Poolsajandi õnnesoovid Jaak Aaviksoole / Ain Heinaru, Jaak Kangilaski, Tõnu Lehtsaar...[jt.
2004-01-01
Mõtteid Tartu Ülikooli rektorist tema 50. sünnipäeva puhul : Ain Heinaru, Jaak Kangilaski, Tõnu Lehtsaar, Indrek Reimand, Toomas Kiho, Leelo Kriisa, Peeter Olesk, Risto Tammelo, Birute Klaas, Peeter Saari, Andrus Ansip, Mait Klaassen, Marika Kullamaa, Kaupo Bend
2007-01-01
Jõekääru Jazz'ile järgneval nädalal tõi ürituse peakorraldaja Allan Liik toimetusse seal esinenud muusikud. Vestlusringis olid: Allan Liik, Hedvig Hanson, Andre Maaker, Ain Agan, Raivo Tafenau ja Sergio Bastos
Rector's office as of 31 December 2006
2007-01-01
Rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Birute Klaas, administratsioonidirektor prof. Mihkel Pärnoja, finantsdirektor Taimo saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit
2007-01-01
Rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Birute Klaas, administratsioonidirektor prof. Mihkel Pärnoja, finantsdirektor Taimo saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit
Rector's office as of 31 December 2005
2006-01-01
TÜ rektoraadi koosseis: rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Tõnu Lehtsaar, prorektor prof. Jaak Kangilaski; administratsioonidirektor Mihkel Pärnoja, finantsdirektor Taimo Saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit
2006-01-01
TÜ rektoraadi koosseis: rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Tõnu Lehtsaar, prorektor prof. Jaak Kangilaski; administratsioonidirektor Mihkel Pärnoja, finantsdirektor Taimo Saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit
2006-01-01
TÜ teadustöötajaist ja õppejõududest on 2/3 doktorikraadiga. TÜ rektor Jaak Aaviksoo ja teadusprprektor Ain Heinaru valiti Euroopa kõrghariduspoliitika juhtorganitesse. Sotsiaalteaduskonna prof. Wolfgang Drechsler sai Saksa-Eesti akadeemiliste suhete arendamise eest Saksamaa Liitvabariigi Teeneteristi
ALLAN.simulation club; Club ALLAN.simulation
Energy Technology Data Exchange (ETDEWEB)
Boudaud, F
1994-05-27
The ALLAN.Simulation code was developed by the R and D direction of Gaz de France (GdF) company with the support of CISI and Dassault Data Services companies. Its aim is to provide a modeling tool for the design and operation of complex technical systems. It uses a `boxes and ropes` representation (non-oriented multi-variable bloc-schemes) which allows the re-use of all or part of previous models or analyses already developed and recorded. The third meeting of the non-GdF users of the ALLAN.Simulation code took place at Sophia Antipolis (France) on May 27, 1994. Several studies performed with ALLAN.Simulation were presented and dealt with: a thermohydraulic loop, an alternator for automobile, and the hydration of cements. This report is a compilation of the transparencies relative to these three studies. A last part is devoted the presentation of the possible links between different existing simulation codes: ALLAN, BASILE, MAPLE, NEPTUNIX. (J.S.)
Spectral Ambiguity of Allan Variance
Greenhall, C. A.
1996-01-01
We study the extent to which knowledge of Allan variance and other finite-difference variances determines the spectrum of a random process. The variance of first differences is known to determine the spectrum. We show that, in general, the Allan variance does not. A complete description of the ambiguity is given.
Coe, Rob; Dalrymple, Brent
More than 1000 friends, students, and colleagues from all over the country filled Stanford Memorial Chapel (Stanford, Calif.) on February 3, 1987, to join in “A Celebration of the Life of Allan Cox.” Allan died early on the morning of January 27 while bicycling, the sport he had come to love the most. Between pieces of his favorite music by Bach and Mozart, Stanford administrators and colleagues spoke in tribute of Allan's unique qualities as friend, scientist, teacher, and dean of the School of Earth Sciences. James Rosse, Vice President and Provost of Stanford University, struck a particularly resonant chord with his personal remarks: "Allan reached out to each person he knew with the warmth and attention that can only come from deep respect and affection for others. I never heard him speak ill of others, and I do not believe he was capable of doing anything that would harm another being. He cared too much to intrude where he was not wanted, but his curiosity about people and the loving care with which he approached them broke down reserve to create remarkable friendships. His enthusiasm and good humor made him a welcome guest in the hearts of the hundreds of students and colleagues who shared the opportunity of knowing Allan Cox as a person."
Ain Kivisaar : äärelinn pole kvaliteetne investeering / Ain Kivisaar ; interv. Enn Tosso
Kivisaar, Ain, 1978-
2007-01-01
Ilmunud ka: Delovõje Vedomosti : Nedvizhimost 24. okt. lk. 2-3. Küsimustele kinnisvaraturu olukorra ja investeeringute kohta vastab Metro Capital Managementi finantsjuht Ain Kivisaar. CV: Ain Kivisaar
Energy Technology Data Exchange (ETDEWEB)
Cho, Sung Chul; Han, Jun Hyun [Chungnam National University, Daejeon (Korea, Republic of); Ko, Se-Hyun [Korea Institute of Industrial Technology, Incheon (Korea, Republic of); Kim, Hye Sung [Pusan National University, Miryang (Korea, Republic of); Han, Jun Hyun [Korea Institute of Science and Technology, Seoul (Korea, Republic of)
2015-12-15
AIN/Cu composite powders with a core-shell structure were synthesized by a new technique using electroless plating of Cu on AIN particles and consolidated by spark plasma sintering (SPS). Dependence of the thermal conductivity and coefficient of thermal expansion (CTE) of the AIN/Cu composites on the particle size of AIN were studied. The thermal conductivity and coefficient of thermal expansion were significantly dependent on the existence of both boundary pores surrounding the Cu-coated AIN particles and the internal pores of the AIN particles. In order to eliminate the pores, the temperature and pressure of SPS were increased and the AIN particles were heat-treated at high temperature. Adoption of the core-shell AIN/Cu composite powders facilitated the fabrications of AIN/Cu composites with low porosity and uniform distribution in the AIN in Cu matrix.
Profilaxis de la úlcera gastrointestinal producida por AINES
Directory of Open Access Journals (Sweden)
Carlos Bustamante Rojas
1998-04-01
Full Text Available Como grupo, los AINES son los fármacos más frecuentemente relacionados con informes acerca de Reacciones Adversas en varios países, se considera que más de 30 millones de personas en el mundo toman a diario AINES por prescripción médica o por autoprescripción y que un alto porcentaje de dichas personas corresponden al grupo de edad mayor de 60 años. Diversos metaanálisis revelan que el riesgo de presentar eventos gastrointestinales graves en consumidores regulares de AINES puede ser de 3 a 4 veces mayor que en no usuarios al cabo de 30 dias y que dicho riesgo relativo estimado puede elevarse a 5.5 en pacientes ancianos (7 y a valores cercanos a 8.0 cuando se usan altas dosis del AINE (I, 8. También se ha relacionado el empleo crónico de AINES con un aumento en la mortalidad en ancianos.
Baudelaire Eestis : märkmeid. III / Ain Kaalep
Kaalep, Ain, 1926-
2004-01-01
Ants Orase loodud eesti aleksandriinist. Artiklis tuuakse välja Charles Baudelaire luuletuse "Correspondances" eri tõlked (Ants Oras, Ain Kaalep) ja luuletuse "Le rêve d'un curieux" tõlked (Ilmar Laaban, Ain Kaalep)
Baudelaire Eestis : märkmeid. III / Ain Kaalep
Kaalep, Ain, 1926-
2013-01-01
Ants Orase loodud eesti aleksandriinist. Artiklis tuuakse välja Charles Baudelaire luuletuse "Correspondances" eri tõlked (Ants Oras, Ain Kaalep) ja luuletuse "Le rêve d'un curieux" tõlked (Ilmar Laaban, Ain Kaalep)
African Journals Online (AJOL)
Hamaidi-Chergui F, Brahim Errahmani M, Debib A, Hamaidi M.S
2016-05-01
May 1, 2016 ... Water from boreholes in Arib (Ain Defla) was investigated to ... of 100 ml is drawn through a membrane filter (0.45 μm pore size) using a vacuum pump. The .... boreholes are very important as clean and hygienic environment ...
2009-01-01
Allan Murdmaast (4. 08. 1934-15. 11. 2009) vestlevad 18. novembril Arhitektuuri- ja Disainigaleriis avatud Allan Murdmaa näituse ja raamatu "Monumentaalne : Allan Murdmaa" autorid arhitektid Toivo Tammik ja Arne Maasik ning graafiline disainer Martin Pedanik, lisaks kunstiteadlane Heie Treier
Allan Bloom, America, and Education.
West, Thomas
2000-01-01
Refutes the claims of Allan Bloom that the source of the problem with today's universities is modern philosophy, that the writings and ideas of Hobbes and Locke planted the seeds of relativism in American culture, and that the cure is Great Books education. Suggests instead that America's founding principles are the only solution to the failure of…
"Budjem nazhimat" / Allan Martinson ; interv. Petr Birger
Martinson, Allan, 1966-
2006-01-01
Allan Martinson oma asutatud infotehnoloogia ettevõtetest Eestis ja Baltimaades, investeerimisfirma Martinson Trigon Venture Partners investeeringust Vene tarkvarafirmasse Reksoft ning Eesti IT arengust tervikuna. Vt. samas intervjuud Reksoft'i peadirektori Aleksandr Jegoroviga
Allan Martinson - Eesti mees maailmas / Monica Raud
Raud, Monica, 1981-
2008-01-01
Investeerimisfirma Martinson Trigon Venture Partners juhist Allan Martinsonist, tema karjäärist, elulaadist ja harrastustest. Kommenteerivad AS Delfi nõukogu esimees Ville Jehe ja AS Helmes nõukogu esimees Jaan Pillesaar
Allan Deviation Plot as a Tool for Quartz-Enhanced Photoacoustic Sensors Noise Analysis.
Giglio, Marilena; Patimisco, Pietro; Sampaolo, Angelo; Scamarcio, Gaetano; Tittel, Frank K; Spagnolo, Vincenzo
2016-04-01
We report here on the use of the Allan deviation plot to analyze the long-term stability of a quartz-enhanced photoacoustic (QEPAS) gas sensor. The Allan plot provides information about the optimum averaging time for the QEPAS signal and allows the prediction of its ultimate detection limit. The Allan deviation can also be used to determine the main sources of noise coming from the individual components of the sensor. Quartz tuning fork thermal noise dominates for integration times up to 275 s, whereas at longer averaging times, the main contribution to the sensor noise originates from laser power instabilities.
Pragmatics: The State of the Art: An Online Interview with Keith Allan
Allan, Keith; Salmani Nodoushan, Mohammad Ali
2015-01-01
This interview was conducted with Professor Keith Allan with the aim of providing a brief but informative summary of the state of the art of pragmatics. In providing answers to the interview questions, Professor Allan begins with a definition of pragmatics as it is practiced today, i.e., the study of the meanings of utterances with attention to…
Directory of Open Access Journals (Sweden)
Hélio Afonso Ghizoni Teive
2014-06-01
Full Text Available Edgar Allan Poe was one of the most celebrated writers of all time. He published several masterpieces, some of which include references to neurological diseases. Poe suffered from recurrent depression, suggesting a bipolar disorder, as well as alcohol and drug abuse, which in fact led to his death from complications related to alcoholism. Various hypotheses were put forward, including Wernicke's encephalopathy.
Allan Allmere: tulevane Meelis Atonen / Henri Allas
Arras, Henri
2009-01-01
Liberalismi Akadeemia juht ja Tallinna reforminoorte esimees Allan Allmere keskendub 2009. aastal Tallinna linnavolikokku kandideerides peamiselt noortele ja nende probleemidele. Noormehe hobiks on väärtpaberiturgudel mängimine ning oma eeskujudena nimetab ta USA majandusteadlast Milton Friedmani ja Meelis Atoneni
Autonomous estimation of Allan variance coefficients of onboard fiber optic gyro
International Nuclear Information System (INIS)
Song Ningfang; Yuan Rui; Jin Jing
2011-01-01
Satellite motion included in gyro output disturbs the estimation of Allan variance coefficients of fiber optic gyro on board. Moreover, as a standard method for noise analysis of fiber optic gyro, Allan variance has too large offline computational effort and data storages to be applied to online estimation. In addition, with the development of deep space exploration, it is urged that satellite requires more autonomy including autonomous fault diagnosis and reconfiguration. To overcome the barriers and meet satellite autonomy, we present a new autonomous method for estimation of Allan variance coefficients including rate ramp, rate random walk, bias instability, angular random walk and quantization noise coefficients. In the method, we calculate differences between angle increments of star sensor and gyro to remove satellite motion from gyro output, and propose a state-space model using nonlinear adaptive filter technique for quantities previously measured from offline data techniques such as the Allan variance method. Simulations show the method correctly estimates Allan variance coefficients, R = 2.7965exp-4 0 /h 2 , K = 1.1714exp-3 0 /h 1.5 , B = 1.3185exp-3 0 /h, N = 5.982exp-4 0 /h 0.5 and Q = 5.197exp-7 0 in real time, and tracks degradation of gyro performance from initail values, R = 0.651 0 /h 2 , K = 0.801 0 /h 1.5 , B = 0.385 0 /h, N = 0.0874 0 /h 0.5 and Q = 8.085exp-5 0 , to final estimations, R = 9.548 0 /h 2 , K = 9.524 0 /h 1.5 , B = 2.234 0 /h, N = 0.5594 0 /h 0.5 and Q = 5.113exp-4 0 , due to gamma radiation in space. The technique proposed here effectively isolates satellite motion, and requires no data storage and any supports from the ground.
Allan Martinson ja Trigon teevad oma riskikapitalifondi / Kristiina Randmaa
Randmaa, Kristiina
2004-01-01
Investeerimispank Trigon Capital ja infotehnoloogiaettevõte MicroLink endine juht Allan Martinson loovad Martinson Trigon Venture Partners nime all ühise kuni 400 miljoni kroonise mahuga riskikapitalifondi
Analysis of Motherly Love in Edgar Allan Poe's “to My Mother
Rusdi, Putra
2017-01-01
Project analisisMotherly Love in Edgar Allan Poe's “To My Mother” mengkaji unsur intrinsik dan konsep motherly love dalam puisi To My Motherkarya Edgar Allan Poe. Penulis menggunakan studi pustaka sebagai metode pengumpulan data dan informasi tentang objek penelitian melalui buku dan internet. Penulis menggunakan pendekatan psikologi sastra dengan teori cinta karya Erich Fromm untuk mengetahui cinta yang diberikan ibu kepada anak. Dari hasil analisis, penulis menemukan konsep cinta yang dibe...
Electronic structure and optical properties of AIN under high pressure
International Nuclear Information System (INIS)
Li Zetao; Dang Suihu; Li Chunxia
2011-01-01
We have calculated the electronic structure and optical properties of Wurtzite structure AIN under different high pressure with generalized gradient approximation (GGA) in this paper. The total energy, density of state, energy band structure and optical absorption and reflection properties under high pressure are calculated. By comparing the changes of the energy band structure, we obtained AIN phase transition pressure for 16.7 GPa, which is a direct band structure transforming to an indirect band structure. Meanwhile, according to the density of states distribution and energy band structure, we analyzed the optical properties of AIN under high-pressure, the results showed that the absorption spectra moved from low-energy to high-energy. (authors)
The Making of Allan Aubrey Boesak: Theologian and Political Activist
Directory of Open Access Journals (Sweden)
Maluleke, Tinyiko
2017-09-01
Full Text Available Although no conventional biography of Allan Boesak has been published, either by himself or others, we have enough data and information in various places. This is especially true since the 2009 publication of his Running with Horses. In this essay, we attempt an appraisal of the contribution of Allan Boesak to politics and theology by focusing on key milestones and reflections in his life. We take our cue from Boesak’s own self-definition of being a theologian and a political activist. While this article is not a thorough-going theological, the roots and sources of his theology and politics will be explored.
Autonomous estimation of Allan variance coefficients of onboard fiber optic gyro
Energy Technology Data Exchange (ETDEWEB)
Song Ningfang; Yuan Rui; Jin Jing, E-mail: rayleing@139.com [School of Instrumentation Science and Opto-electronics Engineering, Beihang University, Beijing 100191 (China)
2011-09-15
Satellite motion included in gyro output disturbs the estimation of Allan variance coefficients of fiber optic gyro on board. Moreover, as a standard method for noise analysis of fiber optic gyro, Allan variance has too large offline computational effort and data storages to be applied to online estimation. In addition, with the development of deep space exploration, it is urged that satellite requires more autonomy including autonomous fault diagnosis and reconfiguration. To overcome the barriers and meet satellite autonomy, we present a new autonomous method for estimation of Allan variance coefficients including rate ramp, rate random walk, bias instability, angular random walk and quantization noise coefficients. In the method, we calculate differences between angle increments of star sensor and gyro to remove satellite motion from gyro output, and propose a state-space model using nonlinear adaptive filter technique for quantities previously measured from offline data techniques such as the Allan variance method. Simulations show the method correctly estimates Allan variance coefficients, R = 2.7965exp-4 {sup 0}/h{sup 2}, K = 1.1714exp-3 {sup 0}/h{sup 1.5}, B = 1.3185exp-3 {sup 0}/h, N = 5.982exp-4 {sup 0}/h{sup 0.5} and Q = 5.197exp-7 {sup 0} in real time, and tracks degradation of gyro performance from initail values, R = 0.651 {sup 0}/h{sup 2}, K = 0.801 {sup 0}/h{sup 1.5}, B = 0.385 {sup 0}/h, N = 0.0874 {sup 0}/h{sup 0.5} and Q = 8.085exp-5 {sup 0}, to final estimations, R = 9.548 {sup 0}/h{sup 2}, K = 9.524 {sup 0}/h{sup 1.5}, B = 2.234 {sup 0}/h, N = 0.5594 {sup 0}/h{sup 0.5} and Q = 5.113exp-4 {sup 0}, due to gamma radiation in space. The technique proposed here effectively isolates satellite motion, and requires no data storage and any supports from the ground.
McAdams, Charity Beth
2013-01-01
This thesis focuses on the creative work of Edgar Allan Poe, and pieces together how various references to music in his poems and tales function in ways that echo throughout his oeuvre. By taking into account the plots and themes that surround references to music in Poe’s works, this thesis explores how Poe uses and describes music as it inhabits real world settings, liminal spaces, and otherworldly sites. The literature this thesis draws from ranges from tales little-discussed...
Oxidation behaviour of Ti2AIN films composed mainly of nanolaminated MAX phase.
Wang, Q M; Garkas, W; Renteria, A Flores; Leyens, C; Kim, K H
2011-10-01
In this paper, we reported the oxidation behaviour of Ti2AIN films on polycrystalline Al2O3 substrates. The Ti2AIN films composed mainly of nanolaminated MAX phase was obtained by first depositing Ti-Al-N films using reactive sputtering of two elemental Ti and Al targets in Ar/N2 atmosphere and subsequent vacuum annealing at 800 degrees C for 1 h. The Ti2AIN films exhibited excellent oxidation resistance and thermal stability at 600-900 degrees C in air. Very low mass gain was observed. At low temperature (600 degrees C), no oxide crystals were observed on film surface. Blade-like Theta-Al2O3 fine crystals formed on film surfaces at 700-800 degrees C. At high temperature (900 degrees C), firstly Theta-Al2O3 formed on film surface and then transformed into alpha-Al2O3. At 700-900 degrees C, a continuous Al2O3 layer formed on Ti2AIN films surface, acting as diffusion barrier preventing further oxidation attack. The mechanism of the excellent oxidation resistance of Ti2AIN films was discussed based on the experimental results.
