vazquez-Huerta, G.; Esparza-Garcia, F.; Solorza-Feria, O.; Poggi Varaldo, H.M. [Centro de Investigacion y de Estudios Avanzados del IPN, Mexico D.F. (Mexico)]. E-mail: hectorpoggi2001@gmail.com; linevazquez@yahoo.com.mx

2009-09-15

The objective of this work was to electrochemically characterize a new type of microbial fuel cell (MFC-A) and evaluate the effect of three inoculated types on internal resistance (Ir). The results were compared with those from a standard fuel cell (MFC-B). The MFC-A consisted of a horizontal acrylate cylinder equipped with two sandwiched electrode systems (each with a anode proton exchange membrane-cathode) at each end of the chamber. The MFC-B consisted of an anode and cathode each placed at opposing faces of the chamber, separated by 78 mm. The Ir of the cells were determined using a polarization curve. The inoculates were from continuous complete-mix reactors, biomass in suspension, at the laboratory scale. The inoculate with the lowest Ir value (1 200 and 3900 {Omega}) was sulfate reduction (SR-In). The second corresponded to methanogen inoculated cells (M-In) with Ir of 5300 and 7500 {Omega}. Aerobic inoculated cells (A-IN) had extremely high Ir values, 100000 and 130000 {Omega} for MFC-A and MFC-B, respectively. The Ir for all the inoculates was the lowest in the MFC-A, attributed to the change in the cell's architecture and the design of the electrodes. These results are encouraging since a decrease in Ir is required to increase the power and efficiency of a microbial fuel cell. [Spanish] El objetivo de este trabajo fue caracterizar electroquimicamente una celda de combustible microbiana de nuevo tipo (CCM-A), y evaluar el efecto de tres tipos de inoculos sobre la resistencia interna (R{sub i}). Los resultados fueron comparados con los de una celda de combustible estandar (CCM-B). La CCM-A consistio de un cilindro horizontal de acrilato, equipado con dos sistemas de electrodos emparedados (cada uno con catodo/membrana de intercambio protonico/anodo) en cada uno de los extremos de la camara. La CCM-B consistio de un anodo y un catodo colocados cada uno en las caras opuestas de la celda, separados por 78 mm. Las Ri de las celdas fueron determinadas por

Spordipreemiad leidsid omaniku / Anne Põder

Index Scriptorium Estoniae

Põder, Anne, 1973-

2007-01-01

Järvamaa omavalitsuste liit ja spordiliit tunnustasid maakonna parimaid sportlasi, kelleks osutusid Ain-Alar Juhanson, Mikko Vanaisak, Viktoria Leks ja Grit Shadeiko. Spordiedendaja preemia sai Tiit Kavak, spordi elutöö preemia pälvis Enn Sõmeri

Teatrid murravad päid ja piike / Dea Martinjonis

Index Scriptorium Estoniae

Martinjonis, Dea

2000-01-01

Eesti Televisiooni ekraanile jõuab teatriteemaline teleturniir "Bläkkpoks" : stsenarist Villu Kangur : režissöör Ain Prosa : saatejuht Sepo Seeman : toimetaja Anne Tuuling : produtsent Priit Vaher. Ka : Teleleht nr. 50, lk. 36-37

Download this PDF file

African Journals Online (AJOL)

rme

1Medical Genetic Center, Faculty of Medicine, Ain Shams University,. 2Community ... indications for amniocentesis in 60.8% were history of having previous child .... best location for placing the needle ..... leukemia, 8.5% for neural tube defects.

Geochemistry of dark coastal heavy-mineral beaches sand (Annaba ...

African Journals Online (AJOL)

Acer

3 Institute of Earth and Environmental Science, University of Potsdam, ... Some beaches are characterized by a red-brownish sand colour, the Ain Achir and the ... The occurrence of clays has been determined using the methyl-blue method.

