WorldWideScience

Sample records for ain heinaru allan

  1. Poolsajandi õnnesoovid Jaak Aaviksoole / Ain Heinaru, Jaak Kangilaski, Tõnu Lehtsaar...[jt.

    2004-01-01

    Mõtteid Tartu Ülikooli rektorist tema 50. sünnipäeva puhul : Ain Heinaru, Jaak Kangilaski, Tõnu Lehtsaar, Indrek Reimand, Toomas Kiho, Leelo Kriisa, Peeter Olesk, Risto Tammelo, Birute Klaas, Peeter Saari, Andrus Ansip, Mait Klaassen, Marika Kullamaa, Kaupo Bend

  2. Jõekääru Jazz täitis eesmärgi nii korraldajate, esinejate kui publiku poolelt / Allan Liik, Hedvig Hanson, Andre Maaker, Ain Agan...[jt.] ; foto ja küsitl. Kaire Tensuda

    2007-01-01

    Jõekääru Jazz'ile järgneval nädalal tõi ürituse peakorraldaja Allan Liik toimetusse seal esinenud muusikud. Vestlusringis olid: Allan Liik, Hedvig Hanson, Andre Maaker, Ain Agan, Raivo Tafenau ja Sergio Bastos

  3. Spectral Ambiguity of Allan Variance

    Greenhall, C. A.

    1996-01-01

    We study the extent to which knowledge of Allan variance and other finite-difference variances determines the spectrum of a random process. The variance of first differences is known to determine the spectrum. We show that, in general, the Allan variance does not. A complete description of the ambiguity is given.

  4. ain defla, algeria

    Hamaidi-Chergui F, Brahim Errahmani M, Debib A, Hamaidi M.S

    2016-05-01

    May 1, 2016 ... Water from boreholes in Arib (Ain Defla) was investigated to ... of 100 ml is drawn through a membrane filter (0.45 μm pore size) using a vacuum pump. The .... boreholes are very important as clean and hygienic environment ...

  5. Allan Cox 1926”1987

    Coe, Rob; Dalrymple, Brent

    More than 1000 friends, students, and colleagues from all over the country filled Stanford Memorial Chapel (Stanford, Calif.) on February 3, 1987, to join in “A Celebration of the Life of Allan Cox.” Allan died early on the morning of January 27 while bicycling, the sport he had come to love the most. Between pieces of his favorite music by Bach and Mozart, Stanford administrators and colleagues spoke in tribute of Allan's unique qualities as friend, scientist, teacher, and dean of the School of Earth Sciences. James Rosse, Vice President and Provost of Stanford University, struck a particularly resonant chord with his personal remarks: "Allan reached out to each person he knew with the warmth and attention that can only come from deep respect and affection for others. I never heard him speak ill of others, and I do not believe he was capable of doing anything that would harm another being. He cared too much to intrude where he was not wanted, but his curiosity about people and the loving care with which he approached them broke down reserve to create remarkable friendships. His enthusiasm and good humor made him a welcome guest in the hearts of the hundreds of students and colleagues who shared the opportunity of knowing Allan Cox as a person."

  6. ALLAN.simulation club; Club ALLAN.simulation

    Boudaud, F

    1994-05-27

    The ALLAN.Simulation code was developed by the R and D direction of Gaz de France (GdF) company with the support of CISI and Dassault Data Services companies. Its aim is to provide a modeling tool for the design and operation of complex technical systems. It uses a `boxes and ropes` representation (non-oriented multi-variable bloc-schemes) which allows the re-use of all or part of previous models or analyses already developed and recorded. The third meeting of the non-GdF users of the ALLAN.Simulation code took place at Sophia Antipolis (France) on May 27, 1994. Several studies performed with ALLAN.Simulation were presented and dealt with: a thermohydraulic loop, an alternator for automobile, and the hydration of cements. This report is a compilation of the transparencies relative to these three studies. A last part is devoted the presentation of the possible links between different existing simulation codes: ALLAN, BASILE, MAPLE, NEPTUNIX. (J.S.)

  7. Paneeldiskussioon (fonogrammilt lühendatult) / Ain Heinaru, Rein Vaikmäe, Rein Raud, Hardi Tullus, Urve Lippus, Andres Tali, Martin Zobel

    2006-01-01

    Projekti "Eesti doktoriõppe kvaliteedi, tulemuslikkuse ja jätkusuutlikkuse tagamise süsteem" (2005-2008) II konverentsi "Doktorid Eesti tuleviku arengumootoriks" paneeldiskussioonist, millel arutleti doktoriõppe rahastamise ning doktoriõppe korralduse ja doktorandi juhendamise teemadel

  8. Edgar Allan Poe and neurology

    Hélio Afonso Ghizoni Teive

    2014-06-01

    Full Text Available Edgar Allan Poe was one of the most celebrated writers of all time. He published several masterpieces, some of which include references to neurological diseases. Poe suffered from recurrent depression, suggesting a bipolar disorder, as well as alcohol and drug abuse, which in fact led to his death from complications related to alcoholism. Various hypotheses were put forward, including Wernicke's encephalopathy.

  9. Allan Bloom, America, and Education.

    West, Thomas

    2000-01-01

    Refutes the claims of Allan Bloom that the source of the problem with today's universities is modern philosophy, that the writings and ideas of Hobbes and Locke planted the seeds of relativism in American culture, and that the cure is Great Books education. Suggests instead that America's founding principles are the only solution to the failure of…

  10. Edgar Allan Poe and music

    McAdams, Charity Beth

    2013-01-01

    This thesis focuses on the creative work of Edgar Allan Poe, and pieces together how various references to music in his poems and tales function in ways that echo throughout his oeuvre. By taking into account the plots and themes that surround references to music in Poe’s works, this thesis explores how Poe uses and describes music as it inhabits real world settings, liminal spaces, and otherworldly sites. The literature this thesis draws from ranges from tales little-discussed...

  11. "Budjem nazhimat" / Allan Martinson ; interv. Petr Birger

    Martinson, Allan, 1966-

    2006-01-01

    Allan Martinson oma asutatud infotehnoloogia ettevõtetest Eestis ja Baltimaades, investeerimisfirma Martinson Trigon Venture Partners investeeringust Vene tarkvarafirmasse Reksoft ning Eesti IT arengust tervikuna. Vt. samas intervjuud Reksoft'i peadirektori Aleksandr Jegoroviga

  12. Allan Martinson - Eesti mees maailmas / Monica Raud

    Raud, Monica, 1981-

    2008-01-01

    Investeerimisfirma Martinson Trigon Venture Partners juhist Allan Martinsonist, tema karjäärist, elulaadist ja harrastustest. Kommenteerivad AS Delfi nõukogu esimees Ville Jehe ja AS Helmes nõukogu esimees Jaan Pillesaar

  13. Laevade erinevate soetamisviiside kommertstingimuste võrdlev analüüs / Ain Eidast, Allan Kivi

    Eidast, Ain, 1939-2013

    2005-01-01

    Laevade erinevate soetamisviiside analüüs näitab, et ühtse, kõikidele osapooltele vastuvõetavate tingimuste väljatöötamine ja rakendamine ei ole tehniliselt võimalik ning majanduslikult õigustatud. Tabelid. Diagrammid

  14. Ain Kivisaar : äärelinn pole kvaliteetne investeering / Ain Kivisaar ; interv. Enn Tosso

    Kivisaar, Ain, 1978-

    2007-01-01

    Ilmunud ka: Delovõje Vedomosti : Nedvizhimost 24. okt. lk. 2-3. Küsimustele kinnisvaraturu olukorra ja investeeringute kohta vastab Metro Capital Managementi finantsjuht Ain Kivisaar. CV: Ain Kivisaar

  15. Allan Allmere: tulevane Meelis Atonen / Henri Allas

    Arras, Henri

    2009-01-01

    Liberalismi Akadeemia juht ja Tallinna reforminoorte esimees Allan Allmere keskendub 2009. aastal Tallinna linnavolikokku kandideerides peamiselt noortele ja nende probleemidele. Noormehe hobiks on väärtpaberiturgudel mängimine ning oma eeskujudena nimetab ta USA majandusteadlast Milton Friedmani ja Meelis Atoneni

  16. Baudelaire Eestis : märkmeid. III / Ain Kaalep

    Kaalep, Ain, 1926-

    2004-01-01

    Ants Orase loodud eesti aleksandriinist. Artiklis tuuakse välja Charles Baudelaire luuletuse "Correspondances" eri tõlked (Ants Oras, Ain Kaalep) ja luuletuse "Le rêve d'un curieux" tõlked (Ilmar Laaban, Ain Kaalep)

  17. Baudelaire Eestis : märkmeid. III / Ain Kaalep

    Kaalep, Ain, 1926-

    2013-01-01

    Ants Orase loodud eesti aleksandriinist. Artiklis tuuakse välja Charles Baudelaire luuletuse "Correspondances" eri tõlked (Ants Oras, Ain Kaalep) ja luuletuse "Le rêve d'un curieux" tõlked (Ilmar Laaban, Ain Kaalep)

  18. Allan Urho Paivio (1925-2016).

    Katz, Albert

    2017-01-01

    Presents an obituary for Allan Urho Paivio, who passed away on June 19, 2016. One of his many accomplishments was the development of a dual-coding theory. Dual-coding theory, while very influential, has, unfortunately, been discussed all too often as a theory of mental imagery, and not within its larger context wherein mental imagery and verbal processes are separable but interconnected representational systems, an academic battle in clarification that Paivio waged much of his life. He published prodigiously, even in the decades after retirement. Among his many honors, he served as president of the Canadian Psychological Association (1975) and was appointed a fellow of the Royal Society of Canada (1978). (PsycINFO Database Record (c) 2017 APA, all rights reserved).

  19. Allan Martinson ja Trigon teevad oma riskikapitalifondi / Kristiina Randmaa

    Randmaa, Kristiina

    2004-01-01

    Investeerimispank Trigon Capital ja infotehnoloogiaettevõte MicroLink endine juht Allan Martinson loovad Martinson Trigon Venture Partners nime all ühise kuni 400 miljoni kroonise mahuga riskikapitalifondi

  20. Allan deviation analysis of financial return series

    Hernández-Pérez, R.

    2012-05-01

    We perform a scaling analysis for the return series of different financial assets applying the Allan deviation (ADEV), which is used in the time and frequency metrology to characterize quantitatively the stability of frequency standards since it has demonstrated to be a robust quantity to analyze fluctuations of non-stationary time series for different observation intervals. The data used are opening price daily series for assets from different markets during a time span of around ten years. We found that the ADEV results for the return series at short scales resemble those expected for an uncorrelated series, consistent with the efficient market hypothesis. On the other hand, the ADEV results for absolute return series for short scales (first one or two decades) decrease following approximately a scaling relation up to a point that is different for almost each asset, after which the ADEV deviates from scaling, which suggests that the presence of clustering, long-range dependence and non-stationarity signatures in the series drive the results for large observation intervals.

  1. Obituary: Allan R. Sandage (1926-2010)

    Devorkin, David

    2011-12-01

    Allan Rex Sandage died of pancreatic cancer at his home in San Gabriel, California, in the shadow of Mount Wilson, on November 13, 2010. Born in Iowa City, Iowa, on June 18, 1926, he was 84 years old at his death, leaving his wife, former astronomer Mary Connelly Sandage, and two sons, David and John. He also left a legacy to the world of astronomical knowledge that has long been universally admired and appreciated, making his name synonymous with late 20th-Century observational cosmology. The only child of Charles Harold Sandage, a professor of advertising who helped establish that academic specialty after obtaining a PhD in business administration, and Dorothy Briggs Sandage, whose father was president of Graceland College in Iowa, Allan Sandage grew up in a thoroughly intellectual, university oriented atmosphere but also a peripatetic one taking him to Philadelphia and later to Illinois as his father rose in his career. During his 2 years in Philadelphia, at about age eleven, Allan developed a curiosity about astronomy stimulated by a friend's interest. His father bought him a telescope and he used it to systematically record sunspots, and later attempted to make a larger 6-inch reflector, a project left uncompleted. As a teenager Allan read widely, especially astronomy books of all kinds, recalling in particular The Glass Giant of Palomar as well as popular works by Eddington and Hubble (The Realm of the Nebulae) in the early 1940s. Although his family was Mormon, of the Reorganized Church, he was not practicing, though he later sporadically attended a Methodist church in Oxford, Iowa during his college years. Sandage knew by his high school years that he would engage in some form of intellectual life related to astronomy. He particularly recalls an influential science teacher at Miami University in Oxford, Ohio named Ray Edwards, who inspired him to think critically and "not settle for any hand-waving of any kind." [Interview of Allan Rex Sandage by Spencer

  2. Fabrication of AIN/cU Composites Using Electroless Plating and Evaluation of Their Thermal Properties according to AIN Particle Size

    Cho, Sung Chul; Han, Jun Hyun [Chungnam National University, Daejeon (Korea, Republic of); Ko, Se-Hyun [Korea Institute of Industrial Technology, Incheon (Korea, Republic of); Kim, Hye Sung [Pusan National University, Miryang (Korea, Republic of); Han, Jun Hyun [Korea Institute of Science and Technology, Seoul (Korea, Republic of)

    2015-12-15

    AIN/Cu composite powders with a core-shell structure were synthesized by a new technique using electroless plating of Cu on AIN particles and consolidated by spark plasma sintering (SPS). Dependence of the thermal conductivity and coefficient of thermal expansion (CTE) of the AIN/Cu composites on the particle size of AIN were studied. The thermal conductivity and coefficient of thermal expansion were significantly dependent on the existence of both boundary pores surrounding the Cu-coated AIN particles and the internal pores of the AIN particles. In order to eliminate the pores, the temperature and pressure of SPS were increased and the AIN particles were heat-treated at high temperature. Adoption of the core-shell AIN/Cu composite powders facilitated the fabrications of AIN/Cu composites with low porosity and uniform distribution in the AIN in Cu matrix.

  3. The Making of Allan Aubrey Boesak: Theologian and Political Activist

    Maluleke, Tinyiko

    2017-09-01

    Full Text Available Although no conventional biography of Allan Boesak has been published, either by himself or others, we have enough data and information in various places. This is especially true since the 2009 publication of his Running with Horses. In this essay, we attempt an appraisal of the contribution of Allan Boesak to politics and theology by focusing on key milestones and reflections in his life. We take our cue from Boesak’s own self-definition of being a theologian and a political activist. While this article is not a thorough-going theological, the roots and sources of his theology and politics will be explored.

  4. Tõeline modernist Allan Murdmaa / Toivo Tammik, Arne Maasik, Martin Pedanik, Heie Treier ; intervjueerinud Reet Varblane

    2009-01-01

    Allan Murdmaast (4. 08. 1934-15. 11. 2009) vestlevad 18. novembril Arhitektuuri- ja Disainigaleriis avatud Allan Murdmaa näituse ja raamatu "Monumentaalne : Allan Murdmaa" autorid arhitektid Toivo Tammik ja Arne Maasik ning graafiline disainer Martin Pedanik, lisaks kunstiteadlane Heie Treier

  5. Kaninen Allan, giraffen Marius og llivets værdi

    Sandøe, Peter

    2015-01-01

    Det var ikke smart, da en rasiovært på Radio24syv dor åben mikrofon dræbte kaninen Allan ved hjælp af en cykelpumpe. Men det er i orden at slå dyr ihjæl, hvis det sikrer, at de resterende dyr får bedre livsvilkår....

  6. O clássico Edgar Allan Poe

    Perna, Cristina Becker Lopes

    2009-01-01

    Full Text Available O estudo mostra alguns aspectos da vida de Edgar Allan Poe e situa o contexto histórico do qual fez parte o contista, poeta e ensaísta. A biografia do autor norte-americano é permeada de dúvidas, incertezas e mistérios que o escritor transporta para seus textos, criando um ambiente fantástico que, muitas vezes, foge ao racionalismo humano

  7. The principle of individuation in Edgar Allan Poe

    Maria Alice Ribeiro Gabriel

    2017-12-01

    Full Text Available Thematically, in Edgar Allan Poe’s fiction, the concept of principium individuationis (principle of individuation is a complex system of topics and interconnected elements, involving the notions of rational being, national and cultural identities, and social role. The purpose of this essay is to examine comparatively the idea of principium individuationis in “Morela” (1835 and others works by Poe, according to the studies undertaken by David Halliburton (1973, Martin Roth (1979, and Beverly R. Voloshin (1996.

  8. Dozhivjom do võborov / Ain Seppik ; interv. Tatjana Opekina

    Seppik, Ain, 1952-

    2007-01-01

    Riigikogu liige vastab küsimustele, mis puudutavad Keskerakonna poliitikat, parlamendivalimisi, aprillisündmusi, korruptsiooni, riigieelarvet. Ain Seppik leiab, et Keskerakonna missiooniks on arendada riiki ja kaitsta nõrku

  9. Põhikooli ainesõnastikud / Heiki Jaan Kaalep, Jaan Mikk

    Kaalep, Heiki-Jaan, 1962-

    2008-01-01

    Eesti vene õppekeelega koolidele keskastme ainesõnastike loomise konkursi tulemustest, kirjeldatakse koostatud sõnastike eesmärke ja kirjestruktuuri, samuti loomisprotsessi etappe. Vaadeldakse ka morfoloogiaalase tarkvara kasutamisvõimalusi sõnastiku loomisel

  10. Allan Martinson ja Trigon panid käima uue riskikapitalifondi / Kristina Traks

    Traks, Kristina, 1976-

    2005-01-01

    Allan Martinson ja investeerimispank Trigon Capital lõid uue riskikapitaliettevõtte Martinson Trigon Venture Partners, mis hakkab investeerima tehnoloogia-, meedia- ja telekommunikatsioonifirmadesse Balti riikides ja Venemaal

  11. Profilaxis de la úlcera gastrointestinal producida por AINES

    Carlos Bustamante Rojas

    1998-04-01

    Full Text Available Como grupo, los AINES son los fármacos más frecuentemente  relacionados con informes acerca de Reacciones Adversas en varios países, se considera que más de 30 millones de personas en el mundo toman a diario AINES por  prescripción médica o por autoprescripción y que un alto porcentaje de dichas personas corresponden al grupo de edad mayor de 60 años. Diversos metaanálisis revelan que el riesgo de presentar eventos gastrointestinales graves en consumidores regulares de AINES puede ser de 3 a 4 veces mayor que en no usuarios al cabo de 30 dias y que dicho riesgo relativo estimado puede elevarse a 5.5 en pacientes ancianos (7 y a valores cercanos a 8.0 cuando se usan altas dosis del AINE (I, 8. También se ha relacionado el empleo crónico de AINES con un aumento en la mortalidad en ancianos.

  12. On the extended and Allan spectra and topological radii

    Hugo Arizmendi-Peimbert

    2012-01-01

    Full Text Available In this paper we prove that the extended spectrum \\(\\Sigma(x\\, defined by W. Żelazko, of an element \\(x\\ of a pseudo-complete locally convex unital complex algebra \\(A\\ is a subset of the spectrum \\(\\sigma_A(x\\, defined by G.R. Allan. Furthermore, we prove that they coincide when \\(\\Sigma(x\\ is closed. We also establish some order relations between several topological radii of \\(x\\, among which are the topological spectral radius \\(R_t(x\\ and the topological radius of boundedness \\(\\beta_t(x\\.

  13. Pragmatics: The State of the Art: An Online Interview with Keith Allan

    Allan, Keith; Salmani Nodoushan, Mohammad Ali

    2015-01-01

    This interview was conducted with Professor Keith Allan with the aim of providing a brief but informative summary of the state of the art of pragmatics. In providing answers to the interview questions, Professor Allan begins with a definition of pragmatics as it is practiced today, i.e., the study of the meanings of utterances with attention to…

  14. Electronic structure and optical properties of AIN under high pressure

    Li Zetao; Dang Suihu; Li Chunxia

    2011-01-01

    We have calculated the electronic structure and optical properties of Wurtzite structure AIN under different high pressure with generalized gradient approximation (GGA) in this paper. The total energy, density of state, energy band structure and optical absorption and reflection properties under high pressure are calculated. By comparing the changes of the energy band structure, we obtained AIN phase transition pressure for 16.7 GPa, which is a direct band structure transforming to an indirect band structure. Meanwhile, according to the density of states distribution and energy band structure, we analyzed the optical properties of AIN under high-pressure, the results showed that the absorption spectra moved from low-energy to high-energy. (authors)

  15. REPRESENTATION OF DEATH IN EDGAR ALLAN POE AND EMILY DICKINSON

    Sudha Swarnakar

    2017-03-01

    Full Text Available Este artigo reflete sobre a representação do tema da morte nas obras de dois escritores norte americano; o Edgar Allan Poe e Emily Dickinson. Como instrumento de pesquisa e apoio teórico buscamos a teoria com-parada e estudo temático. Para ser justo na nossa comparação com Emily Dickinson, que nunca entro no mundo de ficção e ficou escrevendo só po-emas, tentamos não entrar no mundo de ficção de Edgar Allan Poe e limitar a discussão só para os poemas dele. O argumento principal neste trabalho se constrói ao redor a idéia que apesar de ambos os poetas ser obcecados com a morte, como a constante presença da morte nos trabalhos deles prova. Percebemos que a maneira no qual eles apresenta a morte é bem diferente.

  16. Keila Tervisekeskus. Ujula = Keila Health Club. Swimming Pool / Ain Padrik

    Padrik, Ain, 1947-

    2001-01-01

    Projekteerija: Arhitektuuribüroo Künnapu & Padrik. Arhitektid Ain Padrik ja Kristi Alamaa, sisearhitekt Sirje Männik. Konstruktsioonid: Jaan Laks, A-Grupp. Ujulas on võistlus- ja lastebassein, suvel on avatud välibassein. 5 ill.: I korruse plaan, ristlõige, vaated

  17. Allan Deviation Plot as a Tool for Quartz-Enhanced Photoacoustic Sensors Noise Analysis.

    Giglio, Marilena; Patimisco, Pietro; Sampaolo, Angelo; Scamarcio, Gaetano; Tittel, Frank K; Spagnolo, Vincenzo

    2016-04-01

    We report here on the use of the Allan deviation plot to analyze the long-term stability of a quartz-enhanced photoacoustic (QEPAS) gas sensor. The Allan plot provides information about the optimum averaging time for the QEPAS signal and allows the prediction of its ultimate detection limit. The Allan deviation can also be used to determine the main sources of noise coming from the individual components of the sensor. Quartz tuning fork thermal noise dominates for integration times up to 275 s, whereas at longer averaging times, the main contribution to the sensor noise originates from laser power instabilities.

  18. Sõjareporter peab ajakirjanduse objektiivsust kättesaamatuks / Allan Little ; interv. Priit Pullerits

    Little, Allan

    2005-01-01

    Briti telekompanii BBC staazhikas väliskorrespondent vastab küsimustele, mis puudutavad BBC saadete objektiivsust, telekompanii vasakliberaalseid hoiakuid, BBC suhtumist Iisraeli-Palestiina konflikti ning keerukate välispoliitiliste teemade kajastamist. Lisa: Allan Little

  19. Rector's office as of 31 December 2006

    2007-01-01

    Rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Birute Klaas, administratsioonidirektor prof. Mihkel Pärnoja, finantsdirektor Taimo saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit

  20. Rector's office as of 31 December 2005

    2006-01-01

    TÜ rektoraadi koosseis: rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Tõnu Lehtsaar, prorektor prof. Jaak Kangilaski; administratsioonidirektor Mihkel Pärnoja, finantsdirektor Taimo Saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit

  1. Rektoraat seisuga 31.12. 2005

    2006-01-01

    TÜ rektoraadi koosseis: rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Tõnu Lehtsaar, prorektor prof. Jaak Kangilaski; administratsioonidirektor Mihkel Pärnoja, finantsdirektor Taimo Saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit

  2. Rektoraat seisuga 31.12.2006

    2007-01-01

    Rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Birute Klaas, administratsioonidirektor prof. Mihkel Pärnoja, finantsdirektor Taimo saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit

  3. Analysis of Motherly Love in Edgar Allan Poe's “to My Mother

    Rusdi, Putra

    2017-01-01

    Project analisisMotherly Love in Edgar Allan Poe's “To My Mother” mengkaji unsur intrinsik dan konsep motherly love dalam puisi To My Motherkarya Edgar Allan Poe. Penulis menggunakan studi pustaka sebagai metode pengumpulan data dan informasi tentang objek penelitian melalui buku dan internet. Penulis menggunakan pendekatan psikologi sastra dengan teori cinta karya Erich Fromm untuk mengetahui cinta yang diberikan ibu kepada anak. Dari hasil analisis, penulis menemukan konsep cinta yang dibe...

  4. F-type centers in neutron-irradiated AIN

    Atobe, Kozo; Honda, Makoto; Fukuoka, Noboru; Okada, Moritami; Nakagawa, Masuo.

    1990-01-01

    The production of point defects by neutron irradiation and thermal decay in sintered AIN polycrystal are investigated. The absorption band at 370 nm is observed after reactor neutron irradiation to a dose of 10 16 n/cm 2 (E > 0.1 MeV). The defect corresponding to the band is tentatively assigned as an F-type center from the optical absorption and electron spin resonance. (author)

  5. Application of Allan Deviation to Assessing Uncertainties of Continuous-measurement Instruments, and Optimizing Calibration Schemes

    Jacobson, Gloria; Rella, Chris; Farinas, Alejandro

    2014-05-01

    Technological advancement of instrumentation in atmospheric and other geoscience disciplines over the past decade has lead to a shift from discrete sample analysis to continuous, in-situ monitoring. Standard error analysis used for discrete measurements is not sufficient to assess and compare the error contribution of noise and drift from continuous-measurement instruments, and a different statistical analysis approach should be applied. The Allan standard deviation analysis technique developed for atomic clock stability assessment by David W. Allan [1] can be effectively and gainfully applied to continuous measurement instruments. As an example, P. Werle et al has applied these techniques to look at signal averaging for atmospheric monitoring by Tunable Diode-Laser Absorption Spectroscopy (TDLAS) [2]. This presentation will build on, and translate prior foundational publications to provide contextual definitions and guidelines for the practical application of this analysis technique to continuous scientific measurements. The specific example of a Picarro G2401 Cavity Ringdown Spectroscopy (CRDS) analyzer used for continuous, atmospheric monitoring of CO2, CH4 and CO will be used to define the basics features the Allan deviation, assess factors affecting the analysis, and explore the time-series to Allan deviation plot translation for different types of instrument noise (white noise, linear drift, and interpolated data). In addition, the useful application of using an Allan deviation to optimize and predict the performance of different calibration schemes will be presented. Even though this presentation will use the specific example of the Picarro G2401 CRDS Analyzer for atmospheric monitoring, the objective is to present the information such that it can be successfully applied to other instrument sets and disciplines. [1] D.W. Allan, "Statistics of Atomic Frequency Standards," Proc, IEEE, vol. 54, pp 221-230, Feb 1966 [2] P. Werle, R. Miicke, F. Slemr, "The Limits

  6. Sissejuhatus suure kirjaniku loomingusse : Edgar Allan Poe' väändunud maailm / Aare Ermel

    Ermel, Aare, 1957-2013

    2001-01-01

    Prantsusmaa-Itaalia 1968.a. ühisfilm "Erakordsed lood" ("Histoires extraordinaires"), mis koosneb Edgar Allan Poe kolme novelli ekraniseeringutest : "Metzengerstein" (režissöör Roger Vadim), "William Wilson" (režissöör Louis Malle) ja "Toby Dammit" (režissöör Federico Fellini). Ka : Nädal nr. 25, lk. 14

  7. Looking at the "Next" 20 Years of Multiliteracies: A Discussion with Allan Luke

    Garcia, Antero; Luke, Allan; Seglem, Robyn

    2018-01-01

    In this discussion with literacies researcher Allan Luke, the New London Group Member reflects on the role of multiliteracies in shaping literacies research and the continuing changes to technology, capitalism, and learning. Focused on looking toward future advances in literacies research, Luke reflects on the role of multiliteracies in…

  8. Observation, Inference, and Imagination: Elements of Edgar Allan Poe's Philosophy of Science

    Gelfert, Axel

    2014-01-01

    Edgar Allan Poe's standing as a literary figure, who drew on (and sometimes dabbled in) the scientific debates of his time, makes him an intriguing character for any exploration of the historical interrelationship between science, literature and philosophy. His sprawling "prose-poem" "Eureka" (1848), in particular, has…

  9. Horror from the Soul--Gothic Style in Allan Poe's Horror Fictions

    Sun, Chunyan

    2015-01-01

    Edgar Allan Poe made tremendous contribution to horror fiction. Poe's inheritance of gothic fiction and American literature tradition combined with his living experience forms the background of his horror fictions. He inherited the tradition of the gothic fictions and made innovations on it, so as to penetrate to subconsciousness. Poe's horror…

  10. Where Were the Whistleblowers? The Case of Allan McDonald and Roger Boisjoly.

    Stewart, Lea P.

    Employees who "blow the whistle" on their company because they believe it is engaged in practices that are illegal, immoral, or harmful to the public, often face grave consequences for their actions, including demotion, harassment, forced resignation, or termination. The case of Allan McDonald and Roger Boisjoly, engineers who blew the…

  11. Playing on the Right Side of the Brain: An Interview with Allan N. Schore

    American Journal of Play, 2017

    2017-01-01

    Allan N. Schore has served on the clinical faculty of the Department of Psychiatry and Biobehavioral Sciences at UCLA's David Geffen School of Medicine since 1996 and has maintained a private clinical practice for more than four decades. He has contributed significant research to the disciplines of interpersonal neurobiology, affective…

  12. Intervjuu uue autoriga Kalifornias / Allan Kiisk ; küsitlenud Heino Jõgis

    Kiisk, Allan

    2008-01-01

    intervjuu aprilli lõpus trükist ilmunud raamatu "Simple Phonetic English Spelling : Introduction to Simpel-Fonetik, the Single-Sound-per-Letter Writing Method : A practical and proven solution to the spelling and pronunciation problems of the English language/ Tate Publishing & Enterprises, LLC (Mustang, Oklahoma USA 2008) autori Allan Kiisk'iga

  13. Autonomous estimation of Allan variance coefficients of onboard fiber optic gyro

    Song Ningfang; Yuan Rui; Jin Jing

    2011-01-01

    Satellite motion included in gyro output disturbs the estimation of Allan variance coefficients of fiber optic gyro on board. Moreover, as a standard method for noise analysis of fiber optic gyro, Allan variance has too large offline computational effort and data storages to be applied to online estimation. In addition, with the development of deep space exploration, it is urged that satellite requires more autonomy including autonomous fault diagnosis and reconfiguration. To overcome the barriers and meet satellite autonomy, we present a new autonomous method for estimation of Allan variance coefficients including rate ramp, rate random walk, bias instability, angular random walk and quantization noise coefficients. In the method, we calculate differences between angle increments of star sensor and gyro to remove satellite motion from gyro output, and propose a state-space model using nonlinear adaptive filter technique for quantities previously measured from offline data techniques such as the Allan variance method. Simulations show the method correctly estimates Allan variance coefficients, R = 2.7965exp-4 0 /h 2 , K = 1.1714exp-3 0 /h 1.5 , B = 1.3185exp-3 0 /h, N = 5.982exp-4 0 /h 0.5 and Q = 5.197exp-7 0 in real time, and tracks degradation of gyro performance from initail values, R = 0.651 0 /h 2 , K = 0.801 0 /h 1.5 , B = 0.385 0 /h, N = 0.0874 0 /h 0.5 and Q = 8.085exp-5 0 , to final estimations, R = 9.548 0 /h 2 , K = 9.524 0 /h 1.5 , B = 2.234 0 /h, N = 0.5594 0 /h 0.5 and Q = 5.113exp-4 0 , due to gamma radiation in space. The technique proposed here effectively isolates satellite motion, and requires no data storage and any supports from the ground.

  14. Aineüleste pädevuste koolitus Pestalozzi programmi raames / Tiia Pukk, Tiiu Vaher

    Pukk, Tiia

    2011-01-01

    1969 alguse saanud Pestalozzi koolitusprogramm on suunatud Euroopa kultuurikonventsiooniga ühinenud 49 riigi haridustöötajatele. Seekordne üritus toimus Tartus, koolituse teemaks aineülesed pädevused

  15. Tumedad ained kirjanduses ja päriselt / Mare Müürsepp

    Müürsepp, Mare

    2007-01-01

    Analüüsitud on Philip Pullmani triloogiasse "Tema tumedad ained" kuuluvaid romaane : Pullman, Philip. Kuldne kompass. Tallinn : Tiritamm, 2002; Pullman, Philip. Inglite torn. Tallinn : Tiritamm, 2004; Pullman, Philip. Vaigust kiiker. Tallinn : Tiritamm, 2005

  16. Application of electrical geophysics to the release of water resources, case of Ain Leuh (Morocco

    Zitouni A.

    2018-01-01

    In the present work, which concerns only the methodology of the electric resistivity, we treat the adopted methodological approach and the study of the case of application in the tray of Ajdir Ain Leuh.

  17. Ain Hanschmidt jättis küsijad vastuseta / Andrus Karnau

    Karnau, Andrus

    2005-01-01

    Ühispanga endise juhi Ain Hanschmidti 26. septembri pöördumine ei andnud vastuseid tema äritehingutega seoses esile kerkinud olulistele küsimustele: mille eest ta sai osalused laevakompaniis Tallink Grupp ja Haapsalu HRM-is. Lisa: Ain Hanschmidti argumendid. Küsimusele, kas Hanschmidti seletused olid piisavad vastavad Eesti Investorite Liidu juhatuse liige Heldur Meerits ja Sillamäe Soojuselektrijaama juhataja Väino Sarnet

  18. Dynamic Allan Variance Analysis Method with Time-Variant Window Length Based on Fuzzy Control

    Shanshan Gu

    2015-01-01

    Full Text Available To solve the problem that dynamic Allan variance (DAVAR with fixed length of window cannot meet the identification accuracy requirement of fiber optic gyro (FOG signal over all time domains, a dynamic Allan variance analysis method with time-variant window length based on fuzzy control is proposed. According to the characteristic of FOG signal, a fuzzy controller with the inputs of the first and second derivatives of FOG signal is designed to estimate the window length of the DAVAR. Then the Allan variances of the signals during the time-variant window are simulated to obtain the DAVAR of the FOG signal to describe the dynamic characteristic of the time-varying FOG signal. Additionally, a performance evaluation index of the algorithm based on radar chart is proposed. Experiment results show that, compared with different fixed window lengths DAVAR methods, the change of FOG signal with time can be identified effectively and the evaluation index of performance can be enhanced by 30% at least by the DAVAR method with time-variant window length based on fuzzy control.

  19. Autonomous estimation of Allan variance coefficients of onboard fiber optic gyro

    Song Ningfang; Yuan Rui; Jin Jing, E-mail: rayleing@139.com [School of Instrumentation Science and Opto-electronics Engineering, Beihang University, Beijing 100191 (China)

    2011-09-15

    Satellite motion included in gyro output disturbs the estimation of Allan variance coefficients of fiber optic gyro on board. Moreover, as a standard method for noise analysis of fiber optic gyro, Allan variance has too large offline computational effort and data storages to be applied to online estimation. In addition, with the development of deep space exploration, it is urged that satellite requires more autonomy including autonomous fault diagnosis and reconfiguration. To overcome the barriers and meet satellite autonomy, we present a new autonomous method for estimation of Allan variance coefficients including rate ramp, rate random walk, bias instability, angular random walk and quantization noise coefficients. In the method, we calculate differences between angle increments of star sensor and gyro to remove satellite motion from gyro output, and propose a state-space model using nonlinear adaptive filter technique for quantities previously measured from offline data techniques such as the Allan variance method. Simulations show the method correctly estimates Allan variance coefficients, R = 2.7965exp-4 {sup 0}/h{sup 2}, K = 1.1714exp-3 {sup 0}/h{sup 1.5}, B = 1.3185exp-3 {sup 0}/h, N = 5.982exp-4 {sup 0}/h{sup 0.5} and Q = 5.197exp-7 {sup 0} in real time, and tracks degradation of gyro performance from initail values, R = 0.651 {sup 0}/h{sup 2}, K = 0.801 {sup 0}/h{sup 1.5}, B = 0.385 {sup 0}/h, N = 0.0874 {sup 0}/h{sup 0.5} and Q = 8.085exp-5 {sup 0}, to final estimations, R = 9.548 {sup 0}/h{sup 2}, K = 9.524 {sup 0}/h{sup 1.5}, B = 2.234 {sup 0}/h, N = 0.5594 {sup 0}/h{sup 0.5} and Q = 5.113exp-4 {sup 0}, due to gamma radiation in space. The technique proposed here effectively isolates satellite motion, and requires no data storage and any supports from the ground.

  20. Oxidation behaviour of Ti2AIN films composed mainly of nanolaminated MAX phase.

    Wang, Q M; Garkas, W; Renteria, A Flores; Leyens, C; Kim, K H

    2011-10-01

    In this paper, we reported the oxidation behaviour of Ti2AIN films on polycrystalline Al2O3 substrates. The Ti2AIN films composed mainly of nanolaminated MAX phase was obtained by first depositing Ti-Al-N films using reactive sputtering of two elemental Ti and Al targets in Ar/N2 atmosphere and subsequent vacuum annealing at 800 degrees C for 1 h. The Ti2AIN films exhibited excellent oxidation resistance and thermal stability at 600-900 degrees C in air. Very low mass gain was observed. At low temperature (600 degrees C), no oxide crystals were observed on film surface. Blade-like Theta-Al2O3 fine crystals formed on film surfaces at 700-800 degrees C. At high temperature (900 degrees C), firstly Theta-Al2O3 formed on film surface and then transformed into alpha-Al2O3. At 700-900 degrees C, a continuous Al2O3 layer formed on Ti2AIN films surface, acting as diffusion barrier preventing further oxidation attack. The mechanism of the excellent oxidation resistance of Ti2AIN films was discussed based on the experimental results.

  1. Leaky surface acoustic waves in Z-LiNbO3 substrates with epitaxial AIN overlays

    Bu, G.; Ciplys, D.; Shur, M.S.; Namkoong, G.; Doolittle, W.A.; Hunt, W.D.

    2004-01-01

    The properties of leaky surface acoustic waves (LSAW) in MBE grown AIN layer on Z-cut LiNbO 3 structures have been studied by numerical simulation and experimental measurements and compared with those of Rayleigh waves in the same structure. In the range of AIN layer thicknesses studied (0 3 substrate was essentially constant at around 4400 m/s. The measured electromechanical coupling coefficients (K 2 ) for the LSAW are roughly 1/4 of the predicted values, which might be due to the strong attenuation of the leaky wave unaccounted for during the parameter extraction. The thin AIN film slightly improved the measured temperature coefficient of frequency for the LSAW over that attained for the Z-cut, X-propagating LiNbO 3 substrate alone

  2. Aine y riesgo cardiovascular: los menos posibles, a la menor dosis posible y durante el menor tiempo posible

    Ferrán Catalá-López

    2014-09-01

    Conclusiones: Existe poca evidencia para sugerir que alguno de los AINE estudiados es seguro en términos de riesgo cardiovascular. Naproxeno parece ser menos perjudicial que el resto. El riesgo cardiovascular asociado al uso de AINE debe ser tenido en cuenta en la prescripción de cualquiera de estos medicamentos.

  3. Kurja lilled / Charles Baudelaire ; prantsuse k. tlk. Ain Kaalep ja Märt Väljataga

    Baudelaire, Charles

    2000-01-01

    Sisu: Õnnistamine ; "Jumaldan Sind ma siin, öist taevavõlvi nägev / tlk. Ain Kaalep ; Palkon / tlk. Märt Väljataga ; Kodukäija ; Kassid / tlk. A. Kaalep ; Armastades valet / tlk. M. Väljataga ; Üksildase vein ; Päeva lõpp / tlk. Ain Kaalep. Orig.: Bénédiction ; "Je t'adore ̉ l'égal de la vo͠te nocturne ; Le balcon ; Les chats ; L'amour du mensonge ; Le vin du solitaire ; La fin de la journée

  4. [Exome sequencing revealed Allan-Herndon-Dudley syndrome underlying multiple disabilities].

    Arvio, Maria; Philips, Anju K; Ahvenainen, Minna; Somer, Mirja; Kalscheuer, Vera; Järvelä, Irma

    2014-01-01

    Normal function of the thyroid gland is the cornerstone of a child's mental development and physical growth. We describe a Finnish family, in which the diagnosis of three brothers became clear after investigations that lasted for more than 30 years. Two of the sons have already died. DNA analysis of the third one, a 16-year-old boy, revealed in exome sequencing of the complete X chromosome a mutation in the SLC16A2 gene, i.e. MCT8, coding for a thyroid hormone transport protein. Allan-Herndon-Dudley syndrome was thus shown to be the cause of multiple disabilities.

  5. Citizen journalism is as old as journalism itself: An interview with Stuart Allan

    Hajek, Roman; Stefanikova, Sandra; Allan, Stuart

    2014-01-01

    Professor Stuart Allan from Cardiff University in the UK is one of the leading scholars\\ud in contemporary journalism studies. He has made a significant contribution to the development\\ud of this research field, having authored or edited seventeen books to date (many\\ud of which have been translated into multiple languages), as well as a wide range of journal\\ud articles and book chapters. He is a co-founder of the peer-reviewed journal Journalism\\ud Education, and serves on the editorial boa...

  6. Lectotype designations of new species of hydroids (Cnidaria, Hydrozoa), described by C.M. Fraser, from Allan Hancock Pacific and Caribbean Sea Expeditions

    Calder, D.R.; Vervoort, W.; Hochberg, F.G.

    2009-01-01

    Hydroids of the Allan Hancock Pacific Expeditions, and those of the Allan Hancock Caribbean Sea Expedition, were examined by Charles McLean Fraser in a series of reports published between 1938 and 1948. A total of 159 new nominal species was described from material collected in the eastern Pacific

  7. GarcÍa Lorca luulest ja Ain Kaalepi tõlkest / Jüri Talvet

    Talvet, Jüri, 1945-

    1998-01-01

    Arvustus: GarcÍa Lorca, Federico. Mu kätes põleb tuli : valitud luuletused / tlk. ja saateks: Ain Kaalep. 2. tr. Tallinn : Vagabund, 1997. Ilmunud ka kogumikus: Talvet, Jüri. Tõrjumatu äär. Tartu : Ilmamaa, 2005, lk. 442-453

  8. HPV infection, anal intra-epithelial neoplasia (AIN and anal cancer: current issues

    Stanley Margaret A

    2012-09-01

    Full Text Available Abstract Background Human papillomavirus (HPV is well known as the major etiological agent for ano-genital cancer. In contrast to cervical cancer, anal cancer is uncommon, but is increasing steadily in the community over the last few decades. However, it has undergone an exponential rise in the men who have sex with men (MSM and HIV + groups. HIV + MSM in particular, have anal cancer incidences about three times that of the highest worldwide reported cervical cancer incidences. Discussion There has therefore traditionally been a lack of data from studies focused on heterosexual men and non-HIV + women. There is also less evidence reporting on the putative precursor lesion to anal cancer (AIN – anal intraepithelial neoplasia, when compared to cervical cancer and CIN (cervical intraepithelial neoplasia. This review summarises the available biological and epidemiological evidence for HPV in the anal site and the pathogenesis of AIN and anal cancer amongst traditionally non-high risk groups. Summary There is strong evidence to conclude that high-grade AIN is a precursor to anal cancer, and some data on the progression of AIN to invasive cancer.

  9. Ain't Gonna Study War No More? Explorations of War through Picture Books

    Crawford, Patricia A.; Roberts, Sherron Killingsworth

    2009-01-01

    At the height of the Vietnam War, Down by the Riverside was transformed from a traditional folk song to a popular anti-war anthem. The raucous and repetitive chorus, "I ain't gonna study war no more ...," became a rallying cry for those who wanted nothing to do with the war and the pain and controversy that surrounded it. Although it seems…

  10. Fabrication and performance of AIN insulator coatings for application in fusion reactor blankets

    Natesan, K.

    1995-09-01

    The liquid-metal blanket concept for fusion reactors requires an coating on the first-wall structural material to minimize the magnetohydrodynamic pressure drop that occurs during the flow of liquid metal in a magnetic field. Based on the thermodynamics of interactions betwen the coating and the liquid lithium on one side and the structural V-base alloy on the other side, an AIN coating was selected as a candidate. Detailed investigations were conducted on the fabrication, metallurgical microstructure, compatibility in liquid Li, and electrical characteristics of AIN material obtained from several sources. Lithium compatibility was studied in static systems by exposing AIN-coated specimens to liquid Li for several time periods. Electrical resistance was measured at room temperature on the specimens before and after exposure to liquid Li. The results obtained in this study indicate that AIN is a viable coating from the standpoint of chemical compatibility in Li, electrical insulation, and ease of fabrication; for these reasons, the coating should be examined further for fusion reactor applications

  11. New frameshift CF mutation 3729delAinsTCT in a Tunisian cystic

    Home; Journals; Journal of Genetics; Volume 92; Issue 1. New frameshift CF mutation 3729delAinsTCT in a Tunisian cystic fibrosis patient. Sondess Hadj Fredj Monia Boudaya Sabrine Oueslati Safa Sahnoun Chaima Sahli Hajer Siala Khedija Boussetta Amina Bibi Taieb Messaoud. Research Note Volume 92 Issue 1 April ...

  12. ISO sertifikaat kuulutab tootja mainet üle maailma / Ain Alvela

    Alvela, Ain, 1967-

    2006-01-01

    Ilmunud ka: Delovõje Vedomosti 12. apr. lk. 24-25. ISO standardi rakendamine tagab toodangu kvaliteedi ja annab firmale usaldusväärsuse. Kommenteerib Ain Noormägi. Vt. samas: ISO 9001; ISO 14 001; Universaalne standard kohandub ettevõtte vajadustega

  13. The Scientific Method Ain't What It Used to Be

    Herreid, Clyde Freeman

    2010-01-01

    Remember the time when all you had to do was memorize these five steps: ask a question, formulate a hypothesis, perform experiment, collect data, and draw conclusions? And you received full credit for defining the scientific method. Well, those days are gone. This article discusses why the "scientific method ain't what it used to be." (Contains 2…

  14. Further insights into the allan-herndon-dudley syndrome: Clinical and functional characterization of a novel MCT8 mutation

    Armour, C.M. (Christine M.); S. Kersseboom (Simone); Yoon, G. (Grace); T.J. Visser (Theo)

    2015-01-01

    textabstractBackground. Mutations in the thyroid hormone (TH) transporter MCT8 have been identified as the cause for Allan-Herndon-Dudley Syndrome (AHDS), characterized by severe psychomotor retardation and altered TH serum levels. Here we report a novel MCT8 mutation identified in 4 generations of

  15. Element distribution and noble gas isotopic abundances in lunar meteorite Allan Hills A81005

    Kraehenbuehl, U.; Eugster, O.; Niedermann, S.