Ain Hanschmidt jättis küsijad vastuseta / Andrus Karnau
Karnau, Andrus
2005-01-01
Ühispanga endise juhi Ain Hanschmidti 26. septembri pöördumine ei andnud vastuseid tema äritehingutega seoses esile kerkinud olulistele küsimustele: mille eest ta sai osalused laevakompaniis Tallink Grupp ja Haapsalu HRM-is. Lisa: Ain Hanschmidti argumendid. Küsimusele, kas Hanschmidti seletused olid piisavad vastavad Eesti Investorite Liidu juhatuse liige Heldur Meerits ja Sillamäe Soojuselektrijaama juhataja Väino Sarnet
Jacobson, Gloria; Rella, Chris; Farinas, Alejandro
2014-05-01
Technological advancement of instrumentation in atmospheric and other geoscience disciplines over the past decade has lead to a shift from discrete sample analysis to continuous, in-situ monitoring. Standard error analysis used for discrete measurements is not sufficient to assess and compare the error contribution of noise and drift from continuous-measurement instruments, and a different statistical analysis approach should be applied. The Allan standard deviation analysis technique developed for atomic clock stability assessment by David W. Allan [1] can be effectively and gainfully applied to continuous measurement instruments. As an example, P. Werle et al has applied these techniques to look at signal averaging for atmospheric monitoring by Tunable Diode-Laser Absorption Spectroscopy (TDLAS) [2]. This presentation will build on, and translate prior foundational publications to provide contextual definitions and guidelines for the practical application of this analysis technique to continuous scientific measurements. The specific example of a Picarro G2401 Cavity Ringdown Spectroscopy (CRDS) analyzer used for continuous, atmospheric monitoring of CO2, CH4 and CO will be used to define the basics features the Allan deviation, assess factors affecting the analysis, and explore the time-series to Allan deviation plot translation for different types of instrument noise (white noise, linear drift, and interpolated data). In addition, the useful application of using an Allan deviation to optimize and predict the performance of different calibration schemes will be presented. Even though this presentation will use the specific example of the Picarro G2401 CRDS Analyzer for atmospheric monitoring, the objective is to present the information such that it can be successfully applied to other instrument sets and disciplines. [1] D.W. Allan, "Statistics of Atomic Frequency Standards," Proc, IEEE, vol. 54, pp 221-230, Feb 1966 [2] P. Werle, R. Miicke, F. Slemr, "The Limits
Directory of Open Access Journals (Sweden)
Perna, Cristina Becker Lopes
2009-01-01
Full Text Available O estudo mostra alguns aspectos da vida de Edgar Allan Poe e situa o contexto histórico do qual fez parte o contista, poeta e ensaísta. A biografia do autor norte-americano é permeada de dúvidas, incertezas e mistérios que o escritor transporta para seus textos, criando um ambiente fantástico que, muitas vezes, foge ao racionalismo humano
Põhikooli ainesõnastikud / Heiki Jaan Kaalep, Jaan Mikk
Kaalep, Heiki-Jaan, 1962-
2008-01-01
Eesti vene õppekeelega koolidele keskastme ainesõnastike loomise konkursi tulemustest, kirjeldatakse koostatud sõnastike eesmärke ja kirjestruktuuri, samuti loomisprotsessi etappe. Vaadeldakse ka morfoloogiaalase tarkvara kasutamisvõimalusi sõnastiku loomisel
HPV infection, anal intra-epithelial neoplasia (AIN and anal cancer: current issues
Directory of Open Access Journals (Sweden)
Stanley Margaret A
2012-09-01
Full Text Available Abstract Background Human papillomavirus (HPV is well known as the major etiological agent for ano-genital cancer. In contrast to cervical cancer, anal cancer is uncommon, but is increasing steadily in the community over the last few decades. However, it has undergone an exponential rise in the men who have sex with men (MSM and HIV + groups. HIV + MSM in particular, have anal cancer incidences about three times that of the highest worldwide reported cervical cancer incidences. Discussion There has therefore traditionally been a lack of data from studies focused on heterosexual men and non-HIV + women. There is also less evidence reporting on the putative precursor lesion to anal cancer (AIN – anal intraepithelial neoplasia, when compared to cervical cancer and CIN (cervical intraepithelial neoplasia. This review summarises the available biological and epidemiological evidence for HPV in the anal site and the pathogenesis of AIN and anal cancer amongst traditionally non-high risk groups. Summary There is strong evidence to conclude that high-grade AIN is a precursor to anal cancer, and some data on the progression of AIN to invasive cancer.
Allan Martinson ja Trigon panid käima uue riskikapitalifondi / Kristina Traks
Traks, Kristina, 1976-
2005-01-01
Allan Martinson ja investeerimispank Trigon Capital lõid uue riskikapitaliettevõtte Martinson Trigon Venture Partners, mis hakkab investeerima tehnoloogia-, meedia- ja telekommunikatsioonifirmadesse Balti riikides ja Venemaal
Fabrication and performance of AIN insulator coatings for application in fusion reactor blankets
International Nuclear Information System (INIS)
Natesan, K.
1995-09-01
The liquid-metal blanket concept for fusion reactors requires an coating on the first-wall structural material to minimize the magnetohydrodynamic pressure drop that occurs during the flow of liquid metal in a magnetic field. Based on the thermodynamics of interactions betwen the coating and the liquid lithium on one side and the structural V-base alloy on the other side, an AIN coating was selected as a candidate. Detailed investigations were conducted on the fabrication, metallurgical microstructure, compatibility in liquid Li, and electrical characteristics of AIN material obtained from several sources. Lithium compatibility was studied in static systems by exposing AIN-coated specimens to liquid Li for several time periods. Electrical resistance was measured at room temperature on the specimens before and after exposure to liquid Li. The results obtained in this study indicate that AIN is a viable coating from the standpoint of chemical compatibility in Li, electrical insulation, and ease of fabrication; for these reasons, the coating should be examined further for fusion reactor applications
Kaninen Allan, giraffen Marius og llivets værdi
DEFF Research Database (Denmark)
Sandøe, Peter
2015-01-01
Det var ikke smart, da en rasiovært på Radio24syv dor åben mikrofon dræbte kaninen Allan ved hjælp af en cykelpumpe. Men det er i orden at slå dyr ihjæl, hvis det sikrer, at de resterende dyr får bedre livsvilkår....
Dynamic Allan Variance Analysis Method with Time-Variant Window Length Based on Fuzzy Control
Directory of Open Access Journals (Sweden)
Shanshan Gu
2015-01-01
Full Text Available To solve the problem that dynamic Allan variance (DAVAR with fixed length of window cannot meet the identification accuracy requirement of fiber optic gyro (FOG signal over all time domains, a dynamic Allan variance analysis method with time-variant window length based on fuzzy control is proposed. According to the characteristic of FOG signal, a fuzzy controller with the inputs of the first and second derivatives of FOG signal is designed to estimate the window length of the DAVAR. Then the Allan variances of the signals during the time-variant window are simulated to obtain the DAVAR of the FOG signal to describe the dynamic characteristic of the time-varying FOG signal. Additionally, a performance evaluation index of the algorithm based on radar chart is proposed. Experiment results show that, compared with different fixed window lengths DAVAR methods, the change of FOG signal with time can be identified effectively and the evaluation index of performance can be enhanced by 30% at least by the DAVAR method with time-variant window length based on fuzzy control.
REPRESENTATION OF DEATH IN EDGAR ALLAN POE AND EMILY DICKINSON
Directory of Open Access Journals (Sweden)
Sudha Swarnakar
2017-03-01
Full Text Available Este artigo reflete sobre a representação do tema da morte nas obras de dois escritores norte americano; o Edgar Allan Poe e Emily Dickinson. Como instrumento de pesquisa e apoio teórico buscamos a teoria com-parada e estudo temático. Para ser justo na nossa comparação com Emily Dickinson, que nunca entro no mundo de ficção e ficou escrevendo só po-emas, tentamos não entrar no mundo de ficção de Edgar Allan Poe e limitar a discussão só para os poemas dele. O argumento principal neste trabalho se constrói ao redor a idéia que apesar de ambos os poetas ser obcecados com a morte, como a constante presença da morte nos trabalhos deles prova. Percebemos que a maneira no qual eles apresenta a morte é bem diferente.
Dozhivjom do võborov / Ain Seppik ; interv. Tatjana Opekina
Seppik, Ain, 1952-
2007-01-01
Riigikogu liige vastab küsimustele, mis puudutavad Keskerakonna poliitikat, parlamendivalimisi, aprillisündmusi, korruptsiooni, riigieelarvet. Ain Seppik leiab, et Keskerakonna missiooniks on arendada riiki ja kaitsta nõrku
Allan Urho Paivio (1925-2016).
Katz, Albert
2017-01-01
Presents an obituary for Allan Urho Paivio, who passed away on June 19, 2016. One of his many accomplishments was the development of a dual-coding theory. Dual-coding theory, while very influential, has, unfortunately, been discussed all too often as a theory of mental imagery, and not within its larger context wherein mental imagery and verbal processes are separable but interconnected representational systems, an academic battle in clarification that Paivio waged much of his life. He published prodigiously, even in the decades after retirement. Among his many honors, he served as president of the Canadian Psychological Association (1975) and was appointed a fellow of the Royal Society of Canada (1978). (PsycINFO Database Record (c) 2017 APA, all rights reserved).
Little, Allan
2005-01-01
Briti telekompanii BBC staazhikas väliskorrespondent vastab küsimustele, mis puudutavad BBC saadete objektiivsust, telekompanii vasakliberaalseid hoiakuid, BBC suhtumist Iisraeli-Palestiina konflikti ning keerukate välispoliitiliste teemade kajastamist. Lisa: Allan Little
The principle of individuation in Edgar Allan Poe
Directory of Open Access Journals (Sweden)
Maria Alice Ribeiro Gabriel
2017-12-01
Full Text Available Thematically, in Edgar Allan Poe’s fiction, the concept of principium individuationis (principle of individuation is a complex system of topics and interconnected elements, involving the notions of rational being, national and cultural identities, and social role. The purpose of this essay is to examine comparatively the idea of principium individuationis in “Morela” (1835 and others works by Poe, according to the studies undertaken by David Halliburton (1973, Martin Roth (1979, and Beverly R. Voloshin (1996.
Horror from the Soul--Gothic Style in Allan Poe's Horror Fictions
Sun, Chunyan
2015-01-01
Edgar Allan Poe made tremendous contribution to horror fiction. Poe's inheritance of gothic fiction and American literature tradition combined with his living experience forms the background of his horror fictions. He inherited the tradition of the gothic fictions and made innovations on it, so as to penetrate to subconsciousness. Poe's horror…
Intervjuu uue autoriga Kalifornias / Allan Kiisk ; küsitlenud Heino Jõgis
Kiisk, Allan
2008-01-01
intervjuu aprilli lõpus trükist ilmunud raamatu "Simple Phonetic English Spelling : Introduction to Simpel-Fonetik, the Single-Sound-per-Letter Writing Method : A practical and proven solution to the spelling and pronunciation problems of the English language/ Tate Publishing & Enterprises, LLC (Mustang, Oklahoma USA 2008) autori Allan Kiisk'iga
F-type centers in neutron-irradiated AIN
International Nuclear Information System (INIS)
Atobe, Kozo; Honda, Makoto; Fukuoka, Noboru; Okada, Moritami; Nakagawa, Masuo.
1990-01-01
The production of point defects by neutron irradiation and thermal decay in sintered AIN polycrystal are investigated. The absorption band at 370 nm is observed after reactor neutron irradiation to a dose of 10 16 n/cm 2 (E > 0.1 MeV). The defect corresponding to the band is tentatively assigned as an F-type center from the optical absorption and electron spin resonance. (author)
Leaky surface acoustic waves in Z-LiNbO3 substrates with epitaxial AIN overlays
International Nuclear Information System (INIS)
Bu, G.; Ciplys, D.; Shur, M.S.; Namkoong, G.; Doolittle, W.A.; Hunt, W.D.
2004-01-01
The properties of leaky surface acoustic waves (LSAW) in MBE grown AIN layer on Z-cut LiNbO 3 structures have been studied by numerical simulation and experimental measurements and compared with those of Rayleigh waves in the same structure. In the range of AIN layer thicknesses studied (0 3 substrate was essentially constant at around 4400 m/s. The measured electromechanical coupling coefficients (K 2 ) for the LSAW are roughly 1/4 of the predicted values, which might be due to the strong attenuation of the leaky wave unaccounted for during the parameter extraction. The thin AIN film slightly improved the measured temperature coefficient of frequency for the LSAW over that attained for the Z-cut, X-propagating LiNbO 3 substrate alone
Calder, D.R.; Vervoort, W.; Hochberg, F.G.
2009-01-01
Hydroids of the Allan Hancock Pacific Expeditions, and those of the Allan Hancock Caribbean Sea Expedition, were examined by Charles McLean Fraser in a series of reports published between 1938 and 1948. A total of 159 new nominal species was described from material collected in the eastern Pacific
Kurja lilled / Charles Baudelaire ; prantsuse k. tlk. Ain Kaalep ja Märt Väljataga
Baudelaire, Charles
2000-01-01
Sisu: Õnnistamine ; "Jumaldan Sind ma siin, öist taevavõlvi nägev / tlk. Ain Kaalep ; Palkon / tlk. Märt Väljataga ; Kodukäija ; Kassid / tlk. A. Kaalep ; Armastades valet / tlk. M. Väljataga ; Üksildase vein ; Päeva lõpp / tlk. Ain Kaalep. Orig.: Bénédiction ; "Je t'adore ̉ l'égal de la vo͠te nocturne ; Le balcon ; Les chats ; L'amour du mensonge ; Le vin du solitaire ; La fin de la journée
ISO sertifikaat kuulutab tootja mainet üle maailma / Ain Alvela
Alvela, Ain, 1967-
2006-01-01
Ilmunud ka: Delovõje Vedomosti 12. apr. lk. 24-25. ISO standardi rakendamine tagab toodangu kvaliteedi ja annab firmale usaldusväärsuse. Kommenteerib Ain Noormägi. Vt. samas: ISO 9001; ISO 14 001; Universaalne standard kohandub ettevõtte vajadustega
Farias Santos, Juliana; Suruagy Amaral, Monique; Lima Oliveira, Suzana; Porto Barbosa, Júnia; Rego Cabral, Cyro; Sofia Melo, Ingrid; Bezerra Bueno, Nassib; Duarte Freitas, Johnatan; Goulart Sant'ana, Antônio; Rocha Ataíde, Terezinha
2015-05-01
There are several standard diets for animals used in scientific research, usually conceived by scientific institutions. The AIN-93 diet is widely used, but there are some reports of fatty liver in Wistar rats fed this diet. We aimed to evaluate the hepatic repercussions of the AIN-93 diet intake in Wistar rats. Forty newly-weaned 21-day-old male Wistar rats were fed either the AIN-93 diet or a commercial diet for either 1 month or 4 months. Weight gain, serum biochemistry, hepatic histology, and hepatic fatty acid profile were analyzed. Hepatic steatosis was observed, especially in the group fed the AIN-93 diet. Serum blood glucose, absolute and relative liver weight and hepatic levels of oleic, palmitoleic, stearic, and palmitic fatty acids were related to the observed steatosis, while lipidogram and serum markers of liver function and injury were not. AIN-93 diet induced acute hepatic steatosis in Wistar rats, which may compromise its use as a standard diet for experimental studies with rodents. The hepatic fatty acid profile was associated with steatosis, with possible implications for disease prognosis. Copyright AULA MEDICA EDICIONES 2014. Published by AULA MEDICA. All rights reserved.
Keila Tervisekeskus. Ujula = Keila Health Club. Swimming Pool / Ain Padrik
Padrik, Ain, 1947-
2001-01-01
Projekteerija: Arhitektuuribüroo Künnapu & Padrik. Arhitektid Ain Padrik ja Kristi Alamaa, sisearhitekt Sirje Männik. Konstruktsioonid: Jaan Laks, A-Grupp. Ujulas on võistlus- ja lastebassein, suvel on avatud välibassein. 5 ill.: I korruse plaan, ristlõige, vaated
Tumedad ained kirjanduses ja päriselt / Mare Müürsepp
Müürsepp, Mare
2007-01-01
Analüüsitud on Philip Pullmani triloogiasse "Tema tumedad ained" kuuluvaid romaane : Pullman, Philip. Kuldne kompass. Tallinn : Tiritamm, 2002; Pullman, Philip. Inglite torn. Tallinn : Tiritamm, 2004; Pullman, Philip. Vaigust kiiker. Tallinn : Tiritamm, 2005
On the extended and Allan spectra and topological radii
Directory of Open Access Journals (Sweden)
Hugo Arizmendi-Peimbert
2012-01-01
Full Text Available In this paper we prove that the extended spectrum \\(\\Sigma(x\\, defined by W. Żelazko, of an element \\(x\\ of a pseudo-complete locally convex unital complex algebra \\(A\\ is a subset of the spectrum \\(\\sigma_A(x\\, defined by G.R. Allan. Furthermore, we prove that they coincide when \\(\\Sigma(x\\ is closed. We also establish some order relations between several topological radii of \\(x\\, among which are the topological spectral radius \\(R_t(x\\ and the topological radius of boundedness \\(\\beta_t(x\\.
Looking at the "Next" 20 Years of Multiliteracies: A Discussion with Allan Luke
Garcia, Antero; Luke, Allan; Seglem, Robyn
2018-01-01
In this discussion with literacies researcher Allan Luke, the New London Group Member reflects on the role of multiliteracies in shaping literacies research and the continuing changes to technology, capitalism, and learning. Focused on looking toward future advances in literacies research, Luke reflects on the role of multiliteracies in…
Directory of Open Access Journals (Sweden)
Ferrán Catalá-López
2014-09-01
Conclusiones: Existe poca evidencia para sugerir que alguno de los AINE estudiados es seguro en términos de riesgo cardiovascular. Naproxeno parece ser menos perjudicial que el resto. El riesgo cardiovascular asociado al uso de AINE debe ser tenido en cuenta en la prescripción de cualquiera de estos medicamentos.
Where Were the Whistleblowers? The Case of Allan McDonald and Roger Boisjoly.
Stewart, Lea P.