9. II avati taas von Krahli Akna galerii

Index Scriptorium Estoniae

2004-01-01

Näitusel "Mute - a Register of Dreams" on vaadata Aine Phillipsi (Iirimaa), Avangardi, Diane Dwyer & Tillamook Cheddari (USA), Evelin Urmi, Kiwa, Lee Adamsi (Inglismaa), Marcello Mercado (Saksamaa), Miguel Rodriguez Sepulveda (Mehhiko) ja Renato Meneghetti (Itaalia) töid

Алексий II 1929-2008

Index Scriptorium Estoniae

2008-01-01

Aleksius II meenutavad: Kornelius, Tallinna ja kogu Eesti metropoliit ; Karin Jaani ; Marina Kaljurand ; Dmitri Medvedev, Venemaa president ; Helene Kamzol, Aleksius II sugulane ; Ain Seppik ; Vladimir Illjashevitsh ; Edgar Savisaar ; Jevgeni Tomberg ; Ene Ergma ; Toomas Hendrik Ilves, Eesti Vabariigi president

Dgroup: DG00804 [KEGG MEDICUS

Lifescience Database Archive (English)

Full Text Available aine hydrochloride Neuropsychiatric agent ... DG02030 ... Anesthetics ... DG01675 ... Local anesthetic ... DG01673 ... Amide type local anesthetic... ... DG01675 ... Local anesthetic ... DG01673 ... Amide type local anesthetic ATC code: N01BB07 Local anesthetic

deletion polymorphism of ACE gene and Alzheimerв€™s disease

African Journals Online (AJOL)

Omayma M. Hassanin

2014-06-27

Jun 27, 2014 ... ease, 45 males and 39 females aged 65 ± 7 years from the Geriatric Department at Ain-Shams Uni- ..... alternative therapy provided by the ACE protein. .... enzyme (ACE) gene polymorphism in relation to physical perfor-.

Egyptian Journal of Pediatric Allergy and Immunology (The): Journal ...

African Journals Online (AJOL)

Publisher. Contact: Professor Ihab Z. El-Hakim. Email ihab.elhakim@gmail.com. Phone +201111224974. Fax … +202 33045060. Children's Hospital, Ain Shams University, Ramses Street, Abbassiya, Cairo 11566, Egypt. The Egyptian Society of Pediatric Allergy and Immunology ...

Ahhaa teaduskeskus Tartus = The Ahhaa Science Centre in Tartu

Index Scriptorium Estoniae

2012-01-01

Arhitektide Ain Padriku ja Vilen Künnaou projekteeritud Ahhaa teaduskeskuse (Sadama 1) ekspositsiooni ja sisekujundusest. Sisearhitektid Tea Tammelaan, Krista Lepland ja Malle Jürgenson (Laika, Belka & Strelka), loetletud nende ühiselt tehtud töid. Infograafika: Alar Pikkorainen

Keskerakonna nõrk PR-käik / Aivar Hundimägi

Index Scriptorium Estoniae

Hundimägi, Aivar, 1975-

2008-01-01

Seoses keskerakondlastest ettevõtjate Richard Siku ja Heldur Undi sattumisega bordelliskandaali on Keskerakonna aukohtu esimees Ain Seppik pöördunud järelpärimisega politseiameti peadirektori Raivo Aegi ja riigi peaprokuröri Norman Aasa poole

Data of evolutionary structure change: 1WPWB-1XAAA [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 1WPWB-1XAAA 1WPW 1XAA B A GFTVALIQGDGIGPEIVSKSKRILAKINELYSLPIEYIE...SDGVAVGMKIITRFASERIAKVGLNFALRRRKKVTCVHKANVMRITDGLFAEACRSVLKG--KVEYSEMYVDAAAANLVRNPQMFDVIVTENVYGDILSDEASQIAGS...LEU CA 502 1XAA A 1XAAA...R CA 306 1XAA A 1XAAA...ain>A 1XAAA KANVL-EVGEF -

Tornkorteritega maja otse tulevikust / Ave Randviir

Index Scriptorium Estoniae

Randviir, Ave, 1981-

2006-01-01

Vilen Künnapu, Ain Padriku ja Kristi Alamaa ümberehitusprojekti järgi valminud modernsest kolme torniga elumajast Triumph Plaza Tallinnas Narva mnt. 7. Rekonstrueeriti Olga Brunsi ja Mart Kallingu 1981. a. valminud konterihoone. Kommenteerib Vilen Künnapu

Uus eksamikord tõi 13 tudengi eksmati / Inga Uusmaa

Index Scriptorium Estoniae

Uusmaa, Inga

2001-01-01

Eesti Sisekaitseakadeemias kehtestatud vaheeksami süsteemist, mille järgi tuleb igas aines sooritada kaks eksamit, teine eksam ei anna küll ainepunkte, kuid selles läbikukkumine tähendab seniste ainetulemuste tühistamist

Browse Title Index

African Journals Online (AJOL)

Items 51 - 100 of 149 ... ... of Pediatric Asthma Review of Ain Shams Pediatric Hospital Chest Clinic ... Vol 15, No 1 (2017), Gastrointestinal manifestations in children ... Vol 6, No 1 (2008), Immunogenetics of type 1 diabetes mellitus, Abstract PDF.