    1986-01-01

    Antarctic meteorite ALLAN HILLS A81005, an anorthositic breccia, is recognized to be of lunar origin. The noble gases in this meteorite were analyzed and found to be solar-wind implanted gases, whose absolute and relative concentrations are quite similar to those in lunar regolith samples. A sample of this meteorite was obtained for the analysis of the noble gas isotopes, including Kr(81), and for the determination of the elemental abundances. In order to better determine the volume derived from the surface correlated gases, grain size fractions were prepared. The results of the instrumental measurements of the gamma radiation are listed. From the amounts of cosmic ray produced noble gases and respective production rates, the lunar surface residence times were calculated. It was concluded that the lunar surface time is about half a billion years

  16. Application of Fast Dynamic Allan Variance for the Characterization of FOGs-Based Measurement While Drilling.

    Wang, Lu; Zhang, Chunxi; Gao, Shuang; Wang, Tao; Lin, Tie; Li, Xianmu

    2016-12-07

    The stability of a fiber optic gyroscope (FOG) in measurement while drilling (MWD) could vary with time because of changing temperature, high vibration, and sudden power failure. The dynamic Allan variance (DAVAR) is a sliding version of the Allan variance. It is a practical tool that could represent the non-stationary behavior of the gyroscope signal. Since the normal DAVAR takes too long to deal with long time series, a fast DAVAR algorithm has been developed to accelerate the computation speed. However, both the normal DAVAR algorithm and the fast algorithm become invalid for discontinuous time series. What is worse, the FOG-based MWD underground often keeps working for several days; the gyro data collected aboveground is not only very time-consuming, but also sometimes discontinuous in the timeline. In this article, on the basis of the fast algorithm for DAVAR, we make a further advance in the fast algorithm (improved fast DAVAR) to extend the fast DAVAR to discontinuous time series. The improved fast DAVAR and the normal DAVAR are used to responsively characterize two sets of simulation data. The simulation results show that when the length of the time series is short, the improved fast DAVAR saves 78.93% of calculation time. When the length of the time series is long ( 6 × 10 5 samples), the improved fast DAVAR reduces calculation time by 97.09%. Another set of simulation data with missing data is characterized by the improved fast DAVAR. Its simulation results prove that the improved fast DAVAR could successfully deal with discontinuous data. In the end, a vibration experiment with FOGs-based MWD has been implemented to validate the good performance of the improved fast DAVAR. The results of the experience testify that the improved fast DAVAR not only shortens computation time, but could also analyze discontinuous time series.

  17. Application of Fast Dynamic Allan Variance for the Characterization of FOGs-Based Measurement While Drilling

    Lu Wang

    2016-12-01

    Full Text Available The stability of a fiber optic gyroscope (FOG in measurement while drilling (MWD could vary with time because of changing temperature, high vibration, and sudden power failure. The dynamic Allan variance (DAVAR is a sliding version of the Allan variance. It is a practical tool that could represent the non-stationary behavior of the gyroscope signal. Since the normal DAVAR takes too long to deal with long time series, a fast DAVAR algorithm has been developed to accelerate the computation speed. However, both the normal DAVAR algorithm and the fast algorithm become invalid for discontinuous time series. What is worse, the FOG-based MWD underground often keeps working for several days; the gyro data collected aboveground is not only very time-consuming, but also sometimes discontinuous in the timeline. In this article, on the basis of the fast algorithm for DAVAR, we make a further advance in the fast algorithm (improved fast DAVAR to extend the fast DAVAR to discontinuous time series. The improved fast DAVAR and the normal DAVAR are used to responsively characterize two sets of simulation data. The simulation results show that when the length of the time series is short, the improved fast DAVAR saves 78.93% of calculation time. When the length of the time series is long ( 6 × 10 5 samples, the improved fast DAVAR reduces calculation time by 97.09%. Another set of simulation data with missing data is characterized by the improved fast DAVAR. Its simulation results prove that the improved fast DAVAR could successfully deal with discontinuous data. In the end, a vibration experiment with FOGs-based MWD has been implemented to validate the good performance of the improved fast DAVAR. The results of the experience testify that the improved fast DAVAR not only shortens computation time, but could also analyze discontinuous time series.

  18. Pima Community College Planning Grant for Autonomous Intelligent Network of Systems (AINS) Science, Mathematics and Engineering Education Center

    2006-01-01

    .... The Center was to be funded by the Department of Defense, Office of Naval Research (ONR). The TDRI AINS Center's objectives were to advance ONR's technologies and to improve exposure and participation in science, math, and engineering (SME...

  19. Isotope hydrological investigation of Moghra and Ain El-Sharip environment, north western desert, Egypt

    Aly, A.I.M.; Nada, A.; Awad, M.; Salman, A.B.; Hamza, M.S.

    1991-01-01

    Groundwater samples collected from some localities in the vicinity of Moghra and Ain El-Sharip in the north western desert were subjected to chemical and to isotopic analyses. The combination of the hydrochemical data with the isotopic compositions of deuterium, oxygen-18 and tritium shows that the groundwater in this region represents a mixture of water recharged from different sources including : Nile, sea and paleo-waters.5 fig.,2 tab

  20. Valik arvamusi läbi aastate / Ain-Elmar Kaasik

    Kaasik, Ain-Elmar, 1934-

    2008-01-01

    Valik Eesti Teaduste Akadeemia Aastaraamatus rubriigis "Arvamusi akadeemikutelt" ilmunud kirjutisi, kus vabas vormis käsitletakse mitmesuguseid aktuaalseid küsimusi, eelkõige hariduse, teadustöö ning ühiskonna suhteid. Kokku on rubriigis avaldatud ligi kaks ja poolsada kirjutist. Siinse valiku autoriteks akadeemikud Raimund Hagelberg, Mart Saarma, Boris Tamm, Ene Ergma, Arvo Krikmann, Agu Laisk, Hans-Voldemar Trass, Harald Keres, Anto Raukas, Rein Küttner, Enn Tõugu, Raimund-Johannes Ubar, Ain-Elmar Kaasik

  1. T his article is m ainly about using sim ple trigonom etric identities ...

    T his article is m ainly about using sim ple trigonom etric identities and basic calculus to deduce som e new and interesting series. In particular, I use basic aspects of. G am m a and B eta integrations to deduce these series. T hese lead to interesting series for ¼ or functions of ¼ . O ne form ofbeta integration w hich is often ...

  2. COxSwAIN: Compressive Sensing for Advanced Imaging and Navigation

    Kurwitz, Richard; Pulley, Marina; LaFerney, Nathan; Munoz, Carlos

    2015-01-01

    The COxSwAIN project focuses on building an image and video compression scheme that can be implemented in a small or low-power satellite. To do this, we used Compressive Sensing, where the compression is performed by matrix multiplications on the satellite and reconstructed on the ground. Our paper explains our methodology and demonstrates the results of the scheme, being able to achieve high quality image compression that is robust to noise and corruption.

  3. Apostolate of the laity: a re-discovery of holistic post-war missiology in Scotland, with reference to the ministry of Tom Allan

    Forsyth, Alexander Craig

    2014-01-01

    This thesis offers principles for Christian mission in the present Western milieu derived from a retrieval of the missiology in post-war Scotland of Tom Allan. Allan was a minister, evangelist and theologian of particular public prominence in Scotland and beyond in the period from 1946 to 1964. His missiology focused upon the ‘apostolate of the laity’ through the ‘contextualisation’ of Christianity and Church. It was drawn from diverse, rich sources in Scottish and European theolo...

  4. Evaluating the Duration and Continuity of Potential Climate Records From the Allan Hills Blue Ice Area, East Antarctica

    Kehrl, Laura; Conway, Howard; Holschuh, Nicholas; Campbell, Seth; Kurbatov, Andrei V.; Spaulding, Nicole E.

    2018-05-01

    The current ice core record extends back 800,000 years. Geologic and glaciological evidence suggests that the Allan Hills Blue Ice Area, East Antarctica, may preserve a continuous record that extends further back in time. In this study, we use ice-penetrating radar and existing age constraints to map the internal stratigraphy and age structure of the Allan Hills Main Ice Field. The dated isochrones provide constraints for an ice flow model to estimate the age of ice near the bed. Previous drilling in the region recovered stratigraphically disturbed sections of ice up to 2.7 million years old. Our study identifies a site 5 km upstream, which likely preserves a continuous record through Marine Isotope Stage 11 with the possibility that the record extends back 1 million years. Such records would provide new insight into the past climate and glacial history of the Ross Sea Sector.

  5. On an Allan variance approach to classify VLBI radio-sources on the basis of their astrometric stability

    Gattano, C.; Lambert, S.; Bizouard, C.

    2017-12-01

    In the context of selecting sources defining the celestial reference frame, we compute astrometric time series of all VLBI radio-sources from observations in the International VLBI Service database. The time series are then analyzed with Allan variance in order to estimate the astrometric stability. From results, we establish a new classification that takes into account the whole multi-time scales information. The algorithm is flexible on the definition of ``stable source" through an adjustable threshold.

  6. Observation, Inference, and Imagination: Elements of Edgar Allan Poe's Philosophy of Science

    Gelfert, Axel

    2014-03-01

    Edgar Allan Poe's standing as a literary figure, who drew on (and sometimes dabbled in) the scientific debates of his time, makes him an intriguing character for any exploration of the historical interrelationship between science, literature and philosophy. His sprawling `prose-poem' Eureka (1848), in particular, has sometimes been scrutinized for anticipations of later scientific developments. By contrast, the present paper argues that it should be understood as a contribution to the raging debates about scientific methodology at the time. This methodological interest, which is echoed in Poe's `tales of ratiocination', gives rise to a proposed new mode of—broadly abductive—inference, which Poe attributes to the hybrid figure of the `poet-mathematician'. Without creative imagination and intuition, Science would necessarily remain incomplete, even by its own standards. This concern with imaginative (abductive) inference ties in nicely with his coherentism, which grants pride of place to the twin virtues of Simplicity and Consistency, which must constrain imagination lest it degenerate into mere fancy.

  7. The Allan Burns mummies: A history and future prospect of an anatomical collection

    J Lee

    2017-01-01

    Full Text Available Acquiring adequate resources for anatomy education has represented a challenge throughout the discipline's long history. A significant number of collections housed in anatomy departments contain human tissue of unknown provenance with some obtained in morally dubious ways. This paper outlines the history and future prospects of one such anatomical assemblage – the Burns Anatomical Collection, currently housed at the University of Maryland (UM. The collection originally contained more than 1000 anatomically prepared mummified human remains. They were produced by the renowned Scottish anatomist Allan Burns in Glasgow in the late eighteenth and early nineteenth centuries. The prepared cadavers became a commodity and after Burns' death, were acquired by his pupil Granville Pattison, who later sold them to the UM. While the origin of these human remains is unknown, historical data suggests that most of the cadavers for the collection were obtained through grave robbing. While intensely used in anatomy teaching in the nineteenth century, specimens from the collection should now be treated primarily as historical artifacts, appropriate only for teaching medical history and ethics. Other perspectives may include repatriating and reburying the human remains and providing a memorial service. Most importantly, this collection and others similar to it should initiate dialog and reflection on the ethical aspects of the past and present medical practice.

  8. Application of the Allan Variance to Time Series Analysis in Astrometry and Geodesy: A Review.

    Malkin, Zinovy

    2016-04-01

    The Allan variance (AVAR) was introduced 50 years ago as a statistical tool for assessing the frequency standards deviations. For the past decades, AVAR has increasingly been used in geodesy and astrometry to assess the noise characteristics in geodetic and astrometric time series. A specific feature of astrometric and geodetic measurements, as compared with clock measurements, is that they are generally associated with uncertainties; thus, an appropriate weighting should be applied during data analysis. In addition, some physically connected scalar time series naturally form series of multidimensional vectors. For example, three station coordinates time series X, Y, and Z can be combined to analyze 3-D station position variations. The classical AVAR is not intended for processing unevenly weighted and/or multidimensional data. Therefore, AVAR modifications, namely weighted AVAR (WAVAR), multidimensional AVAR (MAVAR), and weighted multidimensional AVAR (WMAVAR), were introduced to overcome these deficiencies. In this paper, a brief review is given of the experience of using AVAR and its modifications in processing astrogeodetic time series.

  9. Method and Madness: An Analysis of Edgar Allan Poe's “The Bells”

    U. Marie Engemann

    2017-11-01

    Full Text Available In this article, U. Marie Engemann has tried to indicate the method and internal cohesion of “The Bells”: a poem by Edgar Allan Poe, regardless of its apparent madness. This poem consists of four stanzas each of which is a symbol of a stage in the human's life for which a specific bell has been dedicated to. This poem follows trochaic meter in which the poet ingeniously has used catalexis in order to imitate the chime of bells. Throughout the poem, he has used different sound devices such as rhyme, sound patterning, alliteration, and onomatopoeia to create parallelism, and accordingly, he has conformed the chime of the bells to the dominant feature of each stage of life; thus, a meaningful cohesion has been created. This article can show how a poet may use different sound devices of his own language to create a parallelism between sound symbolism and meaning. The structure of the article has been changed a little by inserting the figures and the tables in the appendices into its straight text in translation so that it becomes easier for the readers to make a link between discussions and the data presented in each figure or table.

  10. Twenty-Five Years of Applications of the Modified Allan Variance in Telecommunications.

    Bregni, Stefano

    2016-04-01

    The Modified Allan Variance (MAVAR) was originally defined in 1981 for measuring frequency stability in precision oscillators. Due to its outstanding accuracy in discriminating power-law noise, it attracted significant interest among telecommunications engineers since the early 1990s, when it was approved as a standard measure in international standards, redressed as Time Variance (TVAR), for specifying the time stability of network synchronization signals and of equipment clocks. A dozen years later, the usage of MAVAR was also introduced for Internet traffic analysis to estimate self-similarity and long-range dependence. Further, in this field, it demonstrated superior accuracy and sensitivity, better than most popular tools already in use. This paper surveys the last 25 years of progress in extending the field of application of the MAVAR in telecommunications. First, the rationale and principles of the MAVAR are briefly summarized. Its adaptation as TVAR for specification of timing stability is presented. The usage of MAVAR/TVAR in telecommunications standards is reviewed. Examples of measurements on real telecommunications equipment clocks are presented, providing an overview on their actual performance in terms of MAVAR. Moreover, applications of MAVAR to network traffic analysis are surveyed. The superior accuracy of MAVAR in estimating long-range dependence is emphasized by highlighting some remarkable practical examples of real network traffic analysis.

  11. THE DEAD-LIVING-MOTHER: MARIE BONAPARTE'S INTERPRETATION OF EDGAR ALLAN POE'S SHORT STORIES.

    Obaid, Francisco Pizarro

    2016-06-01

    Princess Marie Bonaparte is an important figure in the history of psychoanalysis, remembered for her crucial role in arranging Freud's escape to safety in London from Nazi Vienna, in 1938. This paper connects us to Bonaparte's work on Poe's short stories. Founded on concepts of Freudian theory and an exhaustive review of the biographical facts, Marie Bonaparte concluded that the works of Edgar Allan Poe drew their most powerful inspirational force from the psychological consequences of the early death of the poet's mother. In Bonaparte's approach, which was powerfully influenced by her recognition of the impact of the death of her own mother when she was born-an understanding she gained in her analysis with Freud-the thesis of the dead-living-mother achieved the status of a paradigmatic key to analyze and understand Poe's literary legacy. This paper explores the background and support of this hypothesis and reviews Bonaparte's interpretation of Poe's most notable short stories, in which extraordinary female figures feature in the narrative.

  12. Dietary intake of ain-93 standard diet induces Fatty liver with altered hepatic fatty acid profile in Wistar rats.

    Farias Santos, Juliana; Suruagy Amaral, Monique; Lima Oliveira, Suzana; Porto Barbosa, Júnia; Rego Cabral, Cyro; Sofia Melo, Ingrid; Bezerra Bueno, Nassib; Duarte Freitas, Johnatan; Goulart Sant'ana, Antônio; Rocha Ataíde, Terezinha

    2015-05-01

    There are several standard diets for animals used in scientific research, usually conceived by scientific institutions. The AIN-93 diet is widely used, but there are some reports of fatty liver in Wistar rats fed this diet. We aimed to evaluate the hepatic repercussions of the AIN-93 diet intake in Wistar rats. Forty newly-weaned 21-day-old male Wistar rats were fed either the AIN-93 diet or a commercial diet for either 1 month or 4 months. Weight gain, serum biochemistry, hepatic histology, and hepatic fatty acid profile were analyzed. Hepatic steatosis was observed, especially in the group fed the AIN-93 diet. Serum blood glucose, absolute and relative liver weight and hepatic levels of oleic, palmitoleic, stearic, and palmitic fatty acids were related to the observed steatosis, while lipidogram and serum markers of liver function and injury were not. AIN-93 diet induced acute hepatic steatosis in Wistar rats, which may compromise its use as a standard diet for experimental studies with rodents. The hepatic fatty acid profile was associated with steatosis, with possible implications for disease prognosis. Copyright AULA MEDICA EDICIONES 2014. Published by AULA MEDICA. All rights reserved.

  13. Monsieur Philippe Galli Préfet de l’Ain France

    Maximilien Brice

    2011-01-01

    Photo 35: Le chef du département Physique P. Bloch, le porte-parole de la Collaboration CMS G. Tonelli,le Sous-Préfet de Gex O. Laurens-Bernard, le chef du département Technologie F. Bordry, le Péfet de l'Ain P. Galli et le Directeur-général R. Heuer. Photo 62: signature du livre d'or avec le Directeur de la recherche et de l'informatique S. Bertolucci.

  14. Pamidronato endovenoso en espondilitis anquilosante refractaria a antiinflamatorios no esteroideos (AINES y sulfasalazina

    Augusto García-Poma

    2007-03-01

    Full Text Available Objetivo: Evaluar la terapia con pamidronato, en pacientes con espondilitis anquilosante (EA activa, con respuesta subóptima o falla a los antiinflamatorios no-esteroideos (AINES y sulfasalazina. Diseño: Estudio clínico comparativo. Lugar: Hospital Nacional Edgardo Rebagliati Martins, EsSalud, Lima, Perú. Participantes: Pacientes con espondilitis anquilosante. Intervenciones. Se incluyó 9 pacientes con EA (6 varones, con enfermedad activa (BASDAI > o = 4, actividad axial y falta de respuesta a los Aines y sulfasalazina a dosis de 3g/d. Todos los pacientes recibieron 60 mg de pamidronato mensual, en infusión endovenosa, durante 6 meses, y continuaron tomando AINES y sulfasalazina. La mejoría clínica fue evaluada usando el ASAS 20. En forma secundaria se evaluó el ASAS 40, BASDAI 50, BASDAI, BASFI Y BASMI, a las 24 y 48 semanas (32 a 86 semanas. La diferencia entre el índice de pre y postratamiento fue evaluada usando la prueba de Wilcoxon. Principales medidas de resultados: Evaluación del ASAS 20. Resultados: El 67% alcanzó un Asas 20 a las 24 semanas y 78% a las 48 semanas; 33,3% y 55,6% tuvieron ASAS 40 y 33,3%; y 44,4% alcanzó BASDAI 50 a las 24 y 48 semanas, respectivamente. Un paciente recayó a la semana 20. Tres pacientes (33,3% permanecieron sin cambios. A las 24 y 48 semanas, la media de BASDAI disminuyó en 45,1% (p=0,007 y en 52,1% (p=0,01, la media de BASFI en 38,2% (p=0,007 y en 52,3% (p=0,007, y la media de BASMI en 39,2% (p=0,01 y 39,2% (p=0,01, respectivamente. Los eventos adversos no fueron importantes con esta terapia. Conclusiones: El tratamiento con pamidronato demostró ser efectivo en este grupo de pacientes con EA, refractaria a AINES y a sulfasalazina.

  15. Staff

    2006-01-01

    TÜ teadustöötajaist ja õppejõududest on 2/3 doktorikraadiga. TÜ rektor Jaak Aaviksoo ja teadusprprektor Ain Heinaru valiti Euroopa kõrghariduspoliitika juhtorganitesse. Sotsiaalteaduskonna prof. Wolfgang Drechsler sai Saksa-Eesti akadeemiliste suhete arendamise eest Saksamaa Liitvabariigi Teeneteristi

  16. Analysis of Urban Expansion of the Resort City of Al Ain Using Remote Sensing and GIS

    Issa, S.; Al Shuwaihi, A.

    2009-12-01

    The urban growth of AL Ain city has been investigated using remote sensing data for three different dates, 1972, 1990 and 2000. We used three Landsat images together with socio-economic data in a post-classification analysis to map the spatial dynamics of land use/cover changes and identify the urbanization process in Al Ain resort city, United Arab Emirates. Land use/cover statistics, extracted from Landsat Multi-spectral Scanner (MSS). Thematic Mapper (TM) and Enhanced Thematic Mapper plus (ETM +) images for 1972. 1990 and 2000 respectively, revealed that the built-up area has expanded by about 170.53km2. The city was found to have a tendency for major expansion in four different directions: along the Abu Dhabi highway, along Dubai highway, Myziad direction and Hafeet recreational area. Expansion in any direction was found to be governed by the availability of road network, suitability for construction, utilities, economic activities, geographical constraints, and legal factors (boundary with Sultanate of Oman). The road network in particular has influenced the spatial patterns and structure of urban development, so that the expansion of the built-up areas has assumed an accretive as well as linear growth along the major roads. The research concludes that the development is based on conservation of agricultural areas (oases) and reclamation of the desert for farming and agricultural activities. The integration of remote sensing and GIS was found to be effective in monitoring LULC changes and providing valuable information necessary for planning and research.

  17. Mida sina täna õppisid? / Veikko Täär, Ain Aaviksoo, Ingrid Tõniste ... [jt.

    2012-01-01

    Oma õppimistest ja tulevikuplaanidest räägivad näitleja ja ettevõtja Veikko Täär, tervishoiuteadlane Ain Aaviksoo, tegevjuht Ingrid Tõniste, TV3 avalike suhete juht ja uudisteankur Anneli Adermann, arenduskonsultant Anu Puusaag, personaaltreener Katrin Pärt ja loodusarst Tiina Keldrima

  18. Teaduskeskus Ahhaa = Ahhaa Science Centre / Vilen Künnapu, Ain Padrik, Malle Jürgenson, Tea Tammelaan ; intervjueerinud Margit Mutso

    2012-01-01

    Tartus Sadama 1 auva Ahhaa teaduskeskuse arhitektuurist ja sisearhitektuurist. Arhitektid: Ain Padrik ja Vilen Künnapu, kaasa töötasid Kristjan Tõlk, Kristiin Keernik, Siim Tuksam, Hannes Tilk (Künnapu & Padrik). Sisearhitektid: Tea Tammelaan, Krista Lepland ja Malle Jürgenson (Laika, Belka & Strelka). Infograafika: Alar Pikkorainen

  19. An activity-based cost analysis of the Honduras community-based, integrated child care (AIN-C) programme.

    Fiedler, John L; Villalobos, Carlos A; De Mattos, Annette C

    2008-11-01

    The Honduras AIN-C programme is a preventive health and nutrition programme of the Honduras Ministry of Health (MOH) that relies on volunteers to help mothers monitor and maintain the adequate growth of young children. A quasi-experimental, design-based evaluation found that the programme achieved near-universal coverage and was effective in improving mothers' child-rearing knowledge, attitudes and practices, including feeding and appropriate care-giving and care-seeking practices for children with diarrhoea and acute respiratory illness. The programme is widely regarded as a model. This study was undertaken to provide the first comprehensive estimates of the cost of the AIN-C programme, with the goal of providing a programme and financial planning tool for Honduras. An additional comparison of study findings was also undertaken to determine the cost of the AIN-C programme's community-based services relative to a similar facility-based service. Expressed in mid-2005 US dollars, the study found that after the programme is phased-in: (1) the annual, recurrent cost per child under 2 years participating in the programme is $6.43; (2) the annual, incremental budget requirements per child under 2 years participating in the programme are $3.90; (3) the cost of an AIN-C monthly growth monitoring and counselling session per child is 11% of the cost of a traditional MOH, facility-based growth and development consultation per child; and (4) the effect of mothers substituting AIN-C monitor care for MOH facility-based care 'saves' 203 000 outpatient visits a year, with a potential cost saving of $1.66 million, the equivalent of 60% of the recurrent cost of the programme and roughly equal to the annual incremental budget requirements of the programme. Sensitivity analysis of the cost estimates is performed to provide insight, for countries considering introducing a similar programme, into how modifications of key characteristics of the programme affect its costs.

  20. Management of toxic cyanobacteria for drinking water production of Ain Zada Dam.

    Saoudi, Amel; Brient, Luc; Boucetta, Sabrine; Ouzrout, Rachid; Bormans, Myriam; Bensouilah, Mourad

    2017-07-01

    Blooms of toxic cyanobacteria in Algerian reservoirs represent a potential health problem, mainly from drinking water that supplies the local population of Ain Zada (Bordj Bou Arreridj). The objective of this study is to monitor, detect, and identify the existence of cyanobacteria and microcystins during blooming times. Samples were taken in 2013 from eight stations. The results show that three potentially toxic cyanobacterial genera with the species Planktothrix agardhii were dominant. Cyanobacterial biomass, phycocyanin (PC) concentrations, and microcystin (MC) concentrations were high in the surface layer and at 14 m depth; these values were also high in the treated water. On 11 May 2013, MC concentrations were 6.3 μg/L in MC-LR equivalent in the drinking water. This study shows for the first time the presence of cyanotoxins in raw and treated waters, highlighting that regular monitoring of cyanobacteria and cyanotoxins must be undertaken to avoid potential health problems.

  1. Application of electrical geophysics to the release of water resources, case of Ain Leuh (Morocco)

    Zitouni, A.; Boukdir, A.; El Fjiji, H.; Baite, W.; Ekouele Mbaki, V. R.; Ben Said, H.; Echakraoui, Z.; Elissami, A.; El Maslouhi, M. R.

    2018-05-01

    Being seen needs in increasing waters in our contry for fine domestics, manufactures and agricultural, the prospecting of subterranean waters by geologic and hydrogeologic classic method remains inaplicable in the cases of the regions where one does not arrange drillings or polls (soundings) of gratitude (recongnition) in very sufficient (self-important) number. In that case of figure, the method of prospecting geophysics such as the method of nuclear magnetic resonance (NMR) and the method of the geophysics radar are usually used most usually because they showed, worldwide, results very desive in the projects of prospecting and evaluation of the resources in subterranean waters. In the present work, which concerns only the methodology of the electric resistivity, we treat the adopted methodological approach and the study of the case of application in the tray of Ajdir Ain Leuh.

  2. TEM and XANES study of MOVPE grown InAIN layers with different indium content

    Kret, S; Wolska, A; Klepka, M T; Letrouit, A; Ivaldi, F; Szczepańska, A; Carlin, J-F; Kaufmann, N A K; Grandjean, N

    2011-01-01

    We present structure and spatially resolved composition studies by TEM (Transmission Electron Microscopy) and XANES (X-ray Absorption Near Edge Structure) of InAIN MOVPE (Metal-Organic Vapor Phase Epitaxy) epilayers containing 16-27 at% of indium. Investigations of the In L 3 edge by synchrotron radiation absorption show a significant change of the post-edge structure depending on the indium content. We attribute this to the solubility limit and phase separation in this system. Our measurements suggest that the critical composition is 18% for our growth conditions. HRTEM cross-sectional and EDX investigations confirm such phase separation as well as the changing of the structure from 2D growth to columnar like growth for the sample with the highest indium content.

  3. Evaluation of the clinical maxim: "If it ain't broke, don't fix it".

    Howell-Duffy, Chris; Hrynchak, Patricia K; Irving, Elizabeth L; Mouat, Graham S V; Elliott, David B

    2012-01-01

    A significant number of patients return to optometric practice dissatisfied with their spectacles. An important question is whether any of these cases are preventable. There are several different clinical maxims that are used to modify the subjective refraction when determining the refractive prescription. These maxims aim to improve patient comfort and adaptation and thereby reduce patient dissatisfaction with new spectacles. They are not based on research evidence, but rather on expert opinion gained from clinical experience. The aim of this study was to retrospectively analyze a large number of case records of dissatisfied patients to assess the possible usefulness of the prescribing maxim "if it ain't broke, don't fix it." Three hundred eighteen non-tolerance cases from a university-based Canadian optometric clinic were categorized by a focus group of optometrists. Three prescribing categories were defined and comprised cases in which application of the proposed maxim may have prevented the recheck eye examination; a more limited application of the maxim for one working distance may have been appropriate; and finally scenarios in which the maxim did not work in that the practitioner was judged to have initially followed the maxim, yet patient dissatisfaction was still reported. The remaining unallocated records comprised prescribing situations outside the scope of this study. Approximately 32% of non-tolerance cases were judged to have been preventable by use of the proposed maxim. Furthermore, an additional 10% reduction in recheck cases may have been possible by a more liberal interpretation of the maxim. Conversely, 4% of cases were deemed to comprise scenarios in which the maxim was followed yet the patient returned later to report problems with their spectacles. The prescribing maxim "if it ain't broke, don't fix it" appears to have a role in reducing recheck eye examinations and improving patient satisfaction with new spectacles.

  4. Clues on Past Climatic Environments and Subsurface Flow in Mars from Aqueous Alteration Minerals Found in Nakhla and Allan Hills 84001 Meteorites

    Trigo-Rodriguez, J. M.; Moyano-Cambero, C. E.; Donoso, J. A.; Benito-Moreno, M. I.; Alonso-Azcárate, J.

    2018-04-01

    The study of aqueous alteration minerals like Fe-Mg-Ca carbonates in Allan Hills 84001 or iddingsite and magnetite in Nakhla meteorite allow us to constrain their formation conditions and water availability at 4 and 1.3 Ga ago, respectively.

  5. Soomes kolleeg, Eestis kollanokk / Fogel, Kristina; Tilk, Piret; Pärgmäe, Pille; Kiivet, Raul-Allan ; intervjueerija Krister Kivi

    2004-01-01

    Tartu Ülikooli arstiteaduskonna üliõpilased põhjendavad, miks nad ei soovi Eestis residentuuri astuda, vaid hoopis Soome tööle lähevad. Residentuurisüsteemi prodekaan professor Raul-Allan Kivet selgitab, miks noored arstid peavad pärast ülikooli lõpetamist mitmeid aastaid pisikese palga eest praktiseerima

  6. O que o cinema aprendeu com Edgar Allan Poe: (e o que a literatura ainda aprende com o cinema

    Gerbase, Carlos

    2009-01-01

    Full Text Available Edgar Allan Poe é um dos autores mais adaptados pelo cinema em todos os tempos. Há quase 200 filmes baseados ou inspirados em obras de Poe. Este ensaio analisa os motivos da fascinação que Poe exerce sobre o mundo do cinema, a partir de um ensaio do realizador e teórico Jean Epstein, publicado em 1921, e de reflexões mais recentes de Umberto Eco sobre traduções e adaptações. As semelhanças e diferenças entre as linguagens literária e cinematográfica também são abordadas, na perspectiva pragmática do processo de realização

  7. Antiinflamatorios no esteroideos (AINES.: Consideraciones para su uso estomatológico

    Andrés A. Pérez Ruiz

    2002-08-01

    Full Text Available Se realiza una revisión extensa y actualizada sobre los antiinflamatorios no esteroideos (AINEs, con el fin de actualizar al estomatólogo en su uso. Para ello se revisan aspectos importantes del proceso inflamatorio en estructuras de la boca que como las pulpitis, presentan sus peculiaridades. Se identifica a una de las 2 familias de autacoides provenientes de los fosfolípidos de membrana celular, es decir, los eicosanoides derivados a partir de algunos ácidos grasos polisaturados, en particular, ácido araquidónico, que tras la acción de enzimas da lugar a la formación de prostaglandinas, prostaciclinas, tromboxeno A2 y leucotrienos. Conocidos estos antecedentes, nos ocupamos de fármacos usados para combatir los síntomas y signos de la inflamación. Casi todos los antiinflamatorios no esteroideos utilizados en la actualidad, casi todos, inhiben las actividades de la ciclooxigenasa 1 constitutiva y la ciclooxigenasa 2, inducida en el sitio de la inflamación y con ello, la síntesis de prostaglandinas y tromboxanos. Se alude a la ventaja terapéutica de los inhibidores de la COX-2 que aparecen hoy en el mercado. Se expone las dosis y frecuencias de los AINEs, sus interacciones, así como las reacciones adversas al medicamento y contraindicaciones, y se proponen aquellos que son de interés en la práctica estomatológica.Non-steroidal anti-inflammatory drugs. Considerations about their dental use. An extensive updated review of non-steroidal anti-inflammatory agents (NSAIN was made to give an updated information to the dentist about their use. To this purpose, important aspects of the inflammatory process in mouth structures like pulpitis that present with their own peculiarities are reviewed. We identified one of the two autacoid families from cell membrane phospholipids, that is, eicosanoids derived from some polysaturated fatty acids, in particular, arachidonic acid, which, after the action of enzymes, give rise to the formation of

  8. Pediatric and youth traffic-collision injuries in Al Ain, United Arab Emirates: a prospective study.

    Michal Grivna

    Full Text Available AIM: To study the mechanism of road traffic collisions (RTC, use of safety devices, and outcome of hospitalized pediatric and youth RTC injured patients so as to give recommendations regarding prevention of pediatric RTC injuries. METHODS: All RTC injured children and youth (0-19-year-olds who were admitted to Al Ain City's two major trauma centers or who died after arrival to these centers were prospectively studied from April 2006 to October 2007. Demography of patients, road-user and vehicle types, crash mechanism, usage of safety devices, injured body regions, injury severity, Revised Trauma Score, Glasgow Coma Scale, intensive care unit admissions, hospital stay and mortality were analyzed. RESULTS: 245 patients were studied, 69% were vehicle occupants, 15% pedestrians, 9% motorcyclists and 5% bicyclists. 79% were males and 67% UAE citizens. The most common mechanism of RTC was rollover of vehicle (37% followed by front impact collision (32%. 32 (13% of vehicle occupants were ejected from car. 63% of ejected occupants and 70% of motorcyclists sustained head injuries. Only 2% (3/170 vehicle passengers used seatbelts and 13% (3/23 motorcyclists a helmet. CONCLUSIONS: Male drivers and UAE nationals were at high risk of RTC as drivers and as motorcyclists. Ejection rate was high because safety restraint use was extremely low in our community. More education and law enforcement focusing especially on car/booster seat use is needed.

  9. Water-rock interaction and geochemistry of groundwater from the Ain Azel aquifer, Algeria.

    Belkhiri, Lazhar; Mouni, Lotfi; Tiri, Ammar

    2012-02-01

    Hydrochemical, multivariate statistical, and inverse geochemical modeling techniques were used to investigate the hydrochemical evolution within the Ain Azel aquifer, Algeria. Cluster analysis based on major ion contents defined 3 main chemical water types, reflecting different hydrochemical processes. The first group water, group 1, has low salinity (mean EC = 735 μS/cm). The second group waters are classified as Cl-HCO(3)-alkaline earth type. The third group is made up of water samples, the cation composition of which is dominated by Ca and Mg with anion composition varying from dominantly Cl to dominantly HCO(3) plus SO(4). The varifactors obtained from R-mode FA indicate that the parameters responsible for groundwater quality variations are mainly related to the presence and dissolution of some carbonate, silicate, and evaporite minerals in the aquifer. Inverse geochemical modeling along groundwater flow paths indicates the dominant processes are the consumption of CO(2), the dissolution of dolomite, gypsum, and halite, along with the precipitation of calcite, Ca-montmorillonite, illite, kaolinite, and quartz. © Springer Science+Business Media B.V. 2011

  10. Pediatric and youth traffic-collision injuries in Al Ain, United Arab Emirates: a prospective study.

    Grivna, Michal; Eid, Hani O; Abu-Zidan, Fikri M

    2013-01-01

    To study the mechanism of road traffic collisions (RTC), use of safety devices, and outcome of hospitalized pediatric and youth RTC injured patients so as to give recommendations regarding prevention of pediatric RTC injuries. All RTC injured children and youth (0-19-year-olds) who were admitted to Al Ain City's two major trauma centers or who died after arrival to these centers were prospectively studied from April 2006 to October 2007. Demography of patients, road-user and vehicle types, crash mechanism, usage of safety devices, injured body regions, injury severity, Revised Trauma Score, Glasgow Coma Scale, intensive care unit admissions, hospital stay and mortality were analyzed. 245 patients were studied, 69% were vehicle occupants, 15% pedestrians, 9% motorcyclists and 5% bicyclists. 79% were males and 67% UAE citizens. The most common mechanism of RTC was rollover of vehicle (37%) followed by front impact collision (32%). 32 (13%) of vehicle occupants were ejected from car. 63% of ejected occupants and 70% of motorcyclists sustained head injuries. Only 2% (3/170) vehicle passengers used seatbelts and 13% (3/23) motorcyclists a helmet. Male drivers and UAE nationals were at high risk of RTC as drivers and as motorcyclists. Ejection rate was high because safety restraint use was extremely low in our community. More education and law enforcement focusing especially on car/booster seat use is needed.

  11. Vitamin D deficiency among healthy adolescents in Al Ain, United Arab Emirates

    2013-01-01

    Background Although vitamin D deficiency has been studied in various adult populations, there are few data on the prevalence of this nutritional deficiency among healthy adolescents in the United Arab Emirates (UAE). This study was conducted to determine the prevalence of vitamin D deficiency and to examine its correlates in adolescents aged 15 to 18 years. Methods This was a cross-sectional study in urban schools. Healthy adolescents (N=315) from a sample of 8 schools were randomly selected from the 142 schools in Al Ain, Abu Dhabi Emirate. Outcomes measured included serum concentrations of 25-hydroxy vitamin D (25OHD), plasma lipids, blood sugar, blood pressure and anthropometric data, nutrition and lifestyle variables. Results Fourty-one participants (19.7%) were vitamin D deficient (serum 25OHD level ≤15 ng/mL [≤37.5 nmol/L]. Using a cutoff level of 25(OH) D of ≤20 ng/ml [≤50 nmol/l] 143 participants (45.4%) were vitamin D insufficient. Overall 65.1% of study participants were either vitamin D deficient or insufficient. The prevalence of vitamin D deficiency varied between boys (10%) and girls (28%). In a final multivariate model, serum 25(OH) D concentrations were inversely correlated with female gender, consumption of fast food per week, and body mass index and positively correlated with physical activity scores after adjustment for age. Conclusions Vitamin D deficiency and insufficiency were highly prevalent in adolescents, and more common in girls. PMID:23311702

  12. Climate change and their consequences on coastal zone of Ain el Turck in Oran

    Mohammed Tewfik Bouroumi

    2017-12-01

    Full Text Available Algeria does not escape the problem of the climate change, its geographical position in zone of transition, and its dry and semi-arid climate, in fact a very vulnerable space. In Algeria, approximately two thirds of the population is concentrated on the coast which represents only 4 % of the territory. The Mediterranean coast, in particular in Algeria, is subjected to pressures: financial stakes, climatic risks, pollutions and conservation of the water. It is on the basis of the critical and objective report with regard to a wild urbanization of the Algerian coast as well as the influence of the demographic pressure that the choice of the search for this article was held. This publication has for objective to raise (to draw up a current situation (inventory of fixtures of the sector of the environment in Algeria and to present through the case of the coastal city of Oran the consequences of climate change. We propose, to review the situation through the case of the municipality of Ain El Türck, by basing itself on data relative to the evolution of the temperatures and the sea level.

  13. Deformation history of the Neoproterozoic basement complex, Ain Shams area, Western Arabian Shield, Saudi Arabia

    El-Fakharani, Abdelhamid; Hamimi, Zakaria

    2013-04-01

    Ain Shams area, Western Arabian Shield, Saudi Arabia, is occupied by four main rock units; gneisses, metavolcanics, metasediments and syn- to post-tectonic granitoids. Field and structural studies reveal that the area was subjected to at least three phases of deformation (D1, D2 and D3). The structural features of the D1 are represented by tight to isoclinal and intrafolial folds (F1), axial plane foliation (S1) and stretching lineations (L1). This phase is believed to be resulted from an early NW-SE contractional phase due to the amalgamation between Asir and Jeddah tectonic terranes. D2 deformation phase progressively overprinted D1 structures and was dominated by thrusts, minor and major F2 thrust-related overturned folds. These structures indicate a top-to-the-NW movement direction and compressional regime during the D2 phase. Emplacement of the syn-tectonic granitoids is likely to have occurred during this phase. D3 structures are manifested F3 folds, which are open with steep to subvertical axial planes and axes moderately to steeply plunging towards the E, ENE and ESE directions, L3 is represented by crenulation lineations and kink bands. These structures attest NE-SW contractional phase, concurrent with the accretion of the Arabian-Nubian Shield (ANS) to the Saharan Metacraton (SM) and the final assembly between the continental blocks of East and West Gondwana.

  14. A retrospective review of the Honduras AIN-C program guided by a community health worker performance logic model.

    Rodríguez, Daniela C; Peterson, Lauren A

    2016-05-06

    Factors that influence performance of community health workers (CHWs) delivering health services are not well understood. A recent logic model proposed categories of support from both health sector and communities that influence CHW performance and program outcomes. This logic model has been used to review a growth monitoring program delivered by CHWs in Honduras, known as Atención Integral a la Niñez en la Comunidad (AIN-C). A retrospective review of AIN-C was conducted through a document desk review and supplemented with in-depth interviews. Documents were systematically coded using the categories from the logic model, and gaps were addressed through interviews. Authors reviewed coded data for each category to analyze program details and outcomes as well as identify potential issues and gaps in the logic model. Categories from the logic model were inconsistently represented, with more information available for health sector than community. Context and input activities were not well documented. Information on health sector systems-level activities was available for governance but limited for other categories, while not much was found for community systems-level activities. Most available information focused on program-level activities with substantial data on technical support. Output, outcome, and impact data were drawn from various resources and suggest mixed results of AIN-C on indicators of interest. Assessing CHW performance through a desk review left gaps that could not be addressed about the relationship of activities and performance. There were critical characteristics of program design that made it contextually appropriate; however, it was difficult to identify clear links between AIN-C and malnutrition indicators. Regarding the logic model, several categories were too broad (e.g., technical support, context) and some aspects of AIN-C did not fit neatly in logic model categories (e.g., political commitment, equity, flexibility in implementation). The

  15. Hääletades läbi Eesti : ehk intervjuu kahe noorega, kelle jaoks loodus on sõber ja hääletamine nauding / Tea Jänes, Allan Kahar ; küsitlenud Merje Pors

    Jänes, Tea

    2007-01-01

    Intervjuu tudengite igasuvise hääletusvõistluse "Kas tunned maad VII" kolmanda koha omanikega Tartu Ülikooli keskkonnatehnoloogia magistrandi Tea Jänese ja Luua Metsanduskoolis loodusretkede juhi ametit õppiva Allan Kahariga

  16. Identidade e Fronteiras do espiritismo na obra de Allan Kardec (Identity and Boundaries of Spiritism in the Allan Kardec’s works - DOI: 10.5752/P.2175-5841.2010v8n16p117

    Augusto César Dias de Araujo

    2010-09-01

    Full Text Available Este artigo é uma reflexão sobre o processo de formação identitária do espiritismo a partir da análise de seu discurso fundador presente na obra de Allan Kardec (1804-1869. Para cumprir este objetivo, trabalhar-se-á com a hipótese de que tal processo acontece a partir de uma peculiar interação do espiritismo com três instâncias de conhecimento: a ciência, a filosofia e a religião. Através da análise do exemplo específico de como o espiritismo interpreta elementos da tradição cristã-católica, dando-lhes um significado renovado, pretende-se demonstrar que neste jogo, o conceito de espiritismo se configura como um conceito híbrido, de caráter polissêmico, o qual aponta para o fato de que a nova doutrina e o movimento articulado em seu entorno nascem sob o signo da mediação. Tais reflexões indicariam que, ao fazerem referência à obra de Kardec como núcleo imaginário de identificação doutrinária, grupos das diversas tendências dentro do espiritismo contemporâneo podem encontrar relativas zonas de conforto para seu progressivo desenvolvimento. Palavras-chave: Espiritismo; Ciência; Filosofia; Religião; Fronteiras. Abstract This paper is a reflection about the identity formation process of spiritism from analysis of its founding speech present in Allan Kardec's work (1804-1869. To fulfill this aim, one will work with the hypothesis of that such process happens from a peculiar interaction of the spiritism with three instances of knowledge: the science, the philosophy and the religion. Through the analysis of the specific example of as the spiritism interprets elements of the Christian-catholic tradition, giving to them one renewed meaning, is intended to demonstrate that in this game, the spiritism concept if configures as a hybrid concept, of polissemic character, which points with respect to the fact of that the new doctrine and the movement articulated in its around are born under the sign of the mediation. Such

  17. Further Insights into the Allan-Herndon-Dudley Syndrome: Clinical and Functional Characterization of a Novel MCT8 Mutation.