Employees who "blow the whistle" on their company because they believe it is engaged in practices that are illegal, immoral, or harmful to the public, often face grave consequences for their actions, including demotion, harassment, forced resignation, or termination. The case of Allan McDonald and Roger Boisjoly, engineers who blew the…
Observation, Inference, and Imagination: Elements of Edgar Allan Poe's Philosophy of Science
Gelfert, Axel
2014-01-01
Edgar Allan Poe's standing as a literary figure, who drew on (and sometimes dabbled in) the scientific debates of his time, makes him an intriguing character for any exploration of the historical interrelationship between science, literature and philosophy. His sprawling "prose-poem" "Eureka" (1848), in particular, has…
The Scientific Method Ain't What It Used to Be
Herreid, Clyde Freeman
2010-01-01
Remember the time when all you had to do was memorize these five steps: ask a question, formulate a hypothesis, perform experiment, collect data, and draw conclusions? And you received full credit for defining the scientific method. Well, those days are gone. This article discusses why the "scientific method ain't what it used to be." (Contains 2…
Playing on the Right Side of the Brain: An Interview with Allan N. Schore
American Journal of Play, 2017
2017-01-01
Allan N. Schore has served on the clinical faculty of the Department of Psychiatry and Biobehavioral Sciences at UCLA's David Geffen School of Medicine since 1996 and has maintained a private clinical practice for more than four decades. He has contributed significant research to the disciplines of interpersonal neurobiology, affective…
Forsyth, Alexander Craig
2014-01-01
This thesis offers principles for Christian mission in the present Western milieu derived from a retrieval of the missiology in post-war Scotland of Tom Allan. Allan was a minister, evangelist and theologian of particular public prominence in Scotland and beyond in the period from 1946 to 1964. His missiology focused upon the ‘apostolate of the laity’ through the ‘contextualisation’ of Christianity and Church. It was drawn from diverse, rich sources in Scottish and European theolo...
Fiedler, John L; Villalobos, Carlos A; De Mattos, Annette C
2008-11-01
The Honduras AIN-C programme is a preventive health and nutrition programme of the Honduras Ministry of Health (MOH) that relies on volunteers to help mothers monitor and maintain the adequate growth of young children. A quasi-experimental, design-based evaluation found that the programme achieved near-universal coverage and was effective in improving mothers' child-rearing knowledge, attitudes and practices, including feeding and appropriate care-giving and care-seeking practices for children with diarrhoea and acute respiratory illness. The programme is widely regarded as a model. This study was undertaken to provide the first comprehensive estimates of the cost of the AIN-C programme, with the goal of providing a programme and financial planning tool for Honduras. An additional comparison of study findings was also undertaken to determine the cost of the AIN-C programme's community-based services relative to a similar facility-based service. Expressed in mid-2005 US dollars, the study found that after the programme is phased-in: (1) the annual, recurrent cost per child under 2 years participating in the programme is $6.43; (2) the annual, incremental budget requirements per child under 2 years participating in the programme are $3.90; (3) the cost of an AIN-C monthly growth monitoring and counselling session per child is 11% of the cost of a traditional MOH, facility-based growth and development consultation per child; and (4) the effect of mothers substituting AIN-C monitor care for MOH facility-based care 'saves' 203 000 outpatient visits a year, with a potential cost saving of $1.66 million, the equivalent of 60% of the recurrent cost of the programme and roughly equal to the annual incremental budget requirements of the programme. Sensitivity analysis of the cost estimates is performed to provide insight, for countries considering introducing a similar programme, into how modifications of key characteristics of the programme affect its costs.
Directory of Open Access Journals (Sweden)
Augusto García-Poma
2007-03-01
Full Text Available Objetivo: Evaluar la terapia con pamidronato, en pacientes con espondilitis anquilosante (EA activa, con respuesta subóptima o falla a los antiinflamatorios no-esteroideos (AINES y sulfasalazina. Diseño: Estudio clínico comparativo. Lugar: Hospital Nacional Edgardo Rebagliati Martins, EsSalud, Lima, Perú. Participantes: Pacientes con espondilitis anquilosante. Intervenciones. Se incluyó 9 pacientes con EA (6 varones, con enfermedad activa (BASDAI > o = 4, actividad axial y falta de respuesta a los Aines y sulfasalazina a dosis de 3g/d. Todos los pacientes recibieron 60 mg de pamidronato mensual, en infusión endovenosa, durante 6 meses, y continuaron tomando AINES y sulfasalazina. La mejoría clínica fue evaluada usando el ASAS 20. En forma secundaria se evaluó el ASAS 40, BASDAI 50, BASDAI, BASFI Y BASMI, a las 24 y 48 semanas (32 a 86 semanas. La diferencia entre el índice de pre y postratamiento fue evaluada usando la prueba de Wilcoxon. Principales medidas de resultados: Evaluación del ASAS 20. Resultados: El 67% alcanzó un Asas 20 a las 24 semanas y 78% a las 48 semanas; 33,3% y 55,6% tuvieron ASAS 40 y 33,3%; y 44,4% alcanzó BASDAI 50 a las 24 y 48 semanas, respectivamente. Un paciente recayó a la semana 20. Tres pacientes (33,3% permanecieron sin cambios. A las 24 y 48 semanas, la media de BASDAI disminuyó en 45,1% (p=0,007 y en 52,1% (p=0,01, la media de BASFI en 38,2% (p=0,007 y en 52,3% (p=0,007, y la media de BASMI en 39,2% (p=0,01 y 39,2% (p=0,01, respectivamente. Los eventos adversos no fueron importantes con esta terapia. Conclusiones: El tratamiento con pamidronato demostró ser efectivo en este grupo de pacientes con EA, refractaria a AINES y a sulfasalazina.
Sissejuhatus suure kirjaniku loomingusse : Edgar Allan Poe' väändunud maailm / Aare Ermel
Ermel, Aare, 1957-2013
2001-01-01
Prantsusmaa-Itaalia 1968.a. ühisfilm "Erakordsed lood" ("Histoires extraordinaires"), mis koosneb Edgar Allan Poe kolme novelli ekraniseeringutest : "Metzengerstein" (režissöör Roger Vadim), "William Wilson" (režissöör Louis Malle) ja "Toby Dammit" (režissöör Federico Fellini). Ka : Nädal nr. 25, lk. 14
Valik arvamusi läbi aastate / Ain-Elmar Kaasik
Kaasik, Ain-Elmar, 1934-
2008-01-01
Valik Eesti Teaduste Akadeemia Aastaraamatus rubriigis "Arvamusi akadeemikutelt" ilmunud kirjutisi, kus vabas vormis käsitletakse mitmesuguseid aktuaalseid küsimusi, eelkõige hariduse, teadustöö ning ühiskonna suhteid. Kokku on rubriigis avaldatud ligi kaks ja poolsada kirjutist. Siinse valiku autoriteks akadeemikud Raimund Hagelberg, Mart Saarma, Boris Tamm, Ene Ergma, Arvo Krikmann, Agu Laisk, Hans-Voldemar Trass, Harald Keres, Anto Raukas, Rein Küttner, Enn Tõugu, Raimund-Johannes Ubar, Ain-Elmar Kaasik
[Exome sequencing revealed Allan-Herndon-Dudley syndrome underlying multiple disabilities].
Arvio, Maria; Philips, Anju K; Ahvenainen, Minna; Somer, Mirja; Kalscheuer, Vera; Järvelä, Irma
2014-01-01
Normal function of the thyroid gland is the cornerstone of a child's mental development and physical growth. We describe a Finnish family, in which the diagnosis of three brothers became clear after investigations that lasted for more than 30 years. Two of the sons have already died. DNA analysis of the third one, a 16-year-old boy, revealed in exome sequencing of the complete X chromosome a mutation in the SLC16A2 gene, i.e. MCT8, coding for a thyroid hormone transport protein. Allan-Herndon-Dudley syndrome was thus shown to be the cause of multiple disabilities.
Aineüleste pädevuste koolitus Pestalozzi programmi raames / Tiia Pukk, Tiiu Vaher
Pukk, Tiia
2011-01-01
1969 alguse saanud Pestalozzi koolitusprogramm on suunatud Euroopa kultuurikonventsiooniga ühinenud 49 riigi haridustöötajatele. Seekordne üritus toimus Tartus, koolituse teemaks aineülesed pädevused
GarcÍa Lorca luulest ja Ain Kaalepi tõlkest / Jüri Talvet
Talvet, Jüri, 1945-
1998-01-01
Arvustus: GarcÍa Lorca, Federico. Mu kätes põleb tuli : valitud luuletused / tlk. ja saateks: Ain Kaalep. 2. tr. Tallinn : Vagabund, 1997. Ilmunud ka kogumikus: Talvet, Jüri. Tõrjumatu äär. Tartu : Ilmamaa, 2005, lk. 442-453
New frameshift CF mutation 3729delAinsTCT in a Tunisian cystic
Indian Academy of Sciences (India)
Home; Journals; Journal of Genetics; Volume 92; Issue 1. New frameshift CF mutation 3729delAinsTCT in a Tunisian cystic fibrosis patient. Sondess Hadj Fredj Monia Boudaya Sabrine Oueslati Safa Sahnoun Chaima Sahli Hajer Siala Khedija Boussetta Amina Bibi Taieb Messaoud. Research Note Volume 92 Issue 1 April ...
COxSwAIN: Compressive Sensing for Advanced Imaging and Navigation
Kurwitz, Richard; Pulley, Marina; LaFerney, Nathan; Munoz, Carlos
2015-01-01
The COxSwAIN project focuses on building an image and video compression scheme that can be implemented in a small or low-power satellite. To do this, we used Compressive Sensing, where the compression is performed by matrix multiplications on the satellite and reconstructed on the ground. Our paper explains our methodology and demonstrates the results of the scheme, being able to achieve high quality image compression that is robust to noise and corruption.
Obituary: Allan R. Sandage (1926-2010)
Devorkin, David
2011-12-01
Allan Rex Sandage died of pancreatic cancer at his home in San Gabriel, California, in the shadow of Mount Wilson, on November 13, 2010. Born in Iowa City, Iowa, on June 18, 1926, he was 84 years old at his death, leaving his wife, former astronomer Mary Connelly Sandage, and two sons, David and John. He also left a legacy to the world of astronomical knowledge that has long been universally admired and appreciated, making his name synonymous with late 20th-Century observational cosmology. The only child of Charles Harold Sandage, a professor of advertising who helped establish that academic specialty after obtaining a PhD in business administration, and Dorothy Briggs Sandage, whose father was president of Graceland College in Iowa, Allan Sandage grew up in a thoroughly intellectual, university oriented atmosphere but also a peripatetic one taking him to Philadelphia and later to Illinois as his father rose in his career. During his 2 years in Philadelphia, at about age eleven, Allan developed a curiosity about astronomy stimulated by a friend's interest. His father bought him a telescope and he used it to systematically record sunspots, and later attempted to make a larger 6-inch reflector, a project left uncompleted. As a teenager Allan read widely, especially astronomy books of all kinds, recalling in particular The Glass Giant of Palomar as well as popular works by Eddington and Hubble (The Realm of the Nebulae) in the early 1940s. Although his family was Mormon, of the Reorganized Church, he was not practicing, though he later sporadically attended a Methodist church in Oxford, Iowa during his college years. Sandage knew by his high school years that he would engage in some form of intellectual life related to astronomy. He particularly recalls an influential science teacher at Miami University in Oxford, Ohio named Ray Edwards, who inspired him to think critically and "not settle for any hand-waving of any kind." [Interview of Allan Rex Sandage by Spencer
Rodríguez, Daniela C; Peterson, Lauren A
2016-05-06
Factors that influence performance of community health workers (CHWs) delivering health services are not well understood. A recent logic model proposed categories of support from both health sector and communities that influence CHW performance and program outcomes. This logic model has been used to review a growth monitoring program delivered by CHWs in Honduras, known as Atención Integral a la Niñez en la Comunidad (AIN-C). A retrospective review of AIN-C was conducted through a document desk review and supplemented with in-depth interviews. Documents were systematically coded using the categories from the logic model, and gaps were addressed through interviews. Authors reviewed coded data for each category to analyze program details and outcomes as well as identify potential issues and gaps in the logic model. Categories from the logic model were inconsistently represented, with more information available for health sector than community. Context and input activities were not well documented. Information on health sector systems-level activities was available for governance but limited for other categories, while not much was found for community systems-level activities. Most available information focused on program-level activities with substantial data on technical support. Output, outcome, and impact data were drawn from various resources and suggest mixed results of AIN-C on indicators of interest. Assessing CHW performance through a desk review left gaps that could not be addressed about the relationship of activities and performance. There were critical characteristics of program design that made it contextually appropriate; however, it was difficult to identify clear links between AIN-C and malnutrition indicators. Regarding the logic model, several categories were too broad (e.g., technical support, context) and some aspects of AIN-C did not fit neatly in logic model categories (e.g., political commitment, equity, flexibility in implementation). The
Monsieur Philippe Galli Préfet de l’Ain France
Maximilien Brice
2011-01-01
Photo 35: Le chef du département Physique P. Bloch, le porte-parole de la Collaboration CMS G. Tonelli,le Sous-Préfet de Gex O. Laurens-Bernard, le chef du département Technologie F. Bordry, le Péfet de l'Ain P. Galli et le Directeur-général R. Heuer. Photo 62: signature du livre d'or avec le Directeur de la recherche et de l'informatique S. Bertolucci.
Application of electrical geophysics to the release of water resources, case of Ain Leuh (Morocco
Directory of Open Access Journals (Sweden)
Zitouni A.
2018-01-01
In the present work, which concerns only the methodology of the electric resistivity, we treat the adopted methodological approach and the study of the case of application in the tray of Ajdir Ain Leuh.
Kehrl, Laura; Conway, Howard; Holschuh, Nicholas; Campbell, Seth; Kurbatov, Andrei V.; Spaulding, Nicole E.
2018-05-01
The current ice core record extends back 800,000 years. Geologic and glaciological evidence suggests that the Allan Hills Blue Ice Area, East Antarctica, may preserve a continuous record that extends further back in time. In this study, we use ice-penetrating radar and existing age constraints to map the internal stratigraphy and age structure of the Allan Hills Main Ice Field. The dated isochrones provide constraints for an ice flow model to estimate the age of ice near the bed. Previous drilling in the region recovered stratigraphically disturbed sections of ice up to 2.7 million years old. Our study identifies a site 5 km upstream, which likely preserves a continuous record through Marine Isotope Stage 11 with the possibility that the record extends back 1 million years. Such records would provide new insight into the past climate and glacial history of the Ross Sea Sector.
Allan deviation analysis of financial return series
Hernández-Pérez, R.
2012-05-01
We perform a scaling analysis for the return series of different financial assets applying the Allan deviation (ADEV), which is used in the time and frequency metrology to characterize quantitatively the stability of frequency standards since it has demonstrated to be a robust quantity to analyze fluctuations of non-stationary time series for different observation intervals. The data used are opening price daily series for assets from different markets during a time span of around ten years. We found that the ADEV results for the return series at short scales resemble those expected for an uncorrelated series, consistent with the efficient market hypothesis. On the other hand, the ADEV results for absolute return series for short scales (first one or two decades) decrease following approximately a scaling relation up to a point that is different for almost each asset, after which the ADEV deviates from scaling, which suggests that the presence of clustering, long-range dependence and non-stationarity signatures in the series drive the results for large observation intervals.
Armour, C.M. (Christine M.); S. Kersseboom (Simone); Yoon, G. (Grace); T.J. Visser (Theo)
2015-01-01
textabstractBackground. Mutations in the thyroid hormone (TH) transporter MCT8 have been identified as the cause for Allan-Herndon-Dudley Syndrome (AHDS), characterized by severe psychomotor retardation and altered TH serum levels. Here we report a novel MCT8 mutation identified in 4 generations of
Citizen journalism is as old as journalism itself: An interview with Stuart Allan
Hajek, Roman; Stefanikova, Sandra; Allan, Stuart
2014-01-01
Professor Stuart Allan from Cardiff University in the UK is one of the leading scholars\\ud in contemporary journalism studies. He has made a significant contribution to the development\\ud of this research field, having authored or edited seventeen books to date (many\\ud of which have been translated into multiple languages), as well as a wide range of journal\\ud articles and book chapters. He is a co-founder of the peer-reviewed journal Journalism\\ud Education, and serves on the editorial boa...
Mida sina täna õppisid? / Veikko Täär, Ain Aaviksoo, Ingrid Tõniste ... [jt.
2012-01-01
Oma õppimistest ja tulevikuplaanidest räägivad näitleja ja ettevõtja Veikko Täär, tervishoiuteadlane Ain Aaviksoo, tegevjuht Ingrid Tõniste, TV3 avalike suhete juht ja uudisteankur Anneli Adermann, arenduskonsultant Anu Puusaag, personaaltreener Katrin Pärt ja loodusarst Tiina Keldrima
Ain't Gonna Study War No More? Explorations of War through Picture Books
Crawford, Patricia A.; Roberts, Sherron Killingsworth
2009-01-01
At the height of the Vietnam War, Down by the Riverside was transformed from a traditional folk song to a popular anti-war anthem. The raucous and repetitive chorus, "I ain't gonna study war no more ...," became a rallying cry for those who wanted nothing to do with the war and the pain and controversy that surrounded it. Although it seems…
Derdour Abdessamed; Bouanani Abderrazak; Babahamed Kamila
2018-01-01
Ain Sefra is one of the Algerian cities that had been experienced several devastating floods during the past 100 years. The purpose of this study is to simulate runoff in the semi-arid region of Ain Sefra watershed through the employing of the Hydrologic Engineering Center – Hydrologic Modelling System (HEC-HMS). In this paper, the frequency storm is used for the meteorological model, the Soil Conservation Service – curve number (SCS-CN) is selected to calculate the loss rate and Soil Conserv...
International Nuclear Information System (INIS)
Ben Ammar, Safouan
2007-01-01
In the semiarid central part of Tunisia the water resources are becoming increasingly rare because of the scarcity and irregularity of the precipitation and a steadily growing need for fresh water. This study addresses the use of geochemical and isotopic data to analyze the relationship between the El Haouareb dam and the Ain El Beidha and the Kairouan alluvial plain aquifers systems for durable groundwater management. In the Ain El Beidha basin the hydrogeological and geochemical investigations showed that: - The general direction of the groundwater flow is mainly from the SW to the NE, i.e. towards the hydraulic sill of El Haouareb which allows the connection between the Ain El Beidha basin and the Kairouan plain, - The salinity distribution displays a zonation in apparent relationship with the lithological variation of the aquifer formation, - Mineral exchange between groundwater and the aquifer matrix is the dominant process in determining groundwater salinity. The isotopic data confirm the flow directions of groundwater and shows that the recharge of Ain El Beidha aquifers takes place from the floods of the Khechem and Ben Zitoun wadies and also by preferential infiltration of runoff at the front of hill slopes area. Close to preferential recharge areas, groundwater 3H contents reflect a recent input of surface water, whereas the radiocarbon data indicate a longer residence time downstream. The isotopic characteristics of Ain El Beidha groundwater (small space and temporal changes) authorize the use of averaged values for the dam-aquifer water exchange. Under natural conditions, groundwater recharge of the alluvial aquifer of Kairouan plain occurs by infiltration of the Merguellil floods and from the Ain el Beidha groundwater flow close the karstic hydraulic sills. Since the construction of the El Haouareb dam, these natural mechanisms have been strongly modified: the dam waters infiltrate into the karst, mix with the Ain el Beidha groundwater, and feed the
T his article is m ainly about using sim ple trigonom etric identities ...
Indian Academy of Sciences (India)
T his article is m ainly about using sim ple trigonom etric identities and basic calculus to deduce som e new and interesting series. In particular, I use basic aspects of. G am m a and B eta integrations to deduce these series. T hese lead to interesting series for ¼ or functions of ¼ . O ne form ofbeta integration w hich is often ...