Rein Sillar : Kui argumente ei jätku, on hea KGB kaart välja tõmmata / Rein Sillar ; interv. Toomas Sildam

Index Scriptorium Estoniae

Sillar, Rein

2001-01-01

Eesti NSV KGB viimane esimees ei usu, et eestlased sooviksid minevikuhaavu lahti rebida. Vare-Shironini kokkuleppest KGB tegevuse lõpemisest Eestis, süümevandest, ENSV Riiklikust Julgeolekukomiteest. Kommenteerivad: Ain Kaalep, Peeter Olesk, Heinz Valk. Parlamendisaadik (P. Olesk)

90-aastane Tallinna Polütehnikum - ainus omataoline / Sirje Tohver

Index Scriptorium Estoniae

Tohver, Sirje

2005-01-01

Polütehnikumi vilistlastest õpetajate (Heiki Tähis, Andres Ojalill, Jüri Jakubovitš, Hugo Tartlan, Hergi Kruusimaa, Tiina Karja, Priit Kalman, Ardi Priks, Jaan Kuus, Jüri Puhang, Vello Vanem, Rein Kask, Kalle Sammal, Ain Saaret) meenutusi

Archaeological investigations on the site of the cistercian nunnery of st. Michael / Mauri Kiudsoo, Irita Kallis

Index Scriptorium Estoniae

Kiudsoo, Mauri

2005-01-01

2004. aasta suvel Tallinnas Suur-Kloostri 2 kinnistul toimunud kaevamistest. Leidis kinnitust hüpotees, mille kohaselt hävitati kloostri rajamisel mingi varasem asustusvorm. Arheoloogilise stratigraafia analüüsil ja fikseerimisel kasutati Edward C. Harrise koostatud stratigraafia teooria ja metoodika põhimõtteid ja nn. Harrise maatriksit

Study of the components of renin-angiotensinaldosterone system and KalliKrein -Kinin system in normal pregnancy

International Nuclear Information System (INIS)

Abreu Fagundes, V.G. de.

1984-01-01

The alterations in the renin-angiotensin-aldosterone system and Kallikrein-Kinin system were studied. The possible interferences of these systems on the arterial pressure and on the evolution of normal pregnancy were presented in the following situations: when the pregnant change from dorsal decumbency to left lateral decumbency and to orthostatic position. (M.A.C.) [pt

Lauli mi, tuvi' toro sisse, kalli kramahvoona sisse... ehk Neiu surm & suured saajad / Marju Torp-Kõivupuu

Index Scriptorium Estoniae

Torp-Kõivupuu, Marju, 1960-

2004-01-01

Rets. rmt.: The Maiden's Death Song & The Great Wedding : Anne Vabarna's oral twin epic written down by A. O. Väisanen / by Lauri Honko in collaboration with Anneli Honko and Paul Hagu. Helsinki, 2003. Setu rahvalauliku Anne Vabarna kaksikeeposest "Suured saajad. Neiu koolulaul"

Kallis reostuse avastamise seade ähvardab jääda tolmu koguma / Ulvar Käärt

Index Scriptorium Estoniae

Käärt, Ulvar, 1982-

2009-01-01

Eelarvekärbete tõttu puudub siseministeeriumil raha, et saada luba hakata pärast piirivalve lennusalga vana kopteri MI-8 kasutusaja täis saamist edaspidi õlireostuste avastamiseks muretsetud Lidar-seadet vedama olemasolevate Augusta Westland 139 kopterite või lennuki L-410 pardal

Obtention of differential sections in nuclear reactions using a thick target

International Nuclear Information System (INIS)

Chavez R, R.