    Armour, Christine M; Kersseboom, Simone; Yoon, Grace; Visser, Theo J

    2015-01-01

    Mutations in the thyroid hormone (TH) transporter MCT8 have been identified as the cause for Allan-Herndon-Dudley Syndrome (AHDS), characterized by severe psychomotor retardation and altered TH serum levels. Here we report a novel MCT8 mutation identified in 4 generations of one family, and its functional characterization. Proband and family members were screened for 60 genes involved in X-linked cognitive impairment and the MCT8 mutation was confirmed. Functional consequences of MCT8 mutations were studied by analysis of [125I]TH transport in fibroblasts and transiently transfected JEG3 and COS1 cells, and by subcellular localization of the transporter. The proband and a male cousin demonstrated clinical findings characteristic of AHDS. Serum analysis showed high T3, low rT3, and normal T4 and TSH levels in the proband. A MCT8 mutation (c.869C>T; p.S290F) was identified in the proband, his cousin, and several female carriers. Functional analysis of the S290F mutant showed decreased TH transport, metabolism and protein expression in the three cell types, whereas the S290A mutation had no effect. Interestingly, both uptake and efflux of T3 and T4 was impaired in fibroblasts of the proband, compared to his healthy brother. However, no effect of the S290F mutation was observed on TH efflux from COS1 and JEG3 cells. Immunocytochemistry showed plasma membrane localization of wild-type MCT8 and the S290A and S290F mutants in JEG3 cells. We describe a novel MCT8 mutation (S290F) in 4 generations of a family with Allan-Herndon-Dudley Syndrome. Functional analysis demonstrates loss-of-function of the MCT8 transporter. Furthermore, our results indicate that the function of the S290F mutant is dependent on cell context. Comparison of the S290F and S290A mutants indicates that it is not the loss of Ser but its substitution with Phe, which leads to S290F dysfunction.

  18. Further Insights into the Allan-Herndon-Dudley Syndrome: Clinical and Functional Characterization of a Novel MCT8 Mutation.

    Christine M Armour

    Full Text Available Mutations in the thyroid hormone (TH transporter MCT8 have been identified as the cause for Allan-Herndon-Dudley Syndrome (AHDS, characterized by severe psychomotor retardation and altered TH serum levels. Here we report a novel MCT8 mutation identified in 4 generations of one family, and its functional characterization.Proband and family members were screened for 60 genes involved in X-linked cognitive impairment and the MCT8 mutation was confirmed. Functional consequences of MCT8 mutations were studied by analysis of [125I]TH transport in fibroblasts and transiently transfected JEG3 and COS1 cells, and by subcellular localization of the transporter.The proband and a male cousin demonstrated clinical findings characteristic of AHDS. Serum analysis showed high T3, low rT3, and normal T4 and TSH levels in the proband. A MCT8 mutation (c.869C>T; p.S290F was identified in the proband, his cousin, and several female carriers. Functional analysis of the S290F mutant showed decreased TH transport, metabolism and protein expression in the three cell types, whereas the S290A mutation had no effect. Interestingly, both uptake and efflux of T3 and T4 was impaired in fibroblasts of the proband, compared to his healthy brother. However, no effect of the S290F mutation was observed on TH efflux from COS1 and JEG3 cells. Immunocytochemistry showed plasma membrane localization of wild-type MCT8 and the S290A and S290F mutants in JEG3 cells.We describe a novel MCT8 mutation (S290F in 4 generations of a family with Allan-Herndon-Dudley Syndrome. Functional analysis demonstrates loss-of-function of the MCT8 transporter. Furthermore, our results indicate that the function of the S290F mutant is dependent on cell context. Comparison of the S290F and S290A mutants indicates that it is not the loss of Ser but its substitution with Phe, which leads to S290F dysfunction.

  19. Associations of cardiovascular risk factors in Al Ain- United Arab Emirates

    Baynouna, Latifa M; Revel, Anthony D; Nagelkerke, Nico JD; Jaber, Tariq M; Omar, Aziza O; Ahmed, Nader M; Nazirudeen, Mohammad K; Al Sayed, Mamdouh F; Nour, Fuad A; Abdouni, Sameh

    2009-01-01

    Background Over the last 30 years the citizens of the United Arab Emirates have experienced major changes in life-style secondary to increased affluence. Currently, 1 in 5 adults have diabetes mellitus, but the associations (clustering) among risk factors, as well as the relevance of the concept of the metabolic syndrome, in this population is unknown. Aim To investigate the prevalence and associations among cardiovascular risk factors in this population, and explore to what extent associations can be explained by the metabolic syndrome according to ATP-III criteria. Method A community based survey, of conventional risk factors for cardiovascular disease was conducted among 817 national residents of Al Ain city, UAE. These factors were fasting blood sugar, blood pressure, lipid profile, BMI, waist circumference, smoking, or CHD family history. Odds ratios between risks factors, both unadjusted and adjusted for age and sex as well as adjusted for age, sex, and metabolic syndrome were calculated. Results Various risk factors were positively associated in this population; associations that are mostly unexplained by confounding by age and sex. For example, hypertension and diabetes were still strongly related (OR 2.5; 95% CI 1.7–3.7) after adjustment. An increased waist circumference showed similar relationship with hypertension (OR 2.3; 95% CI 1.5–3.5). Diabetes was related to an increased BMI (OR 1.5; 96% CI 1.0–2.3). Smoking was also associated with diabetes (OR 1.9, 95% CI 1.0–3.3). Further adjustment for metabolic syndrome reduced some associations but several remained. Conclusion In this population risk-factors cluster, but associations do not appear to be explained by the presence/absence of the ATP-III metabolic syndrome. Associations provide valuable information in planning interventions for screening and management. PMID:19371412

  20. Associations of cardiovascular risk factors in Al Ain- United Arab Emirates

    Nazirudeen Mohammad K

    2009-04-01

    Full Text Available Abstract Background Over the last 30 years the citizens of the United Arab Emirates have experienced major changes in life-style secondary to increased affluence. Currently, 1 in 5 adults have diabetes mellitus, but the associations (clustering among risk factors, as well as the relevance of the concept of the metabolic syndrome, in this population is unknown. Aim To investigate the prevalence and associations among cardiovascular risk factors in this population, and explore to what extent associations can be explained by the metabolic syndrome according to ATP-III criteria. Method A community based survey, of conventional risk factors for cardiovascular disease was conducted among 817 national residents of Al Ain city, UAE. These factors were fasting blood sugar, blood pressure, lipid profile, BMI, waist circumference, smoking, or CHD family history. Odds ratios between risks factors, both unadjusted and adjusted for age and sex as well as adjusted for age, sex, and metabolic syndrome were calculated. Results Various risk factors were positively associated in this population; associations that are mostly unexplained by confounding by age and sex. For example, hypertension and diabetes were still strongly related (OR 2.5; 95% CI 1.7–3.7 after adjustment. An increased waist circumference showed similar relationship with hypertension (OR 2.3; 95% CI 1.5–3.5. Diabetes was related to an increased BMI (OR 1.5; 96% CI 1.0–2.3. Smoking was also associated with diabetes (OR 1.9, 95% CI 1.0–3.3. Further adjustment for metabolic syndrome reduced some associations but several remained. Conclusion In this population risk-factors cluster, but associations do not appear to be explained by the presence/absence of the ATP-III metabolic syndrome. Associations provide valuable information in planning interventions for screening and management.

  1. Spatial and temporal variability in sedimentation rates associated with cutoff channel infill deposits: Ain River, France

    Piégay, H.; Hupp, C.R.; Citterio, A.; Dufour, S.; Moulin, B.; Walling, D.E.

    2008-01-01

    Floodplain development is associated with lateral accretion along stable channel geometry. Along shifting rivers, the floodplain sedimentation is more complex because of changes in channel position but also cutoff channel presence, which exhibit specific overflow patterns. In this contribution, the spatial and temporal variability of sedimentation rates in cutoff channel infill deposits is related to channel changes of a shifting gravel bed river (Ain River, France). The sedimentation rates estimated from dendrogeomorphic analysis are compared between and within 14 cutoff channel infills. Detailed analyses along a single channel infill are performed to assess changes in the sedimentation rates through time by analyzing activity profiles of the fallout radionuclides 137Cs and unsupported 210Pb. Sedimentation rates are also compared within the channel infills with rates in other plots located in the adjacent floodplain. Sedimentation rates range between 0.65 and 2.4 cm a−1 over a period of 10 to 40 years. The data provide additional information on the role of distance from the bank, overbank flow frequency, and channel geometry in controlling the sedimentation rate. Channel infills, lower than adjacent floodplains, exhibit higher sedimentation rates and convey overbank sediment farther away within the floodplain. Additionally, channel degradation, aggradation, and bank erosion, which reduce or increase the distance between the main channel and the cutoff channel aquatic zone, affect local overbank flow magnitude and frequency and therefore sedimentation rates, thereby creating a complex mosaic of sedimentation zones within the floodplain and along the cutoff channel infills. Last, the dendrogeomorphic and 137Cs approaches are cross validated for estimating the sedimentation rate within a channel infill.

  2. The first description of the complete natural history of uveal melanoma by two Scottish surgeons, Allan Burns and James Wardrop.

    Kivelä, Tero T

    2018-03-01

    James Wardrop (1782-1869), a young Scottish surgeon and an early ophthalmologist in Edinburgh, is credited for describing in 1809 retinoblastoma as an entity in his treatise 'Observations on Fungus Haematodes or Soft Cancer'. His treatise also reveals that Allan Burns (1781-1813), another young Scottish surgeon and anatomist, had invited Wardrop to assist in enucleating an eye from a 41-year-old Glasgow woman who, in retrospect, had a uveal melanoma. Her eye had become blind 4 months after symptoms of exudative retinal detachment had appeared, and it had become painful after a further 2-4 months. The tumour eventually perforated the sclera, and she died within a year thereafter of hepatic metastases. Burns and Wardrop went on to publish detailed parallel accounts of the symptoms, signs, ophthalmic pathology and post-mortem findings regarding the primary, recurrent and metastatic tumour. Burns may have performed the post-mortem after exhuming the body, a common occurrence in early 19th Century Scotland, a thriving hub for teaching morbid anatomy to young surgeons at the time. © 2017 Acta Ophthalmologica Scandinavica Foundation. Published by John Wiley & Sons Ltd.

  3. Implementation of TiAIN and CrN coatings and ion implantation in the modern plastics moulding industry

    Bienk, E.J.; Mikkelsen, N.J.

    1997-01-01

    Two methods of surface improvement widely used in the modern plastics industry are compared, with a view to improving productivity and product quality. Ion implantation of plastics and physical vapour deposition coatings both offer surface engineering advantages. Each method is described and evaluated with reference to plastics moulding. TiAIN coatings are used to protect hard bulk materials, subjected to evenly distributed loads. The more ductile CrN coatings are used for softer materials which give less support to the coatings. (UK)

  4. Modelling rainfall runoff relations using HEC-HMS in a semi-arid region: Case study in Ain Sefra watershed, Ksour Mountains (SW Algeria)

    Derdour Abdessamed; Bouanani Abderrazak; Babahamed Kamila

    2018-01-01

    Ain Sefra is one of the Algerian cities that had been experienced several devastating floods during the past 100 years. The purpose of this study is to simulate runoff in the semi-arid region of Ain Sefra watershed through the employing of the Hydrologic Engineering Center – Hydrologic Modelling System (HEC-HMS). In this paper, the frequency storm is used for the meteorological model, the Soil Conservation Service – curve number (SCS-CN) is selected to calculate the loss rate and Soil Conserv...

  5. Estudio biofarmacéutico de geles antiinflamatorios no esteroideos (AINES

    Margarita Restrepo

    2000-02-01

    Full Text Available

    Los antiinflamatorios no esteroideos (AINES son un grupo heterogéneo de compuestos con actividad analgésica, antipirética y antiinflamatoria que comparten efectos secundarios indeseables, tales como: ulceración gástrica e intestinal, anemia, bloqueo de la agregación plaquetaria, inhibición de la motilidad uterina e hipersensibilidad. Los AINES se utilizan por vía tópica con el fin de aliviar lesiones en tejidos blandos a los cuales puede llegarse directamente a través de la piel, evitando así los efectos colaterales indeseables.

    Actualmente para la gran mayoría de los medicamentos se exige valorar la Biodisponibilidad como criterio de calidad. Biodisponibilidad se define como la cantidad de fármaco que llega a sangre o plasma después de la administración del medicamento que lo contiene y la velocidad a la cual este proceso ocurre; esta determinación de Biodisponibilidad no resulta útil en el caso de medicamentos que se administran a través de la piel y no alcanzan circulación sistémica; la biodisponibilidad relativa o Bioequivalencia es la comparación de las biodisponibilidades de dos medicamentos para determinar si son similares en su comportamiento farmacocinético dentro del organismo.

    El presente trabajo pretende estandarizar y validar un método que permita determinar concentraciones de fármaco en tejidos, en este tipo de medicamentos administrados por vía tópica, que no alcanzan circulación sistémica y por lo tanto no pueden ser cuantificados en sangre o plasma; además pretendemos que esta metodología pueda ser propuesta como una técnica para determinar biodisponibilidad y/o bioequivalencia para este tipo de productos. Para lograr estos objetivos, inicialmente, se induce la inflamación a un grupo

  6. Down Deep in the Dark: A Semiotic Approach to Edgar Allan Poe’s the Black Cat

    Abdul Karim Lazim

    2018-02-01

    Full Text Available Semiotics is the investigation of the nature, type and function of signs in all walks of life. It is the science of interpreting signs and showing how meaning is generated by and through a shared cultural code.  Being a verbal corpus of imaginatively works of art, literature with all its genres, i.e. poetry, drama, fiction, the short story, etc. lends itself to semiotics scrutiny. Verbal works of artifact as such can be analyzed in terms of semiotic theory. This paper purports to explore Edgar Allan Poe’ The Black Cat as a structure of interconnected signs which are organically rooted into the code of horror. If culture, in one sense, is the complex network of beliefs, behaviors and patterns of thinking, these psychopathic cognitive patterns are wittingly structured in the semiotic system of Poe’s narrative work of art. The study proceeds with the hypothesis that Poe’s The Black Cat is a semiotic metaphor or a representation of the actual world of insanity which is resulted from obsession in things. The short story is analyzed in terms of the newly semiotic approach, namely The Semiotic triangle. This tripartite model is a three-dimensional model whose axes are: syntagmaticity, paradigmaticity and signification. The dimensions are supposed to be the foundations of the construction of Poe’s literary text. One result of the study has shown that fear is not an organic human nature in The Black Cat, but a newly born behavior which has led to a serial of crimes committed by the unnamed author. This abnormal behaviorism is encoded in the semiotic veins of Poe’s newly literary genre, i.e. the narratology of horror. The scope of the study is limited to Poe’s The Black Cat as a par excellent narrative work of that creative genre. The paper is rounded up with concluding remarks elicited from the semiotic analysis.

  7. Olivine in Martian Meteorite Allan Hills 84001: Evidence for a High-Temperature Origin and Implications for Signs of Life

    Shearer, C. K.; Leshin, L. A.; Adcock, C. T.

    1999-01-01

    Olivine from Martian meteorite Allan Hills (ALH) 84001 occurs as clusters within orthopyroxene adjacent to fractures containing disrupted carbonate globules and feldspathic shock glass. The inclusions are irregular in shape and range in size from approx. 40 microns to submicrometer. Some of the inclusions are elongate and boudinage-like. The olivine grains are in sharp contact with the enclosing orthopyroxene and often contain small inclusions of chromite The olivine exhibits a very limited range of composition from Fo(sub 65) to Fo(sub 66) (n = 25). The delta(sup 18)O values of the olivine and orthopyroxene analyzed by ion microprobe range from +4.3 to +5.3% and are indistinguishable from each other within analytical uncertainty. The mineral chemistries, O-isotopic data, and textural relationships indicate that the olivine inclusions were produced at a temperature greater than 800 C. It is unlikely that the olivines formed during the same event that gave rise to the carbonates in ALH 84001, which have more elevated and variable delta(sup 18)O values, and were probably formed from fluids that were not in isotopic equilibrium with the orthopyroxene or olivine The reactions most likely instrumental in the formation of olivine could be either the dehydration of hydrous silicates that formed during carbonate precipitation or the reduction of orthopyroxene and spinel If the olivine was formed by either reaction during a postcarbonate beating event, the implications are profound with regards to the interpretations of McKay et al. Due to the low diffusion rates in carbonates, this rapid, high-temperature event would have resulted in the preservation of the fine-scale carbonate zoning' while partially devolatilizing select carbonate compositions on a submicrometer scale. This may have resulted in the formation of the minute magnetite grains that McKay et al attributed to biogenic activity.

  8. Kas uus töölepingu seaduse eelnõu on õnnestunud? / Olga Aasav, Arno Arukask, Ain Tammvere...[jt.] ; interv. Martin Pau

    2008-01-01

    Vastavad restoranklubi Atlantis tegevjuht Olga Aasav, ametiühingute keskliidu osakonnajuhataja Arno Arukuusk, AS Estiko Investeeringud juhataja Ain Tammvere, Tartu Ülikooli ametiühingu esimees Aleksander Jakobson, AS Samelin tegevdirektor Leida Kikka, AS Enics Eesti tegevjuht Kalle Kuusik, personalispetsialist Lea Oras ja Tartu Tarbijate Kooperatiivi juhatuse esimees Tarmo Punger

  9. Impact of Dietary, Socioeconomic, and Physical Factors on Obese and Overweight Schoolchildren Living in Sidi-Bel-Abbes (West of Algeria and Ain Defla (Centre

    Didaoui Hayat

    2018-03-01

    Full Text Available Background and aims: The aim of the current study was to assess the impact of environmental factors; food, socio-economic, and physical activity, on a group of obese children living in Ain-Defla (Center Algeria and Sidi-Bel-Abbes (West Algeria.

  10. Fracaso renal agudo secundario a combinación de inhibidores del sistema renina-angiotensina, diuréticos y AINES. “La Triple Whammy”1

    Rosa Maria Garcia Camin

    2015-03-01

    Conclusiones: El tratamiento con IECA, ARA II, diuréticos y/o AINES presenta elevada incidencia de ingreso por FRA, siendo los diuréticos en monoterapia, doble y triple terapia combinada los que ocasionan la mayor incidencia. El FRAETW supone elevados costes sanitarios y muertes evitables.

  11. Eripedagoogid ootavad poliitilisi otsuseid / Plado, Kaja; Karlep, Karl; Ostrat, Ain; Maila, Meelika; Binsol, Hene; Kontor, Ana; küsitlenud Martin Krõlov

    2007-01-01

    Eripedagoogide vestlusringis osalevad: Tartu Ülikooli eripedagoogika osakonna juhataja Kaja Plado, emeriitdotsent pedagoogikadoktor Karl Karlep, Tartu Kroonuaia Kooli direktor Ain Ostrat ja õppealajuhataja Meelike Maila, Tartu Hiie Kooli õppealajuhataja Hene Binsol ning Tartu Nõustamis- ja õpiabi keskuse juhataja Ana Kontor

  12. NAS FRONTEIRAS ENTRE RAZÃO E DESRAZÃO: UMA LEITURA DE “O GATO PRETO” DE EDGAR ALLAN POE

    Carla Alexandra Ferreira

    2014-12-01

    Full Text Available Known for his macabre and mysterious short stories as well as by his detective stories, Edgar Allan Poe (1809-1849 has a controversial as well as important position among his contemporaries. The objective of this article is to investigate through the reading of one of his most popular stories, “The Black Cat” (1843 how the theme of a subtle line between reason and madness is shown in the short story. Having uncertainty as its unity of effect, this story dialogs with Michel Foucault’s ideas about reason and madness and also with the current thoughts about American literature formation.  

  13. Overexploitation and cumulative drought trend effect on Ras El Ain karstic spring discharge (Khabour Sub-basin, Syria)

    Abou Zakhem, Boulos; Kattaa, Bassam

    2017-10-01

    The effects of climate change and overexploitation are being strongly perceived in the studied area and the springs discharge is obviously affected. In this paper, Ras El Ain spring discharge and precipitation were analyzed by normalized methods on an yearly timescale. The deficit of Ras El Ain spring discharge due to overexploitation factors and drought effects was estimated. Cumulative drought analyses were carried out using SPI10 and SQI10. Finally, the decreasing trends of the spring discharge due to the deficiency in rainfall were analyzed. The main results reveal that the annual mean deficit of Ras El Ain spring discharge due to overpumping was between 32 and 45%, whereas, annual mean deficit related to drought was between 22 and 35% on average, during the last 30 years (post-1984). The moving averages of SPI and SQI delineate very well the drought periods during last three decades. The cumulative droughts using SPI10 and SQI10 reveal that wet period (pre-1984) with positive values was characterized by high precipitation and spring discharge. Overexploitation period (1984-1989) is distinguished by decreasing SQI10 values whereas, SPI10 is almost stable. The response of the karst system to the precipitation signal has been changed, during the drought period (1990-2000), and the spring behaviour has been modified due to the first overexploitation period. Finally, overexploitation period (2001-2008) is related to the second phase of groundwater intensive pumping for irrigation purposes. Consequently, this period is completely catastrophic causing the drying up of the spring. The decreasing trends analyzed using DPI and DQI showed annual decreasing rates relative to the mean values of -0.268% and -0.105%, respectively. Thus, the results of theoretical model reveal that precipitation will decrease by about DPI = -20.7% and the discharge will decline by about -9.2% by 2050. Consequently, the declining discharge due to climatic variation under natural conditions as

  14. Contribution to the hydrogeological, geochemical and isotopic study of Ain El Beidha and Merguellil (Kairouan plain) aquifers: Implication for the dam-aquifer relationship

    Ben Ammar, Safouan

    2007-01-01

    In the semiarid central part of Tunisia the water resources are becoming increasingly rare because of the scarcity and irregularity of the precipitation and a steadily growing need for fresh water. This study addresses the use of geochemical and isotopic data to analyze the relationship between the El Haouareb dam and the Ain El Beidha and the Kairouan alluvial plain aquifers systems for durable groundwater management. In the Ain El Beidha basin the hydrogeological and geochemical investigations showed that: - The general direction of the groundwater flow is mainly from the SW to the NE, i.e. towards the hydraulic sill of El Haouareb which allows the connection between the Ain El Beidha basin and the Kairouan plain, - The salinity distribution displays a zonation in apparent relationship with the lithological variation of the aquifer formation, - Mineral exchange between groundwater and the aquifer matrix is the dominant process in determining groundwater salinity. The isotopic data confirm the flow directions of groundwater and shows that the recharge of Ain El Beidha aquifers takes place from the floods of the Khechem and Ben Zitoun wadies and also by preferential infiltration of runoff at the front of hill slopes area. Close to preferential recharge areas, groundwater 3H contents reflect a recent input of surface water, whereas the radiocarbon data indicate a longer residence time downstream. The isotopic characteristics of Ain El Beidha groundwater (small space and temporal changes) authorize the use of averaged values for the dam-aquifer water exchange. Under natural conditions, groundwater recharge of the alluvial aquifer of Kairouan plain occurs by infiltration of the Merguellil floods and from the Ain el Beidha groundwater flow close the karstic hydraulic sills. Since the construction of the El Haouareb dam, these natural mechanisms have been strongly modified: the dam waters infiltrate into the karst, mix with the Ain el Beidha groundwater, and feed the

  15. Estonia : [2013] / Allan Sikk

    Sikk, Allan, 1975-

    2014-01-01

    Ülevaade Eesti poliitilisest elust 2013. aastal. Käsitletakse kohalikke valimisi, muutusi valitsuse kooseisus, Riigikogu tegemisi, aga ka rahvakogu ettepanekuid, Reformierakonna rahastusskandaali jt sündmusi.

  16. Estonia : [2012] / Allan Sikk

    Sikk, Allan, 1975-

    2013-01-01

    Ülevaade Eesti valitsuses 2012. aastal toimunud muutustest, sisepoliitika olulisematest arengutest (protestid ACTA vastu, Rahvakogu kokkutulek, Silvergate, opositsiooni tegevus, arutelud ESM-i ümber, venekeelsest koolist Eestis)

  17. Estonia : [2011] / Allan Sikk

    Sikk, Allan, 1975-

    2012-01-01

    Ülevaade Eesti poliitika olulisematest sündmustest 2011. aastal, mille hulgas on nii Riigikogu kui ka presidendi valimised, märgitakse skandaali ja korruptsiooni seoses viisavaba liikumise võimaldamisega Shengeni viisaruumis, muutused põhiseaduses seoses Kaitsejõudude ülemjuhataja koha kaotamisega

  18. Estonia : [2010] / Allan Sikk

    Sikk, Allan, 1975-

    2011-01-01

    Ülevaade Eesti poliitika olulisematest sündmustest 2010. aastal, mille hulgas märgitakse skandaale erakondade rahaasjades, korruptsiooni seoses maamüügitehingutega, muutusi valimisseaduses seoses valimistega Euroopa Parlamenti

  19. Soome kosmoseprojekt / Allan Valge

    Valge, Allan

    2006-01-01

    Soome läbi aegade kõige vaadatum film on soome tudengite valmistatud ingliskeelne täispikk internetifilm - "Star Treki" paroodia "Star Wreck : In the Pirkinning" : režissöör Timo Vuorensola : peaosas Samuli Torssonen. Filmi tehti seitse aastat

  20. Aine või toote ravimina määratlemine Eestis Euroopa Liidu õiguse valguses : [magistritöö] / Kaili Lellep ; Tartu Ülikool, õigusteaduskond ; juhendaja Ants Nõmper

    Lellep, Kaili

    2010-01-01

    Aine või toote määratlemisest toiduna, kosmeetikatootena, meditsiiniseadmena, ravimina. Määratlustest Eestis ja nende vastavusest Euroopa Liidu õigusega, määratluste tagajärgedest, ettepanekutest vastuolulise õigusakti muutmiseks

  1. Nimetage mõned suuremad nõmedused, mida üks ülemus teha saab? / Kairi Ütsmüts, Allan Rosenberg, Katriin Jüriska ... [jt.

    2010-01-01

    Küsimusele vastavad Swedbank Eesti infotehnoloogia projektijuht Kairi Ütsmüts, Aspiro Eesti müügijuht Allan Rosenberg, Uuskasutuskeskuse tegevjuht Katriin Jüriska, Tele2 toote- ja turundusjuht Reilika Ilp, GrabCAD'i omanik ja insener Indrek Narusk ning turismifirma Estfly omanik Vahur Mäe

  2. Use of tritium for estimation of groundwater mean residence time, a case study of the Ain Al-Samak Karst springs (Central Syria)

    Kattan, Z.

    2003-01-01

    This work is an attempt to estimate the mean residence time of groundwater in the Ain Al-Tanour and Ain-Samak, which are the major karst springs in the Upper Orontes Basin (Central Syria). This estimate, which consists on the application of a mathematical modeling approach, was based on the use of tritium, as a natural radioisotope tracer and a tool for ground water age dating. By adopting a completely mixed reservoir model, linked with exponential time distribution function, the mean residence time (turnover time) of these two springs was evaluated to be about 50 years. This result is in good agreement with previous estimation obtained for the Figeh main spring, which belongs to the same aquifer (Cenomanian-Turonian complex) in the Damascus Basin. On the basis of this evaluation, a value of about 800 million m 3 was obtained for the maximum groundwater reservoir size

  3. EXIGENCES TECHNIQUES DANS LA CONSTRUCTION ET REGLEMENTATION : ETUDE D’UN EXEMPLE DE LOGEMENT COLLECTIF A AIN-SMARA (ALGERIE

    B BENRACHI

    2002-12-01

    Full Text Available La construction d’un édifice de qualité standard et répondant aux exigences techniques est   obtenue grâce au développement du savoir-faire et au respect des règles de l’art et de la réglementation en vigueur.  Une étude détaillée sur les  exigences techniques et le respect de la réglementation  d’un logement en collectif  nouvellement construit et inhabité à Ain-Smara, nous a montré  qu’il y a une satisfaction pour certaines d'entre-elles et une non-conformité pour d’autres. Il en résulte que le degré de satisfaction de ce logement est inférieur à celui recommandé dans le cadre de la réglementation, ce qui diminue sa qualité par rapport au standard exigé.

  4. High performance W-AIN cermet solar coatings designed by modelling calculations and deposited by DC magnetron sputtering

    Qi-Chu Zhang [The University of Sydney (Australia). School of Physics; Shen, Y.G. [City University of Hong Kong (Hong Kong). Department of Manufacturing Engineering and Engineering Management

    2004-01-25

    High solar performance W-AIN cermet solar coatings were designed using a numerical computer model and deposited experimentally. In the numerical calculations aluminium oxynitride (AlON) was used as ceramic component. The dielectric functions and then complex refractive index of W-AlON cermet materials were calculated using the Sheng's approximation. The layer thickness and W metal volume fraction were optimised to achieve maximum photo-thermal conversion efficiency for W-AlON cermet solar coatings on an Al reflector with a surface AlON ceramic anti-reflection layer. Optimisation calculations show that the W-AlON cermet solar coatings with two and three cermet layers have nearly identical solar absorptance, emittance and photo-thermal conversion efficiency that are much better than those for films with one cermet layer. The optimised calculated AlON/W-AlON/Al solar coating film with two cermet layers has a high solar absorptance of 0.953 and a low hemispherical emittance of 0.051 at 80{sup o}C for a concentration factor of 2. The AlN/W-AlN/Al solar selective coatings with two cermet layers were deposited using two metal target direct current magnetron sputtering technology. During the deposition of W-AlN cermet layer, both Al and W targets were run simultaneously in a gas mixture of argon and nitrogen. By substrate rotation a multi-sub-layer system consisting of alternating AlN ceramic and W metallic sub-layers was deposited that can be considered as a macro-homogeneous W-AlN cermet layer. A solar absorptance of 0.955 and nearly normal emittance of 0.056 at 80{sup o}C have been achieved for deposited W-AlN cermet solar coatings. (author)

  5. The impact of weathering on the uranium-bearing phosphates of Ain Laylon in the Syrian coast, using radon and gamma ray surveys

    Jubeli, Y.; Al-Hilal, M.; Al-Ali, A.

    1998-06-01

    A combination of several exploration techniques was carried out at the main phosphatic outcrop of Ain Laylon in the Syrian coastal region. The survey was extended along an E-W profile parallel to Wadi Al-Mzeraa over a distance of about 23 km from Ain Laylon site towards the shoreline of the Mediterranean Sea. The techniques used in this survey included soil radon emanometry, gamma ray spectrometry and soil geochemistry, with the purpose of evaluating the effects of weathering and erosion on the uranium-hearing phosphate formations in the study ares. Soil radon concentration and gamma ray total count rates found to be ranging between 115-472 pCi/l and 52-520 cps over the main phosphate deposit of Ain Layton and between 16-241 pCi/l and 15-300 cps along the profile of Wadi Al-Mzeraa - Rwemiyeh respectively. Some suitable elements such as U, Zn, Pb, Cr, Fe and Sr were also analyzed to trace the dispersion pattern of uranium and its controls throughout the area. The results showed that the distribution of both radon emission and gamma ray activity, in accordance with chemical uranium and some associated trace elements, were almost identical over the study area. The anomalously high values in all cases were basically found to be related to the main phosphatic outcrop and to the reprecipitation processes at their vicinity following the alteration of the phosphates. The prevailing topographic conditions of the drainage system has probably played a crucial role in carrying the uraniferous solutions from its phosphatic source down to the nearby sedimentary environment. This appears to be sufficient enough to produce an anomalous halo resulting in the detection of some relatively high radon and gamma values of about 7 and 15 times the background respectively, especially close to the main phosphate outcrop. A notable gradual decrease was then observed at the following sampling sites along the pathway west of Ain Laylon site approaching the background level at a distance of

  6. Modelling rainfall runoff relations using HEC-HMS in a semi-arid region: Case study in Ain Sefra watershed, Ksour Mountains (SW Algeria

    Derdour Abdessamed

    2018-03-01

    Full Text Available Ain Sefra is one of the Algerian cities that had been experienced several devastating floods during the past 100 years. The purpose of this study is to simulate runoff in the semi-arid region of Ain Sefra watershed through the employing of the Hydrologic Engineering Center – Hydrologic Modelling System (HEC-HMS. In this paper, the frequency storm is used for the meteorological model, the Soil Conservation Service – curve number (SCS-CN is selected to calculate the loss rate and Soil Conservation Service unit hydrograph method have been applied to simulate the runoff rate. After calibration and validation, the simulated peak discharges were very close with observed values. The Nash–Sutcliffe efficiency coefficient was 0.95, indicates that the hydrological modeling results are satisfactory and accepted for simulation of rainfall-runoff. The peak discharges obtained for the 10, 50, 100 and 1000 year storms are respectively 425.8, 750.5, 904.3 and 1328.3 m3∙s−1.

  7. Rahvusvaheline turismikonverents / Ain Hinsberg

    Hinsberg, Ain

    2011-01-01

    Radisson Blu Hotel Olümpias 28. aprillil korraldatud konverentsist "Läänemere regiooni turismiteadmuse toetus turismimajandusele ja -ettevõtlusele 2011-2026", millega tähistati Eesti Hotelli- ja Turismikõrgkooli EHTE 15. sünnipäeva. Thomas Mielke, Maritta Hiltuneni, Kristian Sieversi, Pauli Santala, Inese Šīrava, Maija Rozite ja Kestutis Ambrozaitise konverentsil peetud ettekannetest ja paneeldiskussioonist

  8. Eeslid / Ain Kaalep

    Kaalep, Ain, 1926-

    2003-01-01

    Sisu: Eeslid ; Luuletaja Koghazi ; Elav kuningas ; Neli legendi : Mungasuudlus ; Dorzhiin ; Legend meister Albrechtist ; Aafrika muld. Ballaad kombaini armastusest ; Kuningakatse ; Rapsoodiad : Draakoni talveuni ; Klaassepa poeg. Kaks indiaani metamorfoosi : Roti metamorfoos ; Ahvnaine. Paani surm ; Valgjärve legend ; Katsikõsõ'

  9. Turundusteenistus / Ain Kaljurand

    Kaljurand, Ain, 1965-

    2004-01-01

    Ilmunud ka: 2003 : annual report : [Eesti Raudtee]. - Tallinn, 2004, lk. 15-20; 2003 : godovoi ottshjot : [Eesti Raudtee]. - Tallinn, 2004, lk. 15-20. Ülevaade AS-i Eesti Raudtee 2003. a. kaubaveost veomahtude ja kaubagruppide järgi, turundusteenistusest, hinnapoliitikast

  10. Keelatud ained / Ave Oit

    Oit, Ave

    2012-01-01

    Öko- ja looduskosmeetikas keelatud või piirangutega lubatud koostisainetest: silikoonid, etoksüleeritud emulgaatorained (PEG-ühendid), toorõli baasil valmistatud rasvained ja emulgaatorid s.h mineraalõlid ja -vahad

  11. Madame Olga Givernet, Députée de la 3ème circonscription de l’Ain, République française, vendredi 16 février 2018

    Caraban Gonzalez, Noemi

    2018-01-01

    Madame Olga Givernet Députée 3ème circonscription de l’Ain. Participants CERN, Signature du livre d’or. M. Frédérick Bordry Directeur des accélérateurs et de la technologie Mme Fabiola Gianotti Directrice générale

  12. Toidutööstus panustab detsembris jõulutoodetele. Pühad toovad käibelisa / Ain Alvela, Ketlin Rauk ; kommenteerinud Ruth Roht, Marek Viilol, Simmo Kruustük, Imre Sokk

    Alvela, Ain, 1967-

    2011-01-01

    Spetsiaalsed jõulutooted aitavad aasta lõpul suurendada toiduainetööstuste käivet. ASi Atria Eesti müügi- ja turundusdirektori Margus Masingu, ASi Fazer Eesti juhatuse esimehe Kristjan Kongo ja ASi Salvest turundusdirektori Ain Nõlvaku kommentaare

  13. Narkootilise ja psühhotroopse aine suures koguses ebaseaduslik käitlemine suure varalise kasu saamise eesmärgil : [magistritöö] / Kerli Lepik ; Tartu Ülikool, õigusteaduskond ; juhendaja: Jaan Ginter

    Lepik, Kerli, 1989-

    2013-01-01

    Suures koguses narkootilise ja psühhotroopse aine käsitlemisest, suure varalise kasu saamise eesmärgist, võrdlus teiste Euroopa riikidega (EL, Läti, Leedu, Soome, Norra, Tšehhi), suurest varalisest kasust kui koosseisutunnusest ja alternatiividest

  14. Application of a TiAIN coating for the increase wear resistance of a passage floodgate manufactured in steel T9

    Montes de Oca, J.; Gonzalez, H. J.; Solis, E.; Moreno, J.; Munoz S, J.

    2009-01-01

    The present work reports a study to increase wear resistance of a ball passage floodgate (steel type T9) trough the application of a thick film (coating). This study have included a material and process selection, synthesis of the coating on steel plates as substrates and spherical device, assembling of the coated floodgate on the ball valves, and finally an evaluation of the valves in the process of a thermoelectric power station. Taking into account the different requirements, a TiAIN coating prepared by cathodic arc evaporation was finally retained. The crystal structure, morphology and chemical composition of the coating were evaluated by x-ray diffraction (XRD) and scanning electron microscopy equipped with an energy dispersive spectrometer (SEM-EDS). Finally, mechanical properties such as hardness and Young modulus were determined by nano indentation. (Author)

  15. Evaluation of the impact of water harvesting techniques on the evolution of piezometric head of Ain El Bidha groundwater in Kairouan at the Central part of Tunisia

    Mechergui, M. Mohamed; Henda Saoudi, Mme

    2016-04-01

    This study aims to assess the impact of water harvesting constructed hydraulic structures (big and small dams, terraces, seuils for recharge…) on the evolution of piezometric head of Ain El Beidha groundwater table. The measurements of depth of water table, taken at the end of rain season and at the end of irrigation season, in many piezometers and monitoring wells, for a long period of observation before and after implementation of all the hydraulic structures, were used with the cumulative rain to the highest water table to diagnostic the effect of natural recharge and constructed hydraulic structures. According to the analysis of curves illustrating the evolution of piezometric head and rainfall over time, it was shown that despite the fact that the same amount of rain fall on the total area in the limits of Ain El Beidha groundwater table, the piezometers respond differently. This is because there are many sources of recharge and many factors affecting the recharge. First of all, the aquifer is divided in four compartments (the calcareous formation of Djebel El Houyareb, the plio-quaternary formation, the Miocene formation: Baglia and Saouaf). All those respond differently to the recharge by their capacity of infiltration and their hydrodynamic characteristics. The recharge of the groundwater table was increased by the implementation of small soil and water conservation structures, artificial lakes, El Haouareb Dam, run off in the natural Oued bads and seuils for recharge installed in the bads of oueds. The different piezometric drown maps were used to determine the flow direction and hydraulic gradient in order to identify the recharge areas, while tracking maps for three equal piezometric heads 210 m 300 m and 370 m established over different years made it possible to assess the impact of hydraulic structures, namely the effect of SWC and Ben Zitoun Lake. To illustrate the impact of El Houareb dam on the groundwater, the piezometric maps and local values

  16. Hollywood kohtu ette / Allan Espenberg

    Espenberg, Allan

    2005-01-01

    Uruguay plaanib kohtusse kaevata mängufilmi "Sügavuses" ("Submerged") tegijad, kuna linalugu loob sellest Lõuna-Ameerika riigist väära ning mõnitava pildi. Režissöör Anthony Hickox, peaosas Steven Seagal : USA 2005

  17. Musta Mandri filmikunst / Allan Espenberg

    Espenberg, Allan

    2008-01-01

    Aafrika tähtsaim ja suurejoonelisim filmifestival FESPACO (Aafrika filmi- ja televisioonifestival). Toimumispaigaks Burkina Faso pealinn Ouagadougou. Ka teistest Aafrika mandril toimuvatest filmifestivalidest

  18. Prantsuskeelsete poliitikute lahkumine / Allan Espenberg

    Espenberg, Allan

    2007-01-01

    Kolm hiljuti lahkunud prantsuskeelset poliitikut, Prantsusmaa endised peaministrid Pierre Messmer ja Raymond Barre ning Luksemburgi endine peaminister Gaston Thorn andsid suure panuse nii Euroopa kui oma kodumaa poliitikasse ja majandusse

  19. Application of a TiAIN coating for the increase wear resistance of a passage floodgate manufactured in steel T9; Aplicacion de un recubrimiento de TiAIN para el incremento de la resistencia al desgaste de una compuerta de paso fabricada en acero T9

    Montes de Oca, J.; Gonzalez, H. J. [Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada, IPN, Unidad Altamira, Km. 14.5 Carretera Tampico-Puerto industrial Altamira, 89600 Altamira, Tamaulipas (Mexico); Solis, E. [Hy-Teck Fluid Power, Blvd. A. Lopez Mateos No. 310, Col. Nuevo Aeropuerto, 89337 Tampico, Tamaulipas (Mexico); Moreno, J. [Departamento de Ingenieria Metalurgica, Escuela Superior de Ingenieria Quimica e Industrias Extractivas, IPN, UPALM Unidad Zacatenco, 07730 Mexico D. F. (Mexico); Munoz S, J. [Centro de Investigacion y de Estudios Avanzados, Unidad Queretaro, Libramiento Norponiente No. 2000, Fracc. Real de Juriquilla, 76230 Santiago de Queretaro, Queretaro (Mexico)], e-mail: jmontedeocav@ipn.mx

    2009-07-01

    The present work reports a study to increase wear resistance of a ball passage floodgate (steel type T9) trough the application of a thick film (coating). This study have included a material and process selection, synthesis of the coating on steel plates as substrates and spherical device, assembling of the coated floodgate on the ball valves, and finally an evaluation of the valves in the process of a thermoelectric power station. Taking into account the different requirements, a TiAIN coating prepared by cathodic arc evaporation was finally retained. The crystal structure, morphology and chemical composition of the coating were evaluated by x-ray diffraction (XRD) and scanning electron microscopy equipped with an energy dispersive spectrometer (SEM-EDS). Finally, mechanical properties such as hardness and Young modulus were determined by nano indentation. (Author)

  20. [Economic impact of etanercept and adalimumab biosimilars on hospitals scale covered by PharmAlp'Ain, a hospitals grouping of orders for health products].

    Berreur, B; Guerin, F; Christophe, B; Limido, G; Paubel, P

    2018-01-01

    To evaluate the economic impact of future prescriptions of etanercept and adalimumab biosimilars at the territorial scale covered by PharmAlp'Ain, a hospitals grouping of orders for health products. Determination of the number and status of patients (naive or in continuation of treatment) from the National Database "Datamart de Consommation Inter-Régimes" of health insurance, concerned by a dispensation in a pharmacy of etanercept or adalimumab in 2015. Calculation of potential savings in case of biosimilar requirements according to 3 hypotheses: 63% (rate observed in a previous study) of initiations are treated with biosimiliaries and the others by princeps (H 1 ); all initiations under biosimilars and continuation therapy with the princeps (H 2 ) or all patients are treated with biosimilars (H 3 ). The annual savings are estimated at 237,000 € with the H 1 hypothesis. In the case of H 2 , the expected savings would be 376,200 € per year. In the case of H 3 , savings for the community could reach almost 1,282,800 € per year. The arrival of biosimilars allows significant savings for medicines market. According to the French recommendations in 2016, the expected savings are between the H 1 and H 2 hypothesis. The rate of penetration of biosimilars depends on many factors such as the involvement of health professionals, patient adherence, or health authority recommendations. Copyright © 2017 Académie Nationale de Pharmacie. Published by Elsevier Masson SAS. All rights reserved.

  1. Time Management and Its Relation To Students’ Stress, Gender and Academic Achievement Among Sample of Students at Al Ain University of Science and Technology, UAE

    Ahmad Saleh Al Khatib

    2014-05-01

    Full Text Available The objective of the present study was to investigate the relationship between time management, perceived stress, gender and academic achievement among United Arab Emirates college students. The respondents were 352 college students from Al Ain University of Science and Technology. The sample was stratified by sex. Among the respondents, 52.5% were female students and 47.5% were male students. The mean age of the sample was 23.4 years ranging from 18 to 39. Time management was measured by Time Management Questionnaire” developed by Britton and Tesser (1991, while perceived stress was measured by The Perceived Stress Scale developed by Cohen (1985. The findings of the study showed that there was statistically significant negative relationship between time management and perceived stress. Females reported higher time management compared to their males counter mates. Higher time management and lower perceived stress were associated with high levels of academic achievement. However, time management was the most significant predictor of academic achievement accounting for 26 % of the variance while perceived stress accounted for an additional 11.2% of the variance in academic achievement. All three predictors explained 29.4% (R = .543 of total variance. The implications and limitations are reviewed as are the suggestions for future research.   Keywords: Time management, perceived stress, academic achievement, college students.

  2. EL HOMBRE DE LA MULTITUD Y EL PINTOR DE LA VIDA MODERNA: LA INFLUENCIA DE EDGAR ALLAN POE EN LA CONSTRUCCIÓN DEL CONCEPTO DE MODERNIDAD DE BAUDELAIRE

    Francisco Pizarro Obaid

    2012-04-01

    Full Text Available El siglo XIX dio lugar a nuevas formas de subjetividad metropolitana que tuvieron en el cuento "El hombre de la multitud", de Edgar Allan Poe, un tratamiento excepcional. Es innegable la relevancia de este relato al interior de su obra, así como su aporte al desarrollo del género narrativo. Sin embargo, el cuento de Poe puede ser considerado, a su vez, como una fuente de notable influencia en la redefinición del concepto de modernidad que Baudelaire plasmará en su obra "El pintor de la vida moderna". Al examinar el personaje anónimo de "El hombre de la multitud" y la singularidad del Sr. G, pintor que da fundamento a la crítica de la tradición pictórica de costumbres, quedará en evidencia como los principales argumentos de Baudelaire sobre el arte y las nuevas formas de habitar la ciudad moderna encuentran en el relato de Poe una significativa fuente de inspiración.The 19th century gave rise to new forms of metropolitan subjectivity with an exceptional treatment in EdgarAllan Poe's tale "TheMan of the Crowd". The relevance of this short story into his work is undeniable, as well as its contribution to the development of the narrative genre. However, Poe's story can be considered as a source of considerable influence in the redefinition of the concept of modernity, that Baudelaire will express in his work "The Painter of Modern Life". In examining the anonymous character of "The Man of the Crowd" and the singularity of Mr. G, the painter who gives substance to the criticism of the pictorial tradition of customs, it grows evident how Baudelaire's main arguments on art and the new ways of life in the modern city find in Poe's short story a significant source of inspiration

  3. Jebel Hafit and the Al Ain oases (Eastern Abu Dhabi, United Arab Emirates): an integrative approach of a cultural landscape through the scope of geodiversity

    Giusti, Christian; Louchet, André; Beuzen-Waller, Tara; Ragala, Rachid; Pavlopoulos, Kosmas; Fouache, Éric; Cohen, Marianne; Desruelles, Stéphane; Gramond, Delphine

    2015-04-01

    human settlements and occupation, it is possible to characterize a threefold transition: first, the former transition between the pre-Islamic prehistoric societies and the development of Muslim societies; second, the more recent transition between the traditional historical society (farmers) and the contemporary society, characterized by the growth of urbanization, the creation of modern transport infrastructure and the concomitant growth of tourist flows; third, the current transition between the yesterday and tomorrow Al Ain City, due to the transformation of a local town centred on national economics all along the second half of the twentieth century, into an international town more open to the wider world with the management of a possible increased 20 % of tourist flow because of the inscription of Cultural Sites of Al Ain on the UNESCO's World Heritage List. It is not possible to completely ignore the fact that the Jebel Hafit and its foothills are partly crossed by an international boundary. In case of political tensions, this may cause some difficulties for the management of this territory, with contradictory requirements between security, tourism, traditional land use, and scientific research.