2004-01-01
Tartu Ülikooli arstiteaduskonna üliõpilased põhjendavad, miks nad ei soovi Eestis residentuuri astuda, vaid hoopis Soome tööle lähevad. Residentuurisüsteemi prodekaan professor Raul-Allan Kivet selgitab, miks noored arstid peavad pärast ülikooli lõpetamist mitmeid aastaid pisikese palga eest praktiseerima
Trigo-Rodriguez, J. M.; Moyano-Cambero, C. E.; Donoso, J. A.; Benito-Moreno, M. I.; Alonso-Azcárate, J.
2018-04-01
The study of aqueous alteration minerals like Fe-Mg-Ca carbonates in Allan Hills 84001 or iddingsite and magnetite in Nakhla meteorite allow us to constrain their formation conditions and water availability at 4 and 1.3 Ga ago, respectively.
National Research Council Canada - National Science Library
2006-01-01
.... The Center was to be funded by the Department of Defense, Office of Naval Research (ONR). The TDRI AINS Center's objectives were to advance ONR's technologies and to improve exposure and participation in science, math, and engineering (SME...
International Nuclear Information System (INIS)
Aly, A.I.M.; Nada, A.; Awad, M.; Salman, A.B.; Hamza, M.S.
1991-01-01
Groundwater samples collected from some localities in the vicinity of Moghra and Ain El-Sharip in the north western desert were subjected to chemical and to isotopic analyses. The combination of the hydrochemical data with the isotopic compositions of deuterium, oxygen-18 and tritium shows that the groundwater in this region represents a mixture of water recharged from different sources including : Nile, sea and paleo-waters.5 fig.,2 tab
Gattano, C.; Lambert, S.; Bizouard, C.
2017-12-01
In the context of selecting sources defining the celestial reference frame, we compute astrometric time series of all VLBI radio-sources from observations in the International VLBI Service database. The time series are then analyzed with Allan variance in order to estimate the astrometric stability. From results, we establish a new classification that takes into account the whole multi-time scales information. The algorithm is flexible on the definition of ``stable source" through an adjustable threshold.
2012-01-01
Tartus Sadama 1 auva Ahhaa teaduskeskuse arhitektuurist ja sisearhitektuurist. Arhitektid: Ain Padrik ja Vilen Künnapu, kaasa töötasid Kristjan Tõlk, Kristiin Keernik, Siim Tuksam, Hannes Tilk (Künnapu & Padrik). Sisearhitektid: Tea Tammelaan, Krista Lepland ja Malle Jürgenson (Laika, Belka & Strelka). Infograafika: Alar Pikkorainen
2006-01-01
Projekti "Eesti doktoriõppe kvaliteedi, tulemuslikkuse ja jätkusuutlikkuse tagamise süsteem" (2005-2008) II konverentsi "Doktorid Eesti tuleviku arengumootoriks" paneeldiskussioonist, millel arutleti doktoriõppe rahastamise ning doktoriõppe korralduse ja doktorandi juhendamise teemadel
2010-01-01
Küsimusele vastavad Swedbank Eesti infotehnoloogia projektijuht Kairi Ütsmüts, Aspiro Eesti müügijuht Allan Rosenberg, Uuskasutuskeskuse tegevjuht Katriin Jüriska, Tele2 toote- ja turundusjuht Reilika Ilp, GrabCAD'i omanik ja insener Indrek Narusk ning turismifirma Estfly omanik Vahur Mäe
International Nuclear Information System (INIS)
Jubeli, Y.; Al-Hilal, M.; Al-Ali, A.
1998-06-01
A combination of several exploration techniques was carried out at the main phosphatic outcrop of Ain Laylon in the Syrian coastal region. The survey was extended along an E-W profile parallel to Wadi Al-Mzeraa over a distance of about 23 km from Ain Laylon site towards the shoreline of the Mediterranean Sea. The techniques used in this survey included soil radon emanometry, gamma ray spectrometry and soil geochemistry, with the purpose of evaluating the effects of weathering and erosion on the uranium-hearing phosphate formations in the study ares. Soil radon concentration and gamma ray total count rates found to be ranging between 115-472 pCi/l and 52-520 cps over the main phosphate deposit of Ain Layton and between 16-241 pCi/l and 15-300 cps along the profile of Wadi Al-Mzeraa - Rwemiyeh respectively. Some suitable elements such as U, Zn, Pb, Cr, Fe and Sr were also analyzed to trace the dispersion pattern of uranium and its controls throughout the area. The results showed that the distribution of both radon emission and gamma ray activity, in accordance with chemical uranium and some associated trace elements, were almost identical over the study area. The anomalously high values in all cases were basically found to be related to the main phosphatic outcrop and to the reprecipitation processes at their vicinity following the alteration of the phosphates. The prevailing topographic conditions of the drainage system has probably played a crucial role in carrying the uraniferous solutions from its phosphatic source down to the nearby sedimentary environment. This appears to be sufficient enough to produce an anomalous halo resulting in the detection of some relatively high radon and gamma values of about 7 and 15 times the background respectively, especially close to the main phosphate outcrop. A notable gradual decrease was then observed at the following sampling sites along the pathway west of Ain Laylon site approaching the background level at a distance of
Wang, Lu; Zhang, Chunxi; Gao, Shuang; Wang, Tao; Lin, Tie; Li, Xianmu
2016-12-07
The stability of a fiber optic gyroscope (FOG) in measurement while drilling (MWD) could vary with time because of changing temperature, high vibration, and sudden power failure. The dynamic Allan variance (DAVAR) is a sliding version of the Allan variance. It is a practical tool that could represent the non-stationary behavior of the gyroscope signal. Since the normal DAVAR takes too long to deal with long time series, a fast DAVAR algorithm has been developed to accelerate the computation speed. However, both the normal DAVAR algorithm and the fast algorithm become invalid for discontinuous time series. What is worse, the FOG-based MWD underground often keeps working for several days; the gyro data collected aboveground is not only very time-consuming, but also sometimes discontinuous in the timeline. In this article, on the basis of the fast algorithm for DAVAR, we make a further advance in the fast algorithm (improved fast DAVAR) to extend the fast DAVAR to discontinuous time series. The improved fast DAVAR and the normal DAVAR are used to responsively characterize two sets of simulation data. The simulation results show that when the length of the time series is short, the improved fast DAVAR saves 78.93% of calculation time. When the length of the time series is long ( 6 × 10 5 samples), the improved fast DAVAR reduces calculation time by 97.09%. Another set of simulation data with missing data is characterized by the improved fast DAVAR. Its simulation results prove that the improved fast DAVAR could successfully deal with discontinuous data. In the end, a vibration experiment with FOGs-based MWD has been implemented to validate the good performance of the improved fast DAVAR. The results of the experience testify that the improved fast DAVAR not only shortens computation time, but could also analyze discontinuous time series.
Directory of Open Access Journals (Sweden)
Lu Wang
2016-12-01
Full Text Available The stability of a fiber optic gyroscope (FOG in measurement while drilling (MWD could vary with time because of changing temperature, high vibration, and sudden power failure. The dynamic Allan variance (DAVAR is a sliding version of the Allan variance. It is a practical tool that could represent the non-stationary behavior of the gyroscope signal. Since the normal DAVAR takes too long to deal with long time series, a fast DAVAR algorithm has been developed to accelerate the computation speed. However, both the normal DAVAR algorithm and the fast algorithm become invalid for discontinuous time series. What is worse, the FOG-based MWD underground often keeps working for several days; the gyro data collected aboveground is not only very time-consuming, but also sometimes discontinuous in the timeline. In this article, on the basis of the fast algorithm for DAVAR, we make a further advance in the fast algorithm (improved fast DAVAR to extend the fast DAVAR to discontinuous time series. The improved fast DAVAR and the normal DAVAR are used to responsively characterize two sets of simulation data. The simulation results show that when the length of the time series is short, the improved fast DAVAR saves 78.93% of calculation time. When the length of the time series is long ( 6 × 10 5 samples, the improved fast DAVAR reduces calculation time by 97.09%. Another set of simulation data with missing data is characterized by the improved fast DAVAR. Its simulation results prove that the improved fast DAVAR could successfully deal with discontinuous data. In the end, a vibration experiment with FOGs-based MWD has been implemented to validate the good performance of the improved fast DAVAR. The results of the experience testify that the improved fast DAVAR not only shortens computation time, but could also analyze discontinuous time series.
Laevade erinevate soetamisviiside kommertstingimuste võrdlev analüüs / Ain Eidast, Allan Kivi
Eidast, Ain, 1939-2013
2005-01-01
Laevade erinevate soetamisviiside analüüs näitab, et ühtse, kõikidele osapooltele vastuvõetavate tingimuste väljatöötamine ja rakendamine ei ole tehniliselt võimalik ning majanduslikult õigustatud. Tabelid. Diagrammid
Observation, Inference, and Imagination: Elements of Edgar Allan Poe's Philosophy of Science
Gelfert, Axel
2014-03-01
Edgar Allan Poe's standing as a literary figure, who drew on (and sometimes dabbled in) the scientific debates of his time, makes him an intriguing character for any exploration of the historical interrelationship between science, literature and philosophy. His sprawling `prose-poem' Eureka (1848), in particular, has sometimes been scrutinized for anticipations of later scientific developments. By contrast, the present paper argues that it should be understood as a contribution to the raging debates about scientific methodology at the time. This methodological interest, which is echoed in Poe's `tales of ratiocination', gives rise to a proposed new mode of—broadly abductive—inference, which Poe attributes to the hybrid figure of the `poet-mathematician'. Without creative imagination and intuition, Science would necessarily remain incomplete, even by its own standards. This concern with imaginative (abductive) inference ties in nicely with his coherentism, which grants pride of place to the twin virtues of Simplicity and Consistency, which must constrain imagination lest it degenerate into mere fancy.
2007-01-01
Eripedagoogide vestlusringis osalevad: Tartu Ülikooli eripedagoogika osakonna juhataja Kaja Plado, emeriitdotsent pedagoogikadoktor Karl Karlep, Tartu Kroonuaia Kooli direktor Ain Ostrat ja õppealajuhataja Meelike Maila, Tartu Hiie Kooli õppealajuhataja Hene Binsol ning Tartu Nõustamis- ja õpiabi keskuse juhataja Ana Kontor
International Nuclear Information System (INIS)
Kattan, Z.
2003-01-01
This work is an attempt to estimate the mean residence time of groundwater in the Ain Al-Tanour and Ain-Samak, which are the major karst springs in the Upper Orontes Basin (Central Syria). This estimate, which consists on the application of a mathematical modeling approach, was based on the use of tritium, as a natural radioisotope tracer and a tool for ground water age dating. By adopting a completely mixed reservoir model, linked with exponential time distribution function, the mean residence time (turnover time) of these two springs was evaluated to be about 50 years. This result is in good agreement with previous estimation obtained for the Figeh main spring, which belongs to the same aquifer (Cenomanian-Turonian complex) in the Damascus Basin. On the basis of this evaluation, a value of about 800 million m 3 was obtained for the maximum groundwater reservoir size
Element distribution and noble gas isotopic abundances in lunar meteorite Allan Hills A81005
International Nuclear Information System (INIS)
Kraehenbuehl, U.; Eugster, O.; Niedermann, S.
1986-01-01
Antarctic meteorite ALLAN HILLS A81005, an anorthositic breccia, is recognized to be of lunar origin. The noble gases in this meteorite were analyzed and found to be solar-wind implanted gases, whose absolute and relative concentrations are quite similar to those in lunar regolith samples. A sample of this meteorite was obtained for the analysis of the noble gas isotopes, including Kr(81), and for the determination of the elemental abundances. In order to better determine the volume derived from the surface correlated gases, grain size fractions were prepared. The results of the instrumental measurements of the gamma radiation are listed. From the amounts of cosmic ray produced noble gases and respective production rates, the lunar surface residence times were calculated. It was concluded that the lunar surface time is about half a billion years
2008-01-01
Vastavad restoranklubi Atlantis tegevjuht Olga Aasav, ametiühingute keskliidu osakonnajuhataja Arno Arukuusk, AS Estiko Investeeringud juhataja Ain Tammvere, Tartu Ülikooli ametiühingu esimees Aleksander Jakobson, AS Samelin tegevdirektor Leida Kikka, AS Enics Eesti tegevjuht Kalle Kuusik, personalispetsialist Lea Oras ja Tartu Tarbijate Kooperatiivi juhatuse esimees Tarmo Punger
Abou Zakhem, Boulos; Kattaa, Bassam
2017-10-01
The effects of climate change and overexploitation are being strongly perceived in the studied area and the springs discharge is obviously affected. In this paper, Ras El Ain spring discharge and precipitation were analyzed by normalized methods on an yearly timescale. The deficit of Ras El Ain spring discharge due to overexploitation factors and drought effects was estimated. Cumulative drought analyses were carried out using SPI10 and SQI10. Finally, the decreasing trends of the spring discharge due to the deficiency in rainfall were analyzed. The main results reveal that the annual mean deficit of Ras El Ain spring discharge due to overpumping was between 32 and 45%, whereas, annual mean deficit related to drought was between 22 and 35% on average, during the last 30 years (post-1984). The moving averages of SPI and SQI delineate very well the drought periods during last three decades. The cumulative droughts using SPI10 and SQI10 reveal that wet period (pre-1984) with positive values was characterized by high precipitation and spring discharge. Overexploitation period (1984-1989) is distinguished by decreasing SQI10 values whereas, SPI10 is almost stable. The response of the karst system to the precipitation signal has been changed, during the drought period (1990-2000), and the spring behaviour has been modified due to the first overexploitation period. Finally, overexploitation period (2001-2008) is related to the second phase of groundwater intensive pumping for irrigation purposes. Consequently, this period is completely catastrophic causing the drying up of the spring. The decreasing trends analyzed using DPI and DQI showed annual decreasing rates relative to the mean values of -0.268% and -0.105%, respectively. Thus, the results of theoretical model reveal that precipitation will decrease by about DPI = -20.7% and the discharge will decline by about -9.2% by 2050. Consequently, the declining discharge due to climatic variation under natural conditions as
THE DEAD-LIVING-MOTHER: MARIE BONAPARTE'S INTERPRETATION OF EDGAR ALLAN POE'S SHORT STORIES.
Obaid, Francisco Pizarro
2016-06-01
Princess Marie Bonaparte is an important figure in the history of psychoanalysis, remembered for her crucial role in arranging Freud's escape to safety in London from Nazi Vienna, in 1938. This paper connects us to Bonaparte's work on Poe's short stories. Founded on concepts of Freudian theory and an exhaustive review of the biographical facts, Marie Bonaparte concluded that the works of Edgar Allan Poe drew their most powerful inspirational force from the psychological consequences of the early death of the poet's mother. In Bonaparte's approach, which was powerfully influenced by her recognition of the impact of the death of her own mother when she was born-an understanding she gained in her analysis with Freud-the thesis of the dead-living-mother achieved the status of a paradigmatic key to analyze and understand Poe's literary legacy. This paper explores the background and support of this hypothesis and reviews Bonaparte's interpretation of Poe's most notable short stories, in which extraordinary female figures feature in the narrative.
Directory of Open Access Journals (Sweden)
Derdour Abdessamed
2018-03-01
Full Text Available Ain Sefra is one of the Algerian cities that had been experienced several devastating floods during the past 100 years. The purpose of this study is to simulate runoff in the semi-arid region of Ain Sefra watershed through the employing of the Hydrologic Engineering Center – Hydrologic Modelling System (HEC-HMS. In this paper, the frequency storm is used for the meteorological model, the Soil Conservation Service – curve number (SCS-CN is selected to calculate the loss rate and Soil Conservation Service unit hydrograph method have been applied to simulate the runoff rate. After calibration and validation, the simulated peak discharges were very close with observed values. The Nash–Sutcliffe efficiency coefficient was 0.95, indicates that the hydrological modeling results are satisfactory and accepted for simulation of rainfall-runoff. The peak discharges obtained for the 10, 50, 100 and 1000 year storms are respectively 425.8, 750.5, 904.3 and 1328.3 m3∙s−1.
Analysis of Urban Expansion of the Resort City of Al Ain Using Remote Sensing and GIS
Issa, S.; Al Shuwaihi, A.
2009-12-01
The urban growth of AL Ain city has been investigated using remote sensing data for three different dates, 1972, 1990 and 2000. We used three Landsat images together with socio-economic data in a post-classification analysis to map the spatial dynamics of land use/cover changes and identify the urbanization process in Al Ain resort city, United Arab Emirates. Land use/cover statistics, extracted from Landsat Multi-spectral Scanner (MSS). Thematic Mapper (TM) and Enhanced Thematic Mapper plus (ETM +) images for 1972. 1990 and 2000 respectively, revealed that the built-up area has expanded by about 170.53km2. The city was found to have a tendency for major expansion in four different directions: along the Abu Dhabi highway, along Dubai highway, Myziad direction and Hafeet recreational area. Expansion in any direction was found to be governed by the availability of road network, suitability for construction, utilities, economic activities, geographical constraints, and legal factors (boundary with Sultanate of Oman). The road network in particular has influenced the spatial patterns and structure of urban development, so that the expansion of the built-up areas has assumed an accretive as well as linear growth along the major roads. The research concludes that the development is based on conservation of agricultural areas (oases) and reclamation of the desert for farming and agricultural activities. The integration of remote sensing and GIS was found to be effective in monitoring LULC changes and providing valuable information necessary for planning and research.
International Nuclear Information System (INIS)
Bienk, E.J.; Mikkelsen, N.J.
1997-01-01
Two methods of surface improvement widely used in the modern plastics industry are compared, with a view to improving productivity and product quality. Ion implantation of plastics and physical vapour deposition coatings both offer surface engineering advantages. Each method is described and evaluated with reference to plastics moulding. TiAIN coatings are used to protect hard bulk materials, subjected to evenly distributed loads. The more ductile CrN coatings are used for softer materials which give less support to the coatings. (UK)
Jänes, Tea
2007-01-01
Intervjuu tudengite igasuvise hääletusvõistluse "Kas tunned maad VII" kolmanda koha omanikega Tartu Ülikooli keskkonnatehnoloogia magistrandi Tea Jänese ja Luua Metsanduskoolis loodusretkede juhi ametit õppiva Allan Kahariga
Lellep, Kaili
2010-01-01
Aine või toote määratlemisest toiduna, kosmeetikatootena, meditsiiniseadmena, ravimina. Määratlustest Eestis ja nende vastavusest Euroopa Liidu õigusega, määratluste tagajärgedest, ettepanekutest vastuolulise õigusakti muutmiseks
Evaluation of the clinical maxim: "If it ain't broke, don't fix it".
Howell-Duffy, Chris; Hrynchak, Patricia K; Irving, Elizabeth L; Mouat, Graham S V; Elliott, David B
2012-01-01
A significant number of patients return to optometric practice dissatisfied with their spectacles. An important question is whether any of these cases are preventable. There are several different clinical maxims that are used to modify the subjective refraction when determining the refractive prescription. These maxims aim to improve patient comfort and adaptation and thereby reduce patient dissatisfaction with new spectacles. They are not based on research evidence, but rather on expert opinion gained from clinical experience. The aim of this study was to retrospectively analyze a large number of case records of dissatisfied patients to assess the possible usefulness of the prescribing maxim "if it ain't broke, don't fix it." Three hundred eighteen non-tolerance cases from a university-based Canadian optometric clinic were categorized by a focus group of optometrists. Three prescribing categories were defined and comprised cases in which application of the proposed maxim may have prevented the recheck eye examination; a more limited application of the maxim for one working distance may have been appropriate; and finally scenarios in which the maxim did not work in that the practitioner was judged to have initially followed the maxim, yet patient dissatisfaction was still reported. The remaining unallocated records comprised prescribing situations outside the scope of this study. Approximately 32% of non-tolerance cases were judged to have been preventable by use of the proposed maxim. Furthermore, an additional 10% reduction in recheck cases may have been possible by a more liberal interpretation of the maxim. Conversely, 4% of cases were deemed to comprise scenarios in which the maxim was followed yet the patient returned later to report problems with their spectacles. The prescribing maxim "if it ain't broke, don't fix it" appears to have a role in reducing recheck eye examinations and improving patient satisfaction with new spectacles.