2000-01-01

The nuclear reaction analysis (NRA) technique is used mainly for detecting the presence and concentration of light elements of great importance such as: carbon, nitrogen and oxygen. This work has the objective to obtain the differential sections of 16 O and 14 N starting from the irradiation with deuterons of TiSrO 3 samples, of AIN and AIN 2 at energies of 2000 KeV and 1800 KeV respectively. The present work have four chapters; chapter 1 is focused to the physical aspects which takes part in the NRA technique. The technical requirements as well as the necessary equipment for developing the techniques are described in the chapter 2. In chapter 3 it is described the algorithm developed for to obtain the differential sections starting from experimental data, and finally, in chapter 4 are given the results and conclusions. (Author)

Fibre optique à la maison en Pays de Gex et de Bellegarde

CERN Multimedia

CERN. Geneva; Goy, Jean Paul

2010-01-01

Le Syndicat Intercommunal d’Electricité de l’Ain(SIEA) déploie un réseau FTTH (Fiber To The Home) de fibres optiques dans le département de l’Ain vers l’ensemble des habitations. Le déploiement sur la zone pilote du Pays de Gex et du Bassin Bellegardien arrive dans la phase terminale vers les habitations. Le SIEA présentera ses activités, l’état du développement du réseau, les implications d’une connexion fibre optique et les procédures d’abonnement. La présentation sera donnée en Français. -------------------------------------------------------------------------------------------------------------------------------Public conference "Optical fiber To The Home in Pays de Gex et de Bellegarde" Michel Chanel et Jean Paul Goy (SIEA) Wednesday, 19th May at 11.30 hrs., Counc...

Portugalikeelse kirjanduse retseptsioon Eestis / Mele Pesti

Index Scriptorium Estoniae

Pesti, Mele, 1979-

2011-01-01

Portugalikeelse kirjanduse tõlgetest ja nende vastuvõtust alates esimese tõlke ilmumisest 1890. aastal kuni 2005. aastani ning retseptsiooni pärssinud teguritest. Ülevaade kahe olulisema tõlkija Aita Kurfeldti ja Ain Kaalepi tööst

Neurofibromatosis type 1 and multiple sclerosis: Genetically related ...

African Journals Online (AJOL)

Solaf M. Elsayed

2016-10-25

Oct 25, 2016 ... a Genetics Unit, Children's Hospital, Ain Shams University, Egypt b Neurology Department ... Through the past 6 months, she started to develop short term memory loss with intact long term memory. There was no other motor ...

Veel vene koolist ja krokodillipisaratest / Yana Toom

Index Scriptorium Estoniae

Toom, Yana, 1966-

2011-01-01

Artikli autori arvates ei ole eesti keele õpetamise kvaliteet piisav, et seada eesmärgiks eestikeelne aineõpe vene koolide gümnaasiumiastmes. Vastukaja artiklile: Priit Simson. Venekeelne kool ja krokodillipisarad. Eesti Päevaleht (2011) 9. sept., lk. 2

Uurija Rita ja näitleja Elisabet / Jüri Laulik

Index Scriptorium Estoniae

Laulik, Jüri, 1959-

2006-01-01

ETV uues algupärases krimisarjas "Ohtlik lend" teeb kaasa ka Tallinna Linnateatri näitlejanna Elisabet Tamm. Sarja stsenarist on Mihkel Ulman, lavastaja Ain Prosa. Näitlejannast lähemalt. Sama : Teleleht, nr. 41, lk. 6-7 : ill

Spielpläne

Index Scriptorium Estoniae

2007-01-01

Laulja Annely Peebo ooperis "Jenufa" 2., 4., 6., 9., 11., 13. ja 15. mail Mailandis. Eesti Filharmoonia Kammerkoor esinemas 27. ja 28. mail Bergenis. Laulja Ain Anger 19. mail Placido-Domingo Galal ja 31. mail ooperis "Othello" Viini Riigiooperis

Parts : ministrite minevik olgu avalik / Juhan Parts ; interv. Toomas Sildam

Index Scriptorium Estoniae

Parts, Juhan, 1966-

2003-01-01

Peaminister Juhan Parts vastab küsimustele, mis on seotud politseinike altkäemaksu andmise avalikuks tulekuga, komissar Indrek Sirgi ametist lahkumisega ja ministrite seadusrikkumiste avalikustamisega. Kommenteerivad: Margus Leivo, Tarmo Loodus, Ain Seppik. Vt. samas: Valik saladuses peetavast teabest