  4. Epidemiology of acute poisoning in children presenting to the poisoning treatment center at Ain Shams University in Cairo, Egypt, 2009–2013

    Azab, Sonya M. S.; Hirshon, Jon Mark; Hayes, Bryan D.; El-Setouhy, Maged; Smith, Gordon S.; Sakr, Mahmoud Lotfy; Tawfik, Hany; Klein-Schwartz, Wendy

    2016-01-01

    Introduction Pediatric poisonings represent a major and preventable cause of morbidity and mortality throughout the world. Epidemiologic information about poisoning among children in many lower- and middle-income countries is scarce. This study describes the epidemiology of acute poisonings in children presenting to Ain Shams University's Poisoning Treatment Center (ASU-PTC) in Cairo and determines the causative agents and characteristics of acute poisoning in several pediatric age groups. Methods This retrospective study involved acutely poisoned patients, 0 to 18 years of age, who presented to the ASU-PTC between 1/1/2009 and 12/31/2013. Data were extracted from electronic records maintained by the ASU-PTC. Collected data included demographics, substance of exposure, circumstances of the poisoning, patient disposition, and outcome. Results During the 5-year study period, 38,470 patients meeting our criteria were treated by the ASU-PTC; 19,987 (52%) were younger than 6 years of age; 4,196 (11%) were 6 to 12 years; and 14,287 (37%) were >12 years. Unintentional poisoning accounted for 68.5% of the ingestions, though among adolescents 84.1% of ingestions were with self-harm intent. In all age groups, the most frequent causative drugs were non-opioid analgesics, antipyretics, and antirheumatics. The most common nonpharmaceutical agents were corrosives in preschool children and pesticides in adolescents. Most patients had no/minor effects (29,174 [75.8%]); hospitalization rates were highest among adolescents. There were 119 deaths (case fatality rate of 0.3), primarily from pesticide ingestion. Conclusion Poisoning in preschool children is mainly unintentional and commonly due to nonpharmaceutical agents while poisoning in adolescents is mainly intentional (self-harm). Pesticides, mainly organophosphorous compounds and carbamates, were the most frequent agent leading to morbidity and mortality. PMID:26653953

  5. Epidemiology of acute poisoning in children presenting to the poisoning treatment center at Ain Shams University in Cairo, Egypt, 2009-2013.

    Azab, Sonya M S; Hirshon, Jon Mark; Hirshon, John Mark; Hayes, Bryan D; El-Setouhy, Maged; Smith, Gordon S; Sakr, Mahmoud Lotfy; Tawfik, Hany; Klein-Schwartz, Wendy

    2016-01-01

    Pediatric poisonings represent a major and preventable cause of morbidity and mortality throughout the world. Epidemiologic information about poisoning among children in many lower- and middle-income countries is scarce. This study describes the epidemiology of acute poisonings in children presenting to Ain Shams University's Poisoning Treatment Center (ASU-PTC) in Cairo and determines the causative agents and characteristics of acute poisoning in several pediatric age groups. This retrospective study involved acutely poisoned patients, 0-18 years of age, who presented to the ASU-PTC between 1 January 2009 and 31 December 2013. Data were extracted from electronic records maintained by the ASU-PTC. Collected data included demographics, substance of exposure, circumstances of the poisoning, patient disposition, and outcome. During the 5-year study period, 38 470 patients meeting our criteria were treated by the ASU-PTC; 19 987 (52%) were younger than 6 years of age; 4196 (11%) were 6-12 years; and 14 287 (37%) were >12 years. Unintentional poisoning accounted for 68.5% of the ingestions, though among adolescents 84.1% of ingestions were with self-harm intent. In all age groups, the most frequent causative drugs were non-opioid analgesics, antipyretics, and antirheumatics. The most common nonpharmaceutical agents were corrosives in preschool children and pesticides in adolescents. Most patients had no/minor effects (29 174 [75.8%]); hospitalization rates were highest among adolescents. There were 119 deaths (case fatality rate of 0.3), primarily from pesticide ingestion. Poisoning in preschool children is mainly unintentional and commonly due to nonpharmaceutical agents whereas poisoning in adolescents is mainly intentional (self-harm). Pesticides, mainly organophosphorous compounds and carbamates, were the most frequent agents leading to morbidity and mortality.

  6. Análise Literária e Quadrinhística e transposição do Conto Assassinatos na Rua Morgue, de Edgar Allan Poe

    Adriano Souza Freitas

    2018-02-01

    Full Text Available For some time, some national literary texts have been adapted to comics, In this same flow, scholars are looking to analyze how this practice is being performed. We followed similar paths, but from a foreign writer, Edgar Allan Poe. Thus, the aim of this work is not only to analyze the "adaptation" of the Murder story in Morgue Street, but also to perform a literary analysis of the story, as well as to make a comparison between the arts, without merit of valuation. For the accomplishment of this work, it had been used books of the literary seam of writers like Tzvetan Todorov and Massaud Moisés, as well as of writers who are dedicated to the study of the comic like Thierry Groensteen. The research was bibliographical, however, whenever necessary a comparative-historical subsidy was sought. From the readings and the writing of the text, the richness of the literary tale and its "adaptation", that is, of the HQ, was perceived. The idea is therefore that it is not necessary to prioritize the arts, because they are different and with objectives, in many cases different, but can be completed depending on the purpose.

  7. Consent ain't anything

    Di Nucci, Ezio

    2016-01-01

    I argue against various versions of the 'attitude' view of consent and of the 'action' view of consent: I show that neither an attitude nor an action is either necessary or sufficient for consent. I then put forward a different view of consent based on the idea that, given a legitimate epistemic ...

  8. Zamerzajushtshaja Bolnitshnaja kassa / Ain Aaviksoo

    Aaviksoo, Ain, 1974-

    2008-01-01

    Autori hinnangul on suur oht, et Eesti patsiente ootab ees Läti saatus, kus on 40-50% tervishoiukuludest patsientide endi kanda. Eesti ees seisvaid valikuid analüüsides oleks parim valik ravikindlustuse reservide läbimõeldud kasutuselevõtt, kuid eeldusel, et otsitakse ravikindlustuse rahastamisele pikaajalisi sisulisi lahendusi

  9. Eesti luuletaja päris oma prantsuse luuleraamat. August Sanga, Jaan Krossi ja Ain Kaalepi loomingust 1960. aastail / An Estonian Poet’s Own Book of French Poetry. About the Works of August Sang, Jaan Kross and Ain Kaalep in the 1960s

    Katre Talviste

    2013-12-01

    Full Text Available This article positions the translations of French verse works (plays and selected collections of individual poets that August Sang, Jaan Kross and Ain Kaalep made in the 1960s, onto the background of their own original works. At that time, August Sang translated four plays by Molière (The Misanthrope, Tartuffe, The School for Wives in 1961; Amphitryon in 1961, which have already been discussed in relation to the tradition of translating the French syllabic verse into Estonian, because these translations form a considerable part of the body of Estonian translations of French verse poetry. For Jaan Kross and Ain Kaalep, the wider context is created by the so-called free verse battles in the 1950s, to which we can link Kross’ translation of a selected collection of Éluard (Veel enne kostma peab, 1969 and Kaalep’s translation of a selected collection of Prévert (Kuidas portreteerida lindu, 1965. One of the two remaining translations by Kross, (Rostand’s Cyrano de Bergerac, 1964, can also be examined in relation to the problems of translating verse, but the other, (Béranger’s Laulud, 1963, should be discussed in the framework of intellectual and cultural resistance, a part of which was also the struggle put up for the existence of free verse in the 1950s and 1960s. Of August Sang’s original work, the article examines his collection of poems Võileib suudlusega (1963, written simultaneously with his translations of Molière’s plays and published right after them. Both the translations and the collection of original poems have attracted critics’ attention with their remarkable lack of linguistic constraint and simplicity. Although Sang has rarely voiced theoretical ideas about translation or explained his method, both his poetic image, outlined in the collection Võileib suudlusega, and his search for right words, reflected in the drafts of his translations, let us believe that the simplicity of expression and the avoidance of marked

  10. Neuronal 3',3,5-triiodothyronine (T3) uptake and behavioral phenotype of mice deficient in Mct8, the neuronal T3 transporter mutated in Allan-Herndon-Dudley syndrome.

    Wirth, Eva K; Roth, Stephan; Blechschmidt, Cristiane; Hölter, Sabine M; Becker, Lore; Racz, Ildiko; Zimmer, Andreas; Klopstock, Thomas; Gailus-Durner, Valerie; Fuchs, Helmut; Wurst, Wolfgang; Naumann, Thomas; Bräuer, Anja; de Angelis, Martin Hrabé; Köhrle, Josef; Grüters, Annette; Schweizer, Ulrich

    2009-07-29

    Thyroid hormone transport into cells requires plasma membrane transport proteins. Mutations in one of these, monocarboxylate transporter 8 (MCT8), have been identified as underlying cause for the Allan-Herndon-Dudley syndrome, an X-linked mental retardation in which the patients also present with abnormally high 3',3,5-triiodothyronine (T(3)) plasma levels. Mice deficient in Mct8 replicate the thyroid hormone abnormalities observed in the human condition. However, no neurological deficits have been described in mice lacking Mct8. Therefore, we subjected Mct8-deficient mice to a comprehensive immunohistochemical, neurological, and behavioral screen. Several behavioral abnormalities were found in the mutants. Interestingly, some of these behavioral changes are compatible with hypothyroidism, whereas others rather indicate hyperthyroidism. We thus hypothesized that neurons exclusively dependent on Mct8 are in a hypothyroid state, whereas neurons expressing other T(3) transporters become hyperthyroid, if they are exposed directly to the high plasma T(3). The majority of T(3) uptake in primary cortical neurons is mediated by Mct8, but pharmacological inhibition suggested functional expression of additional T(3) transporter classes. mRNAs encoding six T(3) transporters, including L-type amino acid transporters (LATs), were coexpressed with Mct8 in isolated neurons. We then demonstrated Lat2 expression in cultured neurons and throughout murine brain development. In contrast, LAT2 is expressed in microglia in the developing human brain during gestation, but not in neurons. We suggest that lack of functional complementation by alternative thyroid hormone transporters in developing human neurons precipitates the devastating neurodevelopmental phenotype in MCT8-deficient patients, whereas Mct8-deficient mouse neurons are functionally complemented by other transporters, for possibly Lat2.

  11. Syntheses, structural variants and characterization of AInM′S4 (A=alkali metals, Tl; M′ = Ge, Sn) compounds; facile ion-exchange reactions of layered NaInSnS4 and KInSnS4 compounds

    Yohannan, Jinu P.; Vidyasagar, Kanamaluru

    2016-01-01

    Ten AInM′S 4 (A=alkali metals, Tl; M′= Ge, Sn) compounds with diverse structure types have been synthesized and characterized by single crystal and powder X-ray diffraction and a variety of spectroscopic methods. They are wide band gap semiconductors. KInGeS 4 (1-β), RbInGeS 4 (2), CsInGeS 4 (3-β), TlInGeS 4 (4-β), RbInSnS 4 (8-β) and CsInSnS 4 (9) compounds with three-dimensional BaGa 2 S 4 structure and CsInGeS 4 (3-α) and TlInGeS 4 (4-α) compounds with a layered TlInSiS 4 structure have tetrahedral [InM′S 4 ] − frameworks. On the other hand, LiInSnS 4 (5) with spinel structure and NaInSnS 4 (6), KInSnS 4 (7), RbInSnS 4 (8-α) and TlInSnS 4 (10) compounds with layered structure have octahedral [InM′S 4 ] − frameworks. NaInSnS 4 (6) and KInSnS 4 (7) compounds undergo facile topotactic ion-exchange, at room temperature, with various mono-, di- and tri-valent cations in aqueous medium to give rise to metastable layered phases. - Graphical abstract: NaInSnS 4 and KInSnS 4 compounds undergo, in aqueous medium at room temperature, facile topotactic ion-exchange with mono, di and trivalent cations. Display Omitted - Highlights: • Ten AInM′S 4 compounds with diverse structure types were synthesized. • They are wide band gap semiconductors. • NaInSnS 4 and KInSnS 4 compounds undergo facile topotactic ion-exchange at room temperature.

  12. Hiinlased upitavad Venezuelat kosmosesse / Allan Espenberg

    Espenberg, Allan

    2005-01-01

    Mullu kirjutasid Venezuela ja Hiina on alla kirjutanud kosmosekokkuleppele, lisaks sõlmiti veel kümmekond lepingut kahepoolsete sidemete tihendamiseks põllumajanduses, mäetööstuses, transpordis, energeetikas, telekommunikatsioonis ja turismis

  13. Tutanhamon saab uue viimse puhkepaiga / Allan Espenberg

    Espenberg, Allan

    2005-01-01

    Egiptuses hakatakse ehitama hiigelsuurt muuseumi, mis eksponaatide kõrval mahutaks ka kunstiteoste restaureerimise töökodasid ja Ramses II 12 m kõrguse kuju. Muuseum tuleks Giza püramiididest põhja poole. Projekti autor Iirimaa arhitektuuribüroo Heneghan Peng Architects

  14. A demographic outline / Kalev Katus, Allan Puur

    Katus, Kalev, 1955-2008

    2002-01-01

    Ajalooline ülevaade Eesti elanikkonna kujunemisest ning Eestit läbinud migratsioonivoogudest Nõukogude okupatsiooni perioodil, mis on suuresti mõjutanud Eesti tänast demograafilist olukorda. Tabel ja diagrammid: Eestlaste ja välismaalaste arv Eestis 1922-2000; Välismaalaste osakaal Eestis päritolumaa järgi; Rahvusvahelised migratsioonivood Eestis 1946-1999; Välismaalaste osakaal valitud Euroopa riikides. Kaart.

  15. Venezuela paneb kokku regionaalset energeetikaliitu / Allan Espenberg

    Espenberg, Allan

    2007-01-01

    Venezuela pealinnas toimus organisatsiooni Petrocaribe kolmas tippkohtumine. Petrocaribe, mis liidab peamiselt Kariibi mere riike ja tegeleb energeetikaküsimustega, algatas 2 aastat tagasi Venezuela president Hugo Chavez. Organisatsiooni kuulub 16 riiki

  16. Angola : valimisi oodatakse ja kardetakse / Allan Espenberg

    Espenberg, Allan

    2008-01-01

    Angolas pole 16 aastat toimunud parlamendi- ja presidendivalimisi. 30 aastat võimul olnud president Jose Eduardo dos Santos kuulutas riigis välja valimised, mis peaksid toimuma käesoleval aastal 5. ja 6. septembril

  17. Mehhikos on ametis kaks presidenti / Allan Espenberg

    Espenberg, Allan

    2006-01-01

    Senine seaduslik riigipea Vicente Fox lahkus küll uue presidendi Felipe Calderon Hinojosa inauguratsiooni järel 1. detsembril ametist, kuid Mehhiko 1910. aasta revolutsiooni aastapäeval 20. novembril kuulutas end presidendiks ka juulikuiste presidendivalimiste kaotaja Andres Manuel Lopex Obrador

  18. Linnud sõjas / Allan Valge

    Valge, Allan

    2005-01-01

    Täispikk arvutianimatsioon "Valiant" : stsenarist George Webster : režissöör Gary Chapman : produtsent John Williams : Suurbritannia 2005. Lisatud Jaan Ruusi poolt kogutud väljavõtteid arvustustest inglise meedias

  19. Ecuador pagendas neljanda riigipea / Allan Espenberg

    Espenberg, Allan

    2005-01-01

    Ecuadori parlament tagandas riigipea Lucio Gutierreze. L. Gutierrez, kellele sai saatuslikuks kolmele ekspresidendile amnestia andmine, pages koos perega Brasiiliasse. Lisa: Kontinendi üks sportlikumaid presidente

  20. Jabur jaht Sudaani presidendile / Allan Espenberg

    Espenberg, Allan

    2009-01-01

    Haagis tegutsev Rahvusvaheline Kriminaalkohus andis käsu Sudaani presidendi Omar Hassan Ahmad al-Bashiri vahistamiseks, keda süüdistatakse inimsusevastastes ja sõjakuritegudes ning Darfuri provintsis tsiviilelanike genotsiidi organiseerimises

  1. Skandaalne visioon : Portugal kaob / Allan Espenberg

    Espenberg, Allan

    2007-01-01

    Välismaal elav Portugali kirjanik Jose Saramago tegi ettepaneku, mille kohaselt muudetaks Portugali riik üheks Hispaania provintsiks, tekkinud uus riik võiks aga kanda Iberia nime. Kaart: Uus Euroopa riik? Lisa: Õpetab ka teisi riike

  2. Uruguay valitsus hakkab riiki korrastama / Allan Espenberg

    Espenberg, Allan

    2005-01-01

    Esimest korda tuleb nii valitsuse kui parlamendi tasandil Uruguays võimule vasakpoolne koalitsioon, mis suutis eemale tõrjuda kokku 174 aastat võimul olnud kahte parteid. Uueks presidendiks sai Tabare Vazquez, kelle poolt hääletasid pooled valijad

  3. Sotsialistide suur edu asendumas kaotusega / Allan Espenberg

    Espenberg, Allan

    2006-01-01

    Portugali senise võimuerakonna, peaminister Jose Socrates Carvalho Pinto de Sousa juhitud sotsialistliku valitsuse populaarsus on tunduvalt vähenenud. Tõenäoliselt peab peaminister välja kuulutama ennetähtaegsed parlamendivalimised

  4. Eesti sai oma koorealgoritmi / Allan Sims

    Sims, Allan, 1975-

    2016-01-01

    Kuna senised meetodid puude koore paksuse mõõtmiseks polnud Eesti oludes kasutamiseks piisavalt täpsed, töötasid teadlased välja algoritmi, mille abil oskavad harvesterid mahavõetud puude koore paksust edaspidi täpsemalt hinnata

  5. Bangladeshis madistab kaks naist / Allan Espenberg

    Espenberg, Allan

    2006-01-01

    Sisepoliitilised pinged Bangladeshis, kus kehtib maailmas küllaltki ainulaadne süsteem, mis näeb ette mõni kuu enne üldvalimisi valitud valitsuse lahkumist ning võimu üleandmist ajutisele üleminekukabinetile

  6. contemplating allan boesak's fascination with preaching

    ... there is not always sufficient emphasis upon ... how that Word can become a living ... democracy, we can get a picture of how political power is structured. With ... South African society, there seem to be no prospects for a better future other than ..... own transgressions and we don't remember our own sins and we miss the ...

  7. Angola üllatas valimistega / Allan Espenberg

    Espenberg, Allan

    2008-01-01

    Angolas toimusid peale 16 aastast vaheaega parlamendivalimised, kus ülekaaluka võidu saavutas Angola Vabastamise Rahvaliikumine (MPLA). Uus peaminister teatas Antonio Paulo Kassoma, et tema prioriteedid on MPLA programmi elluviimine ja lähtumine Jose Eduardo dos Santose antud suunistest

  8. Costa Ricat vapustavad ekspresidendi kuriteod / Allan Espenberg

    Espenberg, Allan

    2004-01-01

    Ameerika Riikide Organisatsiooni juhiks vannutatud Costa Rica endine president Miguel Angel Rodriguez leiti olevat süüdi korruptiivsetes tehingutes. Teisigi Costa Rica endisi presidente on süüdistatud korruptsioonis

  9. Mali president kaotaks surmanuhtluse / Allan Espenberg

    Espenberg, Allan

    2007-01-01

    Mali president Amadou Tourmani Toure pöördus riigi iseseisvuse väljakuulutamise 47. aastapäeva puhul rahva poole läkitusega, kus teatas surmanuhtluse likvideerimise seaduseelnõu parlamenti saatmisest. Presidendi säärane initsiatiiv pole aga meeltmööda Mali moslemivaimulikele. Praeguseks on Amnesty Internationali andmetel umbes pooled maailma riikidest surmanuhtluse tühistanud

  10. Rwanda kuningas igatseb kodumaale tagasi / Allan Espenberg

    Espenberg, Allan

    2007-01-01

    Ameerika Ühendriikides Washingtonis elav Rwanda kuningas Kigeli V pole kodumaad külastanud 48 aastat. Riigi praegune president Paul Kagame sõnul võib pagenduses viibiv kuningas naasta kodumaale vaid tavakodanikuna ning mingit eristaatust talle ei anta

  11. Production of biosurfactant on crude date syrup under saline conditions by entrapped cells of Natrialba sp. strain E21, an extremely halophilic bacterium isolated from a solar saltern (Ain Salah, Algeria).

    Kebbouche-Gana, Salima; Gana, Mohamed Lamine; Ferrioune, Imen; Khemili, Souad; Lenchi, Nesrine; Akmouci-Toumi, Sihem; Bouanane-Darenfed, Nabila Amel; Djelali, Nacer-Eddine

    2013-11-01

    A bacterial strain E21 was isolated from a sample of water collected in the salt lake located close to Ain Salah, Algeria. The analysis of 16S rRNA gene sequence had indicated that the strain had 93 % sequence similarity with the genus Natrialba sp. strain E21 (GenBank, FR750525.1) and was considered extremely halophilic. Production of biosurfactant by the strain E21 with free and entrapped cells was investigated using soluble starch in the saline conditions. Biosurfactant synthesis was followed by measuring the surface tension and emulsifying index 9 days under optimal conditions (40 °C, pH 7). Some diffusional limitations in alginate and agar beads affected the kinetics of biosurfactant production when compared to that obtained with free cells culture. The minimum values of surface tension were 27 and 30 mN m(-1) achieved after 9 days with free and immobilized cells, respectively, while the corresponding maximum E24 values were 65.3 and 62.3 %, respectively. The re-use of bacterial cells along with the limited cell losses provided by the immobilized system might lead to significant reduction of the biosurfactant production cost.

  12. Concilier développement agricole et usage pérenne des eaux souterraines : un dialogue multi-acteurs dans la zone d’Ain Timguenay (province de Séfrou

    Issam Sellika

    2016-10-01

    Full Text Available Au Maroc, l’utilisation des eaux souterraines pour l’irrigation a permis un développement agricole rapide dans de nombreuses régions, mais a aussi fait émerger des situations de baisse des niveaux piezométriques des nappes qui menacent la durabilité de cette agriculture irriguée. L’article présente une action de recherche portant sur la conception d’un projet de territoire agricole durable alliant développement agricole et usage pérenne des ressources en eau souterraine. L’étude a eu lieu dans la zone d’Ain Timguenay (province de Séfrou, qui connait un fort développement de la production de pommes et de prunes depuis une quinzaine d’années. Le programme de recherche a impliqué les agriculteurs, la commune rurale d’Ain Timguenay, les institutions du Ministère de l’Agriculture et l’Agence de bassin hydraulique du Sébou. Une analyse des dynamiques agricoles locales et des tendances nationales a servi de support aux discussions. L’étude de l’aquifère et de ses usages a permis d’établir un bilan sommaire et un ordre de grandeur des surfaces qui pourraient encore être plantées sans que les consommations en eau soient supérieures à la recharge de l’aquifère en année pluviométrique moyenne. Une réflexion prospective menée avec les agriculteurs a mis en évidence deux scénarios possibles à l’échelle locale: 1 un scénario où les difficultés économiques que rencontrent actuellement les exploitations de la zone se renforcent, conduisant à un ralentissement des nouvelles plantations, d’où une pression limitée sur la nappe ; 2 un scénario où les exploitations réussissent à faire face aux défis actuels de production et de commercialisation et de ce fait continuent à planter, ce qui conduit à une consommation en eau bien supérieure à la recharge de la nappe. L’ensemble des acteurs impliqués a participé à l’élaboration d’un troisième scénario permettant de concilier d

  13. Teacher Tenure "Ain't" the Problem.

    Hansen, Kenneth; Ellena, William J.

    The concept of "tenure," with all its clumsy and confusing burden of historic and current misinterpretation, will probably soon disappear. However, what tenure laws intended, and have failed to do, will almost surely be preserved in other forms of administrative procedure. To be effective, administrative procedures must be (1) clear and detailed,…

  14. VJ annab muusikale visuaalsuse / Ain Kivesti

    Kivesti, Ain

    2008-01-01

    Videograafikast. Video jockey ehk videokunstnik maalib kunstiteoseid piltide ja visuaalsete elementide abil, tehes seda muusika taustal, tavaliselt paralleelselt disco jockey'ga. Toomas Altnurme, Taavi Varmi, Sten Saluveeri ja Erki Kannuse kommentaare

  15. Investorid on dilemma ees / Ain Kivisaar

    Kivisaar, Ain, 1978-

    2007-01-01

    Keskmise kuupalga eest ei saa enam ruutmeetritki elamispinda ei meil ega mujal. Aktiivsel investoril pole muud teha, kui heita kõrvale tavatarkus ja usaldada enda sisetunnet. Diagramm: Keskmise kuupalga ja korteri ruutmeetri hinna suhe

  16. Euroopa abiraha igatseb taotlejaid / Ain Alvela

    Alvela, Ain, 1967-

    2008-01-01

    Aastatel 2007-2013 saab Eesti Euroopa Liidult toetusi 78 miljardit krooni, millele toetudes on võimalik rasked ajad üle elada. Vt. samas: Tuhahoidlast asula jäätmepunktini; Suurima toetuse saab keskkond. Kommenteerivad Antti Tooming ja Kai Niels Willadsen

  17. Rumsfeldi ei ole kunagi unustatud / Ain Lember

    Lember, Ain

    2004-01-01

    Väljaandes Teheran Times ilmunud Kian Mokhtari artiklist, milles käsitletakse USA kaitseministri Donald Rumsfeldi poliitikukarjääri, tema süüdistamist Iraagile massihävitusrelvade ja nendega seotud tehnoloogia müümise soodustamises 1980-ndatel aastatel, Iraagi-poolset keemiarelva kasutamist Iraani vastu

  18. Külmetav haigekassa / Ain Aaviksoo

    Aaviksoo, Ain, 1974-

    2008-01-01

    Autori hinnangul on suur oht, et Eesti patsiente ootab ees Läti saatus, kus on 40-50% tervishoiukuludest patsientide endi kanda. Eesti ees seisvaid valikuid analüüsides oleks parim valik ravikindlustuse reservide läbimõeldud kasutuselevõtt, kuid eeldusel, et otsitakse ravikindlustuse rahastamisele pikaajalisi sisulisi lahendusi. Graafik: Haigekassa kulude suhteline muutus

  19. Makita kalmistu antropoloogiline aines / Luule Heapost

    Heapost, Luule

    1993-01-01

    Tabel : Makita koljude keskmised mõõtmed ; Tabel : 13.-15. sajandi Makita koljud ja võrdlusmaterjalid Eestist ; Tabel 3 : 13. -15. sajandi Makita koljud ning võrdlusandmeid soome-ugri hõimude asualadelt ; Tabel 4 : 15.- 17. sajandi Makita koljud ja võrdlusandmed ; Tabel 5 : Makita koljude võrdlusandmed (Pernose'i meetodil) ; Tabel 6 : Makita luustike pikkade luude keskmine pikkus ; Tabel 7 : Kehapikkuse võrdlusandmed

  20. Globaalsus + lennundus = Star Alliance? / Ain Hinsberg

    Hinsberg, Ain

    2002-01-01

    Erinevad koostöövormid lennufirmade vahel, alliansside teke ja areng maailmas. Maailma juhtivad lennundusalliansid ja nende poolt kaetud riigid ja sihtkohad. Kommenteerib Estonian Airi president Erki Urva

  1. Lahesõjas viik / Ain Hinsberg

    Hinsberg, Ain

    2001-01-01

    Helsingi ja Tallinna vahel liikuvate laevafirmade konkurents: Silja Line, Nordic Jet Line, Tallink ja Linda Line. Tabelid: reisijad laevaliinil Helsingi-Tallinn 1998-2001; Helsingi-Tallinna liinil kiirlaevade turuosad 1999-2000

  2. Norma Maja astub kindlalt tulevikku / Ain Alvela

    Alvela, Ain, 1967-

    2000-01-01

    AS Norma Maja saavutas kõrged kasumi ja kasumi kasvu näitajad töötajate koondamisega. Tabel: Norma Maja valdused, AS Norma Maja areng, AS ETK Majad areng. Arvamused: Ero Toom, Ivar Lahi ja Rein Loo

  3. You ain't seen nothing yet

    Walhof, Gert

    Omtrent technologiebedrijven konden we in december 2016 veel lezen over wat artificial intelligence, virtual reality, machine-to-machine automation, machine-to-machine learning en chatbots ons de komende jaren gaan brengen. Als inkoper zou je kunnen wachten tot duidelijk wordt wat de blijvertjes

  4. THE ROLE OF FARMERS IN MANAGING WATER Dr Tony Colman Professor Tony Allan Farmers manage about 92% of the water consumed by society which needs to recognise that farming practices and the decisions made by those who operate food supply chains - including corporates and those making public policy - determine how water is stewarded.

    Colman, A. J.

    2017-12-01

    Title Food-water and society Dr. Tony Colman and Professor Tony Allan Abstract The purpose of the paper is to highlight some key relationships between water resources and society. First, water is an very important resource for society in that it provides an essential input to society's food supply chains. Secondly, it is an essential input to farmer livelihoods. About half of the families of the world still work in agriculture - albeit a declining proportion. Thirdly, farmers manage about 92% of the water consumed by society - including the blue water (surface and groundwater) for irrigation and the green water (effective rainfall) consumed on rainfed farms. They also account for about 66% of society's impacts on biodiversity and about 25% of emissions. Finally it will be argued that those who analyse allocation and management of water must recognise that farming practices and the decisions made by those who operate food supply chains - including corporates and those making public policy - must recognise that it is farmers and food consumers who determine how water is stewarded. It will be suggested that we need to understand that well informed consumers could be the regulators.

  5. Syntheses, structural variants and characterization of AInM′S{sub 4} (A=alkali metals, Tl; M′ = Ge, Sn) compounds; facile ion-exchange reactions of layered NaInSnS{sub 4} and KInSnS{sub 4} compounds

    Yohannan, Jinu P.; Vidyasagar, Kanamaluru, E-mail: kvsagar@iitm.ac.in

    2016-06-15

    Ten AInM′S{sub 4} (A=alkali metals, Tl; M′= Ge, Sn) compounds with diverse structure types have been synthesized and characterized by single crystal and powder X-ray diffraction and a variety of spectroscopic methods. They are wide band gap semiconductors. KInGeS{sub 4}(1-β), RbInGeS{sub 4}(2), CsInGeS{sub 4}(3-β), TlInGeS{sub 4}(4-β), RbInSnS{sub 4}(8-β) and CsInSnS{sub 4}(9) compounds with three-dimensional BaGa{sub 2}S{sub 4} structure and CsInGeS{sub 4}(3-α) and TlInGeS{sub 4}(4-α) compounds with a layered TlInSiS{sub 4} structure have tetrahedral [InM′S{sub 4}]{sup −} frameworks. On the other hand, LiInSnS{sub 4}(5) with spinel structure and NaInSnS{sub 4}(6), KInSnS{sub 4}(7), RbInSnS{sub 4}(8-α) and TlInSnS{sub 4}(10) compounds with layered structure have octahedral [InM′S{sub 4}]{sup −} frameworks. NaInSnS{sub 4}(6) and KInSnS{sub 4}(7) compounds undergo facile topotactic ion-exchange, at room temperature, with various mono-, di- and tri-valent cations in aqueous medium to give rise to metastable layered phases. - Graphical abstract: NaInSnS{sub 4} and KInSnS{sub 4} compounds undergo, in aqueous medium at room temperature, facile topotactic ion-exchange with mono, di and trivalent cations. Display Omitted - Highlights: • Ten AInM′S{sub 4} compounds with diverse structure types were synthesized. • They are wide band gap semiconductors. • NaInSnS{sub 4} and KInSnS{sub 4} compounds undergo facile topotactic ion-exchange at room temperature.

  6. Hämarad tehingud kurnavad riiki / Allan Espenberg

    Espenberg, Allan

    2008-01-01

    Bulgaarias lokkab kuritegevus ja korruptsioon. Opositsioon on algatanud viimase kahe aasta jooksul eri põhjustel viiel korral umbusaldushääletuse organiseeritud kuritegevusega seotuses kahtlustatava koalitsioonivalitsuse vastu. Aprillis astus tagasi siseminister Rumen Petkov

  7. Väikese saareriigi ületamatu probleem / Allan Espenberg

    Espenberg, Allan

    2008-01-01

    Küprose türklaste president Mehmet Ali Talat ja Kreeka-osa uus president Demetris Christofias pidasid läbirääkimisi, mille peateemaks oli võimufunktsioonide jaotumine ning türgi ja kreeka kogukondade staatus ühise föderatiivse riigi loomise korral

  8. Hispaanlased lähevad Afganistani ja Haitisse / Allan Espenberg

    Espenberg, Allan

    2004-01-01

    Aprillis Hispaania uueks peaministriks saanud Jose Luis Rodriguez Zapatero lasi väed Iraagist ära tuua. Nüüd andis parlament valitsusele loa suurendada riigi väekontingenti Afganistanis ja asuda tegutsema ka Haitis

  9. Mosambiigi rikkaim mees presidendiks tõusmas / Allan Espenberg

    Espenberg, Allan

    2004-01-01

    Presidendivalimistest Mosambiigis, kus valimas käis vaid 30% kodanikest. Enim hääli kogusid valitsust esindav ärimees Armandi Guebuza ja sissiorganisatsiooni ning opositsiooniliikumise RENAMO liider Alfonso Dhlakama

  10. Galicia peab valima vana või uue / Allan Espenberg

    Espenberg, Allan

    2005-01-01

    19. juunil toimuvad valimised Hispaania autonoomses piirkonnas Galicias. Arvamusküsitluste tulemused näitavad, et konservatiivset Rahvaparteid ja tema liidrit Manuel Fraga Iribarnet toetab 45 protsenti piirkonna valijatest

  11. Briti eksimpeerium käib koos / Allan Espenberg

    Espenberg, Allan

    2007-01-01

    Ugandas peeti Briti Rahvaste Ühenduse (e. Commonwealth) valitsusjuhtide tippkohtumist. Kohtumise avas Briti kuninganna Elizabeth II, kes on ühenduse paljude maade nominaalne riigipea. Seoses keerulise sisepoliitilise olukorraga Pakistanis ja sealse presidendi Pervez Musharaffi tegevusega otsustati Pakistan ühenduse koosseisust ajutiselt välja arvata

  12. Colonia Dignidadi kuulsusetu lõpp / Allan Espenberg

    Espenberg, Allan

    2004-01-01

    Ligi kaheksa aastat kestnud juurdlus Colonia Dignidadi üle jõudis Tšiili kohtusaalis konkreetsete tulemusteni - 23 kohtualust mõisteti vangi koloonia juhi Paul Schäfer'i asukoha varjamise ja kohtuorganite uurimistöö takistamise eest. P. Schäferit süüdistatakse lisaks lasteahistamisele inimröövides, piinamistes ning tapmistes

  13. Ecuador ajas narkovastase baasi ära / Allan Espenberg

    Espenberg, Allan

    2009-01-01

    2008. aastal võttis Ecuadori Asutav Kogu president Rafael Correa kihutusel vastu otsuse keelata välisriikidel Ecuadoris sõjaväebaase omada. 17. sept. lahkusidki viimased USA sõdurid Ecuadori sõjaväebaasist

  14. Edgar Allan Poe's "Ligeia": an object-relational interpretation.

    Zlotnick-Woldenberg, C

    1999-01-01

    This paper argues that Poe's short story "Ligeia," in which the narrator experiences the death of his adored first wife (Ligeia), a second marriage to the despised Rowena, and ultimately the death of Rowena and the revivification of Ligeia, is not a supernatural tale, but rather a psychological one. According to this reading, the poisoning of Rowena and the revivification of Ligeia are hallucinated by the narrator in the course of an opium-induced psychotic break. The antecedents to this break are explored in light of object relations theory, with particular emphasis placed on the way in which the two women function as part objects. Ligeia represents the narrator's romantic and spiritual side and is associated with the good mother, while Rowena, who represents his more mundane and materialistic side, is associated with the rejecting mother. It is argued that the narrator, functioning primarily in the schizoid position and employing such defense mechanisms as splitting and projection--which already require a high degree of fantasy--is not an unlikely candidate for such a break.

  15. Gaboni riigipea lahkub presidendipaleest vaid jalad ees / Allan Espenberg

    Espenberg, Allan

    2005-01-01

    Kesk-Aafrika riigi Gaboni president Omar Bongo püüab detsembris toimuvatel presidendivalimistel taotleda enda tagasivalimist. Bongo on juhtinud Gaboni 38 aastat, olles sellega Aafrika riigipeade hulgas kõige staazhikam valitseja

  16. Bhutan tõrjus India oma asjade ajamiselt / Allan Espenberg

    Espenberg, Allan

    2007-01-01

    Bhutani kuningas Jigme Khesar Namgyal Wangchuk ja India president Abdul Kalam allkirjastasid lepingu, mille kohaselt saab Bhutan endale suuremad õigused ja vabadused iseseisvamalt välis- ja kaitsepoliitikat ajada

  17. Organisatsioon otsib peasekretäri / Allan Espenberg

    Espenberg, Allan

    2005-01-01

    Ameerika Riikide Organisatsiooni peasekretär Miguel Angel Rodriguez astus tagasi, kuna päevavalgele tuli mitu korruptsioonijuhtu, millesse ta Costa Rica presidendina oli segatud. Uuteks kandidaatideks on Tšiili siseminister Jose Miguel Insulza, Mehhiko välisminister Luis Ernesto Derbez ja El Salvadori ekspresident Francisco Flores

  18. Ladina-Ameerika saab elektroonilise valuuta / Allan Espenberg

    Espenberg, Allan

    2008-01-01

    Ladina-Ameerika riikide Venezuela, Kuuba, Boliivia, Hondurase, Nicaragua, Dominica ja Ecuadori ühendus ALBA on alustanud ettevalmistustega ühise virtuaalse valuuta, sucre, sisseseadmiseks ning ühtse majandus- ja rahandustsooni loomiseks

  19. Veretu retrobuum : [ka TPÜ AR kohvikust] / Allan Hmelnitski

    Hmelnitski, Allan

    2004-01-01

    "Ka mina eelistan kõigi söögikohtade seast Teaduste Akadeemia puhvetit, mis on 100% breezhnevi aegne disain - kunstnahast lett, ümmargused madalad lauad, pikk-pikk nahkdiivan, kurgid ja tomatid mis maitsevad hästi ja tugevalt, täpselt nagu aastal 85, hallides ülikondades vanemad härrad vestlemas põlevkivist ja paeklindi ajaloost. Vot see on tõeline petlik naiivsus, turvalisus, rahu, muretus ja stabiilsus nagu aastal 76 ema süles."

  20. Genetics Home Reference: Allan-Herndon-Dudley syndrome

    ... cells in the developing brain. This hormone, called triiodothyronine or T3, is produced by a butterfly-shaped ... with X-linked psychomotor retardation and elevated serum triiodothyronine. J Clin Endocrinol Metab. 2007 Jun;92(6): ...

  1. Island otsib sõjalisi kaitseingleid / Allan Espenberg

    Espenberg, Allan

    2007-01-01

    Islandil toimuvatel parlamendivalimistel peaks arvamusküsitluste kohaselt enam kui 40% valijatest toetama Iseseisvusparteid, teisele kohale jäävad sotsiaaldemokraadid 23,5% ning neile järgnevad rohelised 17,6 ja Progressiivne Partei 10%-ga. Ka Islandi-Norra kahepoolsest lepingust, mis tihendab kaitse- ja julgeolekualast koostööd

  2. Altkäemaksuskandaal kukutas Peruu valitsuse / Allan Espenberg

    Espenberg, Allan

    2008-01-01

    Oktoobri algul puhkes Peruus ulatuslik korruptsiooniskandaal, millesse olid segatud riigi kõrged ametiisikud. Skandaali tulemusena vabastati peaminister ja tema juhitud valitsus. Uueks peaministriks nimetati vasakpoolsete vaadetega Yehude Simon Munaro

  3. Jalgpallisõjal polnud jalgpalliga mingit seost / Allan Espenberg

    Espenberg, Allan

    2005-01-01

    14. juulil 1969 ründas El Salvador riigipea Fidel Sanchez Hernandeze korraldusel naaberriiki Hondurast. Rahulepinguni jõuti pärast ülikeerukaid ja mitmel korral katkenud läbirääkimisi alles 1980. aastal

  4. Hudoi mir lutshshe dobroi ssorõ / Allan Soon

    Soon, Allan, 1968-

    2007-01-01

    Eestlaste ja venelaste vahelistest suhetest pärast pronkssõduri teisaldamisega toimunud sündmusi. Autori arvates peaksid nii eestlased kui ka venelased astuma samme konflikti lahendamiseks, mitte jääma passiivselt ootama

  5. Miljardär premeerib äraostmatuid / Allan Espenberg

    Espenberg, Allan

    2009-01-01

    Sudaani päritolu ärimees Mo Ibrahim pani välja auhinna Aafrika riigijuhile, kes suudab valitseda demokraatlikult ja võidelda korruptsiooniga, kaks korda on seda välja antud, kuid sel aastal ei leitud ühtegi väärilist kandidaati

  6. Rwandas võtsid võimu naised / Allan Espenberg

    Espenberg, Allan

    2008-01-01

    Septembris toimunud parlamendivalimiste järel sai Aafrikas asuvast Rwandast esimene riik, kus parlamendiliikmete hulgas on rohkem naisi kui mehi. Ka parlamendi alamkoja etteotsa valiti naine - naisõiguslane ja õigusteaduste doktor Rose Mukantabana

  7. USA luure : Fidel Castro on suremas / Allan Espenberg

    Espenberg, Allan

    2006-01-01

    Kuuba president Fidel Castro, Haiti president Rene Preval, Filipiinide president Gloria Macapagal-Arroyo, Türkmenistani president Saparmurat Nijazov, Guinea president Lansana Conte ja Itaalia ekspeaminister Silvio Berlusconi, Sambia ekspresident Frederick Chilubaga võitlevad terviseprobleemidega

  8. Vanuatu-Taiwani sõprus masendab Hiinat / Allan Espenberg

    Espenberg, Allan

    2004-01-01

    Taiwan hakkab laiendama ja tihendama majanduslikku, tehnilist, turismi- ja põllumajandusalast koostööd Vanuatuga. Hiina kasutab suhtlemisel maailma riikidega vastavalt vajadusele survepoliitikat eeskätt majanduse ja rahanduse vallas ning pakub riikidele Taiwaniga suhtlemise lõpetamise eest erinevat finants- ja majandusabi. Lisa: Vanuatu vabariik

  9. Aafrika saab endale esimese ühisarmee / Allan Espenberg

    Espenberg, Allan

    2007-01-01

    Lõuna-Aafrika riikide majandusühenduse (Southern African Development Community) SADCi peaeesmärkidest ja tegevusest. Organisatsiooni 27. tippkohtumisel valiti uueks esimeheks Sambia president Levy Mwanawasa, samas otsustati moodustada ka regionaalne armee, mille peamiseks ülesandeks on rahumissioonide korraldamine ja elluviimine

  10. Naise võim Bermudas : kubjas kukutati / Allan Espenberg

    Espenberg, Allan

    2003-01-01

    Suurbritanniale kuuluva Bermuda saare parlamendivalimised vallandasid sündmuste ahela, mis võivad muuta asumaa poliitikat. Ametist tagandati peaminister Jennifer Meredith Smith ja uueks peaministriks sai senine tööminister William Alexander Scott

  11. Rwanda endine president jäi vanglasse / Allan Espenberg

    Espenberg, Allan

    2006-01-01

    Rwanda ekspresident Pasteur Bizimungu arreteeriti 2002. aastal, kui ta püüdis moodustada uut poliitilist parteid, mis uutele võimudele ei meeldinud. Ta mõisteti 2004. aasta juunis süüdi kolmes kuriteoepisoodis

  12. Kesk-Ameerika võitleb uimastimaffia vastu / Allan Espenberg

    Espenberg, Allan

    2008-01-01

    USA parlament andis rohelise tee Merida initsiatiivile, mis näeb ette Mehhikole, Kesk-Ameerika riikidele ja Kariibi maadele organiseeritud kuritegevuse vastu võitlemiseks majanduslikku ja tehnilist abi

  13. Maldiivide saareriigis kukutati igipresidendiks peetud mees / Allan Espenberg

    Espenberg, Allan

    2008-01-01

    Maldiividel toimusid 8. oktoobril riigi ajaloo esimesed demokraatlikud valimised, sai valida mitme presidendikandidaadi vahel. 35 aastat riiki valitsenud president Maumoon Abdul Gayoom jäi valimistel alla opositsiooni kandidaadile Mohamed Nasheedile

  14. Fernando Ortiz e Allan Kardec: espiritismo e transculturação Fernando Ortiz and Allan Kardec: spiritism and transculturation

    Arcadio Díaz Quiñones

    2011-01-01

    Full Text Available Este ensaio explora a importância do espiritismo de Kardec para os princípios de Fernando Ortiz e para seu longo, por vezes tortuoso, inquérito que o leva à noção de "transculturação". Em seus anos de formação, Ortiz foi profundamente influenciado por Lombroso, mas também, como tantos outros escritores e intelectuais, por Kardec. Ele publicou ensaios fundamentais sobre o espiritismo, especialmente sobre as implicações da reencarnação para hierarquias espirituais e sociais. A doutrina de Kardec sobre o progresso espiritual da alma permitiu a Ortiz defender um projeto nacional mais inclusivo. O kardecismo também forneceu metáforas que correm como um fio por seus trabalhos mais importantes sobre as culturas africanas em Cuba, e também por sua poética. A "transmigração" das almas, com suas possibilidades de constantes novos princípios, permitiu a Ortiz introduzir um elemento espiritual e político na ideia de largo alcance que é a transculturação.This essay explores the importance of Kardec's Spiritism in Fernando Ortiz's beginnings and in his long, often roundabout, inquiry leading to the notion of "transculturation". In his formative years Ortiz was deeply influenced by Lombroso but also, like so many other writers and intellectuals, by Kardec. He published fundamental essays on Spiritism, especially on the implications of reincarnation for spiritual and social hierarchies. Kardec's doctrine of the spiritual progress of the soul allowed Ortiz to argue for a more inclusionary national project. Kardecism also provided metaphors that run like a thread through Ortiz's major works on African cultures in Cuba and in his poetics. The "transmigration" of the souls, with its possibilities of endless new beginnnings, enabled Ortiz to introduce a spiritual and political element into the far-ranging idea of transculturation.