Directory of Open Access Journals (Sweden)
Didaoui Hayat
2018-03-01
Full Text Available Background and aims: The aim of the current study was to assess the impact of environmental factors; food, socio-economic, and physical activity, on a group of obese children living in Ain-Defla (Center Algeria and Sidi-Bel-Abbes (West Algeria.
Directory of Open Access Journals (Sweden)
Rosa Maria Garcia Camin
2015-03-01
Conclusiones: El tratamiento con IECA, ARA II, diuréticos y/o AINES presenta elevada incidencia de ingreso por FRA, siendo los diuréticos en monoterapia, doble y triple terapia combinada los que ocasionan la mayor incidencia. El FRAETW supone elevados costes sanitarios y muertes evitables.
NAS FRONTEIRAS ENTRE RAZÃO E DESRAZÃO: UMA LEITURA DE “O GATO PRETO” DE EDGAR ALLAN POE
Directory of Open Access Journals (Sweden)
Carla Alexandra Ferreira
2014-12-01
Full Text Available Known for his macabre and mysterious short stories as well as by his detective stories, Edgar Allan Poe (1809-1849 has a controversial as well as important position among his contemporaries. The objective of this article is to investigate through the reading of one of his most popular stories, “The Black Cat” (1843 how the theme of a subtle line between reason and madness is shown in the short story. Having uncertainty as its unity of effect, this story dialogs with Michel Foucault’s ideas about reason and madness and also with the current thoughts about American literature formation.
TEM and XANES study of MOVPE grown InAIN layers with different indium content
International Nuclear Information System (INIS)
Kret, S; Wolska, A; Klepka, M T; Letrouit, A; Ivaldi, F; Szczepańska, A; Carlin, J-F; Kaufmann, N A K; Grandjean, N
2011-01-01
We present structure and spatially resolved composition studies by TEM (Transmission Electron Microscopy) and XANES (X-ray Absorption Near Edge Structure) of InAIN MOVPE (Metal-Organic Vapor Phase Epitaxy) epilayers containing 16-27 at% of indium. Investigations of the In L 3 edge by synchrotron radiation absorption show a significant change of the post-edge structure depending on the indium content. We attribute this to the solubility limit and phase separation in this system. Our measurements suggest that the critical composition is 18% for our growth conditions. HRTEM cross-sectional and EDX investigations confirm such phase separation as well as the changing of the structure from 2D growth to columnar like growth for the sample with the highest indium content.
2007-01-01
Eesti Koolijuhtide Ühenduse 17. aastakonverentsist teemal "Õppiv koolijuht". Küsimustele vastavad direktorid: Martin Kaasik (Tallinna Laagna Gümnaasium, Eesti Koolijuhtide Ühenduse üks asutaja), Jaan Reinson (Tartu Descartes'i Lütseum), Raimu Pruul (Häädemeeste Keskkool), Raivo Heinaru (Kohila Gümnaasium), Senta Room (Muhu Põhikool)
Application of the Allan Variance to Time Series Analysis in Astrometry and Geodesy: A Review.
Malkin, Zinovy
2016-04-01
The Allan variance (AVAR) was introduced 50 years ago as a statistical tool for assessing the frequency standards deviations. For the past decades, AVAR has increasingly been used in geodesy and astrometry to assess the noise characteristics in geodetic and astrometric time series. A specific feature of astrometric and geodetic measurements, as compared with clock measurements, is that they are generally associated with uncertainties; thus, an appropriate weighting should be applied during data analysis. In addition, some physically connected scalar time series naturally form series of multidimensional vectors. For example, three station coordinates time series X, Y, and Z can be combined to analyze 3-D station position variations. The classical AVAR is not intended for processing unevenly weighted and/or multidimensional data. Therefore, AVAR modifications, namely weighted AVAR (WAVAR), multidimensional AVAR (MAVAR), and weighted multidimensional AVAR (WMAVAR), were introduced to overcome these deficiencies. In this paper, a brief review is given of the experience of using AVAR and its modifications in processing astrogeodetic time series.
O que o cinema aprendeu com Edgar Allan Poe: (e o que a literatura ainda aprende com o cinema
Directory of Open Access Journals (Sweden)
Gerbase, Carlos
2009-01-01
Full Text Available Edgar Allan Poe é um dos autores mais adaptados pelo cinema em todos os tempos. Há quase 200 filmes baseados ou inspirados em obras de Poe. Este ensaio analisa os motivos da fascinação que Poe exerce sobre o mundo do cinema, a partir de um ensaio do realizador e teórico Jean Epstein, publicado em 1921, e de reflexões mais recentes de Umberto Eco sobre traduções e adaptações. As semelhanças e diferenças entre as linguagens literária e cinematográfica também são abordadas, na perspectiva pragmática do processo de realização
Management of toxic cyanobacteria for drinking water production of Ain Zada Dam.
Saoudi, Amel; Brient, Luc; Boucetta, Sabrine; Ouzrout, Rachid; Bormans, Myriam; Bensouilah, Mourad
2017-07-01
Blooms of toxic cyanobacteria in Algerian reservoirs represent a potential health problem, mainly from drinking water that supplies the local population of Ain Zada (Bordj Bou Arreridj). The objective of this study is to monitor, detect, and identify the existence of cyanobacteria and microcystins during blooming times. Samples were taken in 2013 from eight stations. The results show that three potentially toxic cyanobacterial genera with the species Planktothrix agardhii were dominant. Cyanobacterial biomass, phycocyanin (PC) concentrations, and microcystin (MC) concentrations were high in the surface layer and at 14 m depth; these values were also high in the treated water. On 11 May 2013, MC concentrations were 6.3 μg/L in MC-LR equivalent in the drinking water. This study shows for the first time the presence of cyanotoxins in raw and treated waters, highlighting that regular monitoring of cyanobacteria and cyanotoxins must be undertaken to avoid potential health problems.
Directory of Open Access Journals (Sweden)
Augusto César Dias de Araujo
2010-09-01
Full Text Available Este artigo é uma reflexão sobre o processo de formação identitária do espiritismo a partir da análise de seu discurso fundador presente na obra de Allan Kardec (1804-1869. Para cumprir este objetivo, trabalhar-se-á com a hipótese de que tal processo acontece a partir de uma peculiar interação do espiritismo com três instâncias de conhecimento: a ciência, a filosofia e a religião. Através da análise do exemplo específico de como o espiritismo interpreta elementos da tradição cristã-católica, dando-lhes um significado renovado, pretende-se demonstrar que neste jogo, o conceito de espiritismo se configura como um conceito híbrido, de caráter polissêmico, o qual aponta para o fato de que a nova doutrina e o movimento articulado em seu entorno nascem sob o signo da mediação. Tais reflexões indicariam que, ao fazerem referência à obra de Kardec como núcleo imaginário de identificação doutrinária, grupos das diversas tendências dentro do espiritismo contemporâneo podem encontrar relativas zonas de conforto para seu progressivo desenvolvimento. Palavras-chave: Espiritismo; Ciência; Filosofia; Religião; Fronteiras. Abstract This paper is a reflection about the identity formation process of spiritism from analysis of its founding speech present in Allan Kardec's work (1804-1869. To fulfill this aim, one will work with the hypothesis of that such process happens from a peculiar interaction of the spiritism with three instances of knowledge: the science, the philosophy and the religion. Through the analysis of the specific example of as the spiritism interprets elements of the Christian-catholic tradition, giving to them one renewed meaning, is intended to demonstrate that in this game, the spiritism concept if configures as a hybrid concept, of polissemic character, which points with respect to the fact of that the new doctrine and the movement articulated in its around are born under the sign of the mediation. Such
Method and Madness: An Analysis of Edgar Allan Poe's “The Bells”
Directory of Open Access Journals (Sweden)
U. Marie Engemann
2017-11-01
Full Text Available In this article, U. Marie Engemann has tried to indicate the method and internal cohesion of “The Bells”: a poem by Edgar Allan Poe, regardless of its apparent madness. This poem consists of four stanzas each of which is a symbol of a stage in the human's life for which a specific bell has been dedicated to. This poem follows trochaic meter in which the poet ingeniously has used catalexis in order to imitate the chime of bells. Throughout the poem, he has used different sound devices such as rhyme, sound patterning, alliteration, and onomatopoeia to create parallelism, and accordingly, he has conformed the chime of the bells to the dominant feature of each stage of life; thus, a meaningful cohesion has been created. This article can show how a poet may use different sound devices of his own language to create a parallelism between sound symbolism and meaning. The structure of the article has been changed a little by inserting the figures and the tables in the appendices into its straight text in translation so that it becomes easier for the readers to make a link between discussions and the data presented in each figure or table.
Twenty-Five Years of Applications of the Modified Allan Variance in Telecommunications.
Bregni, Stefano
2016-04-01
The Modified Allan Variance (MAVAR) was originally defined in 1981 for measuring frequency stability in precision oscillators. Due to its outstanding accuracy in discriminating power-law noise, it attracted significant interest among telecommunications engineers since the early 1990s, when it was approved as a standard measure in international standards, redressed as Time Variance (TVAR), for specifying the time stability of network synchronization signals and of equipment clocks. A dozen years later, the usage of MAVAR was also introduced for Internet traffic analysis to estimate self-similarity and long-range dependence. Further, in this field, it demonstrated superior accuracy and sensitivity, better than most popular tools already in use. This paper surveys the last 25 years of progress in extending the field of application of the MAVAR in telecommunications. First, the rationale and principles of the MAVAR are briefly summarized. Its adaptation as TVAR for specification of timing stability is presented. The usage of MAVAR/TVAR in telecommunications standards is reviewed. Examples of measurements on real telecommunications equipment clocks are presented, providing an overview on their actual performance in terms of MAVAR. Moreover, applications of MAVAR to network traffic analysis are surveyed. The superior accuracy of MAVAR in estimating long-range dependence is emphasized by highlighting some remarkable practical examples of real network traffic analysis.
Antiinflamatorios no esteroideos (AINES.: Consideraciones para su uso estomatológico
Directory of Open Access Journals (Sweden)
Andrés A. Pérez Ruiz
2002-08-01
Full Text Available Se realiza una revisión extensa y actualizada sobre los antiinflamatorios no esteroideos (AINEs, con el fin de actualizar al estomatólogo en su uso. Para ello se revisan aspectos importantes del proceso inflamatorio en estructuras de la boca que como las pulpitis, presentan sus peculiaridades. Se identifica a una de las 2 familias de autacoides provenientes de los fosfolípidos de membrana celular, es decir, los eicosanoides derivados a partir de algunos ácidos grasos polisaturados, en particular, ácido araquidónico, que tras la acción de enzimas da lugar a la formación de prostaglandinas, prostaciclinas, tromboxeno A2 y leucotrienos. Conocidos estos antecedentes, nos ocupamos de fármacos usados para combatir los síntomas y signos de la inflamación. Casi todos los antiinflamatorios no esteroideos utilizados en la actualidad, casi todos, inhiben las actividades de la ciclooxigenasa 1 constitutiva y la ciclooxigenasa 2, inducida en el sitio de la inflamación y con ello, la síntesis de prostaglandinas y tromboxanos. Se alude a la ventaja terapéutica de los inhibidores de la COX-2 que aparecen hoy en el mercado. Se expone las dosis y frecuencias de los AINEs, sus interacciones, así como las reacciones adversas al medicamento y contraindicaciones, y se proponen aquellos que son de interés en la práctica estomatológica.Non-steroidal anti-inflammatory drugs. Considerations about their dental use. An extensive updated review of non-steroidal anti-inflammatory agents (NSAIN was made to give an updated information to the dentist about their use. To this purpose, important aspects of the inflammatory process in mouth structures like pulpitis that present with their own peculiarities are reviewed. We identified one of the two autacoid families from cell membrane phospholipids, that is, eicosanoids derived from some polysaturated fatty acids, in particular, arachidonic acid, which, after the action of enzymes, give rise to the formation of
Directory of Open Access Journals (Sweden)
Christine M Armour
Full Text Available Mutations in the thyroid hormone (TH transporter MCT8 have been identified as the cause for Allan-Herndon-Dudley Syndrome (AHDS, characterized by severe psychomotor retardation and altered TH serum levels. Here we report a novel MCT8 mutation identified in 4 generations of one family, and its functional characterization.Proband and family members were screened for 60 genes involved in X-linked cognitive impairment and the MCT8 mutation was confirmed. Functional consequences of MCT8 mutations were studied by analysis of [125I]TH transport in fibroblasts and transiently transfected JEG3 and COS1 cells, and by subcellular localization of the transporter.The proband and a male cousin demonstrated clinical findings characteristic of AHDS. Serum analysis showed high T3, low rT3, and normal T4 and TSH levels in the proband. A MCT8 mutation (c.869C>T; p.S290F was identified in the proband, his cousin, and several female carriers. Functional analysis of the S290F mutant showed decreased TH transport, metabolism and protein expression in the three cell types, whereas the S290A mutation had no effect. Interestingly, both uptake and efflux of T3 and T4 was impaired in fibroblasts of the proband, compared to his healthy brother. However, no effect of the S290F mutation was observed on TH efflux from COS1 and JEG3 cells. Immunocytochemistry showed plasma membrane localization of wild-type MCT8 and the S290A and S290F mutants in JEG3 cells.We describe a novel MCT8 mutation (S290F in 4 generations of a family with Allan-Herndon-Dudley Syndrome. Functional analysis demonstrates loss-of-function of the MCT8 transporter. Furthermore, our results indicate that the function of the S290F mutant is dependent on cell context. Comparison of the S290F and S290A mutants indicates that it is not the loss of Ser but its substitution with Phe, which leads to S290F dysfunction.
Armour, Christine M; Kersseboom, Simone; Yoon, Grace; Visser, Theo J
2015-01-01
Mutations in the thyroid hormone (TH) transporter MCT8 have been identified as the cause for Allan-Herndon-Dudley Syndrome (AHDS), characterized by severe psychomotor retardation and altered TH serum levels. Here we report a novel MCT8 mutation identified in 4 generations of one family, and its functional characterization. Proband and family members were screened for 60 genes involved in X-linked cognitive impairment and the MCT8 mutation was confirmed. Functional consequences of MCT8 mutations were studied by analysis of [125I]TH transport in fibroblasts and transiently transfected JEG3 and COS1 cells, and by subcellular localization of the transporter. The proband and a male cousin demonstrated clinical findings characteristic of AHDS. Serum analysis showed high T3, low rT3, and normal T4 and TSH levels in the proband. A MCT8 mutation (c.869C>T; p.S290F) was identified in the proband, his cousin, and several female carriers. Functional analysis of the S290F mutant showed decreased TH transport, metabolism and protein expression in the three cell types, whereas the S290A mutation had no effect. Interestingly, both uptake and efflux of T3 and T4 was impaired in fibroblasts of the proband, compared to his healthy brother. However, no effect of the S290F mutation was observed on TH efflux from COS1 and JEG3 cells. Immunocytochemistry showed plasma membrane localization of wild-type MCT8 and the S290A and S290F mutants in JEG3 cells. We describe a novel MCT8 mutation (S290F) in 4 generations of a family with Allan-Herndon-Dudley Syndrome. Functional analysis demonstrates loss-of-function of the MCT8 transporter. Furthermore, our results indicate that the function of the S290F mutant is dependent on cell context. Comparison of the S290F and S290A mutants indicates that it is not the loss of Ser but its substitution with Phe, which leads to S290F dysfunction.
Alvela, Ain, 1967-
2011-01-01
Spetsiaalsed jõulutooted aitavad aasta lõpul suurendada toiduainetööstuste käivet. ASi Atria Eesti müügi- ja turundusdirektori Margus Masingu, ASi Fazer Eesti juhatuse esimehe Kristjan Kongo ja ASi Salvest turundusdirektori Ain Nõlvaku kommentaare
Caraban Gonzalez, Noemi
2018-01-01
Madame Olga Givernet Députée 3ème circonscription de l’Ain. Participants CERN, Signature du livre d’or. M. Frédérick Bordry Directeur des accélérateurs et de la technologie Mme Fabiola Gianotti Directrice générale
Lepik, Kerli, 1989-
2013-01-01
Suures koguses narkootilise ja psühhotroopse aine käsitlemisest, suure varalise kasu saamise eesmärgist, võrdlus teiste Euroopa riikidega (EL, Läti, Leedu, Soome, Norra, Tšehhi), suurest varalisest kasust kui koosseisutunnusest ja alternatiividest
Application of electrical geophysics to the release of water resources, case of Ain Leuh (Morocco)
Zitouni, A.; Boukdir, A.; El Fjiji, H.; Baite, W.; Ekouele Mbaki, V. R.; Ben Said, H.; Echakraoui, Z.; Elissami, A.; El Maslouhi, M. R.
2018-05-01
Being seen needs in increasing waters in our contry for fine domestics, manufactures and agricultural, the prospecting of subterranean waters by geologic and hydrogeologic classic method remains inaplicable in the cases of the regions where one does not arrange drillings or polls (soundings) of gratitude (recongnition) in very sufficient (self-important) number. In that case of figure, the method of prospecting geophysics such as the method of nuclear magnetic resonance (NMR) and the method of the geophysics radar are usually used most usually because they showed, worldwide, results very desive in the projects of prospecting and evaluation of the resources in subterranean waters. In the present work, which concerns only the methodology of the electric resistivity, we treat the adopted methodological approach and the study of the case of application in the tray of Ajdir Ain Leuh.
The Allan Burns mummies: A history and future prospect of an anatomical collection
Directory of Open Access Journals (Sweden)
J Lee
2017-01-01
Full Text Available Acquiring adequate resources for anatomy education has represented a challenge throughout the discipline's long history. A significant number of collections housed in anatomy departments contain human tissue of unknown provenance with some obtained in morally dubious ways. This paper outlines the history and future prospects of one such anatomical assemblage – the Burns Anatomical Collection, currently housed at the University of Maryland (UM. The collection originally contained more than 1000 anatomically prepared mummified human remains. They were produced by the renowned Scottish anatomist Allan Burns in Glasgow in the late eighteenth and early nineteenth centuries. The prepared cadavers became a commodity and after Burns' death, were acquired by his pupil Granville Pattison, who later sold them to the UM. While the origin of these human remains is unknown, historical data suggests that most of the cadavers for the collection were obtained through grave robbing. While intensely used in anatomy teaching in the nineteenth century, specimens from the collection should now be treated primarily as historical artifacts, appropriate only for teaching medical history and ethics. Other perspectives may include repatriating and reburying the human remains and providing a memorial service. Most importantly, this collection and others similar to it should initiate dialog and reflection on the ethical aspects of the past and present medical practice.