City Plaza büroohoone edu üllatas asjatundjaid / Aivo Vahemets

Index Scriptorium Estoniae

Vahemets, Aivo

2004-01-01

Kuigi kinnisvaraspetsialistid olid City Plaza büroohoonesse äripindade rentnike leidmise suhtes skeptilised, on Tallinnas asuvas City Plaza kõrghoones 31 äripinnast rentimata veel vaid kaks. Vt. samas intervjuud Ain Kivisaarega. Lisa: City Plaza büroohoone

Staff

Index Scriptorium Estoniae

2006-01-01

TÜ teadustöötajaist ja õppejõududest on 2/3 doktorikraadiga. TÜ rektor Jaak Aaviksoo ja teadusprprektor Ain Heinaru valiti Euroopa kõrghariduspoliitika juhtorganitesse. Sotsiaalteaduskonna prof. Wolfgang Drechsler sai Saksa-Eesti akadeemiliste suhete arendamise eest Saksamaa Liitvabariigi Teeneteristi

Challenges in diagnosis and counseling of a family with two ...

African Journals Online (AJOL)

Heba S. Abd-Elkhalek

2015-12-29

Dec 29, 2015 ... Genetics Unit, Childrens' Hospital, Ain Shams University, Cairo, Egypt. Available online 29 ... normal milestones of development in the first 6 months of life .... most important clue in family history that indicated the pres- ence of ...

Hepatoadrenal syndrome in Egyptian children with liver cirrhosis ...

African Journals Online (AJOL)

Amel A.M. Elfaramawy

2012-08-03

Aug 3, 2012 ... E-mail address: amelhome4@gmail.com. Peer review under responsibility of Ain Shams University. Production and hosting by ..... [23] Ho JT, Al-Musalhi H, Chapman MJ, Quach T, Thomas PD, Bagley. CJ, et al. Septic shock ...

Risk factors for autism: An Egyptian study

African Journals Online (AJOL)

Farida El-Baz

IQ assessment using Stanford–Binrent intelligence scale, and assessment of severity ... All studied developmental milestones were delayed among autistic children than ... Peer review under responsibility of Ain Shams University. ..... Treatment and educa- ..... communication in people with autism and intellectual disability. J.

Determination of thorium and uranium contents in soil samples ...

Indian Academy of Sciences (India)

Experimental Nuclear Physics Department, Atomic Energy Authority, Nuclear Research Center, Abu Zabaal, 13759 Cairo, Egyp; Experimental Nuclear Physics Department, Atomic Energy Authority, Nuclear Research Center, Abu Zabaal, 13759 Cairo, Egypt; Faculty of Girls for Art, Science and Education, Ain-Shams ...

Naised Ilvesenahkades / Agnes Nõu

Index Scriptorium Estoniae

Nõu, Agnes

2006-01-01

Jahtlaeva Santa Maria kapteni Ain Roosma soovist kogu jahtlaeva naiskond ühtsesse vormi riietada sündis tuntud Eesti spordiriiete tootjal AS-il Ilves-Extra uus tootegrupp - purjetamisrõivad. Vt. samas: Ilves-Extra valmistab nüüd purjetamisrõivaid

3 + 2 = 450 : 3+2 õppesüsteem tõi kaasa kuni 450 tudengiga hiigelloengud / Anu Mõistlik, Jüri Saar

Index Scriptorium Estoniae

Mõistlik, Anu, 1980-

2002-01-01

Vastne õppekord pakib loengusaali sadu noori. 3+2 tuleku otsustas kuue inimese hääletus. Vanade õppekavade ained kaovad järjestikku tunniplaanidest. Teadusmagistreid enam ei tule. Ainepunktide ülekandmiseks peab üliõpilane ise vaeva nägema

Musta pesu pesemine / Ivar Tallo

Index Scriptorium Estoniae

Tallo, Ivar, 1964-

2005-01-01

Valitsuse korruptsioonivastase asjatundjate komisjoni juht aastatel 2002-2003 on seisukohal, et ajakirjandus on ainult üks võimalikest vahenditest tõe tuvastamisel ning lõpliku tõe Edgar Savisaare ja Ain Hanschmidti jt seotud skandaalide kohta peavad selgitama võimuinstitutsioonid

Antibacterial, antioxidant and cytotoxic activities of extracts from the ...

African Journals Online (AJOL)

Unicellular green algal strains, identified as Cosmarium (Chlorophyta), were isolated from Ain-Echeffa hot spring in north Tunisia. Different extracts (methanol, hexane, acetone, acetone: methanol and water) obtained from both biomass and extracellular polysaccharides (EPS) were evaluated for their antibacterial, ...