  15. Allan Martinson: vajame 10 000 tarka välismaalast / Allan Martinson ; intervjueerinud Toivo Tänavsuu

    Martinson, Allan, 1966-

    2010-01-01

    Riskikapitalifirma MTVP asutaja ja tegevjuhi arvates peaks Eestisse meelitama tarku välismaalasi. Võiksime suurendada Eesti lojaalset kodanikkonda, jagades mõnelekümnele tuhandele Eesti patrioodile mujal maailmas Eesti kodakondsuse. Startup-liikumisest ja selle üritusest Garage48

  16. EFFETS D’UN ALIMENT EXTRUDE SUR LES PERFORMANCES DE CROISSANCE DE LA TRUITE ARC-EN-CIEL (ONCORHYNCHUS MYKISS WALBAUM, 1792 ET SUR LA QUALITE DE L’EAU DE L’OUED OUM ER-RBIA (STATION AIN AGHBAL, AZROU-MAROC

    Khadija OUAISSA

    2017-05-01

    Full Text Available The objective of our study is to test the efficacy of an extruded food on the growth performance of rainbow trout (Oncorhynchus mykiss Walbaum, 1792 at the fish farm Ain Aghbal in Azrou (Morocco. Generally, only the biochemical composition (percentages of moisture, proteins, lipids and carbohydrates and the (digestible and crude energies of the food are previously known, which is insufficient for the choice of the food in terms of growth performance and quality/environment. The rainbow trout breeding tanks used for this test are 222 days (15 June 2015 - 28 February 2016 are fed with water directly taken from the water of the Oum Er-Rbia sources according to an open circuit with a Renewal of water every half hour. The flow rate is 11.04m3/h. The initial breeding conditions, the density (Kg per volume 1.58kg/m3 and the initial charge with respect to the flow rate is 1.05 m3 / h. Fish are fed by ratios two to three times per day depending on the rearing stage. The frequency of sampling is biweekly where we measured the zootechnical performances of the fish and taken water samples for physicochemical analyzes in order to assess the quality of the waters of exit of the basins before their rejection in the Oum-Er-Rbia river. The results show that the test food shows a better growth of the rainbow trout and a conversion index not exceeding 0.9 for a size of 1043 g of trout.

  17. Advokaadi kutse-eetika reason d’etre / Ain Alvin

    Alvin, Ain, 1959-

    2014-01-01

    Advokaadi kohustus on kutsetegevuses järgida lisaks seadusele kutse-eetika nõudeid, häid kombeid ja südametunnistust. Mida sellised kohustused sisuliselt tähendavad, millest tuleneb vajadus kutse-eetika kutseühendusesisese reguleerimise järele ja milline on kutse-eetika normide sisu?

  18. Terve mõistusega ahnuse vastu / Ain Aaviksoo

    Aaviksoo, Ain, 1974-

    2005-01-01

    Dokumentaalfilm "Ülisuur mina" ("Super Size Me") : režissöör Morgan Spurlock : Ameerika Ühendriigid 2004. Turumajandusest, dieedist ja toitumisest, filmi hoiatavast osast eelkõige teistmelistele ja nende kasvatajatele

  19. Euroopa tootjad ei ole rahul USA survega / Ain Lember

    Lember, Ain

    2006-01-01

    Seoses USA survega Euroopa turgude avanemiseks ning probleemidega Brasiilia toidukaupade ekspordi osas, kutsub üleeuroopalise põllumajandustootjate liit COPA ja põllumajandustööandjate organisatsioonide liit COGECA Euroopa valitsusjuhte üles lõpetama järeleandmiste tegemise

  20. Invsteeringutoetuste saajate ring väheneb / Ain Lember

    Lember, Ain

    2009-01-01

    Eestimaa talupidajate keskliit ei ole rahul mikropõllumajandusettevõtte arendamise investeeringutoetuse (meede 1.4.1) ja loomakasvatusehitiste investeeringutoetuse (meede 1.4.2) määruses tehtud muudatustega

  1. Multivariate statistical characterization of groundwater quality in Ain ...

    Administrator

    blended water (group 3), based on the similarity of groundwater quality characteristics. Principal component analysis, applied to the data sets of the three different groups obtained from ...... from Butucatu aquifer in Sao Paulo State, Brazil.

  2. Saaremaa taotleb LIFE programmist 50 miljonit krooni / Ain Lember

    Lember, Ain

    2001-01-01

    Vilsandi Rahvuspark ja Pärandkoosluste Kaitse Ühing esitasid EL Komisjonile LIFE programmi raames projektitaotlused. Ajalehe küsimustele vastab Vilsandi rahvuspargi kaitsekorralduskava spetsialist Enn Kaljo

  3. Toodangu maht sõltub impordist / Ain Alvela

    Alvela, Ain, 1967-

    2002-01-01

    Saematerjali tootjate TOP 30. Käibe TOP 10. Käibe kasvu TOP 10. Kasumi TOP 10. Kasumi kasvu TOP 10. Rentaabluse TOP 10. Varade tootlikkuse TOP 10. Kahjumi TOP 5. Saematerjali tootjate finantsnäitajad. Saematerjali tootjate üldandmed. Tabelid

  4. Eestis käis ilmataadi maapealne asemik / Ain Kallis

    Kallis, Ain, 1942-

    2005-01-01

    Tänavu täitub 200 aastat pidevate instrumentaalsete ilmamõõtmiste algusest Eestis. Keskkonnaminister Villu Reiljan ja Euroopa Keskpika Ilmaennustuse Keskuse (European Centre for Medium-Range Weather Forecasts, ECMWF) direktor Dominique Marbouty kirjutasid alla koostöölepingule

  5. Peptic ulcer frequency differences related to h. Pylori or aines.

    Carli, Diego Michelon de; Pires, Rafael Cardoso; Rohde, Sofia Laura; Kavalco, Caroline Mayara; Fagundes, Renato Borges

    2015-01-01

    Peptic ulcer etiology has been changing because of H. pylori decline. To estimate peptic ulcer prevalence in 10 years-interval and compare the association with H. pylori and use of non-steroidal anti-inflammatory drugs. Methods Records assessment in two periods: A (1997-2000) and B (2007-2010), searching for peptic ulcer, H. pylori infection and non-steroidal anti-inflammatory drugs use. Peptic ulcer occurred in 30.35% in A and in 20.19% in B. H. pylori infection occurred in 73.3% cases in A and in 46.4% in B. Non-steroidal anti-inflammatory drugs use was 3.5% in A and 13.3% in B. Neither condition occurred in 10.4% and 20.5% in A and B respectively. Comparing both periods, we observed reduction of peptic ulcer associated to H. pylori (P=0.000), increase of peptic ulcer related to non-steroidal anti-inflammatory drugs (P=0.000) and idiopathic peptic ulcer (P=0.002). The concurrent association of H. pylori and non-steroidal anti-inflammatory drugs was also higher in B (P=0.002). Rates of gastric ulcer were higher and duodenal ulcer lower in the second period. After 10 years, the prevalence of peptic ulcer decreased, as well as ulcers related to H. pylori whereas ulcers associated to non-steroidal anti-inflammatory drugs increased. There was an inversion in the pattern of gastric and duodenal ulcer and a rise of idiopathic peptic ulcer.

  6. Kibuvits üllatab ja pakub leevendust / Ain Raal

    Raal, Ain, 1961-

    2005-01-01

    Taani teadlased avastasid-eraldasid kibuvitsaseemnetest ja viljakestadest uue põletikuvastase toimeaine galaktolipiidi (GOPO). Seda lipiidi sisaldub kõige enam koer-kibuvitsa alamliigis Hyben Vital Litos. Nüüdseks on GOPO saamisviis ja nimi patenteeritud nii Euroopas kui ka USAs

  7. Natura 2000 sai tuule tiibadesse Raplamaal / Ain Aivela

    Aivela, Ain

    2004-01-01

    Natura 2000 idee jõudis Eestisse 2000. aastal, mil pilootprojekti raames ning Taani riigi rahalisel toel alustati Natura-võrgustiku eelvalikualade mahamärkimist Lääne- ja Raplamaal. Kommenteerinud Aleksei Lotman

  8. Kevadelaul : [luuletused] / Federico Garcia Lorca ; tlk. Ain Kaalep

    García Lorca, Federico, 1898-1936

    2006-01-01

    Sisu: Kevadelaul ; Uued laulud ; Unenägu ; Uus süda ; Rõske siseõu ; Risttee : "Oh valu: mu värsid võtnud..." ; Ballaad mereveest ; Huile ; Vaikus ; Risttee : "Tuul puhub läänest..." ; Sevilla ; Kuus keelt ; Memento ; Kolm linna : Malaguena ; Cordoba agul ; Tants ; Kitarrimõistatus ; Poolkuu ; Neli kollast ballaadi ; Aadam ; Tasakaal ; Friis ; Maha raiuti kolm puud ; Teokarp ; Rumal laul ; Õhtu ; Ratsaniku laul ; Debussy ; Kuu tõuseb ; Kaks õhtust kuud ; Serenaad ; Laul lahkuvast päevast ; Kuuba neegrilaul ; Itk Ignacio Sanchez Mejiase surma puhul ; Madrigal Santiago linnale ; Hällilaul surnud Rosalia Castrole ; Kuu tants Santiagos ; Gaseel kohutavast lähedusest ; Gaseel tumedast surmast ; Gaseel põgenemisest ; Gaseel saja-aastasest armastusest ; Kassiida okstest ; Kassiida selili lebavast naisest ; Kassiida unenäost vabas õhus ; Kassiida tumedaist tuvidest ; Vee süit ; Herbaariumid ; Omega ; Ood Salvador Dalile ; "Ma kardan, kas su imet ma ei kaota..." . Eluloolisi andmeid autori kohta lk. 879

  9. The cytometric future: it ain't necessarily flow!

    Shapiro, Howard M

    2011-01-01

    Initial approaches to cytometry for classifying and characterizing cells were based on microscopy; it was necessary to collect relatively high-resolution images of cells because only a few specific reagents usable for cell identification were available. Although flow cytometry, now the dominant cytometric technology, typically utilizes lenses similar to microscope lenses for light collection, improved, more quantitative reagents allow the necessary information to be acquired in the form of whole-cell measurements of the intensities of light transmission, scattering, and/or fluorescence.Much of the cost and complexity of both automated microscopes and flow cytometers arises from the necessity for them to measure one cell at a time. Recent developments in digital camera technology now offer an alternative in which one or more low-magnification, low-resolution images are made of a wide field containing many cells, using inexpensive light-emitting diodes (LEDs) for illumination. Minimalist widefield imaging cytometers can provide a smaller, less complex, and substantially less expensive alternative to flow cytometry, critical in systems intended for in resource-poor areas. Minimalism is, likewise, a good philosophy in developing instrumentation and methodology for both clinical and large-scale research use; it simplifies quality assurance and compliance with regulatory requirements, as well as reduces capital outlays, material costs, and personnel training requirements. Also, importantly, it yields "greener" technology.

  10. PEPTIC ULCER FREQUENCY DIFFERENCES RELATED TO H. PYLORI OR AINES

    Diego Michelon de CARLI

    Full Text Available Background Peptic ulcer etiology has been changing because of H. pylori decline. Objectives To estimate peptic ulcer prevalence in 10 years-interval and compare the association with H. pylori and use of non-steroidal anti-inflammatory drugs. Methods Records assessment in two periods: A (1997-2000 and B (2007-2010, searching for peptic ulcer, H. pylori infection and non-steroidal anti-inflammatory drugs use. Results Peptic ulcer occurred in 30.35% in A and in 20.19% in B. H. pylori infection occurred in 73.3% cases in A and in 46.4% in B. Non-steroidal anti-inflammatory drugs use was 3.5% in A and 13.3% in B. Neither condition occurred in 10.4% and 20.5% in A and B respectively. Comparing both periods, we observed reduction of peptic ulcer associated to H. pylori (P=0.000, increase of peptic ulcer related to non-steroidal anti-inflammatory drugs (P=0.000 and idiopathic peptic ulcer (P=0.002. The concurrent association of H. pylori and non-steroidal anti-inflammatory drugs was also higher in B (P=0.002. Rates of gastric ulcer were higher and duodenal ulcer lower in the second period. Conclusions After 10 years, the prevalence of peptic ulcer decreased, as well as ulcers related to H. pylori whereas ulcers associated to non-steroidal anti-inflammatory drugs increased. There was an inversion in the pattern of gastric and duodenal ulcer and a rise of idiopathic peptic ulcer.

  11. Farmide rajamiseks tuleb EList Eestisse 170 miljonit krooni / Ain Alvela

    Alvela, Ain, 1967-

    2009-01-01

    12.-26. oktoobrini 2009 saavad loomapidajad esitada Põllumajanduse Registrite ja Informatsiooni Ametile (PRIA) taotlusi investeeringutoetuse saamiseks loomakasvatusehitiste rajamiseks ja neisse vajalike seadmete soetamiseks. Lisa: toetus peab kindlustama konkurentsivõimet

  12. Tuuleenergia kasutamisvõimalused Eestis / Ain Kull, Valdur Tiit

    Kull, Ain, 1973-

    2005-01-01

    Autorite hinnangul on seni Eestis ulatuslik tuulejõu kasutamine raskendatud nii finantsprobleemide, kodumaise tootmise puudumise, rannikupiirkondade elektriliinide väikese võimsuse kui ka Narva põlevkivijaamade alakoormatuse tõttu. Tabel

  13. Eesti ehitusturu kasv tipneb 2006. aastal / Ain Hinsberg

    Hinsberg, Ain

    2002-01-01

    Taanis asuva uuringufirma European Construction Research, mis jälgib ja prognoosib Ida- ja Lääne-Euroopa ning Lähis-Ida, Hiina ja Aasia ehitusturgu, ennustab Eestile jätkuvat kasvu. Diagramm: Eesti ehitusturu areng 1999-2010

  14. Jõupaberi tootmine tagab Kehra vabriku kasumi / Ain Alvela

    Alvela, Ain, 1967-

    2015-01-01

    Kehra paberivabrik on kodumaa metsaomaniku jaoks oluline okaspuu paberipuidu tarnija, kasutades umbes viiendiku sellise sortimendi aastasest raiemahust. Vabriku toodangust lõviosa moodustab pakendipaber. Selle tootmine tagab ka kasumi

  15. Geniaalne aines, hämmastav film / Tarmo Teder

    Teder, Tarmo, 1958-

    2006-01-01

    Oktoobri algul Kuressaares peetud Saaremaalt pärit ameerika arhitekti Louis Kahni konverentsi raames Kuressaare Linnateatris näidatud dokumentaalfilmist "Minu arhitekt" ("My Architect") : režissöör Nathaniel Kahn : Ameerika Ühendriigid 2003

  16. Overexploitation and cumulative drought trend effect on Ras El Ain ...

    Boulos Abou Zakhem

    2017-10-06

    Oct 6, 2017 ... development of sustainable water resources management program to reduce long-term drought risks, ... Anatolian mountain chain at >1000 m ASL (Turk- ... due to climatic change effect by global warming. ... supply levels.

  17. Multivariate statistical characterization of groundwater quality in Ain ...

    Administrator

    depends much on the sustainability of the available water resources. Water of .... 18 wells currently in use were selected based on the preliminary field survey carried out to ... In recent times, multivariate statistical methods have been applied ...

  18. Puti povõshenija effektivnosti proizvodstva / Ain Alvela

    Alvela, Ain, 1967-

    2008-01-01

    Kulude kokkuhoid aitab saavutada kõrgemat tootlikkust. Vt. samas: Indeks rosta proizvoditelnosti za period 2000-2007gg., %. Kommenteerivad: Aleksandr Miina, Ants Pak, Kaul Aulasmägi, Veljo Haube ja Kuido Kuntro

  19. Poliitiline areng / Vello Pettai, Daunis Auers, Aine Ramonaite

    Pettai, Vello, 1968-

    2011-01-01

    Ülevaade demokraatlikust arengust Baltimaades - valitsuste stabiilsus, parlamendi usaldatavus, valimised, erakonnad, kodanikuühiskonna areng, poliitika läbipaistvus, huvi poliitika vastu ühiskonnas. Tabelid, joonised

  20. Political development / Vello Pettai, Daunis Auers, Aine Ramonaite

    Pettai, Vello, 1968-

    2011-01-01

    Ülevaade demokraatlikust arengust Baltimaades - valitsuste stabiilsus, parlamendi usaldatavus, valimised, erakonnad, kodanikuühiskonna areng, poliitika läbipaistvus, huvi poliitika vastu ühiskonnas. Tabelid, joonised

  1. 18 octobre 2013 - Le Préfet de l’Ain L. Touvet signe le livre d'or avec le Directeur général du CERN R. Heuer et le Chef du Département Technologie F. Bordry. Photo de groupe, de gauche à droite: T. Kupisz, Secrétaire général de la sous préfecture de Gex; L. Miralles, Chef du Département Infrastructure et services généraux; F. Eder, Délégué aux Relations avec les Etats hôtes; S. Donnot, Sous-préfet de Gex; L. Touvet, Préfet de l'Ain; E. Sches, Sous-préfète de Nantua; E.Gröniger-Voss, Conseiller juridique du CERN; R. Heuer, Directeur général; F. Bordry, Chef du Département Technologie et P. Bloch, Chef du Département Physique.

    Anna Pantelia

    2013-01-01

    18 octobre 2013 - Le Préfet de l’Ain L. Touvet signe le livre d'or avec le Directeur général du CERN R. Heuer et le Chef du Département Technologie F. Bordry. Photo de groupe, de gauche à droite: T. Kupisz,\tSecrétaire général de la sous préfecture de Gex; L. Miralles, Chef du Département Infrastructure et services généraux; F. Eder, Délégué aux Relations avec les Etats hôtes; S. Donnot, Sous-préfet de Gex; L. Touvet, Préfet de l'Ain; E. Sches, Sous-préfète de Nantua; E.Gröniger-Voss, Conseiller juridique du CERN; R. Heuer, Directeur général; F. Bordry, Chef du Département Technologie et P. Bloch, Chef du Département Physique.

  2. Rahvastikuteadus ja Eesti rahvastikuarengu pöördepunktid / Kalev Katus, Allan Puur

    Katus, Kalev, 1955-2008

    2006-01-01

    Järg nr. 3 lk. 491-522. Bibl. lk. 511-521. Rahvastikuteaduse tekke- ja arenguloost, rahvastikuarengu kui iseseisva sotsiaalsüsteemi seaduspärasustest ning demograafilisest üleminekust rahvastikutaaste arenguetapina. Tabelid

  3. Eesti väliskaubandus aastal 2007 = Estonian's foreign trade in 2007 / Allan Aron, Riina Kerner

    Aron, Allan

    2008-01-01

    Eesti väliskaubanduse näitajatest 2007. aastal: Eesti kaupade eksport oli 125,5 miljardit krooni, import 177,1 miljardit krooni, kaubavahetuse puudujääk oli 51,6 miljardit krooni. Peamisteks partnerriikideks olid 2007. aastal Soome, Rootsi ja Läti. Olulisemad ekspordi- ja impordiartiklid. Graafikud. Tabel. Diagrammid

  4. Väliskaubandus, jaanuar-detsember 2007 = Foreign Trade, January-December 2007 / Allan Aron

    Aron, Allan

    2008-01-01

    Väliskaubanduskäive oli 2007. aasta jaanuaris-detsembris 302,1 miljardit krooni - eksport 125,6 miljardit krooni (42%) ja import 176,5 miljardit krooni (58%), kaubavahetuse puudujääk moodustas 50,9 miljardit krooni. Lisatud tabelid ja graafikud

  5. Allanças de marca. por que, como e quando?

    Marin, Longinos; Rubio, Alicia

    2012-01-01

    Nos ultimos anos, as atividades de aliança de marta tiveram um crescente protagonismo no lançamento de novos produtos por parte das empresas. Nao obstante, existem poucos trabalhos que analisem de forma integral a justificaçao par parte das empresas sobre esta estrategia. O presente trabalho analisa as teorias que justificam porque e em que cenarios devem ser utilizadas as alianças de marca desde a perspectiva do comportamento do consumidor. O artigo tambem aprofunda nas condiçoes enos cenari...

  6. Eesti munitsipaalpolitsei Lääne taustal / Allan Alaküla

    Alaküla, Allan, 1968-

    2002-01-01

    Ilmunud ka: Stolitsa 5. dets. lk. 1. Riigikogu liikmete ja Euroopa politsei- ja omavalitsustegelaste arvamused munitsipaalpolitseist: Jaanus Männik, Keith Whitmore, Peter Shorer, Mai Treial, Michel Albin, Jaana Padrik, Jean Louis Renier, Eva Dohnalova, Calin Catalin Chirita, Aleksei Aleksandrov, Mohammad Nazir, Arvo Sirendi. Parlamendisaadik

  7. Tšiili kunagise presidendi surma uuritakse mõrvana / Allan Espenberg

    Espenberg, Allan

    2006-01-01

    Tšiili presidendist aastatel 1964-1970 Eduardo Frei Montalvast, tema ootamatust surmast 1982. aastal. Presidendi perekond on seisukohal, et surma põhjus oli mürgitamine. Lisa: Frei võidi tappa keemiarelvaga

  8. Olof Palme mõrvar võib olla hoopis tshiillane / Allan Espenberg

    Espenberg, Allan

    2008-01-01

    Rootsi ajakirjanikul Anders Leopoldil ilmus käesoleval aastal teos, mis võtab taas luubi alla Olof Palme mõrva ja tõstatab sellega seoses uusi versioone. Raamatus "Rootsi puu tuleb langetada" seostatakse peaministri mõrva Tšiili tolleaegse kõrgema juhtkonnaga

  9. Ametiühingujuht püüab Chavezi seljatada / Allan Espenberg

    Espenberg, Allan

    2006-01-01

    Venezuelas põgenes vanglast opositsionäär ja ametiühingujuht Carlos Ortega, keda on nimetatud ka president Hugo Chavezi isiklikuks vastaseks. H. Chavez on teatanud oma kandideerimisest tänavu toimuvatel presidendivalimistel. Lisa: Läbikukkunud riigipöörajast sai president

  10. Nicaragua läheb võitlusesse näljaga / Allan Espenberg

    Espenberg, Allan

    2007-01-01

    Nicaragua on Haiti järel Ameerika vaeseim riik. Jaanuaris taas võimule tulles nimetas president Daniel Ortega oma valitsuse prioriteediks ja tähtsaimaks sotsiaalprogrammiks vaesuse likvideerimise, projekt käivitati riigi põhjaosas Atlandi ookeani rannikul Hondurase piiri ääres Raiti-Bocayu piirkonnas, mida peetakse kõige mahajäänumaks ja vaesemaks

  11. Eksdiktaatori suguvõsa pürib tagasi võimule / Allan Espenberg

    Espenberg, Allan

    2006-01-01

    Paraguay nõuab Brasiilias viibiva kauaaegse diktaatori Alfredo Stroessneri väljaandmist. Tema tütrepoeg Alfredo Dominguez Stroessner on alustanud poliitilist tegevust. Lisa: Miljon dollarit päästis arestist

  12. Allan Martinson: tean palju paremaid viise rikkaks saada / intervjueerinud Toivo Tänavsuu

    Martinson, Allan, 1966-

    2011-01-01

    Tehnoloogiainvestor viitab, et mingil hetkel on Eesti start-up firmadel Eestis piirid ees, sest turud ja tööjõud on mujal. Eestis alustanud start-up firmal on siin suureks kasvada väga raske. Talentide koju kutsumise asemel võiks olla suund, et Eesti talendid elaksid poole ajast siin, samamoodi ei peaks start-up'e kramplikult Eestis hoidma

  13. Ladina-Ameerika Juudas jääb edasi Colombia riigipeaks / Allan Espenberg

    Espenberg, Allan

    2006-01-01

    Colombias valiti presidendiks tagasi Alvaro Uribe, kes on edukalt võidelnud nii tavakuritegevuse kui ka uimastikaubanduse vastu, samuti on tal olnud edu vasakpoolsete partisanirühmituste tegevuse likvideerimisel või kontrollimisel. Lisa: Konservatiivide masendav üleolek

  14. An outsourced offshore information processing model for Japanese finance sector multinationals / Michael Allan Green

    Green, Michael Allan

    2000-01-01

    The complexity and pace of technology, combined with the strategic importance of technology, has created a dilemma for most organisations. The requirement is to be able to take advantage• of the latest technology and state-of-the-art practices. So, instead of trying to be experts in both their core business and technology, executives focus their attention on the core business and rely on others to provide the technology expertise. Healthy and profitable Japanese com...

  15. India rajab Tadžikistani territooriumile sõjaväebaasi / Allan Espenberg

    Espenberg, Allan

    2007-01-01

    Ajaleht The Times of India teatas, et India võtab Tadžikistani territooriumil asuva Ajni lennuvälja kasutusele sõjaväebaasina ning peatselt jõuavad sinna nii õppelennukid, helikopterid kui hävituslennukid. Tadžikistan on sellised väited ümber lükanud

  16. Pank väärtustab kohalikku metsatööstust / Allan Ventsel

    Ventsel, Allan

    2003-01-01

    Autor tõestab Hansapanga ja metsatööstuse näitel, et ettevõtte ja panga vahelistes suhetes on oluline roll tööstusharu üldisel olukorral. Autori hinnangul on metsatööstusettevõtted leidnud Hansapanga poolt finantseerimist kuna tööstusharu peetakse perspektiivseks ning seal tegelevaid ettevõtteid paindlikeks ning elujõulisteks. Diagrammid: puidu-, tselluloosi- ja paberitoodete tootmine aastail 1992-2000; metsal baseeruva tööstuse osakaal Eesti töötleva tööstuse lisandväärtusest protsentides. Lisa: Eesti metsatööstusel on suur potentsiaal

  17. J.S. Allan, J.H. Randall and D. Brink*

    Salmo gairdneri) selected by multi- stage selection for body mass at ten months of age. Trout selectionsare currently based on successivegradings for body width at 2. 4 and 6 months of age. followedby successiveweighingsfor body mass at 8 and ...

  18. Kahtlased äritehingud saadavad peaministrid ridamisi trellide taha / Allan Espenberg

    Espenberg, Allan

    2005-01-01

    Myanmari kunagise peaministri Khin Nyunti konflikt sõjaväehunta liidriga tõi kaasa kohtuasja ja karistuse ka tema pereliikmetele. Nepali ekspeaminister Sher Bahadur Deuba mõisteti süüdi ebaseaduslike tee-ehituslepingute sõlmimises, Deuba väitel on tegemist väljamõeldud kohtuasjaga karistuseks vastuseisu eest kuningas Gyanendra võimuhaaramisele. Lisa: Senegali populaarseimal poliitikul süü raiskamises

  19. Introdução: a arte perversa de Edgar Allan Poe

    Gato, Margarida Vale de, 1973-; Lima, Maria Antónia

    2010-01-01

    E se Edgar Poe, esse autor americano tão fora do seu tempo e espaço, e por isso tão pouco dado a efemérides, tivesse sido atormentado não só pelo vício do álcool, mas também pelo vício da sua arte? A questão estará em saber se esse segredo nunca revelado – procurado na insondável negritude dos abismos, nos turbilhões do mar, nos enterros prematuros, nas experiências de morte antecipada, nos extremos de sofrimento provocados por instrumentos de tortura, por actos de vingança, por amores trágic...

  20. Põgenikust ekspresident tahab Peruus võimu võtta / Allan Espenberg

    Espenberg, Allan

    2005-01-01

    Peruu ekspresident Alberto Fujimori soovib naasta Jaapanist kodumaale, et osaleda 2006. aasta aprillis toimuvatel presidendivalimistel. Peruu valitsus on esitanud Fujimorile ühtekokku 22 kriminaalsüüdistust ja nõudnud Jaapanilt ekspresidendi väljaandmist

  1. Uruguay vasakpoolne president tahab vaeses riigis korra majja lüüa / Allan Espenberg

    Espenberg, Allan

    2005-01-01

    Märtsikuus tuli Uruguays võimule vasakpoolne koalitsioon. President Tabare Vazquez peab kõige olulisemaks vaesusest jagusaamist riigis, välispoliitikas on tema eelistus sidemete arendamine teiste vasakpoolsete režiimidega

  2. Saalomonidel tõi peaminister vägivallalaine / Allan Espenberg

    Espenberg, Allan

    2006-01-01

    Snyder Rini valimine peaministriks tõi Saalomoni saartel kaasa vägivalla. Rinit on süüdistatud korruptsioonis ja parlamendiliikmete äraostmises. Enne parlamendis toimuma pidanud umbusaldushääletust teatas Rini oma tagasiastumisest. Lisad: Meeleavaldajate viha tabas hiinlasi; Kodusõda kestab sisuliselt siiani

  3. Tšehhi asepeaminister on sattunud mitme tule alla / Allan Espenberg

    Espenberg, Allan

    2007-01-01

    Tšehhi asepeaminister ja regionaalarenguminister Jiri Cuneki mustlaste vastu suunatud mõtteavaldused. Asepeaministrit süüdistatakse ka poole miljoni kroonise altkäemaksu vastuvõtmises H&B Reali nimeliselt kinnisvarafirmalt 2002. a.

  4. Prints Charles ja prints Michael külastasid Tallinna kirikuid / Allan Tammiku

    Tammiku, Allan

    2001-01-01

    Prints Charles külastas 6. novembril Eesti-visiidi ajal Tallinna toomkirikut ja Pühavaimu kirikut, prints Michael viibis Tallinnas 11. novembril eravisiidil, ta külastas toomkirikut, Niguliste ja Pühavaimu kirikut

  5. Eesti ja Venemaa kaubavahetusest = Estonian-Russian trade relations / Allan Aron

    Aron, Allan

    2007-01-01

    Eesti ja Venemaa kaubavahetusest pärast taasiseseisvumist ja enne liitumist Euroopa Liiduga, liitumise mõju kaubavahetusele Venemaaga, peamised kaubaartiklid ekspordis ja impordis, arengusuunad 2007. aastal. Kuigi majanduslikult on Venemaaga kauplemine perspektiivikas ja kasulik mõlemale osapoolele, mängivad kahe riigi kaubavahetuses sageli olulist rolli poliitilised ning muud majandusvälised tegurid. Diagrammid

  6. Võimust ilma jäänud presidente ähvardab vangla / Allan Espenberg

    Espenberg, Allan

    2004-01-01

    Aafrika ja Ladina-Ameerika ekspresidentide hirmust uue võimu sanktsioonide ees. Sambia ekspresidendi Frederick Chiluba, Peruu ekspresidendi Alberto Fujimori, Haiti kukutatud presidendi Jean-Bertrand Aristide'i süüdistamisest

  7. Kerry püüab ladinaameeriklaste hääli / Allan Espenberg

    Espenberg, Allan

    2004-01-01

    USA Demokraatliku Partei presidendikandidaat John Kerry teatas, et kavatseb presidendina pühendada suuremat tähelepanu Ladina-Ameerika regioonile. Ameerika Ühendriikide ja Ladina-Ameerika suhted praegu

  8. 20. märts kuni 20. aprill : Kes meie elu mõjutavad? / Allan Espenberg

    Espenberg, Allan

    2003-01-01

    Bosnia ja Hertsegoviina: kolmeliikmelise Presidentuuri serblasest liikmeks valiti Borislav Paravac; Eesti: president Arnold Rüütel nimetas ametisse Juhan Partsi juhitava valitsuse; Iraak: USA erukindral Jay Garner sai Iraagi üleminekuvalitsuse juhiks; Kesk-Aafrika Vabariik: pärast riigipööret kuulutas end uueks presidendiks Francois Bozize; Malawi: II asepresidendiks nimetati Chakufwa Chihana; Nauru: presidendi surma järel nimetati tema kohusetäitjaks Derog Gioura; Soome: uueks peaministriks sai Anneli Jäätteenmäki

  9. Taiwan püüab arendada suhteid Aafrika maadega / Allan Espenberg

    Espenberg, Allan

    2007-01-01

    Taibeis toimus Aafrika maade ja Taiwani esimene tippkohtumine ning tööstus- ja kaubandusringkondade Taiwani-Aafrika progressiivse partnerluse foorum, põhiteemaks "Heaolu ja säästev areng". Hiina pahameel

  10. Revolutsioon meediatööstuses : kõik senised reeglid on surnud / Allan Martinson

    Martinson, Allan, 1966-

    2005-01-01

    Traditsiooniline meedia on üle elamas oma suurimat paradigma muutust kogu meedia ajaloos, see on põhjustatud tehnoloogiast. Uue meedia tootmise kulu on määratult väiksem tänu puuduvale distributsioonikulule ja minimaalsele kulule sisu tootmisel

  11. Uudised : EFK ja TKO kontserdireis. Ajakiri Tempo Veljo Tormisest. Maestro Teo Maiste CD / Allan Vurma

    Vurma, Allan, 1955-

    2000-01-01

    EFK ja TKO kontsertreisist USAsse ja Kanadasse 4.-23. veebr. Inglise kaasaegse muusika kvartalikiri "Tempo" jaanuarinumber (nr. 211) avaldas ulatusliku artikli V. Tormisest. 3. veebr. tähistati Estonia talveaias järjekordse CD ilmumist sarjas "Estonia väljapaistvaid lauljaid", peakangelaseks T. Maiste

  12. Argentina plaanib maailma kõrgeimat pilvelõhkujat / Allan Espenberg

    Espenberg, Allan

    2006-01-01

    200-korruseline rahvusvaheline äri- ja kommunikatsioonikeskus Buenos Aireses - BAF 2016 - valmib 2016. aastal linna 200. aastapäevaks. Autor arhitekt Julio Torcello. Kõrgeima hoone tiitlile pretenteerivad veel ehitatavad hooned Dubais, Moskvas, Chicogos, Jakartas

  13. Deposition and characterization of TaAIN thin films by reactive magnetron sputtering; Deposicao e caracterizacao de filmes finos de TaAIN depositados por magnetron sputtering

    Oliveira, G.B.; Fernandez, D.R.; Fontes Junior, A.S.; Felix, L.C.; Tentardini, E.K. [Universidade Federal de Sergipe (UFS), Sao Cristovao, SE (Brazil). Departamento de Ciencia e Engenharia de Materiais; Hubler, R. [Pontificia Universidade Catolica do Rio Grande do Sul (PUC-RS), RS (Brazil); Silva Junior, A.H. da, E-mail: brito-g@hotmail.com [Universidade Federal do Rio Grande do Sul (UFRGS), RS (Brazil)

    2016-07-01

    Phase stability, oxidation resistance and great mechanical properties are the main objectives when synthesizing protective coatings. The tantalum nitride (TaN) has aroused interest because of its high temperature stability, chemical inertness and thermal conductivity. However, it has a low hardness value when compared to other coatings. Researches has shown that one way to improvements in the properties of a thin film is by adding other elements in the deposition process. Therefore, the objective of this study was to deposit thin films of TaAlN by magnetron sputtering, changing the aluminum concentration of 2, 5, 7, to 14%. Then the coatings were characterized by EDS, RBS, GIXRD and nanohardness. In this study was found that the aluminum deposited did not change the oxidation resistance of the coating, and the highest value of hardness was 28 GPa for the sample with 14 at.%. (author)

  14. Keskaegne Tallinna kambersuurtükk / Kaupo Kangur, Ain Mäesalu

    Kangur, Kaupo

    2008-01-01

    Kambersuurtükid olid 15.-16. sajandi Euroopas laialt levinud relvatüüp. Tallinnast leitud kambersuurtükk paikneb Peterburgi artilleria Ajaloo Muuseumis. Kambertulirelvade üldisest ajaloost, Tallinna kambersuurtüki mõõtmestest, välisilmest, valmistamistehnoloogiast ja vanusest. Vaadeldav suurtükk võis olla valmistatud Eestis, kõige tõenäolisemalt Tallinnas. Ta on üks kõige vanemaid tänaseni säilinud tagantlaetavaid tulirelvi kogu maailmas

  15. Otepää piiskoplinnuse hävimisdaatumist / Ain Mäesalu

    Mäesalu, Ain, 1955-

    2010-01-01

    Ülevaade, miks autor hakkas 1980. aastate keskel toetama hüpoteesi Otepää keskaegse linnuse hävimisest 1396. aastal. Samas on kriitiliselt vaetud sama ajakirja numbris mõningaid Jaak Mälli seisukohti

  16. Katrin Pudersell kaitses farmaatsiadoktori väitekirja / Ain Raal, Elmar Arak

    Raal, Ain, 1961-

    2006-01-01

    3. mail 2006 kaitses farmaatsiamagister Tartu Ülikooli arstiteaduskonna nõukogu ees doktoriväitekirja "Tropaanalkaloidide ja riboflaviini produktsioon koera-pöörirohu (Hyoscyamus niger L.) põllu- ja koekultuurides

  17. "If It Ain't Broke, Don't Fix It"

    Blasco, Maribel; Tackney, Charles

    2013-01-01

    embedded in the hidden curriculum, which made Danish higher education effective at producing graduates with analytical and personal abilities and dispositions, such as reflexivity, curiosity, collaboration and trust that are particularly suitable for today's globalised, knowledge–based economies. We...

  18. Sõjageograafia aine ja Eestimaa sõjageograafia 1920. aastatel / Kersti Vennik

    Vennik, Kersti, 1975-

    2003-01-01

    Autori arvates puudub praeguses ohvitseride väljaõppes kursus, kus selgitataks täpsemalt Eesti maastike omadusi, erinevate maastiku-komponentide omavahelist koosmõju ning maastiku mõju kaitsejõudude tegevusele. Polkovnik Nikolai Reegi (1890-1942) panusest Eesti geograafiateaduse ajalukku

  19. Sulev Keedus : "Jonathan" on film esti indiaanlastest / Sulev Keedus ; interv. Ain Lember

    Keedus, Sulev, 1957-

    2007-01-01

    Dokumentaalfilm "Jonathan Austraaliast" : režissöör ja operaator Sulev Keedus : F-Seitse 2007. Režissöör filmist, kaitstes end kohaliku rahva süüdistuste vastu filmis kujutatu ebaeetilisuse üle

  20. Väärt vara linnas ning maal / Ain Alvela ; kommenteerinud Mart Saa

    Alvela, Ain, 1967-

    2010-01-01

    Uus Maa Kinnisvarabüroo tegevjuhi Mika Sucksdorffi hinnangul on Tallinnas kinnisvara üks arengusuundi Kalamaja-Kopli-Paljassaare piirkond. A&A Kinnisvara tegevjuhi Aivar Villemsoni hinnangul hakkavad kinnisvarahinnad tõusma esmalt pealinna keskmes, Rocca al Mare ja Pirita kandis

  1. Living with the Sermon of the Mount : an uncomfortable presence of transcendence / Ain Riistan

    Riistan, Ain, 1965-

    2003-01-01

    Ettekanne sümpoosionilt: Gemeinsames Symposium der Evangelisch-Theologischen Fakultät der Universität Tartu, der Estnischen Studiengesellschaft für Morgenlandkunde und der Deutschen Religionsgeschichtlichen Studiengesellschaft. Tartu, 2001

  2. Lindora 11.-12. sajandi kääbaskalmistuantropoloogiline aines / Leiu Heapost

    Heapost, Leiu, 1936-

    2006-01-01

    Kagu-Eesti seni kõige varasem laibahaudadest saadud atropoloogiline materjal pärineb Lindora kääbaskalmetest. Lindora ümarkääbastesse maetud olid morfoloogiliselt võrdlemisi sarnased, kõrge ja kitsa koljuga, pikakasvulised ja graatsiliste jäsemeluudega

  3. A successful chronic care program in Al Ain-United Arab Emirates.

    Baynouna, Latifa M; Shamsan, Amal I; Ali, Tahira A; Al Mukini, Lolowa A; Al Kuwiti, Moza H; Al Ameri, Thuraya A; Nagelkerke, Nico J D; Abusamak, Ahmad M; Ahmed, Nader M; Al Deen, Sanaa M Zein; Jaber, Tariq M; Elkhalid, Abdulkarim M; Revel, Anthony D; Al Husaini, Alhusini I; Nour, Fouad A; Ahmad, Hayat O; Nazirudeen, Mohammad K; Al Dhahiri, Rowaya; Al Abdeen, Yahya O Zain; Omar, Aziza O

    2010-02-22

    The cost effective provision of quality care for chronic diseases is a major challenge for health care systems. We describe a project to improve the care of patients with the highly prevalent disorders of diabetes and hypertension, conducted in one of the major cities of the United Arab Emirates. The project, using the principles of quality assurance cycles, was conducted in 4 stages.The assessment stage consisted of a community survey and an audit of the health care system, with particular emphasis on chronic disease care. The information gleaned from this stage provided feedback to the staff of participating health centers. In the second stage, deficiencies in health care were identified and interventions were developed for improvements, including topics for continuing professional development.In the third stage, these strategies were piloted in a single health centre for one year and the outcomes evaluated. In the still ongoing fourth stage, the project was rolled out to all the health centers in the area, with continuing evaluation. The intervention consisted of changes to establish a structured care model based on the predicted needs of this group of patients utilizing dedicated chronic disease clinics inside the existing primary health care system. These clinics incorporated decision-making tools, including evidence-based guidelines, patient education and ongoing professional education. The intervention was successfully implemented in all the health centers. The health care quality indicators that showed the greatest improvement were the documentation of patient history (e.g. smoking status and physical activity); improvement in recording physical signs (e.g. body mass index (BMI)); and an improvement in the requesting of appropriate investigations, such as HbA1c and microalbuminurea. There was also improvement in those parameters reflecting outcomes of care, which included HbA1c, blood pressure and lipid profiles. Indicators related to lifestyle changes, such as smoking cessation and BMI, failed to improve. Chronic disease care is a joint commitment by health care providers and patients. This combined approach proved successful in most areas of the project, but the area of patient self management requires further improvement.

  4. Euroopa tootjad tahavad jätkata sotsiaalset põllumajandust / Ain Lember

    Lember, Ain

    2006-01-01

    Üleeuroopaline põllumajandustootjate liit COPA ja põllumajandustöötajate organisatsioonide liit COGECA kutsuvad säilitama Euroopas juurdunud põllumajandusmudelit, mis on sattunud muu maailma surve alla

  5. Trial excavations of the northern part of the Lehmja settlement site / Ain Lavi

    Lavi, Ain

    2004-01-01

    Hilisrauaajal on pinnaveetaseme tõus sundinud Lehmja asukaid ümber asuma Tuuleveskimäe lõuna- ja edelajalamile. 2003. aasta kaevamiste põhjal näib, et Tuuleveskimäe edelanõlvale tekkis asustus keskajal

  6. The Danish health care system: it ain't broke... so don't fix it.

    Mooney, Gavin

    2002-02-01

    The organisation and financing of the Danish health care system was evaluated within a framework of analysis of strengths, weaknesses, opportunities and threats (a SWOT analysis) by a panel of five members with a background in health economics. The evaluation was based on reading an extensive amount of selected documents and literature on the Danish health care system, and a 1 week-visit to health care authorities, providers and key persons. This paper includes the main findings by one of the panel members. The international competition 'wave' passed by Denmark, and the Danish might rightly say 'thank goodness'. Funding is very largely public and there is a single dominant authority, i.e. the county, which makes planning easier. Low levels of patient payments and the smaller size of the private sector reflect Danish 'solidarity' and promote equity. Planning is good. Exceptions to this are the over-concern with hospital waiting lists and the flirting with DRG based funding. Greater investment in planning approaches would make the system yet better. The GP blended remuneration system with capitation and fee for service is a major strength. The fact that the system has such potential for technical and allocative efficiency and also equity but is not fully exploited suggests the need for more investment in health services research. While there is scope for improving the health care system in Denmark, the rest of the world has as much to learn from the Danes as the Danes have from the rest of the world.

  7. 500 tudengiga aines kontrollib eksamitöid õppejõu eest arvuti / Anu Mõistlik

    Mõistlik, Anu

    2003-01-01

    Tartu Ülikooli selle semestri rahvarohkeima, 500 kuulajaga sotsiaalkultuurilise psühholoogia loengukursuse lõpus kirjutasid tudengid eksamitööks valikvastustega testi, mida hakkavad kontrollima arvutid

  8. Sõjanuiad, võimusümbolid ja margapuud / Ain Mäesalu, Jüri Peets

    Mäesalu, Ain, 1955-

    2010-01-01

    Artiklis käsitletakse muinas- ja keskaegsete sõjanuiade problemaatikat arheoloogiliste leidude, kirjalike allikate ja omaaegsete kunstiteoste põhjal. Eestist leitud sõjanuiapeadest, mida kasutati 12.-13. sajandil relvadena, kuid need võisid sümboliseerida ka selle omaniku kõrget staatust. 19.-20. sajandil kasutati samasuguseid metalltahukaid margapuu otsaraskusena

  9. Мain stages in the development of systems of accounting expenses

    N.P. Snachov

    2012-08-01

    Full Text Available The importances of the historical cost indicate a memo public reporting and cost accounting of primitive society. Knowledge of the costs originates from the theory of value. Foundations of modern vision expenses were laid out in the XIX th century. Increasing needs of production were the impetus for the subsequent study of the costs. Costs are subject to control and measure the impact of economic activities of enterprises.