Water-rock interaction and geochemistry of groundwater from the Ain Azel aquifer, Algeria.
Belkhiri, Lazhar; Mouni, Lotfi; Tiri, Ammar
2012-02-01
Hydrochemical, multivariate statistical, and inverse geochemical modeling techniques were used to investigate the hydrochemical evolution within the Ain Azel aquifer, Algeria. Cluster analysis based on major ion contents defined 3 main chemical water types, reflecting different hydrochemical processes. The first group water, group 1, has low salinity (mean EC = 735 μS/cm). The second group waters are classified as Cl-HCO(3)-alkaline earth type. The third group is made up of water samples, the cation composition of which is dominated by Ca and Mg with anion composition varying from dominantly Cl to dominantly HCO(3) plus SO(4). The varifactors obtained from R-mode FA indicate that the parameters responsible for groundwater quality variations are mainly related to the presence and dissolution of some carbonate, silicate, and evaporite minerals in the aquifer. Inverse geochemical modeling along groundwater flow paths indicates the dominant processes are the consumption of CO(2), the dissolution of dolomite, gypsum, and halite, along with the precipitation of calcite, Ca-montmorillonite, illite, kaolinite, and quartz. © Springer Science+Business Media B.V. 2011
Mechergui, M. Mohamed; Henda Saoudi, Mme
2016-04-01
This study aims to assess the impact of water harvesting constructed hydraulic structures (big and small dams, terraces, seuils for recharge…) on the evolution of piezometric head of Ain El Beidha groundwater table. The measurements of depth of water table, taken at the end of rain season and at the end of irrigation season, in many piezometers and monitoring wells, for a long period of observation before and after implementation of all the hydraulic structures, were used with the cumulative rain to the highest water table to diagnostic the effect of natural recharge and constructed hydraulic structures. According to the analysis of curves illustrating the evolution of piezometric head and rainfall over time, it was shown that despite the fact that the same amount of rain fall on the total area in the limits of Ain El Beidha groundwater table, the piezometers respond differently. This is because there are many sources of recharge and many factors affecting the recharge. First of all, the aquifer is divided in four compartments (the calcareous formation of Djebel El Houyareb, the plio-quaternary formation, the Miocene formation: Baglia and Saouaf). All those respond differently to the recharge by their capacity of infiltration and their hydrodynamic characteristics. The recharge of the groundwater table was increased by the implementation of small soil and water conservation structures, artificial lakes, El Haouareb Dam, run off in the natural Oued bads and seuils for recharge installed in the bads of oueds. The different piezometric drown maps were used to determine the flow direction and hydraulic gradient in order to identify the recharge areas, while tracking maps for three equal piezometric heads 210 m 300 m and 370 m established over different years made it possible to assess the impact of hydraulic structures, namely the effect of SWC and Ben Zitoun Lake. To illustrate the impact of El Houareb dam on the groundwater, the piezometric maps and local values
Climate change and their consequences on coastal zone of Ain el Turck in Oran
Directory of Open Access Journals (Sweden)
Mohammed Tewfik Bouroumi
2017-12-01
Full Text Available Algeria does not escape the problem of the climate change, its geographical position in zone of transition, and its dry and semi-arid climate, in fact a very vulnerable space. In Algeria, approximately two thirds of the population is concentrated on the coast which represents only 4 % of the territory. The Mediterranean coast, in particular in Algeria, is subjected to pressures: financial stakes, climatic risks, pollutions and conservation of the water. It is on the basis of the critical and objective report with regard to a wild urbanization of the Algerian coast as well as the influence of the demographic pressure that the choice of the search for this article was held. This publication has for objective to raise (to draw up a current situation (inventory of fixtures of the sector of the environment in Algeria and to present through the case of the coastal city of Oran the consequences of climate change. We propose, to review the situation through the case of the municipality of Ain El Türck, by basing itself on data relative to the evolution of the temperatures and the sea level.
Estudio biofarmacéutico de geles antiinflamatorios no esteroideos (AINES
Directory of Open Access Journals (Sweden)
Margarita Restrepo
2000-02-01
Full Text Available
Los antiinflamatorios no esteroideos (AINES son un grupo heterogéneo de compuestos con actividad analgésica, antipirética y antiinflamatoria que comparten efectos secundarios indeseables, tales como: ulceración gástrica e intestinal, anemia, bloqueo de la agregación plaquetaria, inhibición de la motilidad uterina e hipersensibilidad. Los AINES se utilizan por vía tópica con el fin de aliviar lesiones en tejidos blandos a los cuales puede llegarse directamente a través de la piel, evitando así los efectos colaterales indeseables.
Actualmente para la gran mayoría de los medicamentos se exige valorar la Biodisponibilidad como criterio de calidad. Biodisponibilidad se define como la cantidad de fármaco que llega a sangre o plasma después de la administración del medicamento que lo contiene y la velocidad a la cual este proceso ocurre; esta determinación de Biodisponibilidad no resulta útil en el caso de medicamentos que se administran a través de la piel y no alcanzan circulación sistémica; la biodisponibilidad relativa o Bioequivalencia es la comparación de las biodisponibilidades de dos medicamentos para determinar si son similares en su comportamiento farmacocinético dentro del organismo.
El presente trabajo pretende estandarizar y validar un método que permita determinar concentraciones de fármaco en tejidos, en este tipo de medicamentos administrados por vía tópica, que no alcanzan circulación sistémica y por lo tanto no pueden ser cuantificados en sangre o plasma; además pretendemos que esta metodología pueda ser propuesta como una técnica para determinar biodisponibilidad y/o bioequivalencia para este tipo de productos. Para lograr estos objetivos, inicialmente, se induce la inflamación a un grupo
Vitamin D deficiency among healthy adolescents in Al Ain, United Arab Emirates
2013-01-01
Background Although vitamin D deficiency has been studied in various adult populations, there are few data on the prevalence of this nutritional deficiency among healthy adolescents in the United Arab Emirates (UAE). This study was conducted to determine the prevalence of vitamin D deficiency and to examine its correlates in adolescents aged 15 to 18 years. Methods This was a cross-sectional study in urban schools. Healthy adolescents (N=315) from a sample of 8 schools were randomly selected from the 142 schools in Al Ain, Abu Dhabi Emirate. Outcomes measured included serum concentrations of 25-hydroxy vitamin D (25OHD), plasma lipids, blood sugar, blood pressure and anthropometric data, nutrition and lifestyle variables. Results Fourty-one participants (19.7%) were vitamin D deficient (serum 25OHD level ≤15 ng/mL [≤37.5 nmol/L]. Using a cutoff level of 25(OH) D of ≤20 ng/ml [≤50 nmol/l] 143 participants (45.4%) were vitamin D insufficient. Overall 65.1% of study participants were either vitamin D deficient or insufficient. The prevalence of vitamin D deficiency varied between boys (10%) and girls (28%). In a final multivariate model, serum 25(OH) D concentrations were inversely correlated with female gender, consumption of fast food per week, and body mass index and positively correlated with physical activity scores after adjustment for age. Conclusions Vitamin D deficiency and insufficiency were highly prevalent in adolescents, and more common in girls. PMID:23311702
Energy Technology Data Exchange (ETDEWEB)
Montes de Oca, J.; Gonzalez, H. J. [Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada, IPN, Unidad Altamira, Km. 14.5 Carretera Tampico-Puerto industrial Altamira, 89600 Altamira, Tamaulipas (Mexico); Solis, E. [Hy-Teck Fluid Power, Blvd. A. Lopez Mateos No. 310, Col. Nuevo Aeropuerto, 89337 Tampico, Tamaulipas (Mexico); Moreno, J. [Departamento de Ingenieria Metalurgica, Escuela Superior de Ingenieria Quimica e Industrias Extractivas, IPN, UPALM Unidad Zacatenco, 07730 Mexico D. F. (Mexico); Munoz S, J. [Centro de Investigacion y de Estudios Avanzados, Unidad Queretaro, Libramiento Norponiente No. 2000, Fracc. Real de Juriquilla, 76230 Santiago de Queretaro, Queretaro (Mexico)], e-mail: jmontedeocav@ipn.mx
2009-07-01
The present work reports a study to increase wear resistance of a ball passage floodgate (steel type T9) trough the application of a thick film (coating). This study have included a material and process selection, synthesis of the coating on steel plates as substrates and spherical device, assembling of the coated floodgate on the ball valves, and finally an evaluation of the valves in the process of a thermoelectric power station. Taking into account the different requirements, a TiAIN coating prepared by cathodic arc evaporation was finally retained. The crystal structure, morphology and chemical composition of the coating were evaluated by x-ray diffraction (XRD) and scanning electron microscopy equipped with an energy dispersive spectrometer (SEM-EDS). Finally, mechanical properties such as hardness and Young modulus were determined by nano indentation. (Author)
International Nuclear Information System (INIS)
Montes de Oca, J.; Gonzalez, H. J.; Solis, E.; Moreno, J.; Munoz S, J.
2009-01-01
The present work reports a study to increase wear resistance of a ball passage floodgate (steel type T9) trough the application of a thick film (coating). This study have included a material and process selection, synthesis of the coating on steel plates as substrates and spherical device, assembling of the coated floodgate on the ball valves, and finally an evaluation of the valves in the process of a thermoelectric power station. Taking into account the different requirements, a TiAIN coating prepared by cathodic arc evaporation was finally retained. The crystal structure, morphology and chemical composition of the coating were evaluated by x-ray diffraction (XRD) and scanning electron microscopy equipped with an energy dispersive spectrometer (SEM-EDS). Finally, mechanical properties such as hardness and Young modulus were determined by nano indentation. (Author)
Directory of Open Access Journals (Sweden)
Francisco Pizarro Obaid
2012-04-01
Full Text Available El siglo XIX dio lugar a nuevas formas de subjetividad metropolitana que tuvieron en el cuento "El hombre de la multitud", de Edgar Allan Poe, un tratamiento excepcional. Es innegable la relevancia de este relato al interior de su obra, así como su aporte al desarrollo del género narrativo. Sin embargo, el cuento de Poe puede ser considerado, a su vez, como una fuente de notable influencia en la redefinición del concepto de modernidad que Baudelaire plasmará en su obra "El pintor de la vida moderna". Al examinar el personaje anónimo de "El hombre de la multitud" y la singularidad del Sr. G, pintor que da fundamento a la crítica de la tradición pictórica de costumbres, quedará en evidencia como los principales argumentos de Baudelaire sobre el arte y las nuevas formas de habitar la ciudad moderna encuentran en el relato de Poe una significativa fuente de inspiración.The 19th century gave rise to new forms of metropolitan subjectivity with an exceptional treatment in EdgarAllan Poe's tale "TheMan of the Crowd". The relevance of this short story into his work is undeniable, as well as its contribution to the development of the narrative genre. However, Poe's story can be considered as a source of considerable influence in the redefinition of the concept of modernity, that Baudelaire will express in his work "The Painter of Modern Life". In examining the anonymous character of "The Man of the Crowd" and the singularity of Mr. G, the painter who gives substance to the criticism of the pictorial tradition of customs, it grows evident how Baudelaire's main arguments on art and the new ways of life in the modern city find in Poe's short story a significant source of inspiration
Directory of Open Access Journals (Sweden)
B BENRACHI
2002-12-01
Full Text Available La construction d’un édifice de qualité standard et répondant aux exigences techniques est obtenue grâce au développement du savoir-faire et au respect des règles de l’art et de la réglementation en vigueur. Une étude détaillée sur les exigences techniques et le respect de la réglementation d’un logement en collectif nouvellement construit et inhabité à Ain-Smara, nous a montré qu’il y a une satisfaction pour certaines d'entre-elles et une non-conformité pour d’autres. Il en résulte que le degré de satisfaction de ce logement est inférieur à celui recommandé dans le cadre de la réglementation, ce qui diminue sa qualité par rapport au standard exigé.
Associations of cardiovascular risk factors in Al Ain- United Arab Emirates
Directory of Open Access Journals (Sweden)
Nazirudeen Mohammad K
2009-04-01
Full Text Available Abstract Background Over the last 30 years the citizens of the United Arab Emirates have experienced major changes in life-style secondary to increased affluence. Currently, 1 in 5 adults have diabetes mellitus, but the associations (clustering among risk factors, as well as the relevance of the concept of the metabolic syndrome, in this population is unknown. Aim To investigate the prevalence and associations among cardiovascular risk factors in this population, and explore to what extent associations can be explained by the metabolic syndrome according to ATP-III criteria. Method A community based survey, of conventional risk factors for cardiovascular disease was conducted among 817 national residents of Al Ain city, UAE. These factors were fasting blood sugar, blood pressure, lipid profile, BMI, waist circumference, smoking, or CHD family history. Odds ratios between risks factors, both unadjusted and adjusted for age and sex as well as adjusted for age, sex, and metabolic syndrome were calculated. Results Various risk factors were positively associated in this population; associations that are mostly unexplained by confounding by age and sex. For example, hypertension and diabetes were still strongly related (OR 2.5; 95% CI 1.7–3.7 after adjustment. An increased waist circumference showed similar relationship with hypertension (OR 2.3; 95% CI 1.5–3.5. Diabetes was related to an increased BMI (OR 1.5; 96% CI 1.0–2.3. Smoking was also associated with diabetes (OR 1.9, 95% CI 1.0–3.3. Further adjustment for metabolic syndrome reduced some associations but several remained. Conclusion In this population risk-factors cluster, but associations do not appear to be explained by the presence/absence of the ATP-III metabolic syndrome. Associations provide valuable information in planning interventions for screening and management.
Associations of cardiovascular risk factors in Al Ain- United Arab Emirates
Baynouna, Latifa M; Revel, Anthony D; Nagelkerke, Nico JD; Jaber, Tariq M; Omar, Aziza O; Ahmed, Nader M; Nazirudeen, Mohammad K; Al Sayed, Mamdouh F; Nour, Fuad A; Abdouni, Sameh
2009-01-01
Background Over the last 30 years the citizens of the United Arab Emirates have experienced major changes in life-style secondary to increased affluence. Currently, 1 in 5 adults have diabetes mellitus, but the associations (clustering) among risk factors, as well as the relevance of the concept of the metabolic syndrome, in this population is unknown. Aim To investigate the prevalence and associations among cardiovascular risk factors in this population, and explore to what extent associations can be explained by the metabolic syndrome according to ATP-III criteria. Method A community based survey, of conventional risk factors for cardiovascular disease was conducted among 817 national residents of Al Ain city, UAE. These factors were fasting blood sugar, blood pressure, lipid profile, BMI, waist circumference, smoking, or CHD family history. Odds ratios between risks factors, both unadjusted and adjusted for age and sex as well as adjusted for age, sex, and metabolic syndrome were calculated. Results Various risk factors were positively associated in this population; associations that are mostly unexplained by confounding by age and sex. For example, hypertension and diabetes were still strongly related (OR 2.5; 95% CI 1.7–3.7) after adjustment. An increased waist circumference showed similar relationship with hypertension (OR 2.3; 95% CI 1.5–3.5). Diabetes was related to an increased BMI (OR 1.5; 96% CI 1.0–2.3). Smoking was also associated with diabetes (OR 1.9, 95% CI 1.0–3.3). Further adjustment for metabolic syndrome reduced some associations but several remained. Conclusion In this population risk-factors cluster, but associations do not appear to be explained by the presence/absence of the ATP-III metabolic syndrome. Associations provide valuable information in planning interventions for screening and management. PMID:19371412
Kivelä, Tero T
2018-03-01
James Wardrop (1782-1869), a young Scottish surgeon and an early ophthalmologist in Edinburgh, is credited for describing in 1809 retinoblastoma as an entity in his treatise 'Observations on Fungus Haematodes or Soft Cancer'. His treatise also reveals that Allan Burns (1781-1813), another young Scottish surgeon and anatomist, had invited Wardrop to assist in enucleating an eye from a 41-year-old Glasgow woman who, in retrospect, had a uveal melanoma. Her eye had become blind 4 months after symptoms of exudative retinal detachment had appeared, and it had become painful after a further 2-4 months. The tumour eventually perforated the sclera, and she died within a year thereafter of hepatic metastases. Burns and Wardrop went on to publish detailed parallel accounts of the symptoms, signs, ophthalmic pathology and post-mortem findings regarding the primary, recurrent and metastatic tumour. Burns may have performed the post-mortem after exhuming the body, a common occurrence in early 19th Century Scotland, a thriving hub for teaching morbid anatomy to young surgeons at the time. © 2017 Acta Ophthalmologica Scandinavica Foundation. Published by John Wiley & Sons Ltd.
Pediatric and youth traffic-collision injuries in Al Ain, United Arab Emirates: a prospective study.
Grivna, Michal; Eid, Hani O; Abu-Zidan, Fikri M
2013-01-01
To study the mechanism of road traffic collisions (RTC), use of safety devices, and outcome of hospitalized pediatric and youth RTC injured patients so as to give recommendations regarding prevention of pediatric RTC injuries. All RTC injured children and youth (0-19-year-olds) who were admitted to Al Ain City's two major trauma centers or who died after arrival to these centers were prospectively studied from April 2006 to October 2007. Demography of patients, road-user and vehicle types, crash mechanism, usage of safety devices, injured body regions, injury severity, Revised Trauma Score, Glasgow Coma Scale, intensive care unit admissions, hospital stay and mortality were analyzed. 245 patients were studied, 69% were vehicle occupants, 15% pedestrians, 9% motorcyclists and 5% bicyclists. 79% were males and 67% UAE citizens. The most common mechanism of RTC was rollover of vehicle (37%) followed by front impact collision (32%). 32 (13%) of vehicle occupants were ejected from car. 63% of ejected occupants and 70% of motorcyclists sustained head injuries. Only 2% (3/170) vehicle passengers used seatbelts and 13% (3/23) motorcyclists a helmet. Male drivers and UAE nationals were at high risk of RTC as drivers and as motorcyclists. Ejection rate was high because safety restraint use was extremely low in our community. More education and law enforcement focusing especially on car/booster seat use is needed.
El-Fakharani, Abdelhamid; Hamimi, Zakaria
2013-04-01
Ain Shams area, Western Arabian Shield, Saudi Arabia, is occupied by four main rock units; gneisses, metavolcanics, metasediments and syn- to post-tectonic granitoids. Field and structural studies reveal that the area was subjected to at least three phases of deformation (D1, D2 and D3). The structural features of the D1 are represented by tight to isoclinal and intrafolial folds (F1), axial plane foliation (S1) and stretching lineations (L1). This phase is believed to be resulted from an early NW-SE contractional phase due to the amalgamation between Asir and Jeddah tectonic terranes. D2 deformation phase progressively overprinted D1 structures and was dominated by thrusts, minor and major F2 thrust-related overturned folds. These structures indicate a top-to-the-NW movement direction and compressional regime during the D2 phase. Emplacement of the syn-tectonic granitoids is likely to have occurred during this phase. D3 structures are manifested F3 folds, which are open with steep to subvertical axial planes and axes moderately to steeply plunging towards the E, ENE and ESE directions, L3 is represented by crenulation lineations and kink bands. These structures attest NE-SW contractional phase, concurrent with the accretion of the Arabian-Nubian Shield (ANS) to the Saharan Metacraton (SM) and the final assembly between the continental blocks of East and West Gondwana.
Pediatric and youth traffic-collision injuries in Al Ain, United Arab Emirates: a prospective study.