Väikesed inimesed kodumaises seebivahus / Margot Visnap

Index Scriptorium Estoniae

Visnap, Margot, 1959-

2000-01-01

Kanal 2 uus teleseriaal "Me saame hakkama" : stsenarist Mihkel Ulman : režissöör Ain Prosa : helilooja Ardo-Ran Varres : mängivad Andrus, Maarika ja Marta Vaarik, Ülle Kaljuste, Maria Avdjushko, Hilja Varem jt. : Wireframe Productions

Nad saidki hakkama / Jüri Laulik

Index Scriptorium Estoniae

Laulik, Jüri, 1959-

2000-01-01

Kanal 2 uus teleseriaal "Me saame hakkama" : stsenarist Mihkel Ulman : režissöör Ain Prosa : helilooja Ardo-Ran Varres : mängivad Andrus, Maarika ja Marta Vaarik, Ülle Kaljuste, Maria Avdjushko, Hilja Varem jt. : Wireframe Productions

Tallinn hakkab Põhjaväila tarvis maid ostma

Index Scriptorium Estoniae

2007-01-01

Seoses Russalkast Ahtri tänavani ulatuva tee-ehitusega seisab linnal ees 16 maaküsimuse lahendamine. Probleemidest seoses väila osaliselt merre ehitamisega ja väila lõpuniehitamiseks lammutada tulevad hooned. Kommenteerivad Alo Brandt ja Ain Valdmann

Reiljan, Savisaar show who's in charge / Joel Alas

Index Scriptorium Estoniae

Alas, Joel

2006-01-01

Eestimaa Rahvaliidu esimees Villu Reiljan ja Eesti Keskerakonna esimees Edgar Savisaar otsustavad uue presidendi üle. Villu Reiljan toetab Arnold Rüütlit. Edgar Savisaare, Ene Ergma, Toomas Hendrik Ilvese ja Riigikogu liikme Ain Seppiku väljaütlemised

Pilistvere rehehoones tapetakse Rasputin / Kaarel Aluoja

Index Scriptorium Estoniae

Aluoja, Kaarel

2008-01-01

7. aug. Pilistvere vanas rehehoones esietendunud Ain Saviaugu kirjutatud ja lavastatud suvetükist "Rasputin". Suvelavastuse tõi välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas mängib näitlejast riigikogulane Indrek Saar

Rasputin - lugu rahva latvade juurimisest / Kati Murutar

Index Scriptorium Estoniae

Murutar, Kati, 1967-

2008-01-01

7. aug. Pilistvere vanas rehehoones esietendunud Ain Saviaugu kirjutatud ja lavastatud suvetükist "Rasputin". Suvelavastuse tõi välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas mängib näitlejast riigikogulane Indrek Saar

Pilistvere vana rehe all päästetakse Venemaad / Krista Valdvee

Index Scriptorium Estoniae

Valdvee, Krista, 1978-

2008-01-01

7. aug. Pilistvere vanas rehehoones esietendunud Ain Saviaugu kirjutatud ja lavastatud suvetükist "Rasputin". Suvelavastuse tõi välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas mängib näitlejast riigikogulane Indrek Saar

Pilistveres saab homme kohtuda Rasputiniga / Ülle Lätte

Index Scriptorium Estoniae

Lätte, Ülle, 1955-

2008-01-01

7. aug. Pilistvere vanas rehehoones esietenduvast Ain Saviaugu kirjutatud ja lavastatud suvetükist "Rasputin". Suvelavastuse toob välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas mängib näitlejast riigikogulane Indrek Saar

Ellunäod toovad välja "Rasputini" / Riina Mägi

Index Scriptorium Estoniae

Mägi, Riina, 1957-

2008-01-01

7. aug. Pilistvere vanas rehehoones esietenduvast Ain Saviaugu kirjutatud ja lavastatud suvetükist "Rasputin". Suvelavastuse toob välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas mängib näitlejast riigikogulane Indrek Saar

Pilistveres tegutseb Rasputin / Margus Haav

Index Scriptorium Estoniae

Haav, Margus, 1969-

2008-01-01

7. aug. Pilistvere vanas rehehoones esietenduvast Ain Saviaugu kirjutatud ja lavastatud suvetükist "Rasputin". Suvelavastuse toob välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas mängib näitlejast riigikogulane Indrek Saar