  10. Tarmo Kriis: Eesti majandus kukkus tagasi aastasse 2007 / Lemmi Kann ; kommenteerinud Ain Seppik

    Kann, Lemmi

    2009-01-01

    Tööandjate keskliidu juht Tarmo Kriis esitles eelarve kokkuhoiukava tutvustamisel tööandjate prognoosi, mille järgi on Eesti majandus tagasi aastas 2007 ning maksimumtase kulude osas saabki olla sama, mis 2007. aastal

  11. Hilissügise õhtul : [luuletused] / Ain Väät

    Väät, Ain

    2001-01-01

    Sisu: Hilissügise õhtul ; Kalalkäik ; Koerailm ; Tasakaal ; Hiirte elu ; Vabaõhukontsert ; Õhtu varestega ; Heliredel ; Noorte kukkede koor ; Lindude kaitseks ; Valge hommik ; Kala mäng ; Siili vatitekk ; Taevane lugu ; Toad on vahel segamini ; Õhtu tuleb ; Õhtul ; Juss sööb õuna ; Sirtsud ; Tõnu jõulusalm

  12. DiSC aitab käitumist parandada / Ain Kivesti

    Kivesti, Ain

    2008-01-01

    DiSC testi abil on võimalik saada ülevaade personaalsetest käitumishoiakutest ning vastavalt olukorrale on võimalik harjumuspärast reageerimisstiili radikaalselt muuta. Kommenteerivad Jorma Sarv ja Paavo Pilv

  13. "You Ain't My Daddy!": Black Male Teachers and the Politics of Surrogate Fatherhood

    Brockenbrough, Ed

    2012-01-01

    Recent scholarship on male teachers across several national contexts has investigated the dilemmas of hegemonic masculinity for male educators while only recently beginning to examine race as a mediator of masculinity politics in teaching. Conversely, an emergent body of work on Black male teachers has centred analyses of race and culture, but has…

  14. Academic Advising Ain't What It Used to Be: Strangers in the University.

    Byrd, Marquita L.

    1995-01-01

    Ways in which undergraduate education is changing in terms of student diversity, financing, and time required for graduation are discussed, and ways these changes affect academic advising are considered. It is suggested that colleges provide faculty advisors with specific training and make advising an official and evaluated aspect of faculty…

  15. Preliminary investigations of the southeastern section of the settlement site of Lehmja / Ain Lavi

    Lavi, Ain, 1951-

    2007-01-01

    Seoses Tallinn-Tartu maantee rekonstrueerimisega toimusid 1985.-1986. aastal Lehmja asula lõunapoolsel alal mahukad päästekaevamised. Selgus, et tegemist on I aastatuhandest pärit asulakohaga, milliseid teatakse Eestis vähe. 2006. aasta kaevamismetoodikast ja uurimistulemustest

  16. Odnim blazhennõm dnjom : [luuletused] / Uku Masing ; lühibiograafia: A. K. [Ain Kaalep

    Masing, Uku, 1909-1985

    1999-01-01

    Sisu: Odnim blazhennõm dnjom ; Veter tshelnok bõl ; Pesn soldat, otstupajushishih pod natiskom netshistoi silõ / tlk. Svetlan Semenenko ; "Tõ groznaja gora..." ; "Ne mozhet ditja bez ottsa naroditsja..." ; K predelam ; Vestnik iz "Magellanovõh oblakov" : katkend ; Postigaja i verja ; V kazhdom strannike - nadezhda / tlk. A. Zorin. Orig.: Ühel kaunil päeval ; Süstik on tuul ; Tontide eest taganejate sõdurite laul ; "Sa oled mägi, mida kardavad me karjad..." ; "Välja südamest visata..." ; Piiridele püüdes ; Saadik Magellani pilvest : katkend ; Mõistu saades ja uskudes ; Iga rändur on lootus

  17. Teaduspargist võrsub eriti agar gasell / Ain Alvela ; kommenteerinud Seren Eilmann

    Alvela, Ain, 1967-

    2010-01-01

    Tallinna tehnoloogiapargi Tehnopol ja Tartu teaduspargi ettevõtlusinkubaatorid pakuvad ettevõtluskeskkonda kiiret arengut taotlevatele ettevõtetele. Tehnopolis on gaselli staatuse saanud 22 firmat, Tartu teaduspargis 13 firmat. AS-ist Proekspert, OÜ-st Interfire. Tabel

  18. Jaani seek väärib säilitamist / Ain Mäesalu

    Mäesalu, Ain

    2001-01-01

    5. oktoobril kogunes Jaani seegi varemete vahele Eesti juhtivatest arheoloogidest koosnev arheoloogiamälestiste nõukogu, kes otsustas, et müüristik on väga väärtuslik muinsus. Samal seisukohal on ka muinsuskaitsjad. Agne Trummali ja Toomas Tamla kommentaarid

  19. Eesti ei maksa Natura aladel toetust 7800 krooni hektari kohta / Ain Lember

    Lember, Ain

    2004-01-01

    EL 2007-2013 eelarve eelnõu kohaselt võib Natura 2000 aladel tegutsevatele põllumajandustootjatele maksta põllumajanduskõlviku hektari kohta igal aastal kuni 7800 krooni. Põllumajandusministeeriumi spetsialistid ei pea nii suurte toetuste maksmist võimalikuks

  20. All That Glitters Ain't Gold, It's A Goldmine For Growth And Impact

    Dallas, DeLeon Demetrius

    2018-01-01

    When it was announced that Othello was going to be a part of the ‘Winter Season’ I was excited, as were my peers. I landed the role and could not contain my enthusiasm; however, no one, including myself, knew the impact that this role would have on me. I am classically trained and have the technique required to execute this role. So why did I feel so conflicted? It became clear to me that the more I got to know Othello, the more I realized that this role was not written for me, or any Black m...

  1. Deposition and characterization of NbAIN thin films by reactive magnetron sputtering

    Carvalho, R.G.; Felix, L.C.; Fernandez, D.A.R.; Fontes Junior, A.S.; Oliveira, G.B.; Tentardini, E.K.

    2016-01-01

    The objective of this work was to study NbAlN thin films and the influence of variation in the concentration of aluminum in the crystal structure and oxidation resistance of these coatings. The thin films were deposited by reactive magnetron sputtering and characterized by Grazing Incidence X-ray Diffraction (GIXRD), Energy Dispersive Spectroscopy (EDS) and oxidation tests at high temperatures. NbAlN thin films were deposited and present at concentration of 10, 20 and 42 at% Al. The NbAlN crystalline phase obtained was the δ-NbN, however it was observed a shift of the peaks in the patterns obtained GIXRD of regions for larger angles for these samples, indicating the formation of a solid solution. The higher oxidation resistance temperature was 700° C for the sample with 42 in at% Al. From the SEM analysis it was possible to observe the surface of the film after oxidation, all films showed defects, however the amount of such defects was lower in samples with higher aluminum concentrations. (author)

  2. Applying of whole-tree harvesting method; Kokopuujuontomenetelmaen soveltaminen aines- ja energiapuun hankintaan

    Vesisenaho, T [VTT Energy, Jyvaeskylae (Finland); Liukkonen, S [VTT Manufacturing Technology, Espoo (Finland)

    1997-12-01

    The objective of this project is to apply whole-tree harvesting method to Finnish timber harvesting conditions in order to lower the harvesting costs of energy wood and timber in spruce-dominant final cuttings. In Finnish conditions timber harvesting is normally based on the log-length method. Because of small landings and the high level of thinning cuttings, whole-tree skidding methods cannot be utilised extensively. The share of stands which could be harvested with whole-tree skidding method showed up to be about 10 % of the total harvesting amount of 50 mill. m{sup 3}. The corresponding harvesting potential of energy wood is 0,25 Mtoe. The aim of the structural measurements made in this project was to get information about the effect of different hauling methods into the structural response of the tractor, and thus reveal the possible special requirements that the new whole-tree skidding places forest tractor design. Altogether 7 strain gauge based sensors were mounted into the rear frame structures and drive shafts of the forest tractor. Five strain gauges measured local strains in some critical details and two sensors measured the torque moments of the front and rear bogie drive shafts. Also the revolution speed of the rear drive shaft was recorded. Signal time histories, maximum peaks, Time at Level distributions and Rainflow distributions were gathered in different hauling modes. From these, maximum values, average stress levels and fatigue life estimates were calculated for each mode, and a comparison of the different methods from the structural point of view was performed

  3. Pattern of community acquired pneumonia in pregnant ladies in Ain Shams University hospitals

    Aya M. Abdel Dayem

    2012-10-01

    Conclusion: Morbidity and mortality in pregnant patients with pneumonia continue to present a significant challenge. Early recognition of the diseases process and prompt treatment are required to ascertain an optimal outcome. The treatments in the gravid patients generally follow standard guide lines for the treatment of pneumonia in adults. Concern for fetal outcome should not delay treatment as improvement in maternal oxygenation and status is the best way to ensure fetal protection.

  4. Ain't No Neuroscience Mountain High Enough: Experiences of a Neurogardener.

    Abdullah, Jafri Malin

    2015-01-01

    16 years have passed since the idea was mooted in 1999 by five neurosurgeons in the corridors of Hotel Perdana, Kota Bharu. They were Dato' Dr Johari Siregar Bin Adnan, Dato' Professor Dr Ahmad Zubaidi Abdul Latif , Dr Azmin Kass Bin Rosman, Dato' Dr Mohammed Saffari Bin Mohammed Haspani and Professor Dato' Dr Jafri Malin Abdullah. They initiated the beginning of the first programme in Neurosurgery in Malaysia. The rest is history.

  5. A successful chronic care program in Al Ain-United Arab Emirates

    Al Husaini Alhusini I

    2010-02-01

    Full Text Available Abstract Background The cost effective provision of quality care for chronic diseases is a major challenge for health care systems. We describe a project to improve the care of patients with the highly prevalent disorders of diabetes and hypertension, conducted in one of the major cities of the United Arab Emirates. Settings and Methods The project, using the principles of quality assurance cycles, was conducted in 4 stages. The assessment stage consisted of a community survey and an audit of the health care system, with particular emphasis on chronic disease care. The information gleaned from this stage provided feedback to the staff of participating health centers. In the second stage, deficiencies in health care were identified and interventions were developed for improvements, including topics for continuing professional development. In the third stage, these strategies were piloted in a single health centre for one year and the outcomes evaluated. In the still ongoing fourth stage, the project was rolled out to all the health centers in the area, with continuing evaluation. The intervention consisted of changes to establish a structured care model based on the predicted needs of this group of patients utilizing dedicated chronic disease clinics inside the existing primary health care system. These clinics incorporated decision-making tools, including evidence-based guidelines, patient education and ongoing professional education. Results The intervention was successfully implemented in all the health centers. The health care quality indicators that showed the greatest improvement were the documentation of patient history (e.g. smoking status and physical activity; improvement in recording physical signs (e.g. body mass index (BMI; and an improvement in the requesting of appropriate investigations, such as HbA1c and microalbuminurea. There was also improvement in those parameters reflecting outcomes of care, which included HbA1c, blood pressure and lipid profiles. Indicators related to lifestyle changes, such as smoking cessation and BMI, failed to improve. Conclusion Chronic disease care is a joint commitment by health care providers and patients. This combined approach proved successful in most areas of the project, but the area of patient self management requires further improvement.

  6. Fabrication of surface micromachined ain piezoelectric microstructures and its potential apllication to rf resonators

    Saravanan, S.; Saravanan, S.; Berenschot, Johan W.; Krijnen, Gijsbertus J.M.; Elwenspoek, Michael Curt

    2005-01-01

    We report on a novel microfabrication method to fabricate aluminum nitride (AlN) piezoelectric microstructures down to 2 microns size by a surface micromachining process. Highly c-axis oriented AlN thin films are deposited between thin Cr electrodes on polysilicon structural layers by rf reactive

  7. Surface micromachined fabrication of piezoelectric ain unimorph suspension devices for rf resonator applications

    Saravanan, S.; Saravanan, S.; Berenschot, Johan W.; Krijnen, Gijsbertus J.M.; Elwenspoek, Michael Curt

    We report a surface micromachining process for aluminum nitride (AlN) thin films to fabricate piezoelectric unimorph suspension devices for actuator applications. Polysilicon is used as a structural layer. Highly c-axis oriented AlN thin films 1 /spl mu/m thick are deposited by rf reactive

  8. "Ain't no one here but us social forces": constructing the professional responsibility of engineers.

    Davis, Michael

    2012-03-01

    There are many ways to avoid responsibility, for example, explaining what happens as the work of the gods, fate, society, or the system. For engineers, "technology" or "the organization" will serve this purpose quite well. We may distinguish at least nine (related) senses of "responsibility", the most important of which are: (a) responsibility-as-causation (the storm is responsible for flooding), (b) responsibility-as-liability (he is the person responsible and will have to pay), (c) responsibility-as-competency (he's a responsible person, that is, he's rational), (d) responsibility-as-office (he's the responsible person, that is, the person in charge), and (e) a responsibility-as-domain-of-tasks (these are her responsibilities, that is, the things she is supposed to do). For all but the causal sense of responsibility, responsibility may be taken (in a relatively straightforward sense)-and generally is. Why then would anyone want to claim that certain technologies make it impossible to attribute responsibility to engineers (or anyone else)? In this paper, I identify seven arguments for that claim and explain why each is fallacious. The most important are: (1) the argument from "many hands", (2) the argument from individual ignorance, and (3) the argument from blind forces. Each of these arguments makes the same fundamental mistake, the assumption that a certain factual situation, being fixed, settles responsibility, that is, that individuals, either individually or by some group decision, cannot take responsibility. I conclude by pointing out the sort of decisions (and consequences) engineers have explicitly taken responsibility for and why taking responsibility for them is rational, all things considered. There is no technological bar to such responsibility. © Springer Science+Business Media B.V. 2010

  9. 'If it ain't broke, don't fix it': Challenges facing institutional ...

    recruitment and retention of blacks and women in senior posts is still the major challenge facing .... classed social space in order to gain trust and to succeed in their careers. ... In this paper, we examine how participants in one particular ADP experience the .... they didn't want a new way of doing things and they believed the.

  10. It Don't Mean a Thing If It Ain't Got That Swing.

    Stainburn, Samantha

    2002-01-01

    Trumpeter Wynton Marsalis created a curriculum that focuses on jazz music, which he asserts can cure what ails today's students, because its unique musical characteristics (collective improvisation, call and response, solos, and unexpected rhythms) demand respect and patience as musicians listen to one another and collaborate. The article suggests…

  11. Everyday Engineering: Ain't She Sweet--Bats, Rackets, Golf Clubs, and All

    Moyer, Richard; Everett, Susan

    2011-01-01

    The pitcher throws the ball and the batter takes a mighty swing. Crack! The ball is hit on the sweet spot and soars to the outfield. Or, you hear a thud! This time, the ball dribbles along the infield ground and the batter's hands sting. Everyone who has played baseball or softball has probably experienced both of these outcomes. This may not seem…

  12. Füüsikud maailma päästmas / Ain Ainsaar

    Ainsaar, Ain

    2003-01-01

    9.-11. oktoobrini Tallinna Pedagoogikaülikoolis aset leidnud rahvusvahelisest seminarist "Tiheda plasma ja materjalide interaktsioon", kus käsitleti termotuumareaktorite mudelite ehitamisel ette tulnud tehnilisi raskusi

  13. Enha utiliz de anceme ation b erived f ent of by stra from s bioma ain ...

    SAM

    2015-01-12

    Jan 12, 2015 ... mutants (Higuchi et al., 2000). ... factors to induce tolerance to subsequent lethal stress ... source replacement are as follows: glucose, 10 g/L; yeast extract, .... as the absorbance of cell suspensions at 600 nm in a UV/VIS.

  14. Maailmas süveneb nõudlus lehtmetallist toodete järele / Ain Alvela

    Alvela, Ain, 1967-

    2007-01-01

    Ilmunud ka: Delovõje Vedomosti : Promõshlennost 2. mai lk. 13. AS Favor on oma 17 tegevusaasta vältel teostanud allhankeid, mis on kujunenud tulusaks ja perspektiivseks äriks. Vt. samas: Tooraine tuleb hajutatud kanaleid mööda; Favori neli ärisuunda

  15. Water Ser - areng läbi torude ja üle kraavide / Ain Alvela

    Alvela, Ain, 1967-

    2007-01-01

    1992. aastal asutatud vee- ja kanalisatsioonitorustike paigaldamisele spetsialiseerunud perefirma AS Water Ser on kasvanud rahvusvaheliselt mainekaks kontserniks. Vt. samas: Perefirma arengu kronoloogia; Amet sai alguse teismelise eas kraavikaevamisest. Kommenteerivad Andrus Piir ja Toomas Kapp

  16. 2018 : tööstust veavad keskkond ja tervis / Ain Alvela

    Alvela, Ain, 1967-

    2008-01-01

    Arengufondi foorumil "Tööstusvedurid 2018" tõdeti, et kümne aasta pärast peab Eesti majandus olulises osas toetuma töötlevale tööstusele. Kommenteerivad: Arvo Kivikas, Heikki Mäki ja Jaanus Purga

  17. ... ain pild erheben, als das zu perln gehoret... - Relief- und Perlstickerei des Spätmittelalters

    Wetter, Evelin

    -, č. 70 (2014), s. 112-125 ISSN 0231-5793 R&D Projects: GA ČR GA13-39192S Institutional support: RVO:68378033 Keywords : textile works of art from the treasuries * liturgical robes * embroidery * serial production * made-to-order production Subject RIV: AL - Art, Architecture, Cultural Heritage

  18. Cancer Diagnostics: The Future Ain't What It Used to Be

    Groenendijk, F.H.

    2015-01-01

    Cancer is a genomic disease. Most cancers contain multiple genetics alterations that drive their unrestrained proliferation, progression and metastatic capacity. For most cancer types, it is known what these alterations are and what their frequency is. Genomics technologies have made it possible to

  19. Ühiskondliku Leppe Sihtasutus tahab GMO üle otsustamise anda elanikele / Ain Lember

    Lember, Ain

    2005-01-01

    Ühiskondliku Leppe Sihtasutus peab mõttekaks ühineda üle-euroopalise algatusega muuta EL seadusandlust selliselt, et GMO-vabade piirkondade kehtestamiseks õigus jääb maaomanike ja ametnike asemel elanikele

  20. Ester Tuiksoo : Saksamaa on Eestile biomassi ja GMO vallas eeskujuks / Ain Lember

    Lember, Ain

    2006-01-01

    Põllumajandusminister Ester Tuiksoo ja abiminister Rain Vändre kohtusid Kielis Schleswig-Holsteini liidumaa ministri dr. Christian von Boetticheriga, peateemadeks abi biomassi ja geneetiliselt muundatud kultuurtaimede kooseksisteerimise vallas

  1. Ain't I Black Too: Counterstories of Black Atheists in College

    Snipes, Jeremy T.

    2017-01-01

    Increasingly Black college students are identifying as atheist, however few empirical studies in higher education and student affairs are exploring the phenomenon. This dissertation examines the question, "How do Black atheist understand their identity in college?" Using Higginbotham's Politics of Respectability and tenants of Critical…

  2. Theory Ain't Practice: Four Novice Researchers Navigate Dilemmas of Representation within Immigrant Populations

    Aleixo, Marina; Hansen, Sarah; Horii, Sachiko; Un, Silvy

    2014-01-01

    This article illuminates instances in which four graduate students have struggled with issues of representation--of themselves and of immigrant participants--at their research sites and in their writing. These dilemmas are situated within the literature on the politics of representation in qualitative research. Although these dilemmas are not…

  3. Saaremaa maaelu ja põllumajandus said mullu ligi 140 miljonit toetust / Ain Lember

    Lember, Ain

    2005-01-01

    Saare maakond sai 2004. aastal enam kui 138 miljoni krooni eest maaelu- ja põllumajandustoetusi, mis teeb iga maal elava inimese kohta 6760 krooni. Tabelid: Toetussumma maakonna lõikes; Toetussumma iga maal elava inimese kohta (kroonides)

  4. 'If it ain't broke, don't fix it': Challenges facing institutional ...

    The paper is based on interviews with 18 black lecturers who entered the academic workforce through the university's ADP. Employing Pierre Bourdieu's theoretical framework of social and cultural reproduction, we discuss how difficult it is to interrupt the naturalised norms and values that form part of the existing institutional ...

  5. Ellipsometric study of GaN/AIN/Si(111) heterostructures grown by molecular beam epitaxy

    Nabi, M. A. U.; Ashfaq, A.; Arshad, M. I.; Ali, A.; Mahmood, K.; Hasan, M. A.; Asghar, M.

    2013-01-01

    GaN and related structures attracted a great interest in the recent years for electronic and optoelectronic applications due to their promising properties. GaN is grown popularly on foreign substrates like sapphire and SiC. However, silicon due to its favourable properties attended the great attention of material scientists and researchers to utilize as substrate for heteroepitaxy of GaN based structures and devices. Silicon substrates are low cost, available in large diameters and have well characterized thermal and electrical properties. In this study, GaN/AlN/Si(111) heterostructures were grown by molecular beam epitaxy. We performed x-ray diffraction spectroscopy and spectroscopic ellipsometry on these samples to study their structural and optical properties. XRD measurements performed on these samples revealed the presence of high quality GaN films as well as the presence of AlN buffer layer with the following miller indices: GaN (002), GaN (004), GaN (006) and GaN (110) along with Si peak of phase (111). The ellipsometric data obtained were used to characterize the GaN/Si samples as a function of film thickness. Refractive index, extinction coefficient and dielectric constant were calculated by the measured data. (author)

  6. Summertime, and the Choosin' Ain't Easy: An Ice Cream Counting Problem.

    Kreith, Kurt

    1992-01-01

    Utilizes the problem of determining the number of different ice cream cones and cups that can be made from a choice of 31 flavors to investigate the concepts of combinations and permutations. Provides a set of six related problems with their answers. (MDH)

  7. Literacy in the Content Areas: Ain't No Need to Sing the Blues.

    Deegan, Dorothy

    1994-01-01

    Presents a portrait of a content area reading course taken by undergraduates in a health/physical education teacher preparation program. Discusses how resistance was anticipated and rallied as a way of driving the work done over the course of the semester. (RS)

  8. Promõshlennõje zonõ ohvatil "mjortvõi sezon" / Ain Alvela

    Alvela, Ain, 1967-

    2008-01-01

    Arendajad on tehnoparkide rajamise ooterežiimile pannud - ostjaid jaguks, kuid võimalusi napib. Diagramm: Za pjat let stoimost zemli promõshlennogo naznatshenija võrosla v pjat raz; Tabel: Naiboleje dorogaja zemlja - v promparke Lasnamäe. Kommenteerivad Enn Tosso, Nikolai Pitshugov ja Urmas Ahven

  9. Tõnu Virve: filmi aines puudutas mu enda mälestusi / Tõnu Virve ; intervjueerinud Andres Laasik

    Virve, Tõnu, 1946-

    2009-01-01

    Intervjuu 22. septembril Kumu auditooriumis esilinastunud dokumentaalfilmi "Monument" (Freyja Film, 2009) režissööri Tõnu Virvega. Kesksel kohal on filmis Tallinna Tõnismäe monument (skulptor Enn Roos, arhitekt Arnold Alas)

  10. prevalence of hepatitis B and C viruses among health care workers in Ain Shams university hospitals

    El-fouly, A.H.A.

    2005-01-01

    exposure to blood borne pathogens poses a serious risk to health care workers (HCW), since the transmission of viral hepatitis B and C to health care workers has became of worldwide concern. hepatitis B and C viruses are the most frequent occupational disease in health care service workers, HCW are defined as persons (doctors, nurses, employees, students, contractors, attending clinicians, public-safety workers, or volunteers) whose activities involve contact with patients or with blood or other body fluids from patients in a health - care, laboratory, or public-safety setting . the potential exists for blood and body fluid exposure to other workers, and the same principle of exposure management could be applied to other setting.in the united states, the prevalence of HBV and HCV among HCWs range between (6-30%) and (2.7-10%) respectively . in spain HBV prevalence is 11.6% and HCV is 28.8%. while in taiwan 16.7% of HCWs were seropositive to HBsAG and 12.7% were seropositive for HCV. In Egypt, screening of 1485 HCWs in the Ministry of health hospitals, 35% were exposed to needle sticks

  11. Eesti edukad ettevõtted ahvatlevad varakaid piiritaguseid ülesostjaid / Ain Alvela

    Alvela, Ain, 1967-

    2006-01-01

    Viimasel ajal on sagenenud ettevõtete ülevõtmine piiritaguste firmade poolt. Vt. samas: Atria pole Valga kasumlikkust tõstnud; Valio sai Võru juustu näol oma kontserni ka juustutööstuse; Tartu Õlletehas neelas Ösel Foodsi; Plus Brewery nime saanud Pärnu Õlu uuendab seadmeid ja brände

  12. Deposition and characterization of TaAIN thin films by reactive magnetron sputtering

    Oliveira, G.B.; Fernandez, D.R.; Fontes Junior, A.S.; Felix, L.C.; Tentardini, E.K.; Silva Junior, A.H. da

    2016-01-01

    Phase stability, oxidation resistance and great mechanical properties are the main objectives when synthesizing protective coatings. The tantalum nitride (TaN) has aroused interest because of its high temperature stability, chemical inertness and thermal conductivity. However, it has a low hardness value when compared to other coatings. Researches has shown that one way to improvements in the properties of a thin film is by adding other elements in the deposition process. Therefore, the objective of this study was to deposit thin films of TaAlN by magnetron sputtering, changing the aluminum concentration of 2, 5, 7, to 14%. Then the coatings were characterized by EDS, RBS, GIXRD and nanohardness. In this study was found that the aluminum deposited did not change the oxidation resistance of the coating, and the highest value of hardness was 28 GPa for the sample with 14 at.%. (author)

  13. Recubrimientos protectores de TiN y AIN: comportamiento frente a temperatura

    Auger, M. A.

    2006-04-01

    Full Text Available The use of ceramic materials like titanium and aluminium nitrides have experienced a great improvement in the last years due to the variety of applications they show. The use as protective coatings on industrial tools is one important application with very favorable results for the moment, as it is the use as coating molds used for different elements fabrication. One of the mostly often used techniques to deposit protective coatings is the sputtering technique, which has been used in this work. In the present study we have analysed structural and mechanical properties of TiN and AlN thin films, using X-Ray diffraction, scanning electron microscopy, nanoindentation and pin-on-disk techniques. Thermal treatments have been applied on the mentioned films, applying three different temperature values: 750oC, 850oC y 950oC. Changes in their properties before and after the treatments have been observed. TiN layers show a thermal resistance around 750oC. The thermal resistance for AlN layers is around 850oC, being also observed an improvement in their properties when applying 850ºC of thermal treatment.

    La utilización de materiales cerámicos como el nitruro de titanio o de aluminio ha experimentado una gran popularización en los últimos años gracias a su gran variedad de aplicaciones. Una importante aplicación que cuenta hasta el momento con resultados muy favorables es la de su uso como recubrimientos protectores de herramientas industriales, así como de moldes empleados en la fabricación de diferentes elementos. Una de las técnicas más utilizadas en la obtención de recubrimientos protectores es la técnica de sputtering, utilizada en este trabajo. En el presente estudio se han analizado las propiedades estructurales y mecánicas de láminas delgadas de TiN y AlN mediante las técnicas de difracción de rayos X, microscopía electrónica de barrido, nanoindentación y pin-on-disk. Dichas capas han sido sometidas a un tratamiento térmico en el que se han aplicado tres temperaturas: 750oC, 850oC y 950oC, y se han observado variaciones en sus propiedades antes y después del tratamiento. Las capas de TiN presentan una resistencia térmica en torno a 750oC. Las capas de AlN resisten hasta una temperatura en torno a 850oC, observándose además una mejoría en sus propiedades al ser sometidas a dicha temperatura de 850oC.

  14. Detoxification Of Ochratoxin AIN Green Coffee Beans By Physical Methods With Studying Genotoxicity Of Treated Samples

    FARAG, S.A.; SHAMS EL DIEEN, N.M.M.; EL-SIDEEK, L

    2010-01-01

    Ochratoxin A (OTA) is potently nephrotoxic, teratogenic and carcinogenic, and the potency was varied markedly between species and sexes. Unfortunately, OTA are present due to mold contamination in different food stuffs such as coffee bean, therefore, the present study was carried out on collected imported coffee samples from super markets in Egypt. The isolation and identification proved presence of Penicilli sp. and Aspergillus sp. whereas the last one was dominant in two samples as A. niger and A. ochoruses. Determination of OTA by using HPLC analysis showed presence of high levels than the allowance levels in green coffee beans (more than 5 μg/kg; ppb). In addition, another group of collected samples as roasted coffee beans indicated the presence of high toxic concentrations of OTA. The study was then conducted on samples contain the highest OTA content by using some physical methods as gamma irradiation (5 and 10 kGy), charcoal (powder, granules), roasting (at 200 0 C for 7-10 min and 20 min). The results showed that proposed physical methods, mainly gamma irradiation and charcoal, could be efficient to decrease OTA in green beans coffee without produce toxic substance as well as non-significant changes in its properties. In addition, safety of resulted coffee beans after treatments were checked by ESR and genotoxicity test, which raise the preferability of gamma irradiation (10 kGy) treatment before using medium roasting to get coffee beans free from OTA

  15. Rannakalanduse tulevik sõltub varust / Ain Soome ; interv. Agnes Jürgens

    Soome, Ain

    2008-01-01

    Kalapüügiseaduse muudatustest. Lisatud: kalastajad. Ilmunud ka Hiiu Leht 2. mai 2008, lk. 4 ; Oma Saar 6. mai 2008, lk. 4 ; Vooremaa 13. mai 2008, lk. 2 ; Lääne Elu 20. mai 2008, lk. 4, lisatud: taustainfo ; Harju Elu 3. juuni 2008, lk. 2 ; Peipsi Rannik = Tshudskoje Poberezhje mai 2008, lk.4, lisatud: taustinfo

  16. Küla arengukava on külaarengu toetuse saamiseks vajalik / Ain Lember

    Lember, Ain

    2004-01-01

    Liikumine Kodukant kavatseb esitada põllumajandusministeeriumile protestikirja, kuna ei nõustu ministeeriumi infopäevadel levitatava tõlgendusega nagu võiks külade taastamise ja arendamise meetme toetust taotleda ka ilma küla arengukavata. Arvamust avaldavad: Maris Ode, Lemmi Maasik, Heli Raamets, Marek Raud ja Sille Rähn

  17. Saaremaa sadamate majanduslik-regionaalpoliitiline tähtsus ja arenguperspektiivid / Taavo Asuja, Ain Eidast

    Asuja, Taavo

    2005-01-01

    Et puudub selgus püsiühenduse rajamise ning selle tegevuse suhtes, on raskendatud sadamate arengu pikaajaline prognoosimine ja suunamine. Autorite hinnangul oleks vaja koostada Saaremaa sadamate arengu kontseptsioon. Tabelid. Diagrammid

  18. A Completely New Type of Actuator -or- This Ain't Your Grandfather's Internal Combustion Engine

    Gore, Brian W.; Hawkins, Gary F.; Hess, Peter A.; Moore, Teresa A.; Fournier, Eric W.

    2010-01-01

    A completely new type of actuator - one that is proposed for use in a variety of environments from sea to land to air to space - has been designed, patented, built, and tested. The actuator is loosely based on the principle of the internal combustion engine, except that it is a completely closed system, only requiring electrical input, and the working fuel is water. This paper outlines the theory behind the electrolysis- and ignition-based cycle upon which the actuator operates and describes the performance capability test apparatus and results for the actuator. A mechanism application that harnessed the unit s power to twist a scaled rotor blade is also highlighted.

  19. Veiko Õunpuu pälvis Euroopa Talendi auhinna / Ain Lember

    Lember, Ain

    2008-01-01

    Cannes'i filmifestivali raames toimuval Euroopa päeval antakse filmirežissöör Veiko Õunpuule üle Euroopa Talendi auhind (European Talent Prize) mängufilmiprojekti "Püha Tõnu Kiusamine" eest (produtsent Katrin Kissa). MEDIA Desk Eesti juht Anu Ernits peab seda suureks võiduks kogu Eesti filmile

  20. The Chemical Chaperone Phenylbutyrate Rescues MCT8 Mutations Associated With Milder Phenotypes in Patients With Allan-Herndon-Dudley Syndrome.

    Braun, Doreen; Schweizer, Ulrich

    2017-03-01

    Mutations in the thyroid hormone transporter monocarboxylate transporter 8 (MCT8) prevent appropriate entry of thyroid hormones into brain cells during development and cause severe mental retardation in affected patients. The current treatment options are thyromimetic compounds that enter the brain independently of MCT8. Some MCT8-deficient patients (e.g., those carrying MCT8delF501) will not be as severely affected as most others. We have shown that the MCT8delF501 protein has decreased protein stability but important residual function once it reaches the plasma membrane. We were able to rescue protein expression and the function of MCT8delF501 in a Madin-Darby canine kidney cell model by application of the chemical chaperone sodium phenylbutyrate (NaPB), a drug that has been used to treat patients with cystic fibrosis and urea cycle defects for extended periods of time. In the present study, we have extended our previous study and report on the NaPB-dependent rescue of a series of other pathogenic MCT8 mutants associated with milder patient phenotypes. We show that NaPB can functionally rescue the expression and activities of Ser194Phe, Ser290Phe, Leu434Trp, Arg445Cys, Leu492Pro, and Leu568Pro mutations in MCT8 in a dose-dependent manner. The soy isoflavone genistein, a dietary supplement, which was effective in MCT8delF501, was also effective in increasing the expression and transport of these MCT8 mutants; however, the effect size differed among mutants. Kinetic analyses revealed that the Michaelis constants of the mutants toward the primary substrate 3,3',5-triiodothyronine were not much different from the wild-type value, suggesting that these mutants are not impaired in their interaction with substrate but rather destabilized by the mutation and degraded. Copyright © 2017 by the Endocrine Society.

  1. Does timbre affect pitch?: Estimations by musicians and non-musicians / Allan Vurma, Marju Raju, Annika Kuuda

    Vurma, Allan, 1955-

    2011-01-01

    Muusikutel ja mittemuusikutel lasti kuulata lindilt inimhääle, vioola ja trompetihelisid ning hinnata järgmisena kõlanud helikatket võrreldes eelmisega kas "madalaks", "kõrgeks" või "hääles". Leiti, et tämbrist mõjutatud helikõrguse muutused võivad tekitada konflikti subjektiivse tunnetamise ja fundamentaalsel võnkesagedusel põhineva heli hindamise vahel

  2. Võitlus Baltikumi pärast - 15 aastat hiljem / Dag Sebastian Ahlander ; interv. Allan Alaküla

    Ahlander, Dag Sebastian

    2006-01-01

    Endine Rootsi peakonsul Leningradis Dag Sebastian Ahlander teeb tagasivaate 1991. aasta sündmustele ning annab omapoolse hinnangu tänapäeva Baltimaadele. Praegu juhib autor Rootsi välisministeeriumi protokollitööd ning kandideerib ka parlamenti

  3. From Man of the Crowd to Cybernaut: Edgar Allan Poe’s Transatlantic Journey—and Back.

    Paul Jahshan

    2008-07-01

    Full Text Available The wild effects of the light enchained me to an examination of individual faces; and… it seemed that, in my then peculiar mental state, I could frequently read, even in that brief interval of a glance, the history of long years. (Poe 183‘This old man,’ I said at length, ‘is the type and the genius of deep crime. He refuses to be alone. He is the man of the crowd. It will be in vain to follow; for I shall learn no more of him, nor of his deeds…and perhaps it is but one of the great mercies o...

  4. Sri Lanka president lubab sõjalõksus riiki tänapäeva tuua / Allan Espenberg

    Espenberg, Allan

    2005-01-01

    Presidendivalimistest Sri Lankal. Uus president Mahinda Rajapaksa on valmis kohtuma tamilite mässu juhtidega ning arutama rahu taastamise võimalusi. Presidendi eesmärgid. Lisa: Pommirünnakud poliitikute vastu

  5. Koolijuhtide aastakonverents peetakse Pärnus / Martin Kaasik, Jaan Reinson, Raimu Pruul ... [jt.] ; intervjueerinud Ülo Tikk

    2007-01-01

    Eesti Koolijuhtide Ühenduse 17. aastakonverentsist teemal "Õppiv koolijuht". Küsimustele vastavad direktorid: Martin Kaasik (Tallinna Laagna Gümnaasium, Eesti Koolijuhtide Ühenduse üks asutaja), Jaan Reinson (Tartu Descartes'i Lütseum), Raimu Pruul (Häädemeeste Keskkool), Raivo Heinaru (Kohila Gümnaasium), Senta Room (Muhu Põhikool)

  6. In-situ metrology in multiwafer reactors during MOVPE of AIN-based UV-LEDs (Conference Presentation)

    Knauer, Arne; Brunner, Frank; Kolbe, Tim; Hagedorn, Sylvia; Kueller, Viola; Weyers, Markus

    2017-02-01

    UV-LEDs are of great interest for applications like disinfection, gas sensing, and phototherapy. The cost sensitive LEDs are commonly grown by MOVPE on transparent AlN/sapphire templates. The large thermal and lattice mismatch between AlN and sapphire generates a very high dislocation density (DD) and causes big challenges in strain management. The threading dislocation density should be reduced to the order of low 108cm-2 for high internal efficiency of the AlGaN based UV-LED structures. The TDD will be reduced mainly by dislocation annihilation during the growth of thick Al(Ga)N layers, which is a challenge in terms of strain management. We present how in-situ reflectometry and curvature measurement (EpiCurveTT(at)LayTec) in commercial multiwafer growth reactors helps to optimize the growth processes concerning growth rates, surface roughening and avoidance of layer cracking on 2inch substrates and enhance the reproducibility of epitaxial growth. The growth of up to 3 μm thick planar AlN templates and up-to 10 μm thick AlN/sapphire templates by epitaxial lateral overgrowth of stripe patterned templates for UV-C LED structures will be highlighted. The implementation of different types of AlN/GaN superlattices for the subsequent growth of up to 5μm thick Al0.5Ga0.5N layer for UVB LED structures will be shown. Correlations to ex-situ measurements like X-ray diffraction and TEM analysis of defects in the LED structures will be shown. Some challenges of in-situ control through very narrow viewports as in Close Coupled Showerhead reactors will be discussed as well as the influence of silicon doping on curvature and dislocation density in Al(Ga)N layers.

  7. Üks liblika tiivalöök Brasiilias võib tekitada Texases tornaado / Ain Kallis

    Kallis, Ain, 1942-

    2008-01-01

    Meteoroloog ja matemaatik Edward Norton Lorenz (1917-2008) tegi 1961. aastal tavalist numbrilist ilmaprognoosi. Arvutustes tehtud väikese ümarduse tõttu muutus lõpp-prognoos ebatäpseks. Kogetu põhjal formuleeris ta ühe kaoseteooria põhiprintsiibi

  8. Catering for Pilgrims: Petrographic Analysis of Late Antique Kitchenware from the Monastery of St Lot at Deir 'Ain 'Abata, Jordan

    Louise Joyner

    2000-10-01

    Full Text Available Petrography has been used to elucidate patterns of production and consumption of kitchenware at a typical Early Christian desert monastery on the Pilgrim route. While some vessels may have been produced locally, there is evidence for long distance trade of other vessels.

  9. Ain't no mountain high enough? Setting high weight loss goals predict effort and short-term weight loss.

    De Vet, Emely; Nelissen, Rob M A; Zeelenberg, Marcel; De Ridder, Denise T D

    2013-05-01

    Although psychological theories outline that it might be beneficial to set more challenging goals, people attempting to lose weight are generally recommended to set modest weight loss goals. The present study explores whether the amount of weight loss individuals strive for is associated with more positive psychological and behavioral outcomes. Hereto, 447 overweight and obese participants trying to lose weight completed two questionnaires with a 2-month interval. Many participants set goals that could be considered unrealistically high. However, higher weight loss goals did not predict dissatisfaction but predicted more effort in the weight loss attempt, as well as more self-reported short-term weight loss when baseline commitment and motivation were controlled for.

  10. The application of magnetic self-filter to optimization of AIN film growth process during the impulse plasma deposition synthesis

    Chodun Rafal

    2016-03-01

    Full Text Available This work presents the very first results of the application of plasma magnetic filtering achieved by a coil coupled with an electrical circuit of a coaxial accelerator during the synthesis of A1N thin films by use of Impulse Plasma Deposition method (IPD. The uniqueness of this technical solution lies in the fact that the filter is not supplied, controlled and synchronized from any external device. Our solution uses the energy from the electrical circuit of plasma accelerator. The plasma state was described on the basis of OES studies. Estimation of the effects of plasma filtering on the film quality was carried out on the basis of characterization of structure morphology (SEM, phase and chemical composition (vibrational spectroscopy. Our work has shown that the use of the developed magnetic self-filter improved the structure of the AlN coatings synthesized under the condition of impulse plasma, especially by the minimization of the tendency to deposit metallic aluminum droplets and columnar growth.

  11. Provenance studies of archaeological ceramics from Mar-Takla (Ain-Minin, Syria) using radioisotope X-ray fluorescence method

    Bakraji, E.H.; Othman, I.; Karajou, J.

    2001-01-01

    The radioisotope X-ray fluorescence method was applied to studies of the provenance of the ceramics fragments originated from the Mar-Takla site in Syria. The samples were irradiated 1000s by a 109 Cd radioisotope source and 13 elements (Ca, Ti, Mn, Fe, Zn, Ga, As, Rb, Sr, Y, Zr and Pb) were determined in 35 samples. The data were subjected to two multivariate statistical methods, cluster and principal components analysis (PCA). It was shown from the combination of the statistical techniques and the determination of elemental composition of the samples that 94% of the ceramic samples analyzed can be considered to be manufactured using two sources of raw materials

  12. Provenance studies of archaeological ceramics from Mar-Takla (Ain-Minin, Syria) using radioisotope x-ray fluorescence method

    Bakraji, E. H.; Karajou, J.; Othman, I.

    2002-01-01

    The radioisotope x-ray fluorescence method was applied to provenance studies of ceramics fragments originated from the Mar-Takla site in Syria. 35 samples were analyzed, where each sample was irradiated 1000 s by sup 1 sup 0 sup 9 Cd radioisotope source and the elements (As, Ca, fe, Ga, Nb, Mn, Pb, Rb, Sr, Ti, Y, Zn, and Zr) were determined. The data were subjected to two multivariate statistical methods, cluster and principal component analysis (PCA). The study show that 94% of the samples can be considered to be manufactured using two sources of raw materials. (Authors)

  13. Läti elanikud NSVL SARK filterlaagrites 1944-1948 (allikate ülevaade) / Ainārs Bambals

    Bambals, Ainārs, 1964-

    2010-01-01

    Läti filtreerimise kontroll-koondamispunktid olid Riias, Daugavpilsis, Jelgavas, Kuldīga, Liepājas, Skrundas, Tukumsis, Vāiņodes, Ventspilsis, Ugāles. Pärast Teist maailmasõda allutati filtreerimisele 91 000 Läti elanikku

  14. Lootus : [luuletused] / Friedrich Schiller ; tlk. Ain Kaalep, Rein Sepp, Paul Viiding, Eduard Roos, Jaan Kross, Jakob Tamm

    Schiller, Friedrich, 1759-1805

    2006-01-01

    Sisu: Lootus ; Õhtu ; Brutus ja Caesar ; Laura klaveri ees ; Rousseau ; Grupp Tartarosest ; Rõõmule ; Palvekiri ; Hektori lahkumine ; Kunstnikud ; Laulu võim ; Metafüüsik ; Ideaal ja elu ; Maailma jaotamine ; Neiu võõrsilt ; Külvaja ; Odysseus ; Kolumbus ; Antiikkultuur rändurile Põhjast ; Zeus Heraklesele ; Kõrgeim ; Laps hällis ; Surematus ; Võti ; Astronoomilised teosed ; Parim riik ; Minu usk ; Sõber ja vaenlane ; Harv seos ; Nooruse lätted ; Naiste otsus ; Ootus ja täitumine ; Ühine saatus ; Looduseuurijad ja transtsendentaalfilosoofid ; Ohtlik tulemus ; Anonüümne jõgi ; Valgus ja soojus ; Neiu kaebus ; Ühele moralistile ; Goethele ; Pagulane ; Saksa muusa ; Uue sajandi saabumine ; Punshilaul ; Mäelaul ; Polykratese sõrmus ; Rüütel Toggenburg ; Kinnas ; Alpi kütt ; Sõpradele. Eluloolisi andmeid autori kohta lk. 239

  15. Twin City - past 1823-2013 : EHTE ja Haaga-Helia ühisprojekt / Tiit Kask, Ain Hinsberg

    Kask, Tiit

    2012-01-01

    Turismikoolide ühisprojektist "Twin City - Empowering & Designing Twin-Capital Destination - Past, Present and Future of Tourism in Greater-Helsinki and Greater-Tallinn Area", mille eesmärgiks on Tallinna ja Helsingi kui ühtse turismisihtkoha käsitluse loomine ja 26. aprillil Tallinnas toimunud seminarist "TwinCity Helsinki-Tallinn / Tallinn & Estonian tourism 1813-2013", mis kutsus üles tähistama Tallinna (Kadrioru) merekuurordi ja "Eesti Turismimajandus 200" juubelit 2013. aastal

  16. Saaremaal anti täiskäik LEADER-programmi käivitamiseks / Ain Lember

    Lember, Ain

    2006-01-01

    Saaremaa Kodukandi korraldatud infopäeval sündis algatusrühm LEADER-tüüpi arendustegevuse ettevalmistamiseks maakonnas. Tabel: Saaremaa algatusrühma tegevuskava LEADER-tüüpi maapiirkondade arendustegevuse ettevalmistamiseks

  17. The antioxidant response of the liver of male Swiss mice raised on a AIN 93 or commercial diet

    Caetano, Aline C; da Veiga, Lucimara F; Capaldi, Fl?via R; de Alencar, Severino M; Azevedo, Ricardo A; Bezerra, Rosangela MN

    2013-01-01

    Abstract Background Reactive oxygen species (ROS) are formed under natural physiological conditions and are thought to play an important role in many human diseases. A wide range of antioxidants are involved in cellular defense mechanisms against ROS, which can be generated in excess during stressful conditions, these include enzymes and non-enzymatic antioxidants. The aim of this study was to evaluate the antioxid...