Directory of Open Access Journals (Sweden)
Michal Grivna
Full Text Available AIM: To study the mechanism of road traffic collisions (RTC, use of safety devices, and outcome of hospitalized pediatric and youth RTC injured patients so as to give recommendations regarding prevention of pediatric RTC injuries. METHODS: All RTC injured children and youth (0-19-year-olds who were admitted to Al Ain City's two major trauma centers or who died after arrival to these centers were prospectively studied from April 2006 to October 2007. Demography of patients, road-user and vehicle types, crash mechanism, usage of safety devices, injured body regions, injury severity, Revised Trauma Score, Glasgow Coma Scale, intensive care unit admissions, hospital stay and mortality were analyzed. RESULTS: 245 patients were studied, 69% were vehicle occupants, 15% pedestrians, 9% motorcyclists and 5% bicyclists. 79% were males and 67% UAE citizens. The most common mechanism of RTC was rollover of vehicle (37% followed by front impact collision (32%. 32 (13% of vehicle occupants were ejected from car. 63% of ejected occupants and 70% of motorcyclists sustained head injuries. Only 2% (3/170 vehicle passengers used seatbelts and 13% (3/23 motorcyclists a helmet. CONCLUSIONS: Male drivers and UAE nationals were at high risk of RTC as drivers and as motorcyclists. Ejection rate was high because safety restraint use was extremely low in our community. More education and law enforcement focusing especially on car/booster seat use is needed.
EBSi-meeste meisterlik diil riigiga / Ralf-Martin Soe
Soe, Ralf-Martin
2008-01-01
Ilmunud ka: Delovõje Vedomosti 13. aug. lk. 8. EBS-i omanik Madis Habakuk, tema poeg Mart Habakuk ning äripartnerid Sulo Nigul ja Arle Mölder soetasid 10,1 miljoni krooni eest EBSi hoone Tallinna südalinnas, praegu hindab hoone omanikfirma EBS Campus kinnistu väärtuseks 130 miljonit. Paar kuud enne tehingu jõustumist tegid EBSi omanikud suure rahalise annetuse Keskerakonnale ja Reformierakonnale. Vt. samas: Mailis Reps: annetus polnud seotud haridusministeeriumiga; EBS üritas riiki pankrotti ajada; Tehing EBSiga oli erand; Mart Habakuk: EBS maksis hullu hinna; Heinaru: koolipapale tehti hea äraolemine
Down Deep in the Dark: A Semiotic Approach to Edgar Allan Poe’s the Black Cat
Directory of Open Access Journals (Sweden)
Abdul Karim Lazim
2018-02-01
Full Text Available Semiotics is the investigation of the nature, type and function of signs in all walks of life. It is the science of interpreting signs and showing how meaning is generated by and through a shared cultural code. Being a verbal corpus of imaginatively works of art, literature with all its genres, i.e. poetry, drama, fiction, the short story, etc. lends itself to semiotics scrutiny. Verbal works of artifact as such can be analyzed in terms of semiotic theory. This paper purports to explore Edgar Allan Poe’ The Black Cat as a structure of interconnected signs which are organically rooted into the code of horror. If culture, in one sense, is the complex network of beliefs, behaviors and patterns of thinking, these psychopathic cognitive patterns are wittingly structured in the semiotic system of Poe’s narrative work of art. The study proceeds with the hypothesis that Poe’s The Black Cat is a semiotic metaphor or a representation of the actual world of insanity which is resulted from obsession in things. The short story is analyzed in terms of the newly semiotic approach, namely The Semiotic triangle. This tripartite model is a three-dimensional model whose axes are: syntagmaticity, paradigmaticity and signification. The dimensions are supposed to be the foundations of the construction of Poe’s literary text. One result of the study has shown that fear is not an organic human nature in The Black Cat, but a newly born behavior which has led to a serial of crimes committed by the unnamed author. This abnormal behaviorism is encoded in the semiotic veins of Poe’s newly literary genre, i.e. the narratology of horror. The scope of the study is limited to Poe’s The Black Cat as a par excellent narrative work of that creative genre. The paper is rounded up with concluding remarks elicited from the semiotic analysis.
Directory of Open Access Journals (Sweden)
Adriano Souza Freitas
2018-02-01
Full Text Available For some time, some national literary texts have been adapted to comics, In this same flow, scholars are looking to analyze how this practice is being performed. We followed similar paths, but from a foreign writer, Edgar Allan Poe. Thus, the aim of this work is not only to analyze the "adaptation" of the Murder story in Morgue Street, but also to perform a literary analysis of the story, as well as to make a comparison between the arts, without merit of valuation. For the accomplishment of this work, it had been used books of the literary seam of writers like Tzvetan Todorov and Massaud Moisés, as well as of writers who are dedicated to the study of the comic like Thierry Groensteen. The research was bibliographical, however, whenever necessary a comparative-historical subsidy was sought. From the readings and the writing of the text, the richness of the literary tale and its "adaptation", that is, of the HQ, was perceived. The idea is therefore that it is not necessary to prioritize the arts, because they are different and with objectives, in many cases different, but can be completed depending on the purpose.
Piégay, H.; Hupp, C.R.; Citterio, A.; Dufour, S.; Moulin, B.; Walling, D.E.
2008-01-01
Floodplain development is associated with lateral accretion along stable channel geometry. Along shifting rivers, the floodplain sedimentation is more complex because of changes in channel position but also cutoff channel presence, which exhibit specific overflow patterns. In this contribution, the spatial and temporal variability of sedimentation rates in cutoff channel infill deposits is related to channel changes of a shifting gravel bed river (Ain River, France). The sedimentation rates estimated from dendrogeomorphic analysis are compared between and within 14 cutoff channel infills. Detailed analyses along a single channel infill are performed to assess changes in the sedimentation rates through time by analyzing activity profiles of the fallout radionuclides 137Cs and unsupported 210Pb. Sedimentation rates are also compared within the channel infills with rates in other plots located in the adjacent floodplain. Sedimentation rates range between 0.65 and 2.4 cm a−1 over a period of 10 to 40 years. The data provide additional information on the role of distance from the bank, overbank flow frequency, and channel geometry in controlling the sedimentation rate. Channel infills, lower than adjacent floodplains, exhibit higher sedimentation rates and convey overbank sediment farther away within the floodplain. Additionally, channel degradation, aggradation, and bank erosion, which reduce or increase the distance between the main channel and the cutoff channel aquatic zone, affect local overbank flow magnitude and frequency and therefore sedimentation rates, thereby creating a complex mosaic of sedimentation zones within the floodplain and along the cutoff channel infills. Last, the dendrogeomorphic and 137Cs approaches are cross validated for estimating the sedimentation rate within a channel infill.
MR imaging findings of anterior interosseous nerve lesions
Energy Technology Data Exchange (ETDEWEB)
Dunn, Andrew J. [Royal Liverpool University Hospital, Department of Medical Imaging, Liverpool (United Kingdom); Salonen, David C. [University of Toronto, Toronto Western Hospital, Department of Medical Imaging, Toronto, Ontario (Canada); Anastakis, Dimitri J. [University of Toronto, Toronto Western Hospital, Division of Plastic Surgery, Toronto, Ontario (Canada)
2007-12-15
To study and characterise the MR imaging findings of lesions of the anterior interosseous nerve (AIN). Magnetic resonance imaging (MRI) findings of the forearm of ten patients referred to our institution with suspected AIN lesions were retrospectively studied. Five healthy volunteers with normal forearm MRI findings formed a control group. Two musculoskeletal radiologists assessed the forearm musculature for oedema in the distribution of the AIN, median, posterior interosseous and radial nerves on T2-weighted (T2W) fat-saturated sequences. T1-weighted (T1W) images were assessed and graded for the presence of muscle atrophy and fatty involution. Six patients had undergone surgical exploration; five of these had surgically confirmed AIN compression. Four patients had diagnoses other than AIN compression made on imaging features. Of the cases of proven AIN compression, oedema within the pronator quadratus (PQ) muscle was identified in all cases. PQ atrophy and fatty involution were seen in three (43%) surgically confirmed cases. Cases 2 and 3 also demonstrated oedema in the flexor digitorum profundus (FDP)1 and FDP2 muscles. These cases also showed oedema in the flexor-carpi radialis (FCR) and FDP3/FDP4 muscles, respectively. The four cases of non-AIN compression demonstrated muscle oedema patterns that were atypical for the AIN distribution. They included a rupture of the flexor pollicis longus (FPL) tendon, brachial neuritis, amyotrophic lateral sclerosis and compression of the proximal median nerve. MRI is a useful investigation in the diagnostic workup of AIN syndrome. AIN syndrome is likely when there is diffuse oedema of AIN innervated muscles on T2W fat-saturated images. The most reliable sign of an AIN lesion is oedema within the PQ. Oedema in the flexor carpi radialis, FDP3 and FDP4, although not in the classical distribution of the AIN, does not preclude the diagnosis of AIN syndrome. (orig.)
MR imaging findings of anterior interosseous nerve lesions
International Nuclear Information System (INIS)
Dunn, Andrew J.; Salonen, David C.; Anastakis, Dimitri J.
2007-01-01
To study and characterise the MR imaging findings of lesions of the anterior interosseous nerve (AIN). Magnetic resonance imaging (MRI) findings of the forearm of ten patients referred to our institution with suspected AIN lesions were retrospectively studied. Five healthy volunteers with normal forearm MRI findings formed a control group. Two musculoskeletal radiologists assessed the forearm musculature for oedema in the distribution of the AIN, median, posterior interosseous and radial nerves on T2-weighted (T2W) fat-saturated sequences. T1-weighted (T1W) images were assessed and graded for the presence of muscle atrophy and fatty involution. Six patients had undergone surgical exploration; five of these had surgically confirmed AIN compression. Four patients had diagnoses other than AIN compression made on imaging features. Of the cases of proven AIN compression, oedema within the pronator quadratus (PQ) muscle was identified in all cases. PQ atrophy and fatty involution were seen in three (43%) surgically confirmed cases. Cases 2 and 3 also demonstrated oedema in the flexor digitorum profundus (FDP)1 and FDP2 muscles. These cases also showed oedema in the flexor-carpi radialis (FCR) and FDP3/FDP4 muscles, respectively. The four cases of non-AIN compression demonstrated muscle oedema patterns that were atypical for the AIN distribution. They included a rupture of the flexor pollicis longus (FPL) tendon, brachial neuritis, amyotrophic lateral sclerosis and compression of the proximal median nerve. MRI is a useful investigation in the diagnostic workup of AIN syndrome. AIN syndrome is likely when there is diffuse oedema of AIN innervated muscles on T2W fat-saturated images. The most reliable sign of an AIN lesion is oedema within the PQ. Oedema in the flexor carpi radialis, FDP3 and FDP4, although not in the classical distribution of the AIN, does not preclude the diagnosis of AIN syndrome. (orig.)
Directory of Open Access Journals (Sweden)
Katre Talviste
2013-12-01
Full Text Available This article positions the translations of French verse works (plays and selected collections of individual poets that August Sang, Jaan Kross and Ain Kaalep made in the 1960s, onto the background of their own original works. At that time, August Sang translated four plays by Molière (The Misanthrope, Tartuffe, The School for Wives in 1961; Amphitryon in 1961, which have already been discussed in relation to the tradition of translating the French syllabic verse into Estonian, because these translations form a considerable part of the body of Estonian translations of French verse poetry. For Jaan Kross and Ain Kaalep, the wider context is created by the so-called free verse battles in the 1950s, to which we can link Kross’ translation of a selected collection of Éluard (Veel enne kostma peab, 1969 and Kaalep’s translation of a selected collection of Prévert (Kuidas portreteerida lindu, 1965. One of the two remaining translations by Kross, (Rostand’s Cyrano de Bergerac, 1964, can also be examined in relation to the problems of translating verse, but the other, (Béranger’s Laulud, 1963, should be discussed in the framework of intellectual and cultural resistance, a part of which was also the struggle put up for the existence of free verse in the 1950s and 1960s. Of August Sang’s original work, the article examines his collection of poems Võileib suudlusega (1963, written simultaneously with his translations of Molière’s plays and published right after them. Both the translations and the collection of original poems have attracted critics’ attention with their remarkable lack of linguistic constraint and simplicity. Although Sang has rarely voiced theoretical ideas about translation or explained his method, both his poetic image, outlined in the collection Võileib suudlusega, and his search for right words, reflected in the drafts of his translations, let us believe that the simplicity of expression and the avoidance of marked
Shearer, C. K.; Leshin, L. A.; Adcock, C. T.
1999-01-01
Olivine from Martian meteorite Allan Hills (ALH) 84001 occurs as clusters within orthopyroxene adjacent to fractures containing disrupted carbonate globules and feldspathic shock glass. The inclusions are irregular in shape and range in size from approx. 40 microns to submicrometer. Some of the inclusions are elongate and boudinage-like. The olivine grains are in sharp contact with the enclosing orthopyroxene and often contain small inclusions of chromite The olivine exhibits a very limited range of composition from Fo(sub 65) to Fo(sub 66) (n = 25). The delta(sup 18)O values of the olivine and orthopyroxene analyzed by ion microprobe range from +4.3 to +5.3% and are indistinguishable from each other within analytical uncertainty. The mineral chemistries, O-isotopic data, and textural relationships indicate that the olivine inclusions were produced at a temperature greater than 800 C. It is unlikely that the olivines formed during the same event that gave rise to the carbonates in ALH 84001, which have more elevated and variable delta(sup 18)O values, and were probably formed from fluids that were not in isotopic equilibrium with the orthopyroxene or olivine The reactions most likely instrumental in the formation of olivine could be either the dehydration of hydrous silicates that formed during carbonate precipitation or the reduction of orthopyroxene and spinel If the olivine was formed by either reaction during a postcarbonate beating event, the implications are profound with regards to the interpretations of McKay et al. Due to the low diffusion rates in carbonates, this rapid, high-temperature event would have resulted in the preservation of the fine-scale carbonate zoning' while partially devolatilizing select carbonate compositions on a submicrometer scale. This may have resulted in the formation of the minute magnetite grains that McKay et al attributed to biogenic activity.
International Nuclear Information System (INIS)
Yohannan, Jinu P.; Vidyasagar, Kanamaluru
2016-01-01
Ten AInM′S 4 (A=alkali metals, Tl; M′= Ge, Sn) compounds with diverse structure types have been synthesized and characterized by single crystal and powder X-ray diffraction and a variety of spectroscopic methods. They are wide band gap semiconductors. KInGeS 4 (1-β), RbInGeS 4 (2), CsInGeS 4 (3-β), TlInGeS 4 (4-β), RbInSnS 4 (8-β) and CsInSnS 4 (9) compounds with three-dimensional BaGa 2 S 4 structure and CsInGeS 4 (3-α) and TlInGeS 4 (4-α) compounds with a layered TlInSiS 4 structure have tetrahedral [InM′S 4 ] − frameworks. On the other hand, LiInSnS 4 (5) with spinel structure and NaInSnS 4 (6), KInSnS 4 (7), RbInSnS 4 (8-α) and TlInSnS 4 (10) compounds with layered structure have octahedral [InM′S 4 ] − frameworks. NaInSnS 4 (6) and KInSnS 4 (7) compounds undergo facile topotactic ion-exchange, at room temperature, with various mono-, di- and tri-valent cations in aqueous medium to give rise to metastable layered phases. - Graphical abstract: NaInSnS 4 and KInSnS 4 compounds undergo, in aqueous medium at room temperature, facile topotactic ion-exchange with mono, di and trivalent cations. Display Omitted - Highlights: • Ten AInM′S 4 compounds with diverse structure types were synthesized. • They are wide band gap semiconductors. • NaInSnS 4 and KInSnS 4 compounds undergo facile topotactic ion-exchange at room temperature.
Energy Technology Data Exchange (ETDEWEB)
Qi-Chu Zhang [The University of Sydney (Australia). School of Physics; Shen, Y.G. [City University of Hong Kong (Hong Kong). Department of Manufacturing Engineering and Engineering Management
2004-01-25
High solar performance W-AIN cermet solar coatings were designed using a numerical computer model and deposited experimentally. In the numerical calculations aluminium oxynitride (AlON) was used as ceramic component. The dielectric functions and then complex refractive index of W-AlON cermet materials were calculated using the Sheng's approximation. The layer thickness and W metal volume fraction were optimised to achieve maximum photo-thermal conversion efficiency for W-AlON cermet solar coatings on an Al reflector with a surface AlON ceramic anti-reflection layer. Optimisation calculations show that the W-AlON cermet solar coatings with two and three cermet layers have nearly identical solar absorptance, emittance and photo-thermal conversion efficiency that are much better than those for films with one cermet layer. The optimised calculated AlON/W-AlON/Al solar coating film with two cermet layers has a high solar absorptance of 0.953 and a low hemispherical emittance of 0.051 at 80{sup o}C for a concentration factor of 2. The AlN/W-AlN/Al solar selective coatings with two cermet layers were deposited using two metal target direct current magnetron sputtering technology. During the deposition of W-AlN cermet layer, both Al and W targets were run simultaneously in a gas mixture of argon and nitrogen. By substrate rotation a multi-sub-layer system consisting of alternating AlN ceramic and W metallic sub-layers was deposited that can be considered as a macro-homogeneous W-AlN cermet layer. A solar absorptance of 0.955 and nearly normal emittance of 0.056 at 80{sup o}C have been achieved for deposited W-AlN cermet solar coatings. (author)
Anna Pantelia
2013-01-01
18 octobre 2013 - Le Préfet de l’Ain L. Touvet signe le livre d'or avec le Directeur général du CERN R. Heuer et le Chef du Département Technologie F. Bordry. Photo de groupe, de gauche à droite: T. Kupisz,\tSecrétaire général de la sous préfecture de Gex; L. Miralles, Chef du Département Infrastructure et services généraux; F. Eder, Délégué aux Relations avec les Etats hôtes; S. Donnot, Sous-préfet de Gex; L. Touvet, Préfet de l'Ain; E. Sches, Sous-préfète de Nantua; E.Gröniger-Voss, Conseiller juridique du CERN; R. Heuer, Directeur général; F. Bordry, Chef du Département Technologie et P. Bloch, Chef du Département Physique.
African Journals Online (AJOL)
Professor of Genetics (Cytogenetics), Faculty of Medicine, Ain Shams University, Cairo, Egypt. Hosam A Abdel-Ghany. Consultant of Medical Human Genetics, Medical Genetic Center, Ain Shams University, Cairo, Egypt. Nermin S Elsayed. Consultant of Medical Human Genetics, Medical Genetics Center, Ain Shams ...