Rasputin : Rahvakese jaoks on vaja elada / Margus Mikomägi

Index Scriptorium Estoniae

Mikomägi, Margus, 1956-

2008-01-01

7. aug. Pilistvere vanas rehehoones esietendunud Ain Saviaugu kirjutatud ja lavastatud suvetükist "Rasputin". Suvelavastuse tõi välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas mängib näitlejast riigikogulane Indrek Saar

Naissoo ja Agan - 2 in 1 / Igor Garšnek

Index Scriptorium Estoniae

Garšnek, Igor, 1958-

2011-01-01

15. mail Tallinnas Mustpeade majas toimunud kontserdist "Naissoo ja Agan 111", kus esinesid Tõnu Naissoo, Ain Agan, Teemu Viinikainen, Raul Sööt, Daniel Aljo, Joel-Rasmus Remmel, Mihkel Mälgand, Toomas Rull ja Tallinna Kammerorkester Jüri-Ruut Kanguri juhatusel

Efficacious Oxime for Organophosphorus Poisoning: A Minireview

African Journals Online (AJOL)

Erah

University, PO Box 17666, AlAin, United Arab Emirate. Abstract ... poisoning is a major health problem all over the world ... contaminated food in a social ceremony in. Magrawa, India [7] .... either gave null effect or possible harm [19]. According ...

Pinning Down versus Density

OpenAIRE

Juhász, István; Soukup, Lajos; Szentmiklóssy, Zoltán

2015-01-01

The pinning down number $ {pd}(X)$ of a topological space $X$ is the smallest cardinal $\\kappa$ such that for any neighborhood assignment $U:X\\to \\tau_X$ there is a set $A\\in [X]^\\kappa$ with $A\\cap U(x)\

Sapucaia nuts (Lecythis pisonis) modulate the hepatic inflammatory ...

African Journals Online (AJOL)

Mariella

2016-06-22

Jun 22, 2016 ... antioxidant and anti-inflamatory effects of this nut after its introduction into a control (AIN-93G) or ... fat diets increases the total amount of body lipids, and ..... physical exercise on lipid profile, oxidative stress and antioxidant.

Research Article

African Journals Online (AJOL)

2017-05-01

May 1, 2017 ... arid climate, it already suffers the problem of flash flooding during the last 100 years .... Location of Ain Sefra watershed in Algeria (ASTER, 30m resolution, Map datum .... Six methods are included fot Routing model (Kinematic ...

Material and Phonon Engineering for Next Generation Acoustic Devices

Science.gov (United States)

Kuo, Nai-Kuei

This thesis presents the theoretical and experimental work related to micromachining of low intrinsic loss sapphire and phononic crystals for engineering new classes of electroacoustic devices for frequency control applications. For the first time, a low loss sapphire suspended membrane was fabricated and utilized to form the main body of a piezoelectric lateral overtone bulk acoustic resonator (LOBAR). Since the metalized piezoelectric transducer area in a LOBAR is only a small fraction of the overall resonant cavity (made out of sapphire), high quality factor (Q) overtones are attained. The experiment confirms the low intrinsic mechanical loss of the transferred sapphire thin film, and the resonators exhibit the highest Q of 5,440 at 2.8 GHz ( f·Q of 1.53.1013 Hz). This is also the highest f·Q demonstrated for aluminum-nitride-(AIN)-based Lamb wave devices to date. Beyond demonstrating a low loss device, this experimental work has laid the foundation for the future development of new micromechanical devices based on a high Q, high hardness and chemically resilient material. The search for alternative ways to more efficiently perform frequency control functionalities lead to the exploration of Phononic Crystal (PnC) structures in AIN thin films. Four unit cell designs were theoretically and experimentally investigated to explore the behavior of phononic bandgaps (PBGs) in the ultra high frequency (UHF) range: (i) the conventional square lattice with circular air scatterer, (ii) the inverse acoustic bandgap (IABG) structure, (iii) the fractal PnC, and (iv) the X-shaped PnC. Each unit cell has its unique frequency characteristic that was exploited to synthesize either cavity resonators or improve the performance of acoustic delay lines. The PBGs operate in the range of 770 MHz to 1 GHz and exhibit a maximum acoustic rejection of 40 dB. AIN Lamb wave transducers (LWTs) were employed for the experimental demonstration of the PBGs and cavity resonances. Ultra