  18. "Sa, haavapuu, kesköösel valendad..." : [luuletused] / Paul Celan ; saksa k. tlk. [ja saatesõna]: Ain Kaalep

    Celan, Paul, pseud., 1920-1970

    2001-01-01

    Autorist lk. 49-50. Sisu: "Sa, haavapuu, kesköösel valendad..." ; Mälestus Prantsusmaast ; Aastad sinust minuni ; Surmafuuga ; Aja silm ; Kõnevõre ; Silm, lahtine ; Zürich, "Toonekure" kohvik : Nelly Sachsile ; Psalm ; "Niitpäikesed..." ; "Maovankris, mööda..." ; "Maastik urnidega..." ; Prahas ; "Kõmin: see on..." ; "Üks hambajälg eikuskilpool..." ; "Kahinais, otsekui meie alguses..." ; Teine ; "Teie oma..." ; "See, mis meid..." ; "Lõika palvekäsi..." ; "Ma kuulen, et kirves lõi õitsema..." ; "Leht, mille puu küljest..."

  19. Method 445.0 In Vitro Determination of Chlorophyll a and Pheophytin ain Marine and Freshwater Algae by Fluorescence

    This method provides a procedure for low level determination of chlorophyll a (chl a) and its magnesium free derivative, pheophytin a (pheo a), in marine and freshwater phytoplankton using fluorescence detection.(1,2) Phaeophorbides present in the sample are determined collective...

  20. Formation, structure and magnetism of the metastable defect fluorite phases AVO3.5+x (A=In, Sc)

    Shafi, Shahid P.; Lundgren, Rylan J.; Cranswick, Lachlan M.D.; Bieringer, Mario

    2007-01-01

    We report the preparation and stability of ScVO 3.5+x and the novel phase InVO 3.5+x . AVO 3.5+x (A=Sc, In) defect fluorite structures are formed as metastable intermediates during the topotactic oxidation of AVO 3 bixbyites. The oxidation pathway has been studied in detail by means of thermogravimetric/differential thermal analysis and in-situ powder X-ray diffraction. The oxidation of the bixbyite phase follows a topotactic pathway at temperatures between 300 and 400 deg. C in air/carbon dioxide. The range of accessible oxygen stoichiometries for the AVO 3.5+x structures following this pathway are 0.00≤x≤0.22. Rietveld refinements against powder X-ray and neutron data revealed that InVO 3.54 and ScVO 3.70 crystallize in the defect fluorite structure in space group Fm-3 m (227) with a=4.9863(5) and 4.9697(3)A, respectively with A 3+ /V 4+ disorder on the (4a) cation site. Powder neutron diffraction experiments indicate clustering of oxide defects in all samples. Bulk magnetic measurements showed the presence of V 4+ and the absence of magnetic ordering at low temperatures. Powder neutron diffraction experiments confirmed the absence of a long range ordered magnetic ground state. - Graphical abstract: Topotactic oxidation of AVO 3 bixbyite to AVO 3.5 defect fluorite structure followed by in-situ powder X-ray diffraction. The upper structural diagram shows a six coordinated (A/V)-O 6 fragment in bixbyite, the lower structure illustrates the same seven-fold coordinated (A/V)-O 7 cubic environment in the defect fluorite structure

  1. Eestlane tahab tasuta kvaliteetset arstiabi, järjekorras ootamata / Risto Sverdlik ; kommenteerinud Ain Aaviksoo, Eiki Nestor

    Sverdlik, Risto

    2009-01-01

    Autori hinnangul on Eesti tervishoiusüsteem sotsialistlik ning suhteliselt sarnase tervishoiusüsteemiga riikides on samad probleemid: ravijärjekorrad ja kulude kasv. Singapuri tervishoiumudelist. Autor leiab, et keskse planeerimisega tervishoiusüsteemi puhul kannatavad kõige rohkem vaesed, turumajanduslikus süsteemis aga ravihinnad järjest väheneksid

  2. 115 Qualité de la source Ain Hamma et effet du déversement de ses ...

    AKA BOKO

    contamination fécale : Coliformes totales, Coliformes fécaux, Streptocoques fécaux et Entérocoques intestinaux. Ces eaux ne semblent pas être influencées par la qualité bactériologique des eaux de la source dont le degré de pollution est inférieur à celui de l'oued mais reste inquiétant et pouvant constituer un.

  3. Nahast küünarvarrekaitsmed keskaegsest Tartust / Ain Mäesalu, Jüri Peets, Elna Haiba

    Mäesalu, Ain

    2008-01-01

    2000. aastal Tartust leitud 14. sajandi lõpukümnenditest või 15. sajandi algusest pärinevatest küünarvarrekaitsmetest. Keskaegsest kaitsevarustusest, Tartu küünarvarrekaitsmete valmistamistehnikast, nende kahjustustest ja konserveerimisest

  4. Tootest olulisemaks saab ärimudel. Kandiline arbuus tavalisest 30 korda kallim / Ain Alvela ; kommenteerinud Janek Kalvi

    Alvela, Ain, 1967-

    2011-01-01

    Eesti Arengufondi juhatuse esimehe Ott Pärna, ASi Kalev Chocolate Factory juhataja Kaido Kaare ja ASi Balsnack International Holding juhatuse esimehe Elmar Rusingu ettekannetest toiduainetööstuse aastakonverentsil "Uue tõusu ootuses". Graafik

  5. Ain't Necessarily So : Review and Critique of Recent Meta-Analyses of Behavioral Medicine Interventions in Health Psychology

    Coyne, James C.; Thombs, Brett D.; Hagedoorn, Mariet

    Objective: We examined four meta-analyses of behavioral interventions for adults (Dixon, Keefe, Scipio, Perri, & Abernethy, 2007; Hoffman, Papas, Chatkoff, & Kerns, 2007; Irwin, Cole, & Nicassio, 2006; and Jacobsen, Donovan, Vadaparampil, & Small, 2007) that have appeared in the Evidence Based

  6. Ain't necessarily so: review and critique of recent meta-analyses of behavioral medicine interventions in health psychology.

    Coyne, James C; Thombs, Brett D; Hagedoorn, Mariet

    2010-03-01

    We examined four meta-analyses of behavioral interventions for adults (Dixon, Keefe, Scipio, Perri, & Abernethy, 2007; Hoffman, Papas, Chatkoff, & Kerns, 2007; Irwin, Cole, & Nicassio, 2006; and Jacobsen, Donovan, Vadaparampil, & Small, 2007) that have appeared in the Evidence Based Treatment Reviews section of Health Psychology. Narrative review. We applied the following criteria to each meta-analysis: (1) whether each meta-analysis was described accurately, adequately, and transparently in the article; (2) whether there was an adequate attempt to deal with methodological quality of the original trials; (3) the extent to which the meta-analysis depended on small, underpowered studies; and (4) the extent to which the meta-analysis provided valid and useful evidence-based recommendations. Across the four meta-analyses, we identified substantial problems with the transparency and completeness with which these meta-analyses were reported, as well as a dependence on small, underpowered trials of generally poor quality. Results of our exercise raise questions about the clinical validity and utility of the conclusions of these meta-analyses. Results should serve as a wake up call to prospective authors, reviewers, and end-users of meta-analyses now appearing in the literature. Copyright 2010 APA, all rights reserved.

  7. Antisymmetric entangled two-photon states generated in nonlinear GaN/AIN photonic-band-gap structures

    Peřina ml., Jan; Centini, M.; Sibilia, C.; Bertolotti, M.; Scalora, M.

    2007-01-01

    Roč. 75, č. 1 (2007), 013805/1-013805/1 ISSN 1050-2947 R&D Projects: GA MŠk(CZ) 1M06002 Institutional research plan: CEZ:AV0Z10100522 Keywords : parametric down-conversion * quantum teleportation * interference * indistinguishability * dispersion Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.893, year: 2007

  8. Päästetute koor : [luuletused] / Nelly Sachs ; saksa k. tlk. [ja järelsõna:] Ain Kaalep

    Sachs, Nelly

    2003-01-01

    Sisu: Päästetute koor ; Kes aga tühjendas liivast teie kingad ; Et jälitatuist ei saaks jälitajad ; Sündmatute koor ; Liblikas ; Maailma rahvad ; Valmis on kõik maad ; Nii üksildane on inimene

  9. A New Look at Shelter 131/51 in the Natufian Site of Eynan (Ain-Mallaha, Israel.

    Gil Haklay

    Full Text Available In the past 25 years since the reconstruction of Shelter 131 of Eynan was suggested by Francois Valla, its image has become almost iconic--a highly cited symbol of early sedentism constituting a significant part of our knowledge on early stone constructions and the people behind them. A new look at the architectural remains and the stratigraphy resulted in an alternative reconstruction, essentially different than the one we have come to know. We used spatial (architectural-geometrical analysis in order to study the relationships between the different architectural elements and to test our hypothesis that the series of postholes may have not pertained to the upper floor 131 of Layer IV as suggested by Perrot and Valla, but rather to the successive occupational and architectural episode. The association of the postholes with Wall 51 of Layer III sheds new light on the architectural remains revealing their geometric design, an important characteristic of Early Natufian Architecture, the meaning and implications of which we shortly discuss.

  10. Keskkonnakaitsjad pakuvad välja abinõud GMO saaste vältimiseks / Ain Lember

    Lember, Ain

    2006-01-01

    Eesti Keskkonnaühenduste Koda esitas ettepanekud tagamaks geneetiliselt muundatud põllumajanduskultuuride kasvatamise selliselt, et need ei tekitaks kahju tava- ja mahepõllumeestele. Vt. samas: Põllumajandusminister Ester Tuiksoo kommentaar EKO ettepanekutele. Vt. samas: Eesti ilmselt toetab geenmuundatud taimede lubamist Euroopa Liitu ja lühiinterv. põllumajandusministeeriumi taimetervise osakonna juhataja Tambet Sovaga. Vt. ka lk. 5: Nastja Pertsjonok. GMO keskkonnakaitsja pilgu läbi

  11. Hydride vapor phase epitaxy growth of GaN, InGaN, ScN, and ScAIN

    Bohnen, T.

    2010-01-01

    Chemical vapor deposition (CVD); hydride vapor phase epitaxy (HVPE); gallium nitride (GaN); indium gallium nitride (InGaN); scandium nitride (ScN); scandium aluminum nitride (ScAlN); semiconductors; thin films; nanowires; III nitrides; crystal growth - We studied the HVPE growth of different III

  12. Söötmisega disainitud piim tagab tervisliku toidukraami / Ene Tammsaar ; intervjueerinud Ain Alvela ; kommenteerinud Üllas Jaaska

    Tammsaar, Ene, 1952-

    2014-01-01

    Et farmidest tööstusse minevast toorpiimast saaks toota maitsvaid ja tervislikke tooteid, peab toorpiim olema kõrgeima võimaliku kvaliteediga. Selle tagamiseks on piimatööstused koostöös teadlastega ette võtnud piima koostise disainimise

  13. Straight talk about high-fructose corn syrup: what it is and what it ain't.

    White, John S

    2008-12-01

    High-fructose corn syrup (HFCS) is a fructose-glucose liquid sweetener alternative to sucrose (common table sugar) first introduced to the food and beverage industry in the 1970s. It is not meaningfully different in composition or metabolism from other fructose-glucose sweeteners like sucrose, honey, and fruit juice concentrates. HFCS was widely embraced by food formulators, and its use grew between the mid-1970s and mid-1990s, principally as a replacement for sucrose. This was primarily because of its sweetness comparable with that of sucrose, improved stability and functionality, and ease of use. Although HFCS use today is nearly equivalent to sucrose use in the United States, we live in a decidedly sucrose-sweetened world: >90% of the nutritive sweetener used worldwide is sucrose. Here I review the history, composition, availability, and characteristics of HFCS in a factual manner to clarify common misunderstandings that have been a source of confusion to health professionals and the general public alike. In particular, I evaluate the strength of the popular hypothesis that HFCS is uniquely responsible for obesity. Although examples of pure fructose causing metabolic upset at high concentrations abound, especially when fed as the sole carbohydrate source, there is no evidence that the common fructose-glucose sweeteners do the same. Thus, studies using extreme carbohydrate diets may be useful for probing biochemical pathways, but they have no relevance to the human diet or to current consumption. I conclude that the HFCS-obesity hypothesis is supported neither in the United States nor worldwide.

  14. Development of Production PVD-AIN Buffer Layer System and Processes to Reduce Epitaxy Costs and Increase LED Efficiency

    Cerio, Frank

    2013-09-14

    The DOE has set aggressive goals for solid state lighting (SSL) adoption, which require manufacturing and quality improvements for virtually all process steps leading to an LED luminaire product. The goals pertinent to this proposed project are to reduce the cost and improve the quality of the epitaxial growth processes used to build LED structures. The objectives outlined in this proposal focus on achieving cost reduction and performance improvements over state-of-the-art, using technologies that are low in cost and amenable to high efficiency manufacturing. The objectives of the outlined proposal focus on cost reductions in epitaxial growth by reducing epitaxy layer thickness and hetero-epitaxial strain, and by enabling the use of larger, less expensive silicon substrates and would be accomplished through the introduction of a high productivity reactive sputtering system and an effective sputtered aluminum-nitride (AlN) buffer/nucleation layer process. Success of the proposed project could enable efficient adoption of GaN on-silicon (GaN/Si) epitaxial technology on 150mm silicon substrates. The reduction in epitaxy cost per cm{sup 2} using 150mm GaN-on-Si technology derives from (1) a reduction in cost of ownership and increase in throughput for the buffer deposition process via the elimination of MOCVD buffer layers and other throughput and CoO enhancements, (2) improvement in brightness through reductions in defect density, (3) reduction in substrate cost through the replacement of sapphire with silicon, and (4) reduction in non-ESD yield loss through reductions in wafer bow and temperature variation. The adoption of 150mm GaN/Si processing will also facilitate significant cost reductions in subsequent wafer fabrication manufacturing costs. There were three phases to this project. These three phases overlap in order to aggressively facilitate a commercially available production GaN/Si capability. In Phase I of the project, the repeatability of the performance was analyzed and improvements implemented to the Veeco PVD-AlN prototype system to establish a specification and baseline PVD-AlN films on sapphire and in parallel the evaluation of PVD AlN on silicon substrates began. In Phase II of the project a Beta tool based on a scaled-up process module capable of depositing uniform films on batches of 4”or 6” diameter substrates in a production worthy operation was developed and qualified. In Phase III, the means to increase the throughput of the PVD-AlN system was evaluated and focused primarily on minimizing the impact of the substrate heating and cooling times that dominated the overall cycle time.

  15. "It ain't all as bad as it may seem": young Black lesbians' responses to sexual prejudice.

    Reed, Sarah J; Valenti, Maria T

    2012-01-01

    This article explores the ways in which young, Black lesbians manage their sexual minority identity when experiencing sexual prejudice. Fourteen Black lesbians between the ages of 16 and 24 participated in semistructured interviews. Instances of sexual prejudice and the young women's responses were thematically analyzed using open and axial qualitative coding techniques. Results indicated that participants experienced sexual prejudice frequently and even within the lesbian community. Responses to sexual prejudice included: cognitive reframing of heterosexist messages, passing, gaining support from self-created gay families, and fighting back (physically and verbally) in the event of isolated instances of sexual prejudice. Analysis focuses on how gender identity relates to experiences of sexual prejudice and identity management strategies. Findings suggest that there are parallels between the management strategies of these women and young, Black gay and bisexual males and between these women and Black women who are coping with sexism and racism.

  16. Merle Karusoo uue tüki aines pärineb lõpukirjandist / Garel Püüa

    Püüa, Garel

    2006-01-01

    Merle Karusoo alustab proove eesti ja vene koolide õpilaste lõpukirjandite põhjal koostatud lavastusega. Septembris Draamateatris esietenduva Karusoo lavastuse tööpealkiri on "Küpsuskirjand 2005"

  17. Merle Karusoo uue tüki aines pärineb lõpukirjanditest / Garel Püüa

    Püüa, Garel

    2006-01-01

    Lavastaja Merle Karusoo alustab peagi proove lavastusega, mis on koostatud õpilaste lõpukirjandite põhjal. Käsitletavad kirjanditeemad on venekeelsetelt lõpetajatelt ́ђجSeda maad nimetan ma kodumaakśђح ja eestlastelt ́ђجRahvussuhted 21. sajandiĺђح

  18. Nitric oxide as a mediator of gastrointestinal mucosal injury?—Say it ain't so

    Paul Kubes

    1995-01-01

    Full Text Available Nitric oxide has been suggested as a contributor to tissue injury in various experimental models of gastrointestinal inflammation. However, there is overwhelming evidence that nitric oxide is one of the most important mediators of mucosal defence, influencing such factors as mucus secretion, mucosal blood flow, ulcer repair and the activity of a variety of mucosal immunocytes. Nitric oxide has the capacity to down-regulate inflammatory responses in the gastrointestinal tract, to scavenge various free radical species and to protect the mucosa from injury induced by topical irritants. Moreover, questions can be raised regarding the evidence purported to support a role for nitric oxide in producing tissue injury. In this review, we provide an overview of the evidence supporting a role for nitric oxide in protecting the gastrointestinal tract from injury.

  19. If it ain't broke, don't price fix it: the OFT and the PPRS.

    Towse, Adrian

    2007-07-01

    The Office of Fair Trading (OFT) Report on the UK Pharmaceutical Price Regulation Scheme (PPRS) recommends that when the current five-year PPRS expires in 2010 it be replaced with 'value-based pricing' which involves pre-launch centralised government price setting based on a cost-per-QALY threshold plus periodic ex post reviews. I examine the validity of the OFTs criticisms of the existing PPRS, review its proposals and propose an alternative way forward. I conclude that PPRS has performed well as a procurement bargain between industry and the UK government. It does not, however, incentivise efficient relative prices. That is not its job. I identify a number of problems with the OFT proposals. I recommend that key elements of a reformed UK pharmaceutical environment for 2010 should include an expanded role for HTA but with companies retaining freedom to set prices at launch; HTA use targeted via a contingent value of information approach; a retained backstop PPRS, perhaps moving to an RPI-X type control; the use of risk sharing and non-linear pricing arrangements; measures to ensure more effective therapeutic switching at local level; and measures to improve the take up of cost-effective treatments. Copyright (c) 2007 John Wiley & Sons, Ltd.

  20. Evaluations of parameters peculiar to the third group nitrides: BN, AIN, GaN and InN

    Davydov, S Y

    2002-01-01

    The estimations of dielectric, optical electrooptical, magnetic and phonon characteristics of XN (X = B, Al, Ga, In) crystals are obtained by means of simple methods using both quantum mechanics and semiempirical approaches. The values of deformation potentials and magnetic susceptibility these nitrides are defined. The calculation results are compared with experimental data and data obtained by other authors

  1. It ain't what you say, it's how you say it: linguistic and cultural diversity in the classroom.

    Robinson, Cynthia Cole; Clardy, Pauline

    2011-01-01

    The disparity between the cultural and linguistic diversity of the teaching population and the student population continues to grow as teacher education programs enroll and graduate primarily white teacher candidates (83.7%). At the same time, the diversity of the K-12 student body has increased with 65% of public school students being from culturally and linguistically diverse backgrounds (National Center for Education Statistics, 2007). This chasm between the diversity of the teaching force and student population is of concern as many teachers report that they do not have the cultural knowledge and experience of working or living in diverse environments, yet will be faced with teaching a very diverse student population. Hence, the need for teacher candidates and current teachers to be explicitly taught the skills needed to successfully teach diverse student populations is urgent. In this article, we explore the following phenomena: how linguistic and cultural diversity is regarded in teacher education programs, as well as teacher candidates' and current K-12 teachers' dispositions towards students who do not share their cultural backgrounds or language (including those who vary in their dialects). Finally, we will present strategies that teacher educators can use to embrace and empower culturally and linguistically diverse (CLD) teacher candidates, as well as prepare teacher candidates to teach diverse student populations.

  2. Your tooth it ain't so purty but it's gen-u-ine: Cole Porter's comic song "Snagtooth Gertie".

    Christen, Arden G; Christen, Joan A

    2010-01-01

    Cole Porter (1891-1964), an American musical icon, has been internationally acknowledged as one of the most cosmopolitan, sophisticated, elegant and influential composer-lyricists of the 20th century. Born in Indiana and raised in wealth and privilege, he attended both Yale and Harvard universities where he honed his song-writing skills. In his 800 tunes, many of which became smash hits, he blended fresh, witty, urbane and colloquial lyrics with catchy, singable melodies. He composed musical scores for both Broadway stage and Hollywood movies, but focused on the former. While Porter enjoyed penning comic songs, he rarely had them published. In 1946, Cole wrote the music and lyrics for a Broadway show entitled Around the World in Eighty Days. Deemed a failure, it closed after only 75 performances. One light-hearted ditty, "Snagtooth Gertie", which he composed for the show, was never used. The lyrics are presented for the first time in this paper.

  3. Küttimine võib septembris peatuda. Maaomanikud vs. jahimehed / Ain Alvela ; kommenteerinud Heiki Hepner, Val Rajasaar

    Alvela, Ain, 1967-

    2011-01-01

    Maksumaksjad ja maaomanikud toetavad Eesti jahindust sisuliselt viie miljoni euroga aastas, kuigi keskkonnaspetsialistide hinnangul võiks asi olla vastupidi. Kehtiv jahiseadus ei aita kaasa metsa väärtuse parandamisele. Tabelid

  4. "I Ain't Changing Anything": A Case-Study of Successful Generation 1.5 Immigrant College Students' Writing

    Riazantseva, Anastasia

    2012-01-01

    The purpose of this case-study was to understand the relationship between success in college and L2 academic writing of three Generation 1.5 Russian-speaking middle-class college students and to describe the factors that could have contributed to the levels of academic literacy that these students developed. The following research questions were…

  5. Piimandus: laenukarid, ikaldused ja hinnaralli tõid kriisi / Ain Alvela ; kommenteerinud Tiit Tuuleveski, Urmas Põlluaas ja Tõnu Post

    Alvela, Ain, 1967-

    2009-01-01

    Kuigi piimatootmisega tegelevad ettevõtted vajaksid tegevuse arendamiseks hädasti investeeringuid, jäävad enamiku rahastamisplaanid paremaid aegu ootama. Diagramm. Kommenteerivad Tiit Tuuleveski, Urmas Põlluaas ja Tõnu Post

  6. Eesti kaubavahetus majanduse põhikategooriate järgi = Foreign trade of Estonia by broad economic categories / Riina Kerner, Allan Aron

    Kerner, Riina

    2010-01-01

    Eesti väliskaubanduse näitajatest 2009. aastal: Eesti kaupade eksport oli 101,3 miljardit krooni, import 114,1 miljardit krooni, kaubavahetuse puudujääk oli 12,8 miljardit krooni. Majanduse põhikategooriate järgi oli suurim osatähtsus kaubavahetuses vahetarbekaupadel, neile järgnesid tarbekaubad ja kapitalikaubad. Diagramm. Graafikud

  7. Reconstruction of the Exposure Histories of 20 Allan Hills Ordinary Chondrites on the Basis of Cosmogenic 10Be, 26Al, Noble Gases, and Cosmic Ray Tracks

    Neupert, U.; Knauer, M.; Michel, R.; Loeken, Th.; Schultz, L.; Dittrich-Hannen, B.; Suter, M.; Kubik, P. W.; Metzler, K.; Romstedt, J.

    1995-09-01

    Twenty ordinary chondrites from the 1988/89 meteorite search (ALH 88004, 88008, 88010, 88011, 88013, 88016 to 88021, 88026 to 88031, 88033, 88039, 88042) [1,2] were investigated for 10Be and 26Al, and for He, Ne and Ar by accelerator and rare gas mass spectrometry, respectively. Cosmic ray tracks were measured in samples of ALH 88019. Using theoretical production rates calculated by a physical model [3] the experimental data are interpreted with respect to the reconstruction of the preatmospheric exposure conditions and exposure histories of the meteoroids. Ordinary chondrites are particularly well suited to exemplify the capabilities of an interpretation of many cosmogenic nuclides measured in one sample. Model calculations of GCR production rates were performed for 10Be, 26Al, 3He, 21Ne, 22Ne and 38Ar as reported elsewhere [4,5]. For all meteorites, except for ALH 88019, the cosmogenic nuclide data can be explained by simple one stage exposure histories between 3 Ma and 44 Ma in meteoroids with radii between 5 cm and 85 cm. Exposure ages were derived from cosmogenic 3He, 21Ne and 38Ar on the basis of the theoretical production rates as function of3He/21Ne and 22Ne/21Ne as well as on the empirical ones proposed by Eugster [6]. The average ratios of exposure ages determined from theoretical production rates to those calculated according to Eugster [6] were 1.08+/-0.11, 1.11+/-0.25 and 1.12+/-0.17 in case of 3He, 21Ne and 38Ar, respectively. Repeated measurements of 10Be and 26Al in ALH 88019 resulted in 10.4+/-1.3 dpm/kg and 5.6+/-0.5 dpm/kg, respectively. But, the cosmogenic rare gas concentrations point to a (single stage) exposure age of 39 Ma in a meteoroid. This is in accordance with a measured cosmic ray track density in olivine of 2.8 * 10^6 cm^-2. The samples are from depths betwen 3 cm and 8 cm. Based on the track data we obtain a minimum meteoroid radius of 8 cm. The low 10Be and 26Al cannot be explained by a one stage exposure history and a long terrestrial age. Possible other exposure scenarios are discussed. Using the theoretical 10Be production rates and the 3He/21Ne and 22Ne/21Ne ratios, constraints about the sizes of the meteoroids and about the shielding depths in the samples were derived. 26Al was not used for this purpose since in four meteorites it is evidently affected by SCR production and since, generally, it could be changed due to long terrestrial residence times. However, most of the observed 26Al concentrations which are not affected by SCR production are consistent within experimental uncertainties with the expected GCR production rates. Substantial terrestrial age are proposed for ALH 88008, ALH 88029 and ALH 88030. Pairing among the investigated meteorites is discussed on the basis of rare gas data, 10Be and 26Al, and NTL data by Benoit et al. [7,8]. It can be concluded that the 20 meteorites result from at least 16 different falls. Acknowledgement: This work was supported by the Deutsche Forschungsgemeinschaft and the Swiss National Science Foundation. References: [1] Meteoritical Bulletin (1990) Meteoritics, 25, 237. [2] Meteoritical Bulletin (1991) Meteoritics, 26, 68. [3] Michel R. et al. (1991) Meteoritics, 26, 221-242. [4] Michel R. et al. (1995) Planet. Space Sci., in press. [5] Herpers U. et al. (1995) Planet. Space Sci., in press. [6] Eugster O. (1988) GCA, 52, 1649-1662. [7] Benoit P. H. et al. (1991) Meteoritics, 26, 262. [8] Benoit P. H. et al. (1992) Meteoritics, 27, 110.

  8. Jaani kogudus tähistas Einar Kiviste 100ndat sünniaastapäeva / Allan Taruste ; fotod: Tea Taruste

    Taruste, Allan

    2006-01-01

    15. oktoobril Sydney Jaani koguduses piduliku jumalateenistusega, praosti lesele Ermilde Kivistele öeldi palju sooje sõnu. Teenistust ilmestas lauluga Andres Perendi, põhjaliku ettekande esitas Aet Lees

  9. Vaike Kiik-Salupere doktoritööst "Esinemiseks valmistumine ja esinemisärevusega toimetulek klassikaliste lauljate vokaalpedagoogikas" / Allan Vurma

    Vurma, Allan, 1955-

    2014-01-01

    Arvustus: Kiik-Salupere, Vaike. Performance preparation and coping with performance anxiety in the vocal pedagogy of classical singers. Tallinn : Tallinn University, 2013. (Tallinna Ülikooli sotsiaalteaduste dissertatsioonid ; 64)

  10. Just watching the game ain't enough: striatal fMRI reward responses to successes and failures in a video game during active and vicarious playing.

    Kätsyri, Jari; Hari, Riitta; Ravaja, Niklas; Nummenmaa, Lauri

    2013-01-01

    Although the multimodal stimulation provided by modern audiovisual video games is pleasing by itself, the rewarding nature of video game playing depends critically also on the players' active engagement in the gameplay. The extent to which active engagement influences dopaminergic brain reward circuit responses remains unsettled. Here we show that striatal reward circuit responses elicited by successes (wins) and failures (losses) in a video game are stronger during active than vicarious gameplay. Eleven healthy males both played a competitive first-person tank shooter game (active playing) and watched a pre-recorded gameplay video (vicarious playing) while their hemodynamic brain activation was measured with 3-tesla functional magnetic resonance imaging (fMRI). Wins and losses were paired with symmetrical monetary rewards and punishments during active and vicarious playing so that the external reward context remained identical during both conditions. Brain activation was stronger in the orbitomedial prefrontal cortex (omPFC) during winning than losing, both during active and vicarious playing. In contrast, both wins and losses suppressed activations in the midbrain and striatum during active playing; however, the striatal suppression, particularly in the anterior putamen, was more pronounced during loss than win events. Sensorimotor confounds related to joystick movements did not account for the results. Self-ratings indicated losing to be more unpleasant during active than vicarious playing. Our findings demonstrate striatum to be selectively sensitive to self-acquired rewards, in contrast to frontal components of the reward circuit that process both self-acquired and passively received rewards. We propose that the striatal responses to repeated acquisition of rewards that are contingent on game related successes contribute to the motivational pull of video-game playing.

  11. Perforated Peptic Ulcer: Different Ethnic, Climatic and Fasting Risk Factors for Morbidity in Al-Ain Medical District, United Arab Emirates

    Fawaz Chikh Torab

    2009-04-01

    Conclusion: Patients with dyspeptic symptoms and a history of previous PUD should be considered for prophylactic treatment to prevent ulcer recurrence during prolonged daytime fasting in Ramadan, especially during the winter time.

  12. Maastikusõiduk UTV aitab tööd teha ja lõõgastuda / Ain Alvela ; kommenteerinud Tanel Rütman

    Alvela, Ain, 1967-

    2015-01-01

    Analoogselt ATVga (ingl k All Terrain Vehicle - iga maastiku sõiduk) võib ka UTVd (ingl k Utility Terrain Vehicle - vahend maastikul liikumiseks) käsitleda nii tarbesõidukina väiksemate maatööde tegemiseks või raskestiläbitaval maastikul liikumiseks kui ka lihtsalt adrenaliinilaksu pakkuva meelelahutajana

  13. I've got 99 problems but a phone ain't one: Electronic and mobile health in low and middle income countries.

    Kumar, Pratap; Paton, Chris; Kirigia, Doris

    2016-10-01

    Mobile technology is very prevalent in Kenya-mobile phone penetration is at 88% and mobile data subscriptions form 99% of all internet subscriptions. While there is great potential for such ubiquitous technology to revolutionise access and quality of healthcare in low-resource settings, there have been few successes at scale. Implementations of electronic health (e-Health) and mobile health (m-Health) technologies in countries like Kenya are yet to tackle human resource constraints or the political, ethical and financial considerations of such technologies. We outline recent innovations that could improve access and quality while considering the costs of healthcare. One is an attempt to create a scalable clinical decision support system by engaging a global network of specialist doctors and reversing some of the damaging effects of medical brain drain. The other efficiently extracts digital information from paper-based records using low-cost and locally produced tools such as rubber stamps to improve adherence to clinical practice guidelines. By bringing down the costs of remote consultations and clinical audit, respectively, these projects offer the potential for clinics in resource-limited settings to deliver high-quality care. This paper makes a case for continued and increased investment in social enterprises that bridge academia, public and private sectors to deliver sustainable and scalable e-Health and m-Health solutions. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/

  14. Mööbel vajab nišše ja ekspordiauke. Vallutamist ootab vana Euroopa / Ain Alvela ; kommenteerinud Ari Lustila, Heido Vitsur, Priit Tamm

    Alvela, Ain, 1967-

    2011-01-01

    Olukorrast mööbliturul: edukamad on olnud korpusmööbliga tegelevad ettevõtted. Arvamust avaldavad ASi Suwem turundusjuht Mart Nilson ja OÜ Bellus Furnitur tootmisjuht Rolf Kristian Relander. Diagrammid

  15. The atomic world spooky? It ain't necessarily so! emergent quantum mechanics, how the classical laws of nature can conspire to cause quantum-like behaviour

    van Holten, Theo

    2017-01-01

    The present book takes the discovery that quantum-like behaviour is not solely reserved to atomic particles one step further. If electrons are modelled as vibrating droplets instead of the usually assumed point objects, and if the classical laws of nature are applied, then exactly the same behaviour as in quantum theory is found, quantitatively correct! The world of atoms is strange and quantum mechanics, the theory of this world, is almost magic. Or is it? Tiny droplets of oil bouncing round on a fluid surface can also mimic the world of quantum mechanics. For the layman - for whom the main part of this book is written - this is good news. If the everyday laws of nature can conspire to show up quantum-like phenomena, there is hope to form mental pictures how the atomic world works. The book is almost formula-free, and explains everything by using many sketches and diagrams. The mathematical derivations underlying the main text are kept separate in a -peer reviewed - appendix. The author, a retired professor ...

  16. Mars ain't the kind of place to raise your kid: ethical implications of pregnancy on missions to colonize other planets.

    Schuster, Haley; Peck, Steven L

    2016-12-01

    The colonization of a new planet will inevitably bring about new bioethical issues. One is the possibility of pregnancy during the mission. During the journey to the target planet or moon, and for the first couple of years before a colony has been established and the colony has been accommodated for children, a pregnancy would jeopardize the safety of the crew and the wellbeing of the child. The principal concern with a pregnancy during an interplanetary mission is that it could put the entire crew in danger. Resources such as air, food, and medical supplies will be limited and calculated to keep the crew members alive. We explore the bioethical concerns of near-future space travel.

  17. Õnnistus : [luuletused] / Charles Baudelaire ; tlk. Johannes Semper, Ants Oras, August Sang, Ilmar Laaban, Ain Kaalep, Indrek Hirv, Jaan Kross

    Baudelaire, Charles, 1821-1867

    2006-01-01

    Sisu: Õnnistus ; Albatross ; Ülenemine ; Vastavusi ; Kutse teekonnale ; Muusika ; Elav tungal ; Vaenlane ; Ebaõnn ; Mees ja meri ; Ilu ; Hiigelnaine ; Hümn ilule ; Kalliskivid ; Eksootiline lõhn ; Raibe ; Vampiir ; Pihtimus ; Kass ; Mis ütled, vaene hing ; Lõhnapudel ; Sume laotus ; Kutse teele ; Sügissonett ; Öökullid ; Olematuse maitse ; Spliin : "Mu mälestuste last on nii painajalik..." ; Spliin : "Ma olen nii kui vürst, vürst sajulisel maal..." ; Mõrane kell ; "Nagu põhjatu taevas, öös tummuv ja mustav..." ; Kell ; Maastik ; Päike ; Punajuukselisele kerjustüdrukule ; Luik ; Hämarus ; Mäng ; Somp ja udud ; Pariisi unenägu ; Hommikuhämarik ; Üksildaste vein ; Üks märtritar ; Beatrice ; Aabel ja Kain ; Armastajate surm ; Vaeste surm ; Matk ; Lunahind ; Ühe pilgu lubadused. Eluloolisi andmeid autori kohta lk. 703

  18. Kuidas on läinud vene koolide eestikeelsele aineõppele üleminek? / Natalja Lapikova, Vjatšeslav Gussarov, Irene Käosaar

    Lapikova, Natalja

    2008-01-01

    Küsimusele vastavad Tallinna Haridusameti hariduskorralduse teenistuse üldhariduse osakonna vanemspetsialist Natalja Lapikova, Tallinna Kesklinna Vene Gümnaasiumi direktor Vjatšeslav Gussarov ja HTM-i rahvusvähemuste hariduse osakonna juhataja Irene Käosaar

  19. 'It ain't what you do it's the way that you do it': lessons for health care from decommissioning of older people's services.

    Robinson, Suzanne; Glasby, Jon; Allen, Kerry

    2013-11-01

    Public sector organisations are facing one of the most difficult financial periods in history and local decision-makers are tasked with making tough rationing decisions. Withdrawing or limiting services is an emotive and complex task and something the National Health Service has always found difficult. Over time, local authorities have gained significant experience in the closure of care homes - an equally complex and controversial issue. Drawing on local knowledge and best practice examples, this article highlights lessons and themes identified by those decommissioning care home services. We believe that such lessons are relevant to those making disinvestment decisions across public sector services, including health-care. The study employed semi-structured interviews with 12 Directors of Adult Social Services who had been highlighted nationally as having extensive experience of home closures. Interviews were conducted over a 2-week period in March 2011. Results from the study found that having local policy guidance that is perceived as fair and reasonable was advocated by those involved in home closures. Many local policies had evolved over time and had often been developed following experiences of home closures (both good and bad). Decisions to close care home services require a combination of strong leadership, clear strategic goals, a fair decision-making process, strong evidence of the need for change and good communication, alongside wider stakeholder engagement and support. The current financial challenge means that public sector organisations need to make tough choices on investment and disinvestment decisions. Any such decisions need to be influenced by what we know constitutes best practice. Sharing lessons and experiences within and between sectors could well inform and develop decision-making practices. © 2013 John Wiley & Sons Ltd.

  20. Ehitusmaavarad ümber puhkes poliitiline kemplemine. Ettevõtjad loodavad kindlust tuleviku ees / Ain Alvela ; kommenteerinud Veljo Haube ja Enno Reinsalu

    Alvela, Ain, 1967-

    2011-01-01

    Valitsus on kinnitanud ehitusmaavarade arengukava aastani 2020 ja sinna on sisse kirjutatud ka Nabala karstiala lubjakivivarud, kuigi enne 6. märtsil toimunud parlamendivalimisi oli lubatud, et need jäetakse arengukavast välja. Tõstetakse ka ressursitasusid

  1. Kõrghoone "Tower" Tallinnas, Tartu mnt. ja Pääsukese tänava nurgal. Projekt, 1996. Arhitektid Vilen Künnapu ja Ain Padrik

    1997-01-01

    32-korruselise torni neljal esimesel korrusel on kaubamaja, järgmisel viiel korrusel parkla, siis tehnilise korruse järel on 14 korrusel bürooruumid, seejärel viiel korrusel korterid, järgnevastel korrustel bürood, restoran, baar jm.

  2. It Don't Mean a Thing if It Ain't Got Musicality: A Music-First Method for Teaching Historically Rooted Jazz Dance

    Liebhard, Erinn

    2015-01-01

    This article proposes a method for teaching jazz dance technique according to music concepts and prioritizing deep embodiment of music. This method addresses what can be seen as a disconnect between current practices and historical understanding in jazz dance today, a gap that can be bridged with education empowering students to make innovative…

  3. Interacción analgésica entre antiinflamatorios no esteroideos (AINES) y opiáceos durante la anestesia inhalatoria en la rata

    Benito de la Víbora, Javier

    2016-01-01

    La reducción de las necesidades de anestésicos inhalatorios mediante la coadministración de analgésicos intraoperatorios conlleva un incremento del margen de seguridad del paciente pero también una disminución de la polución ambiental y una reducción de costes. La combinación de diferentes tipos de analgésicos puede incrementar dicho efecto ahorrador de anestésico e incluso se ha observado un efecto potenciador derivado de la administración conjunta con de inhibidores de la ciclooxigenasa (CO...

  4. "That Ain't No Ninja Turtles": The Prevalence and Influence of Popular Culture in the Talk and Writing of Prekindergarten Children

    Kissel, Brian T.

    2011-01-01

    This article describes how 2 classrooms of 4-year-old children incorporated popular media (cartoons, television shows, video games, movies, and music) into their conversations with peers during writing. The findings assert that (a) children naturally incorporate popular culture into their writing, (b) children include popular culture in their…

  5. I Ain't Gonna Make It. Comparing Job Demands-Resources and Attrition Intention Between Senior Teachers and Senior Employees of Six Other Occupational Categories in Flanders.

    Van Droogenbroeck, Filip; Spruyt, Bram

    2016-07-01

    Teachers are often thought to retire early and have more stress and burnout than other human service professionals. In this article, we investigate attrition intention amongst senior teachers and senior employees of six other blue- and white-collar occupational categories using the Job Demands-Resources (JD-R) model. We followed a two-step approach. First, analysis of variance and logistic regression analysis was used to assess differences in the level of job demands, resources, and attrition intention between occupations for male and female employees separately. Subsequently, multiple group path analysis was used to assess the invariance of the JD-R model across occupational groups and genders. We used representative data gathered in Flanders among 6,810 senior employees (45 years or older). Results indicate that there are differences in the determinants of attrition intention between men and women. The differences in attrition intention are minimal between occupations once controlled for job demands and resources. In addition, the JD-R model is largely invariant across white-collar occupations and gender. We provide support for both the energetic and motivational process of the JD-R model. © The Author(s) 2016.

  6. A nickel ain't worth a dime anymore: the illusion of money and the rapid encoding of its true value.

    Rongjun Yu

    Full Text Available People often evaluate money based on its face value and overlook its real purchasing power, known as the money illusion. For example, the same 100 Chinese Yuan can buy many more goods in Tibet than in Beijing, but such difference in buying power is usually underestimated. Using event related potential combined with a gambling task, we sought to investigate the encoding of both the real value and the face value of money in the human brain. We found that the self-reported pleasantness of outcomes was modulated by both values. The feedback related negativity (FRN, which peaks around 250ms after feedback and is believed to be generated in the anterior cingulate cortex (ACC, was only modulated by the true value but not the face value of money. We conclude that the real value of money is rapidly encoded in the human brain even when participants exhibit the money illusion at the behavioral level.

  7. Mass movement susceptibility mapping - A comparison of logistic regression and Weight of evidence methods in Taounate-Ain Aicha region (Central Rif, Morocco

    JEMMAH A I

    2018-01-01

    Full Text Available Taounate region is known by a high density of mass movements which cause several human and economic losses. The goal of this paper is to assess the landslide susceptibility of Taounate using the Weight of Evidence method (WofE and the Logistic Regression method (LR. Seven conditioning factors were used in this study: lithology, fault, drainage, slope, elevation, exposure and land use. Over the years, this site and its surroundings have experienced repeated landslides. For this reason, landslide susceptibility mapping is mandatory for risk prevention and land-use management. In this study, we have focused on recent large-scale mass movements. Finally, the ROC curves were established to evaluate the degree of fit of the model and to choose the best landslide susceptibility zonation. A total mass movements location were detected; 50% were randomly selected as input data for the entire process using the Spatial Data Model (SDM and the remaining locations were used for validation purposes. The obtained WofE’s landslide susceptibility map shows that high to very high susceptibility zones contain 62% of the total of inventoried landslides, while the same zones contain only 47% of landslides in the map obtained by the LR method. This landslide susceptibility map obtained is a major contribution to various urban and regional development plans under the Taounate Region National Development Program.

  8. Justiitsminister Langi umbusaldamine kogub hoogu / Tuuli Koch; kommenteerinud Andrus Ansip, AIn Seppik, Valdur Lahtvee, Karel Rüütli, Andres Herkel, Sven Mikser

    Koch, Tuuli

    2009-01-01

    Reformierakonna valitsuspartner IRL ja opositsioon ei mõista justiitsminister Rein Langi otsust ajutise siseministrina kustutada küberrünnakuga seotud Sergei Markovi nimi Schengeni mustast nimekirjast

  9. Your blues ain't like mine: considering integrative antiracism in HIV prevention research with black men who have sex with men in Canada and the United States.

    Nelson, LaRon E; Walker, Ja'Nina J; DuBois, Steve N; Giwa, Sulaimon

    2014-12-01

    Evidence-based interventions have been developed and used to prevent HIV infections among black men who have sex with men (MSM) in Canada and the United States; however, the degree to which interventions address racism and other interlocking oppressions that influence HIV vulnerability is not well known. We utilize integrative antiracism to guide a review of HIV prevention intervention studies with black MSM and to determine how racism and religious oppression are addressed in the current intervention evidence base. We searched CINAHL, PsychInfo, MEDLINE and the CDC compendium of evidence-based HIV prevention interventions and identified seventeen interventions. Three interventions targeted black MSM, yet only one intervention addressed racism, religious oppression, cultural assets and religious assets. Most interventions' samples included low numbers of black MSM. More research is needed on interventions that address racism and religious oppression on HIV vulnerability among black MSM. Future research should focus on explicating mechanisms by which multiple oppressions impact HIV vulnerability. We recommend the development and integration of social justice tools for nursing practice that aid in addressing the impacts of racism and other oppressions on HIV vulnerability of black MSM. © 2014 John Wiley & Sons Ltd.

  10. Ėtude sur l’alimentation du poulet de chaire à base du maïs Zenata et Ain kebira

    KENZI, MOHAMMED ZAKARYA; WAHAJ, MOHAMMED

    2016-01-01

    Résume L’aliment représente 70% du cout de production dans l’élevage de poulet de chair, il est donc important d’accorder une attention particulière à ce paramètre. Ce dernier est le premier poste intervenant dans le prix de revient du poulet de chair. La supplémentation de l’aliment du poulet en 2 5% de maïs durant le démarrage et croissance permet aussi de réduire le cout d’élevage et d’améliorer le poids a l’abattage. Study chair of chicken feed made of corn Summ...

  11. It Ain't the Heat, It's the Humanity: Evidence and Implications of a Knowledge-Based Consensus on Man-Made Global Warming

    Jacobs, P.; Cook, J.; Nuccitelli, D. A.

    2013-12-01

    One of the most worrisome misconceptions among the general public about climate change is a belief that scientists disagree not only about the cause of the present climate change, but also whether or not the planet is currently warming. Recent surveys have demonstrated that an overwhelming consensus exists, both within the scientific literature and among scientists with climate expertise, that the planet is warming and humans are driving this climatic change. This disconnect, or 'consensus gap', between scientific agreement and public belief has significant consequences for public understanding of the reality and cause of climate change, as well as support for potential solutions. Ensuring that the consensus message is not simply broadcast but is also accepted as legitimate by the public appears to be a primary education and communications opportunity. While the existence of a consensus is not itself evidence of a position's truth, according to Miller (2013) scientific consensus can be taken as evidence that a position is true if it is 'knowledge-based', satisfying the conditions of social calibration, apparent consilience of evidence, and social diversity. We demonstrate that the scientific consensus on anthropogenic climate change is knowledge-based, satisfying Miller's criteria. In so doing, we hope to increase confidence in its use as an education and communications tool, and assure the public of its validity. We show the consensus is socially calibrated, based on common evidential standards, ontological schemes, and shared formalism. We establish that consilience of evidence points overwhelmingly to the reality of anthropogenic climate change by examining the evidence from several perspectives. We identify unique fingerprints expected as a result of increased greenhouse forcing, eliminate potential natural drivers of climate change as the cause of the present change, and demonstrate the consistency of the observed climate response with known changes in natural and manmade forcings across a wide variety of indices. Finally, we determine that the consensus is socially diverse, being geographically and disciplinarily varied, supported within public and private institutions, and endorsed by research organizations as well as groups with obvious financial incentives to deny it, such as fossil fuel companies. Additionally, we briefly discuss examples of purported incorrect consensus in climate research, and detail how they fail to satisfy one or more aspects of Miller's criteria. We conclude by discussing the key role that knowledge-based consensus can potentially play in education, influencing public beliefs about climate change, and increasing support for solutions.

  12. Gene : CBRC-GGOR-01-1448 [SEVENS

    Full Text Available ain Friedlin] 1e-79 49% MCLALGSAGTADDVKLHPVACADTARSTPGTSAPSTPGTSAPSTPGTSAPSTSGISAPSTSGTSAPSTLGTSAPSKPGTSAPSKPGISAPSTSGISAPSTSGTSA...PSTSGTSAPSTPGTSAPSKPGTSAPSKPGISAPYTPGTSAPSTLGTSAPSTPGTSAPSTPGTSAPSKPGTSAPSKPGTSA...PSTPGTSAPSTLGTSAPSTPGTTAPSTAGTSAPSTSGTSAPSTSGTSAPSKPTTSAPYTPGTSAPSIPGTSAPSTTGTSAPSTPGTSAPSTPGTSAPSKPGTSAPSTPGTSA...PSTLGTSAPSTPGTSAPSTPGTSAPSKPGTSAPSMSGTSAPSTPGTSVPSKAGTSAPVDPGVLWGLERPLTDTEGRWLPPYVLL

  13. 20 aastat taasiseseisvumisest ja 90 aastat Eesti riikliku statistika rajamisest = 20 years from the restoration of independence and the 90th anniversary of official statistics in Estonia / Priit Potisepp, Kaja Sõstra, Allan Randlepp

    Potisepp, Priit, 1968-

    2011-01-01

    Eesti liitumisest Euroopa Liidu statistikasüsteemiga. Ettekandest konverentsil "Development of the European Statistical System within Eastern Partnership - directions and strategy" (Krakow, 18.-19. okt. 2011)

  14. EBSi-meeste meisterlik diil riigiga / Ralf-Martin Soe

    Soe, Ralf-Martin

    2008-01-01

    Ilmunud ka: Delovõje Vedomosti 13. aug. lk. 8. EBS-i omanik Madis Habakuk, tema poeg Mart Habakuk ning äripartnerid Sulo Nigul ja Arle Mölder soetasid 10,1 miljoni krooni eest EBSi hoone Tallinna südalinnas, praegu hindab hoone omanikfirma EBS Campus kinnistu väärtuseks 130 miljonit. Paar kuud enne tehingu jõustumist tegid EBSi omanikud suure rahalise annetuse Keskerakonnale ja Reformierakonnale. Vt. samas: Mailis Reps: annetus polnud seotud haridusministeeriumiga; EBS üritas riiki pankrotti ajada; Tehing EBSiga oli erand; Mart Habakuk: EBS maksis hullu hinna; Heinaru: koolipapale tehti hea äraolemine

  15. Resonance April Cover Pg TP

    Admin

    word possibly having its origin in Sanskrit). W hat is ... History and Some Perspectives on Intermolecular Forces. E Arunan. Keywords van der Waals forces, hydrogen bonding. ... A tom s have rem ained a dom ain of physics, rather than.

  16. ORF Alignment: NC_003212 [GENIUS II[Archive

    Full Text Available ain Clip11262) ... Length = 200 ... Query: 88 ... NAGLIKIGISEPSASLVLPQILKQFLTDFP...KLMVNVSVDDANTCSQKLIDGEIDFAICGE 147 ... NAGLIKIGISEPSASLVLPQILKQFLTDFPKLMVNVSVDDANTCSQKLIDGEIDFAICGE Sbjct: 1 ... NAGLIKIGISEPS

  17. Risk Factors for the presence of anal intraepithelial neoplasia in HIV+ men who have sex with men

    Richel, Olivier; de Vries, Henry J. C.; Dijkgraaf, Marcel G. W.; van Noesel, Carel J. M.; Prins, Jan M.

    2013-01-01

    Anal Intraepithelial Neoplasia (AIN) is present in the majority of HIV+ men who have sex with men (MSM) and routine AIN-screening is subject of discussion. In this study we analysed a wide range of potential risk factors for AIN in order to target screening programs. We screened 311 HIV+ MSM by high

  18. Anterior interosseous nerve syndrome diagnosis and intraoperative findings: A case report

    Abdulla Aljawder

    2016-01-01

    Conclusion: Clinical suspicion should arise in the presence of isolated paralysis of the AIN-supplied muscles. MRI and electrodiagnostic studies will confirm the diagnosis and identify the etiology. The optimal treatment of AIN syndrome has not been established. We recommend surgical intervention in confirmed AIN syndrome from compression neuropathy, refractive to conservative therapy.

  19. Download this PDF file

    Professor of Genetics (Cytogenetics), Faculty of Medicine, Ain Shams University, Cairo, Egypt. Hosam A Abdel-Ghany. Consultant of Medical Human Genetics, Medical Genetic Center, Ain Shams University, Cairo, Egypt. Nermin S Elsayed. Consultant of Medical Human Genetics, Medical Genetics Center, Ain Shams ...

  20. Integrated stratigraphy, astronomical dating and proxy records of the Ain el Beida and Loulja sections (NW Morocco). Implications for regional climate change, glacial history and the Messinian Salinity Crisis. Geologica Ultraiectina (324)

    van der Laan, E.

    2010-01-01

    This Ph.D. thesis aims to provide a better understanding of the origin of sedimentary colour cycles in the Bou Regreg area in NW Morocco. Sediments were deposited during the late Miocene and early Pliocene at times that the Mediterranean was isolated from the Atlantic during the Messinian salinity

  1. "It Don't Mean a Thing if It Ain't Got that Swing"- an Alternative Concept for Understanding the Evolution of Dance and Music in Human Beings.

    Richter, Joachim; Ostovar, Roya

    2016-01-01

    The functions of dance and music in human evolution are a mystery. Current research on the evolution of music has mainly focused on its melodic attribute which would have evolved alongside (proto-)language. Instead, we propose an alternative conceptual framework which focuses on the co-evolution of rhythm and dance (R&D) as intertwined aspects of a multimodal phenomenon characterized by the unity of action and perception. Reviewing the current literature from this viewpoint we propose the hypothesis that R&D have co-evolved long before other musical attributes and (proto-)language. Our view is supported by increasing experimental evidence particularly in infants and children: beat is perceived and anticipated already by newborns and rhythm perception depends on body movement. Infants and toddlers spontaneously move to a rhythm irrespective of their cultural background. The impulse to dance may have been prepared by the susceptibility of infants to be soothed by rocking. Conceivable evolutionary functions of R&D include sexual attraction and transmission of mating signals. Social functions include bonding, synchronization of many individuals, appeasement of hostile individuals, and pre- and extra-verbal communication enabling embodied individual and collective memorizing. In many cultures R&D are used for entering trance, a base for shamanism and early religions. Individual benefits of R&D include improvement of body coordination, as well as painkilling, anti-depressive, and anti-boredom effects. Rhythm most likely paved the way for human speech as supported by studies confirming the overlaps between cognitive and neural resources recruited for language and rhythm. In addition, dance encompasses visual and gestural communication. In future studies attention should be paid to which attribute of music is focused on and that the close mutual relation between R&D is taken into account. The possible evolutionary functions of dance deserve more attention.

  2. "It don't mean a thing if it ain't got that swing"– an Alternative Concept for Understanding the Evolution of Dance and Music in Human Beings

    Joachim Richter

    2016-10-01

    Full Text Available The functions of dance and music in human evolution are a mystery. Current research on the evolution of music has mainly focused on its melodic attribute which would have evolved alongside proto-language. Instead, we propose an alternative conceptual framework which focuses on the co-evolution of rhythm and dance (R&D as intertwined aspects of a multimodal phenomenon characterized by the unity of action and perception. Reviewing the current literature from this viewpoint we propose the hypothesis that R&D have co-evolved long before other musical attributes and (proto-language. Our view is supported by increasing experimental evidence particularly in infants and children: beat is perceived and anticipated already by newborns and rhythm perception depends on body movement. Infants and toddlers spontaneously move to a rhythm irrespective of their cultural background. If this behavior is universal, R&D must have an essential function in human evolution. Conceivable evolutionary functions of R&D include sexual attraction, transmission of mating signals, synchronization of many individuals, social bonding, appeasement of hostile individuals, pre- and extra-verbal communication, improvement of body coordination, as well as pain killing, anti-depressive, and anti-boredom functions. The impulse to dance may have been prepared by the susceptibility of infants to be soothed by rocking. Dance enables embodied individual and collective memorizing; in many cultures R&D are used for entering trance, a base for shamanism and early religions. Rhythm is necessary to codify human speech and dance encompasses gesture. In future studies attention should be paid to which attribute of music is focused and that the close mutual relation between R&D is taken into account. The possible evolutionary functions of dance deserve more attention.

  3. If It Ain't Broke, Why Fix It? Framework and Processes for Engaging in Constructive Institutional Development and Renewal in the Context of Increasing Standards, Assessments, and Accountability for University-Based Teacher Preparation

    Lit, Ira; Nager, Nancy; Snyder, Jon David

    2010-01-01

    In this article, the authors offer a descriptive essay outlining the framework and processes of a five-year institutional renewal effort at Bank Street College of Education. Extended the opportunity to participate in the "Teachers for a New Era" (TNE) initiative, a multi-year, multi-million dollar effort to enhance and "radically…

  4. Cultural tourism 2011 - Projekt Central Baltic INTERREGIV A Project Cultural Tourism 2011 - Developing cultural tourism as a joint network in Capitals of Culture 2011 võtab kokku ja plaanib jätku / Maritta Hiltunen, Ain Hinsberg

    Hinsberg, Ain

    2012-01-01

    Soome organisatsiooni Matkailun ja elämystuotannon osaamisklusteri (OSKE) algatatud koostööprojektist Tallinna ja Turu kultuuripealinna vahel, mille laiem eesmärk on edendada Läänemere regiooni kultuuriturismi alast koostööd ning luua Läänemere regiooni hõlmav kultuuriturismi bränd

  5. Stiiliharjutused / Raymond Queneau ; prantsuse k. tlk. Jana Porila, värsstekstid tlk. Ain Kaalep, Toim. Hasso Krull, Järelsõna: M. V. [Märt Väljataga

    Queneau, Raymond

    1995-01-01

    Sisu: Märkmed; Kahekordselt; Litootes; Metafoorselt; Tagasivaateline; Üllatused; Unenägu; Prognoosid; Vikerkaar; Kõhklused; Täpsustused; Subjektiivne pool; Teistpidi isiklik; Jutustus; Liitsõnad; Eitus; Animism; Anagrammid; Ametlik kiri; Annotatsioon; Teadmatus; Aleksandriinid; Mina igatahes; Hüüatused; Ja siis; Ülev; Ülekuulamine; Komöödia; Vahelaused; Kummituslik; Kõnetlus; Sonett; Gustatiivne; Taktiilne; Telegraafiline; Tanka; Kirjeldus; Hüüdsõnad; Ootamatu

  6. Uudised : Vello Pähn Savonlinnas. Eri Klas pärast juubelit. Ain Anger Mirjam Helini konkursil. Türnpu sünnipäevakontsert / Priit Kuusk

    Kuusk, Priit, 1938-

    1999-01-01

    V. Pähn dirigeeris Savonlinna ooperifestivalil Gounod" ooperit "Faust". E.Klas erinevate orkestrite ees juuni-september 1999. 8.-20. augustini Helsingis toimunud IV rahvusvahelisest M. Helini konkursist, kus osales A. Anger. 13.augustil tähistati K. Türnpu 134. sünniaastapäeva kontserdiga Tuulna külas Keila vallas

  7. MR imaging findings of anterior interosseous nerve lesions

    Dunn, Andrew J. [Royal Liverpool University Hospital, Department of Medical Imaging, Liverpool (United Kingdom); Salonen, David C. [University of Toronto, Toronto Western Hospital, Department of Medical Imaging, Toronto, Ontario (Canada); Anastakis, Dimitri J. [University of Toronto, Toronto Western Hospital, Division of Plastic Surgery, Toronto, Ontario (Canada)

    2007-12-15

    To study and characterise the MR imaging findings of lesions of the anterior interosseous nerve (AIN). Magnetic resonance imaging (MRI) findings of the forearm of ten patients referred to our institution with suspected AIN lesions were retrospectively studied. Five healthy volunteers with normal forearm MRI findings formed a control group. Two musculoskeletal radiologists assessed the forearm musculature for oedema in the distribution of the AIN, median, posterior interosseous and radial nerves on T2-weighted (T2W) fat-saturated sequences. T1-weighted (T1W) images were assessed and graded for the presence of muscle atrophy and fatty involution. Six patients had undergone surgical exploration; five of these had surgically confirmed AIN compression. Four patients had diagnoses other than AIN compression made on imaging features. Of the cases of proven AIN compression, oedema within the pronator quadratus (PQ) muscle was identified in all cases. PQ atrophy and fatty involution were seen in three (43%) surgically confirmed cases. Cases 2 and 3 also demonstrated oedema in the flexor digitorum profundus (FDP)1 and FDP2 muscles. These cases also showed oedema in the flexor-carpi radialis (FCR) and FDP3/FDP4 muscles, respectively. The four cases of non-AIN compression demonstrated muscle oedema patterns that were atypical for the AIN distribution. They included a rupture of the flexor pollicis longus (FPL) tendon, brachial neuritis, amyotrophic lateral sclerosis and compression of the proximal median nerve. MRI is a useful investigation in the diagnostic workup of AIN syndrome. AIN syndrome is likely when there is diffuse oedema of AIN innervated muscles on T2W fat-saturated images. The most reliable sign of an AIN lesion is oedema within the PQ. Oedema in the flexor carpi radialis, FDP3 and FDP4, although not in the classical distribution of the AIN, does not preclude the diagnosis of AIN syndrome. (orig.)

  8. MR imaging findings of anterior interosseous nerve lesions

    Dunn, Andrew J.; Salonen, David C.; Anastakis, Dimitri J.

    2007-01-01

    To study and characterise the MR imaging findings of lesions of the anterior interosseous nerve (AIN). Magnetic resonance imaging (MRI) findings of the forearm of ten patients referred to our institution with suspected AIN lesions were retrospectively studied. Five healthy volunteers with normal forearm MRI findings formed a control group. Two musculoskeletal radiologists assessed the forearm musculature for oedema in the distribution of the AIN, median, posterior interosseous and radial nerves on T2-weighted (T2W) fat-saturated sequences. T1-weighted (T1W) images were assessed and graded for the presence of muscle atrophy and fatty involution. Six patients had undergone surgical exploration; five of these had surgically confirmed AIN compression. Four patients had diagnoses other than AIN compression made on imaging features. Of the cases of proven AIN compression, oedema within the pronator quadratus (PQ) muscle was identified in all cases. PQ atrophy and fatty involution were seen in three (43%) surgically confirmed cases. Cases 2 and 3 also demonstrated oedema in the flexor digitorum profundus (FDP)1 and FDP2 muscles. These cases also showed oedema in the flexor-carpi radialis (FCR) and FDP3/FDP4 muscles, respectively. The four cases of non-AIN compression demonstrated muscle oedema patterns that were atypical for the AIN distribution. They included a rupture of the flexor pollicis longus (FPL) tendon, brachial neuritis, amyotrophic lateral sclerosis and compression of the proximal median nerve. MRI is a useful investigation in the diagnostic workup of AIN syndrome. AIN syndrome is likely when there is diffuse oedema of AIN innervated muscles on T2W fat-saturated images. The most reliable sign of an AIN lesion is oedema within the PQ. Oedema in the flexor carpi radialis, FDP3 and FDP4, although not in the classical distribution of the AIN, does not preclude the diagnosis of AIN syndrome. (orig.)

  9. KaufmanFest 2007: Plasma theory, wave kinetics, and nonlinear dynamics

    Brizard, A J; Tracy, E R

    2009-01-01

    A symposium in honor of Professor Allan N. Kaufman's 80th year was held at the University of California at Berkeley on October 5-7, 2007. The meeting celebrated Allan's contributions to plasma physics as well as his friendship and guidance. The present paper very briefly summarizes the talks presented.

  10. United States Foreign Policy Failures Toward Revolutionary Iran: Miscalculating Tehran’s Power Projection and Ignoring the National Character of the Iranian People

    2010-12-01

    position.36 In 1951, Mosaddeq was elected 34 Roger M. Savory , “Religious Dogma and the...42 Pollack, The Persian Puzzle, 42. 43 Yonah Alexander and Allan Nanes, The United States and Iran: A...Alexander, Yonah, and Allan Nanes. The United States and Iran: A Documentary History. Frederick, Md. : University Publication of America, 1980. Al

  11. KaufmanFest 2007: Plasma theory, wave kinetics, and nonlinear dynamics

    Brizard, A J [Saint Michael' s College, Colchester, VT 05439 (United States); Tracy, E R [Department of Physics, College of William and Mary, Williamsburg, VA 23187-8795 (United States)

    2009-05-01

    A symposium in honor of Professor Allan N. Kaufman's 80th year was held at the University of California at Berkeley on October 5-7, 2007. The meeting celebrated Allan's contributions to plasma physics as well as his friendship and guidance. The present paper very briefly summarizes the talks presented.

  12. Response of Phlebotomine Sand Flies to Light-Emitting Diode-Modified Light Traps in Southern Egypt

    2007-04-01

    dispersal , and oviposition site selection (Allan et al. 1987, Allan 1994, Snow 1971). Target size, shape, movement, contrast, and color are...dogs, and goats. The village is built from baked mud bricks and covered with kaolin day to produce hardened, smooth wall surfaces, structures are one

  13. "Kurja lillede" kuus ärakeelatud luuletust / Charles Baudelaire ; saatesõna: Marek Tamm

    Baudelaire, Charles

    2000-01-01

    Sisu: Kalliskivid / tlk. Ain Kaalep ; Lethe / tlk. Märt Väljataga ; Temale, kes on liiga rõõmus / tlk. Ain Kaalep ; Lesbos / tlk. Ilmar Laaban ; Äraneetud naised (Delphine ja Hyppolyte) / tlk. Ain Kaalep ; Vampiiri metamorfoosid / tlk. August Sang. Orig.: Les Bijoux ; Le Léthé ; A celle qui est trop gaie ; Lesbos ; Femmes damnées. Delphine et Hippolyte ; Les Métamorphoses du vampire

  14. Trimethoprim-sulfamethoxazole induced acute interstitial nephritis in renal allografts; clinical course and outcome.

    Garvey, J P

    2009-11-01

    Acute interstitial nephritis (AIN) secondary to trimethoprim-sulfamethoxazole (TMP-SMX) is well documented as a cause of acute renal failure in native kidneys. TMP-SMX is the standard prophylactic agent against pneumocystis carinii (PCP) used in the early post-transplant period, however, it has to date only been indirectly associated with AIN in renal allografts. DESIGN, SETTING, PARTICIPANTS AND MEASUREMENTS: We describe eleven renal transplant patients with acute allograft dysfunction in whom a transplant biopsy demonstrated primary histopathologic features of allergic AIN, all of whom were receiving TMP-SMX in addition to other medications known to cause AIN.

  15. Data of evolutionary structure change: 1ONAD-2D3PB [Confc[Archive

    Full Text Available 1ONAD-2D3PB 1ONA 2D3P D B ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAK...WNMQNGKVGTAHIIYNSVDKRLSAVVSYPNADSATVSYDVDLDNVLPEWVRVGLSASTGLYKETNTILSWSFTSKLKT------NALHFMFNQFSKDQKDLILQGDAT...ain> 1ONA D 1ONAD TR

  16. Data of evolutionary structure change: 1ONAD-2GDFC [Confc[Archive

    Full Text Available 1ONAD-2GDFC 1ONA 2GDF D C ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAK...WNMQNGKVGTAHIIYNSVDKRLSAVVSYPNADSATVSYDVDLDNVLPEWVRVGLSASTGLYKETNTILSWSFTSKLKT-NALHFMFNQFSKDQKDLILQGDATTGTDG...ain> 1ONA D 1ONAD

  17. Data of evolutionary structure change: 1ONAD-2GDFA [Confc[Archive

    Full Text Available 1ONAD-2GDFA 1ONA 2GDF D A ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAK...WNMQNGKVGTAHIIYNSVDKRLSAVVSYPNADSATVSYDVDLDNVLPEWVRVGLSASTGLYKETNTILSWSFTSKLKT-NALHFMFNQFSKDQKDLILQGDATTGTDG...ain> 1ONA D 1ONAD

  18. ORF Alignment: NC_003212 [GENIUS II[Archive

    Full Text Available ain ... Clip11262) ... Length = 73 ... Query: 8 ... ASALLELIGGKENISSVTHCATRMRFV...LLDPDNADVEAIEDIPAVKGTFTQAGQFQVIIG 67 ... ASALLELIGGKENISSVTHCATRMRFVLLDPDNADVEAIEDIPAVKGTFTQAGQFQ...VIIG Sbjct: 1 ... ASALLELIGGKENISSVTHCATRMRFVLLDPDNADVEAIEDIPAVKGTFTQAGQFQVIIG 60 ...

  19. Kaks debüüti / Lilian Vellerand

    Vellerand, Lilian, 1932-

    1997-01-01

    "Shakespeare'i kogutud teosed" ("The Complete Works of William Shakespeare") Rakvere Teatris, lavastaja Ain Prosa ja Friedebert Tuglase - Ingomar Vihmari "Hei, Luciani!" Ugalas, lavastaja Ingomar Vihmar

  20. One lesion, one virus: individual components of high-grade anal intraepithelial neoplasia in HIV-positive men contain a single HPV type

    Richel, Olivier; Quint, Koen D.; Lindeman, Jan; van Noesel, Carel J. M.; de Koning, Maurits N. C.; van den Munckhof, Henk A. M.; de Vries, Henry J. C.; Prins, Jan M.; Quint, Wim G. V.

    2014-01-01

    High-grade anal intraepithelial neoplasia (AIN) is present in many human immunodeficiency virus (HIV)-positive men who have sex with men. The major etiologic factor is infection with an oncogenic human papillomavirus (HPV) genotype. We investigated whether individual components of high-grade AIN are

  1. Bulletin of Materials Science | Indian Academy of Sciences

    Laboratoire de Physique Fondamentale et Applique (LPFA), Faculté des Sciences Ain Chock, Université Hassan II, B.P. 5366 Mâarif, Casablanca, Maroc; Laboratoire de Physique des Matériaux, Micro-électronique, Automatique et Thermique (LPMMAT), Faculté des Sciences Ain Chock, Université Hassan II, B.P. 5366 ...

  2. Pärast kõike / intervjueerinud Veiko Märka

    1998-01-01

    Vestlusring: Ain Mäeots, Merle Jääger, Helena Merzin, Margus Jaanovits, Riho Kütsar. Madis Kõivu võrukeelse näidendi 'Omavahelisi jutuajamisi tädi Elliga' lavastamisest Vanemuise teatris, lavastaja Ain Mäeots. Ka Kauksi Ülle kommentaar

  3. Teatrilugu nendest, kes teatris ei käi / Tuuli Koch

    Koch, Tuuli

    2000-01-01

    Nr. 52/1999. Martin McDonaghi "Mägede iluduskuninganna" Vanemuises, lavastaja Ain Mäeots. Esietendus oli 5. nov. Ka Ain Mäeotsa ja näitlejate Liina Tennosaare ning Margus Jaanovitsi arvamusi näidendist

  4. Hypothyroidism could be the only manifestation of mitochondrial ...

    Hoda Tomoum

    2012-11-24

    Nov 24, 2012 ... Hypothyroidism could be the only manifestation of mitochondrial T8993C mutation in Leigh syndrome. Hoda Tomoum a. , Solaf M. Elsayed b,. *, Elizabeth Berry-Kravis c a Department of Pediatrics, Ain Shams University, Cairo, Egypt b Genetics Unit, Department of Pediatrics, Ain Shams University, Cairo, ...

  5. Exegi monumentum ehk palee Tallinnas / Siim Sultson

    Sultson, Siim

    2007-01-01

    Tallinnas Narva mnt. 7 endisest Tsentrosojuzprojektist ümber ehitatud Triumph Plazast (arhitektid Vilen Künnapu ja Ain Padrik). Maja kavandati 1981. a. büroohooneks (arhitektid Olga Bruns ja Mart Kalling). Kommenteerivad Mart Port, Dmitri Bruns, Kristiina Möldre ja Ain Padrik

  6. "É muito dificultoso!": etnografia dos cuidados a pacientes com hipertensão e/ou diabetes na atenção básica, em Manaus, Amazonas, Brasil "It sure ain't easy!": an ethnographic study of primary health care for patients with hypertension and/or diabetes in Manaus, Amazonas State, Brazil

    Maximiliano Loiola Ponte de Souza

    2008-01-01

    Full Text Available O texto analisa os resultados de pesquisa avaliativa da Atenção Básica à Saúde do paciente com hipertensão e/ou diabetes em Manaus, Amazonas, Brasil. A abordagem etnográfica utilizou, como categorias analíticas centrais, o acesso aos serviços e a integralidade do cuidado, comparando-se as práticas sanitárias desenvolvidas em unidade do Programa Saúde da Família (PSF e em unidade básica de saúde não-PSF. A facilitação do acesso à unidade de saúde da família implantada em comunidade carente é limitada pela precariedade de infra-estrutura urbana do seu entorno. A unidade básica de saúde tem, nas grandes distâncias, a sua principal barreira de acesso. A inexistência de sistema de referência entre os distintos níveis de complexidade compromete o acesso dos pacientes a exames e especialistas. O cuidado oferecido nas duas unidades é restrito às queixas físicas passíveis de abordagem farmacológica, comprometendo a integralidade. Há baixa capacidade de escuta dos profissionais para problemas distintos do foco da ação programática. Destacam-se as potencialidades da utilização da etnografia na pesquisa avaliativa de sistemas e serviços de saúde.This paper analyzes the results of an evaluative study in the city of Manaus, Amazonas State, Brazil, on primary health care for patients with hypertension and/or diabetes. The ethnographic approach used access to services and comprehensiveness of health care as core analytical categories, comparing the health practices developed by Family Health Program (FHP units with traditional non-FHP primary care units. Access to family health care units in low-income communities is limited by the precarious surrounding urban infrastructure. The main barrier to access to primary care units is distance. The lack of a referral system between the various levels of complexity jeopardizes patients' access to tests and specialists. The care supplied by the two units is limited to patient conditions that can be treated pharmacologically, thus compromising the comprehensiveness of care. The health professionals display a limited capacity to hear problems outside the immediate focus of the program activity. The paper highlights the potential for using ethnography in evaluative research on health systems and services.

  7. TiC含量和烧结工艺对AlN-TiC复相陶瓷烧结性能的影响%Effect of TiC Content and Sintering Process on Sintering Properties of AIN-SiC Composite Ceramics

    程卫华

    2012-01-01

    Taking A1N and TiC as raw materials, the A1N-TiC composite ceramics were prepared by hot pressing sintering process, and the effects of TiC content and sintering process on sintering properties of A1N-SiC composite ceramics were studied. The results show that the composite ceramics didnlt generate new phase and consisted of A1N and TiC phases during sintering. The compact composite ceramics could be prepared after sintering at 1 900 ℃ for 1 h, the relative density reached more than 99%and the TiC content had no effect on sintering properties of the composite ceramics.%以A1N和TiC粉为原料,采用热压烧结工艺制备AlN-TiC复相陶瓷,研究了TiC含量、烧结工艺对复相陶瓷烧结性能的影响。结果表明:在烧结过程中复相陶瓷没有新相生成,由AlN和TiC两相组成;在1900℃下烧结1h后,可以制备出致密的A1N-TiC复相陶瓷,其相对密度达到了99%以上,TiC的加入量对复相陶瓷的烧结性能无影响。

  8. How Should SOF Be Organized?

    2011-06-01

    186 Eric Micheletti, French Special Forces: Special Operations Command (Paris: Histoire & Collections, 1999), 16. 187 NSCC, NATO SOF...University, September 2008. Micheletti, Eric. French Special Forces: Special Operations Command. Paris: Histoire & Collections, 1999. Millet, Allan

  9. Teist korda kodus kodus käimas / Sven Karja

    Karja, Sven, 1968-

    1999-01-01

    Harold Pinteri "Kojutulek" Tallinna Linnateatris, lavastaja Andres Noormets, kunstnik Aime Unt, osades Ago Roo, Marko Matvere, Andres Raag, Allan Noormets, Jaan Tätte, Triinu Meriste. Esietendus 24. märtsil

  10. Eesti Linnade Liidu, Eesti Omavalitsusliitude Ühenduse, Eesti Korteriühistute Liidu ja Eesti Gaasiliidu pöördumine = Obrashtshenije k Sojuzu Gorodov Estonii, Obedineniju Samoupravlenii Estonii, Sojuzu Kvartirnõhh Tovarishtshestv Estonii i Sojuzu

    2003-01-01

    Pöördumises tehakse valitsusele ettepanek kavandada kodugaasiseadmete väljavahetamise projekt koos finantseerimise kavaga. Pöördumisele on alla kirjutanud Jaanus Tamkivi, Toomas Välimäe, Marit Otsing ja Allan Sepp

  11. Oma last juhendava treeneri dilemma - kas sõimata või poputada / Ann Hiiemaa, Inga Höglund

    Hiiemaa, Ann

    2008-01-01

    Korvpallitreener Allan Dorbek tunnistab, et oma lastelt nõuab ja ootab ta paratamatult rohkem. Oma laste treenimisest räägivad ka Rein Kirsipuu, Keete Puri, Riho Aljand, Hille Saarepuu ja Janika Mölder

  12. CybermarketingInEstonia.ee / interv. Oksana Kostina

    2005-01-01

    Vestlusringis reklaamist ja turundusest Internetis osalesid Sten Klemm, Mihkel Vabrit, Esme Kassak, Aivar Laan, Andrei Korobeinik, Üllar Tamm, Raiko Raie, Martin Orav, Priit A. Heinsalu ja Allan Sombri

  13. "If it works, you can break it" / Joshua Levine

    Levine, Joshua

    2004-01-01

    Ülevaade Eesti infotehnoloogilisest arengust ning edusammudest: mobiilteenused, e-valitsus, edukamad tarkvaraarendusprojektid. Arvamust avaldavad Linnar Viik, Niklas Zennström, Allan Martinson, Steve Jürvetson jt. Tabel. Kaart

  14. Kunstnikukeskne näitus / Heie Treier

    Treier, Heie, 1963-

    2016-01-01

    Näitus "Pseudo" EKKMis. Kuraator Marten Esko, kujundaja Allan Appelberg, kunstnikud Dénes Farkas ja Taavi Talve, Dora García, Flo Kasearu, Jevgeni Zolotko, Kristiina Hansen ja Sigrid Viir ning Neeme Külm

  15. Film põhineb koomiksil / Märt Milter

    Milter, Märt

    2002-01-01

    Mängufilm "Road To Perdition" Max Allan Collinsi koomiksi teemadel : režissöör Sam Mendes :Tom Hanks, Jude Law, Paul Newman : Ameerika Ühendriigid 2002. Ka teistest koomiksite põhjal loodud filmidest

  16. Suvemaja käiakivide-Gotlandilt / Shanti Broeng

    Broeng, Shanti

    2008-01-01

    Disainer Ulla Christianssoni ja tema abikaasa Lars E. Petterssoni suvekodust. 19. saj. ehitatud maja renoveeriti arhitekt Allan Wahlby projekti järgi, sisustuses domineerib minimalism. 14 värv. ill.

  17. Speaking out for America's poor

    Jensen, Niels Rosendal

    2008-01-01

    The review of Edward Allan Brawley's biography on the life, work and struggle of Robert Hunter (1874-1941), one of the forgotten American social workers (settlement movement), social theoretists (poverty and revolution) as well as welfare protagonists....

  18. Skype-hyped ja Eesti IT-sektori väljakutsed

    2006-01-01

    Eesti IT-sektori potentsiaali ja tulevikuväljavaadete üle arutlevad Martinson Trigon Venture Partners partner Allan Martinson, Helmese juht Jaan Pillesaar, Skype Eesti juht Sten Tamkivi ja EMT tehnoloogia- ja arendusjuht Tõnu Grünberg

  19. Joakim Helenius ajab Eestis juuri laiali / Joakim Helenius ; interv. Priit Pullerits

    Helenius, Joakim, 1957-

    2006-01-01

    Ida-Euroopa suurima kodu- ja aianduskeskuse Eestisse rajanud Trigon Gardeningi juht Joakim Helenius peab aiandust kõige kiiremini arenevaks äriks maailmas. Kommenteerib Martsinson Trigon Venture Partnersi juhataja Allan Martinson. Lisa: Joakin Helenius (48).

  20. Rotary klubi tuli rannarahvale appi / Anu Jürisson

    Jürisson, Anu

    2005-01-01

    Tallinna Vanalinna Rotary klubi kinkis kolmele Rannametsa perele kümme tuhat krooni jaanuaritormi kahjustuste likvideerimiseks. Klubi presidendiks on Allan Martinson, nimekirjas ka Tõnis Palts, Toomas Hendrik Ilves, Rein Kilk, Hans H. Luik, Vahur Kraft jt.

  1. Uudised : Juuksur - uus live-muusika lokaal. Madonna tögas Bushi. Andrea Bocelli Helsingis

    2006-01-01

    Kontserdil 19. mail Tallinnas (Vaimu 1) õhtulokaali "Juuksur" avamisel esineb jazzrokki viljelev ansambel Wrupk Urei ja 26. mail Allan Vainola sooloprojektiga. Ameerika poplauljast Madonnast. Itaalia tenori Andrea Bocelli kontserdist 19. nov. Hartwall Arenal Helsingis

  2. Time Domain Frequency Stability Estimation Based On FFT Measurements

    Chang, P

    2004-01-01

    .... In this paper, the biases of the Fast Fourier transform (FFT) spectral estimate with Hanning window are checked and the resulting unbiased spectral density are used to calculate the Allan variance...

  3. Konverents avardas osalejate silmaringi / Liis Lukk

    Lukk, Liis

    2010-01-01

    Viljandis peeti 26. märtsil rakendusteatriteemalist konverentsi "Teater kogukonna hüvanguks" ettekannete, töötubade ja etendustega, kus peakülaline Allan Owens korraldas protsessidraama töötoa.

  4. Clinical Action against Drunk Driving.

    Donald A Redelmeier

    2017-02-01

    Full Text Available In advance of a safety campaign on 17 March 2017, Donald Redelmeier and Allan Detsky call on physicians and clinical colleagues to reduce the chances that patients will drive drunk.

  5. The Problem of Disobedience and the Intelligence Community

    1990-06-01

    focus on the technological and analytical aspects of the profession. Despite some highly successful but less-than- savory operations in the past,3 there... Allan Bloom, The Closing of the American Mind (New York: Simon & Schuster, 1987), p. 26. 23. Thomas B. Allen and Norman Polmar, Merchants of Treason...Waldo Emerson. New York: Modern Library, 1940. Bloom, Allan . The Closing of the American Mind. New York: Simon & Schuster, 1942. Carter, Jimmy

  6. Chairman of the Joint Chiefs of Staff Strategy Essay Competition: Essays 2002

    2002-10-01

    onset of hostilities, one overarching concern is the very nature of the surrogate. Allies of convenience may not be great people or savory characters, and...government were invariably failures.”51 Williamson Murray and Allan Millett observed in their work on net as- sessments, “If it is difficult to calculate...Military Innovation in Peacetime,” in Williamson Murray and Allan R. Millett, eds., Military Innovation in the Interwar Period (New York: Cambridge

  7. Non-native acylated homoserine lactones reveal that LuxIR quorum sensing promotes symbiont stability

    Ho, Jessica S.; Geske, Grant D.; Blackwell, Helen E.; Ruby, Edward G.

    2014-01-01

    SUMMARY Quorum sensing, a group behavior coordinated by a diffusible pheromone signal and a cognate receptor, is typical of bacteria that form symbioses with plants and animals. LuxIR-type acyl homoserine-lactone (AHL) quorum sensing is common in Gram-negative proteobacteria, and many members of this group have additional quorum-sensing networks. The bioluminescent symbiont Vibrio fischeri encodes two AHL signal synthases: AinS and LuxI. AinS-dependent quorum sensing converges with LuxI-dependent quorum sensing at the LuxR regulatory element. Both AinS- and LuxI-mediated signaling are required for efficient and persistent colonization of the squid host, Euprymna scolopes. The basis of the mutualism is symbiont bioluminescence, which is regulated by both LuxI- and AinS-dependent quorum sensing, and is essential for maintaining a colonization of the host. Here, we used chemical and genetic approaches to probe the dynamics of LuxI- and AinS-mediated regulation of bioluminescence during symbiosis. We demonstrate that both native AHLs and non-native AHL analogs can be used to non-invasively and specifically modulate induction of symbiotic bioluminescence via LuxI-dependent quorum sensing. Our data suggest that the first day of colonization, during which symbiont bioluminescence is induced by LuxIR, is a critical period that determines the stability of the V. fischeri population once symbiosis is established. PMID:24191970

  8. Allergic Interstitial Nephritis Manifesting as a Striated Nephrogram

    Irfan Moinuddin

    2015-01-01

    Full Text Available Allergic interstitial nephritis (AIN is an underdiagnosed cause of acute kidney injury (AKI. Guidelines suggest that AIN should be suspected in a patient who presents with an elevated serum creatinine and a urinalysis that shows white cells, white cell casts, or eosinophiluria. Drug-induced AIN is suspected if AKI is temporally related to the initiation of a new drug. However, patients with bland sediment and normal urinalysis can also have AIN. Currently, a definitive diagnosis of AIN is made by renal biopsy which is invasive and fraught with risks such as bleeding, infection, and hematoma. Additionally, it is frequently unclear when a kidney biopsy should be undertaken. We describe a biopsy proven case of allergic interstitial nephritis which manifested on contrast enhanced Magnetic Resonance Imaging (MRI as a striated nephrogram. Newer and more stable macrocyclic gadolinium contrast agents have a well-demonstrated safety profile. Additionally, in the presentation of AKI, gadolinium contrast agents are safe to administer in patients who demonstrate good urine output and a downtrending creatinine. We propose that the differential for a striated nephrogram may include AIN. In cases in which the suspicion for AIN is high, this diagnostic consideration may be further characterized by contrast enhanced MRI.

  9. Views and experiences of mental health nurses working with undergraduate assistants in nursing in an acute mental health setting.

    Cleary, Michelle; Horsfall, Jan; O'Hara-Aarons, Maureen; Mannix, Judy; Jackson, Debra; Hunt, Glenn E

    2012-04-01

    Undergraduate nurses are employed as assistants in nursing (AIN) in inpatient mental health settings; however, there is a paucity of published research exploring registered nurses' (RN) views about the AIN role in these settings. This qualitative study documents the views and experiences of RN working with undergraduate AIN. Fifty structured face-to-face interviews were analysed, and the results are discussed in three sections. The first section outlines RN perceptions of qualities and skills required of AIN in mental health, and the responses primarily focus on communication skills, initiative, and willingness to learn. The second section targets factors in the workplace that might enhance the interest of AIN in a mental health nursing career; the responses emphasize their need to work with experienced staff. The last section outlines RN expectations of AIN, most of which are met and involve physical observations and technical tasks; less fulfilled activities primarily cluster around interactions with patients. Findings highlight the advantages and disadvantages of drawing on undergraduate nursing students as AIN in mental health settings. Communication skills, personal initiative, safety training to prevent violence, and education to increase knowledge and awareness about mental illness, diagnosis, and mental status-related skills were all important concerns articulated by RN. © 2011 The Authors. International Journal of Mental Health Nursing © 2011 Australian College of Mental Health Nurses Inc.

  10. Metal nitride coatings by physical vapor deposition (PVD) for a wear resistant aluminum extrusion die.

    Lee, Su Young; Kim, Sang Ho

    2014-12-01

    The purpose of this study is to investigate the friction and wear behaviors of CrN, TiN, CrAlN, and TiAIN coated onto SKD61 for application to Al 7000 series extrusion dies. On the wear test, the experimental parameters are the load and the counter material's temperature. The results showed that the friction coefficient increased with load but decreased with the counter material's temperature, and the friction coefficients of CrN and CrAIN were lower than the friction coefficients of TiAIN and TIN, especially at a higher temperature. The wear track with different coatings identified different wear behaviors; the wear behavior of CrAIN was found to be abrasive, but the wear behavior of TiN, CrN, and TiAIN was adhesive. Therefore, CrAIN showed the least wear loss with a lower friction coefficient and less adhesion with counter materials at the highest range of wear load and temperature. This resulted in the easy formation of aluminum oxide in the wear track and less Al adhesion; moreover during the hard second phase, AIN dispersed in the film during deposition.

  11. Hydrogeological and isotopic studies for selected springs in Sinai Peninsula

    Hamza, M S; Awad, M A; El-gamal, S A [Atomic Energy Authority, Cairo Egypt and Middle Eastern Regional Radioisotope Center for The Arab Countries, Dokki, 12311, Cairo (Egypt); Hammad, F A [Desert Research Centre, Materia, Cairo, (Egypt)

    1995-10-01

    This paper deals with the hydrogeology and isotopic composition of water samples collected from selected spring in sinai (e.g. Algudierate, Alqusiema, qidis and Isram) in order to identify their genesis, their interaction with the host rocks and mixing trend. Results of isotopic composition have indicated the similarity in the hydrogeologic situation of Ain qidis and Ain-al-gudierate, while Ain Isram has shown a marked difference in its stable isotope and this could be due to evaporation effect. The isotopic and hydrochemical constituents of the studied springs reflect eater of a meteoric origin with a possible contamination from surficial materials (evaporates) and deeper aquifers. 6 figs., 2 tabs.

  12. Asociación entre el consumo de antiinflamatorios no esteroideos y la aparición o descompensación de insuficiencia cardíaca congestiva : estudio de casos y controles

    Rodríguez Bernardino, Ángel

    2003-01-01

    La insuficiencia cardiaca congestiva (ICC) es una patología con una alta prevalencia en nuestro medio. Se ha establecido una posible relación entre la acción de los antiinflamatorios no esteroideos (AINEs) sobre la síntesis de prostaglandinas y la aparición de ICC en individuos susceptibles. Nuestro objetivo fue evaluar la asociación entre el ingreso hospitalario por ICC y el consumo previo de AINEs, estimado la contribución individual de los distintos de AINEs. Se realizó un estudio multicén...

  13. In situ EELS and TEM observation of Al implanted with nitrogen ions

    Hojou, K.; Furuno, S.; Kushita, K.N.; Otsu, H.; Izui, K.

    1995-01-01

    Formation processes of Aluminum nitride (AIN) in Aluminum (AI) implanted with nitrogen were examined by in situ EELS and TEM observations during nitrogen ion implantation in an electron microscope at room temperature and 400 deg C. AIN phase was identified both by EDP and EELS after nitrogen ion implantation to 6 x 10 20 (N + )/m 2 . The observed peak (20.8 eV) in EELS spectra was identified as plasmon loss peak of AIN formed in AI. The binding energy of N ls in AI was found to shift by about 4 eV to the lower side with increasing nitrogen-ion fluence. Unreacted AI was also found to remain in the AIN films after high fluence implantation both at room temperature and 400 deg C. (authors). 11 refs., 5 figs., 2 tabs

  14. Drug Allergy

    EL-HAKIM

    Immunology Unit, Department of Pediatrics, Ain Shams University, Cairo ... the case with food allergies).7,8 The parentral route ..... molecular-weight agents. ... and lack positive controls. ..... Immunology; Joint Council of Allergy, Asthma and.

  15. President Meri annetas aumärke

    1996-01-01

    Riigivapi I klassi orden Jaan Krossile ja Kalju Lepikule; Riigivapi III klassi orden Ain Kaalepile, Hilja Rüütlile (Aili Helm); Riigivapi IV klassi orden Voldemar Millerile, Juhan Peeglile ja Ants Viiresele

  16. Partii Reform ne bezrazlitshna sudba russkogo obrazovanija / Sergei Ivanov

    Ivanov, Sergei, 1958-

    2005-01-01

    Riigikogu liige vastab küsimustele, mis puudutavad Tallinna Pedagoogikaülikoolis algavat vene koolide jaoks aineõpetajate ettevalmistamist ja selleks ettenähtud rahasummat, vene akadeemilise keskuse loomiseks eraldatud raha kulutamist

  17. Materjalide jagamisest võidavad kõik / Maarja Soone

    Soone, Maarja

    2011-01-01

    Koolitusest Colchesteris - Content and Language Integrated Learning, mis tähendab võõrkeelset aineõpet, kus vajadusel võetakse kasutusele ka emakeel, mistõttu viidatakse sellele tihti kui kakskeelsele õppele

  18. Popmuusika / Valner Valme

    Valme, Valner, 1970-

    2006-01-01

    Uutest heliplaatidest Graham Coxon "Love Travels At Illegal Speeds", Gabriel Rios "Ghostboy", "Sounds Of India", John Hughes "Wild Ocean", Ain Agan & Tallinn Chamber Orchestra/Toomas Vavilov, Ashanti "Collectables By Ashanti", Liv Kristine "Enter My Religion"

  19. Sekulariseeruv sakraalarhitektuur / Piret Lindpere

    Lindpere, Piret, 1963-

    2002-01-01

    Moodsatest kirikutest, sajandilõpu eesti sakraalarhitektuurist. Pikemalt Tallinna metodisti kirikust (Vilen Künnapu, Ain Padrik), Püha Brigitta keskusest (projekteerimist juhtis Ra Luhse) ja ehitama hakatavast Viimsi Püha Jaakobi kirikust (Erkki Ristoja, Martin Aunin)

  20. Dgroup: DG00804 [KEGG MEDICUS

    Full Text Available aine hydrochloride Neuropsychiatric agent ... DG02030 ... Anesthetics ... DG01675 ... Local anesthetic ... DG01673 ... Amide type local anesthetic... ... DG01675 ... Local anesthetic ... DG01673 ... Amide type local anesthetic ATC code: N01BB07 Local anesthetic