Directory of Open Access Journals (Sweden)
Issam Sellika
2016-10-01
Full Text Available Au Maroc, l’utilisation des eaux souterraines pour l’irrigation a permis un développement agricole rapide dans de nombreuses régions, mais a aussi fait émerger des situations de baisse des niveaux piezométriques des nappes qui menacent la durabilité de cette agriculture irriguée. L’article présente une action de recherche portant sur la conception d’un projet de territoire agricole durable alliant développement agricole et usage pérenne des ressources en eau souterraine. L’étude a eu lieu dans la zone d’Ain Timguenay (province de Séfrou, qui connait un fort développement de la production de pommes et de prunes depuis une quinzaine d’années. Le programme de recherche a impliqué les agriculteurs, la commune rurale d’Ain Timguenay, les institutions du Ministère de l’Agriculture et l’Agence de bassin hydraulique du Sébou. Une analyse des dynamiques agricoles locales et des tendances nationales a servi de support aux discussions. L’étude de l’aquifère et de ses usages a permis d’établir un bilan sommaire et un ordre de grandeur des surfaces qui pourraient encore être plantées sans que les consommations en eau soient supérieures à la recharge de l’aquifère en année pluviométrique moyenne. Une réflexion prospective menée avec les agriculteurs a mis en évidence deux scénarios possibles à l’échelle locale: 1 un scénario où les difficultés économiques que rencontrent actuellement les exploitations de la zone se renforcent, conduisant à un ralentissement des nouvelles plantations, d’où une pression limitée sur la nappe ; 2 un scénario où les exploitations réussissent à faire face aux défis actuels de production et de commercialisation et de ce fait continuent à planter, ce qui conduit à une consommation en eau bien supérieure à la recharge de la nappe. L’ensemble des acteurs impliqués a participé à l’élaboration d’un troisième scénario permettant de concilier d
Lee, Su Young; Kim, Sang Ho
2014-12-01
The purpose of this study is to investigate the friction and wear behaviors of CrN, TiN, CrAlN, and TiAIN coated onto SKD61 for application to Al 7000 series extrusion dies. On the wear test, the experimental parameters are the load and the counter material's temperature. The results showed that the friction coefficient increased with load but decreased with the counter material's temperature, and the friction coefficients of CrN and CrAIN were lower than the friction coefficients of TiAIN and TIN, especially at a higher temperature. The wear track with different coatings identified different wear behaviors; the wear behavior of CrAIN was found to be abrasive, but the wear behavior of TiN, CrN, and TiAIN was adhesive. Therefore, CrAIN showed the least wear loss with a lower friction coefficient and less adhesion with counter materials at the highest range of wear load and temperature. This resulted in the easy formation of aluminum oxide in the wear track and less Al adhesion; moreover during the hard second phase, AIN dispersed in the film during deposition.
Allergic Interstitial Nephritis Manifesting as a Striated Nephrogram
Directory of Open Access Journals (Sweden)
Irfan Moinuddin
2015-01-01
Full Text Available Allergic interstitial nephritis (AIN is an underdiagnosed cause of acute kidney injury (AKI. Guidelines suggest that AIN should be suspected in a patient who presents with an elevated serum creatinine and a urinalysis that shows white cells, white cell casts, or eosinophiluria. Drug-induced AIN is suspected if AKI is temporally related to the initiation of a new drug. However, patients with bland sediment and normal urinalysis can also have AIN. Currently, a definitive diagnosis of AIN is made by renal biopsy which is invasive and fraught with risks such as bleeding, infection, and hematoma. Additionally, it is frequently unclear when a kidney biopsy should be undertaken. We describe a biopsy proven case of allergic interstitial nephritis which manifested on contrast enhanced Magnetic Resonance Imaging (MRI as a striated nephrogram. Newer and more stable macrocyclic gadolinium contrast agents have a well-demonstrated safety profile. Additionally, in the presentation of AKI, gadolinium contrast agents are safe to administer in patients who demonstrate good urine output and a downtrending creatinine. We propose that the differential for a striated nephrogram may include AIN. In cases in which the suspicion for AIN is high, this diagnostic consideration may be further characterized by contrast enhanced MRI.
Risk Factors for the presence of anal intraepithelial neoplasia in HIV+ men who have sex with men
Richel, Olivier; de Vries, Henry J. C.; Dijkgraaf, Marcel G. W.; van Noesel, Carel J. M.; Prins, Jan M.
2013-01-01
Anal Intraepithelial Neoplasia (AIN) is present in the majority of HIV+ men who have sex with men (MSM) and routine AIN-screening is subject of discussion. In this study we analysed a wide range of potential risk factors for AIN in order to target screening programs. We screened 311 HIV+ MSM by high
Anterior interosseous nerve syndrome diagnosis and intraoperative findings: A case report
Directory of Open Access Journals (Sweden)
Abdulla Aljawder
2016-01-01
Conclusion: Clinical suspicion should arise in the presence of isolated paralysis of the AIN-supplied muscles. MRI and electrodiagnostic studies will confirm the diagnosis and identify the etiology. The optimal treatment of AIN syndrome has not been established. We recommend surgical intervention in confirmed AIN syndrome from compression neuropathy, refractive to conservative therapy.
Giusti, Christian; Louchet, André; Beuzen-Waller, Tara; Ragala, Rachid; Pavlopoulos, Kosmas; Fouache, Éric; Cohen, Marianne; Desruelles, Stéphane; Gramond, Delphine
2015-04-01
human settlements and occupation, it is possible to characterize a threefold transition: first, the former transition between the pre-Islamic prehistoric societies and the development of Muslim societies; second, the more recent transition between the traditional historical society (farmers) and the contemporary society, characterized by the growth of urbanization, the creation of modern transport infrastructure and the concomitant growth of tourist flows; third, the current transition between the yesterday and tomorrow Al Ain City, due to the transformation of a local town centred on national economics all along the second half of the twentieth century, into an international town more open to the wider world with the management of a possible increased 20 % of tourist flow because of the inscription of Cultural Sites of Al Ain on the UNESCO's World Heritage List. It is not possible to completely ignore the fact that the Jebel Hafit and its foothills are partly crossed by an international boundary. In case of political tensions, this may cause some difficulties for the management of this territory, with contradictory requirements between security, tourism, traditional land use, and scientific research.
Acute interstitial nephritis with acetaminophen and alcohol intoxication
Directory of Open Access Journals (Sweden)
Alexopoulou Iakovina
2011-04-01
Full Text Available Abstract Drug-induced acute interstitial nephritis (AIN represents a growing cause of renal failure in current medical practice. While antimicrobials and non-steroidal anti-inflammatory drugs are typically associated with drug-induced AIN, few reports have been made on the involvement of other analgesics. We report our experience in managing a 17-year-old female with AIN and subsequent renal injury following an acetaminophen overdose in conjunction with acute alcohol intoxication. It is well established that acetaminophen metabolism, particularly at high doses, produces reactive metabolites that may induce renal and hepatic toxicity. It is also plausible however, that such reactive species could instead alter renal peptide immunogenicity, thereby inducing AIN. In the following report, we review a possible mechanism for the acetaminophen-induced AIN observed in our patient and also discuss the potential involvement of acute alcohol ingestion in disease onset. The objective of our report is to increase awareness of healthcare professionals to the potential involvement of these commonly used agents in AIN pathogenesis.
Energy Technology Data Exchange (ETDEWEB)
Yohannan, Jinu P.; Vidyasagar, Kanamaluru, E-mail: kvsagar@iitm.ac.in
2016-06-15
Ten AInM′S{sub 4} (A=alkali metals, Tl; M′= Ge, Sn) compounds with diverse structure types have been synthesized and characterized by single crystal and powder X-ray diffraction and a variety of spectroscopic methods. They are wide band gap semiconductors. KInGeS{sub 4}(1-β), RbInGeS{sub 4}(2), CsInGeS{sub 4}(3-β), TlInGeS{sub 4}(4-β), RbInSnS{sub 4}(8-β) and CsInSnS{sub 4}(9) compounds with three-dimensional BaGa{sub 2}S{sub 4} structure and CsInGeS{sub 4}(3-α) and TlInGeS{sub 4}(4-α) compounds with a layered TlInSiS{sub 4} structure have tetrahedral [InM′S{sub 4}]{sup −} frameworks. On the other hand, LiInSnS{sub 4}(5) with spinel structure and NaInSnS{sub 4}(6), KInSnS{sub 4}(7), RbInSnS{sub 4}(8-α) and TlInSnS{sub 4}(10) compounds with layered structure have octahedral [InM′S{sub 4}]{sup −} frameworks. NaInSnS{sub 4}(6) and KInSnS{sub 4}(7) compounds undergo facile topotactic ion-exchange, at room temperature, with various mono-, di- and tri-valent cations in aqueous medium to give rise to metastable layered phases. - Graphical abstract: NaInSnS{sub 4} and KInSnS{sub 4} compounds undergo, in aqueous medium at room temperature, facile topotactic ion-exchange with mono, di and trivalent cations. Display Omitted - Highlights: • Ten AInM′S{sub 4} compounds with diverse structure types were synthesized. • They are wide band gap semiconductors. • NaInSnS{sub 4} and KInSnS{sub 4} compounds undergo facile topotactic ion-exchange at room temperature.
Berreur, B; Guerin, F; Christophe, B; Limido, G; Paubel, P
2018-01-01
To evaluate the economic impact of future prescriptions of etanercept and adalimumab biosimilars at the territorial scale covered by PharmAlp'Ain, a hospitals grouping of orders for health products. Determination of the number and status of patients (naive or in continuation of treatment) from the National Database "Datamart de Consommation Inter-Régimes" of health insurance, concerned by a dispensation in a pharmacy of etanercept or adalimumab in 2015. Calculation of potential savings in case of biosimilar requirements according to 3 hypotheses: 63% (rate observed in a previous study) of initiations are treated with biosimiliaries and the others by princeps (H 1 ); all initiations under biosimilars and continuation therapy with the princeps (H 2 ) or all patients are treated with biosimilars (H 3 ). The annual savings are estimated at 237,000 € with the H 1 hypothesis. In the case of H 2 , the expected savings would be 376,200 € per year. In the case of H 3 , savings for the community could reach almost 1,282,800 € per year. The arrival of biosimilars allows significant savings for medicines market. According to the French recommendations in 2016, the expected savings are between the H 1 and H 2 hypothesis. The rate of penetration of biosimilars depends on many factors such as the involvement of health professionals, patient adherence, or health authority recommendations. Copyright © 2017 Académie Nationale de Pharmacie. Published by Elsevier Masson SAS. All rights reserved.
LENUS (Irish Health Repository)
Garvey, J P
2009-11-01
Acute interstitial nephritis (AIN) secondary to trimethoprim-sulfamethoxazole (TMP-SMX) is well documented as a cause of acute renal failure in native kidneys. TMP-SMX is the standard prophylactic agent against pneumocystis carinii (PCP) used in the early post-transplant period, however, it has to date only been indirectly associated with AIN in renal allografts. DESIGN, SETTING, PARTICIPANTS AND MEASUREMENTS: We describe eleven renal transplant patients with acute allograft dysfunction in whom a transplant biopsy demonstrated primary histopathologic features of allergic AIN, all of whom were receiving TMP-SMX in addition to other medications known to cause AIN.
Non-native acylated homoserine lactones reveal that LuxIR quorum sensing promotes symbiont stability
Ho, Jessica S.; Geske, Grant D.; Blackwell, Helen E.; Ruby, Edward G.
2014-01-01
SUMMARY Quorum sensing, a group behavior coordinated by a diffusible pheromone signal and a cognate receptor, is typical of bacteria that form symbioses with plants and animals. LuxIR-type acyl homoserine-lactone (AHL) quorum sensing is common in Gram-negative proteobacteria, and many members of this group have additional quorum-sensing networks. The bioluminescent symbiont Vibrio fischeri encodes two AHL signal synthases: AinS and LuxI. AinS-dependent quorum sensing converges with LuxI-dependent quorum sensing at the LuxR regulatory element. Both AinS- and LuxI-mediated signaling are required for efficient and persistent colonization of the squid host, Euprymna scolopes. The basis of the mutualism is symbiont bioluminescence, which is regulated by both LuxI- and AinS-dependent quorum sensing, and is essential for maintaining a colonization of the host. Here, we used chemical and genetic approaches to probe the dynamics of LuxI- and AinS-mediated regulation of bioluminescence during symbiosis. We demonstrate that both native AHLs and non-native AHL analogs can be used to non-invasively and specifically modulate induction of symbiotic bioluminescence via LuxI-dependent quorum sensing. Our data suggest that the first day of colonization, during which symbiont bioluminescence is induced by LuxIR, is a critical period that determines the stability of the V. fischeri population once symbiosis is established. PMID:24191970
Cleary, Michelle; Horsfall, Jan; O'Hara-Aarons, Maureen; Mannix, Judy; Jackson, Debra; Hunt, Glenn E
2012-04-01
Undergraduate nurses are employed as assistants in nursing (AIN) in inpatient mental health settings; however, there is a paucity of published research exploring registered nurses' (RN) views about the AIN role in these settings. This qualitative study documents the views and experiences of RN working with undergraduate AIN. Fifty structured face-to-face interviews were analysed, and the results are discussed in three sections. The first section outlines RN perceptions of qualities and skills required of AIN in mental health, and the responses primarily focus on communication skills, initiative, and willingness to learn. The second section targets factors in the workplace that might enhance the interest of AIN in a mental health nursing career; the responses emphasize their need to work with experienced staff. The last section outlines RN expectations of AIN, most of which are met and involve physical observations and technical tasks; less fulfilled activities primarily cluster around interactions with patients. Findings highlight the advantages and disadvantages of drawing on undergraduate nursing students as AIN in mental health settings. Communication skills, personal initiative, safety training to prevent violence, and education to increase knowledge and awareness about mental illness, diagnosis, and mental status-related skills were all important concerns articulated by RN. © 2011 The Authors. International Journal of Mental Health Nursing © 2011 Australian College of Mental Health Nurses Inc.
Azab, Sonya M S; Hirshon, Jon Mark; Hirshon, John Mark; Hayes, Bryan D; El-Setouhy, Maged; Smith, Gordon S; Sakr, Mahmoud Lotfy; Tawfik, Hany; Klein-Schwartz, Wendy
2016-01-01
Pediatric poisonings represent a major and preventable cause of morbidity and mortality throughout the world. Epidemiologic information about poisoning among children in many lower- and middle-income countries is scarce. This study describes the epidemiology of acute poisonings in children presenting to Ain Shams University's Poisoning Treatment Center (ASU-PTC) in Cairo and determines the causative agents and characteristics of acute poisoning in several pediatric age groups. This retrospective study involved acutely poisoned patients, 0-18 years of age, who presented to the ASU-PTC between 1 January 2009 and 31 December 2013. Data were extracted from electronic records maintained by the ASU-PTC. Collected data included demographics, substance of exposure, circumstances of the poisoning, patient disposition, and outcome. During the 5-year study period, 38 470 patients meeting our criteria were treated by the ASU-PTC; 19 987 (52%) were younger than 6 years of age; 4196 (11%) were 6-12 years; and 14 287 (37%) were >12 years. Unintentional poisoning accounted for 68.5% of the ingestions, though among adolescents 84.1% of ingestions were with self-harm intent. In all age groups, the most frequent causative drugs were non-opioid analgesics, antipyretics, and antirheumatics. The most common nonpharmaceutical agents were corrosives in preschool children and pesticides in adolescents. Most patients had no/minor effects (29 174 [75.8%]); hospitalization rates were highest among adolescents. There were 119 deaths (case fatality rate of 0.3), primarily from pesticide ingestion. Poisoning in preschool children is mainly unintentional and commonly due to nonpharmaceutical agents whereas poisoning in adolescents is mainly intentional (self-harm). Pesticides, mainly organophosphorous compounds and carbamates, were the most frequent agents leading to morbidity and mortality.
Response of Phlebotomine Sand Flies to Light-Emitting Diode-Modified Light Traps in Southern Egypt
2007-04-01
dispersal , and oviposition site selection (Allan et al. 1987, Allan 1994, Snow 1971). Target size, shape, movement, contrast, and color are...dogs, and goats. The village is built from baked mud bricks and covered with kaolin day to produce hardened, smooth wall surfaces, structures are one
Directory of Open Access Journals (Sweden)
Ahmad Saleh Al Khatib
2014-05-01
Full Text Available The objective of the present study was to investigate the relationship between time management, perceived stress, gender and academic achievement among United Arab Emirates college students. The respondents were 352 college students from Al Ain University of Science and Technology. The sample was stratified by sex. Among the respondents, 52.5% were female students and 47.5% were male students. The mean age of the sample was 23.4 years ranging from 18 to 39. Time management was measured by Time Management Questionnaire” developed by Britton and Tesser (1991, while perceived stress was measured by The Perceived Stress Scale developed by Cohen (1985. The findings of the study showed that there was statistically significant negative relationship between time management and perceived stress. Females reported higher time management compared to their males counter mates. Higher time management and lower perceived stress were associated with high levels of academic achievement. However, time management was the most significant predictor of academic achievement accounting for 26 % of the variance while perceived stress accounted for an additional 11.2% of the variance in academic achievement. All three predictors explained 29.4% (R = .543 of total variance. The implications and limitations are reviewed as are the suggestions for future research. Keywords: Time management, perceived stress, academic achievement, college students.
Zeng, Huawei; Ishaq, Suzanne L; Liu, Zhenhua; Bukowski, Michael R
2018-04-01
The increasing worldwide incidence of colon cancer has been linked to obesity and consumption of a high-fat Western diet. To test the hypothesis that a high-fat diet (HFD) promotes colonic aberrant crypt (AC) formation in a manner associated with gut bacterial dysbiosis, we examined the susceptibility to azoxymethane (AOM)-induced colonic AC and microbiome composition in C57/BL6 mice fed a modified AIN93G diet (AIN, 16% fat, energy) or an HFD (45% fat, energy) for 14 weeks. Mice receiving the HFD exhibited increased plasma leptin, body weight, body fat composition and inflammatory cell infiltration in the ileum compared with those in the AIN group. Consistent with the gut inflammatory phenotype, we observed an increase in colonic AC, plasma interleukin-6, tumor necrosis factor-α, monocyte chemoattractant protein-1 and inducible nitric oxide synthase in the ileum of the HFD-AOM group compared with the AIN-AOM group. Although the HFD and AIN groups did not differ in bacterial species number, the HFD and AIN diets resulted in different bacterial community structures in the colon. The abundance of certain short-chain fatty acid (SCFA) producing bacteria (e.g., Barnesiella) and fecal SCFA (e.g., acetic acid) content were lower in the HFD-AOM group compared with the AIN and AIN-AOM groups. Furthermore, we identified a high abundance of Anaeroplasma bacteria, an opportunistic pathogen in the HFD-AOM group. Collectively, we demonstrate that an HFD promotes AC formation concurrent with an increase of opportunistic pathogenic bacteria in the colon of C57BL/6 mice. Published by Elsevier Inc.
"Kurja lillede" kuus ärakeelatud luuletust / Charles Baudelaire ; saatesõna: Marek Tamm
Baudelaire, Charles
2000-01-01
Sisu: Kalliskivid / tlk. Ain Kaalep ; Lethe / tlk. Märt Väljataga ; Temale, kes on liiga rõõmus / tlk. Ain Kaalep ; Lesbos / tlk. Ilmar Laaban ; Äraneetud naised (Delphine ja Hyppolyte) / tlk. Ain Kaalep ; Vampiiri metamorfoosid / tlk. August Sang. Orig.: Les Bijoux ; Le Léthé ; A celle qui est trop gaie ; Lesbos ; Femmes damnées. Delphine et Hippolyte ; Les Métamorphoses du vampire
KaufmanFest 2007: Plasma theory, wave kinetics, and nonlinear dynamics
International Nuclear Information System (INIS)
Brizard, A J; Tracy, E R
2009-01-01
A symposium in honor of Professor Allan N. Kaufman's 80th year was held at the University of California at Berkeley on October 5-7, 2007. The meeting celebrated Allan's contributions to plasma physics as well as his friendship and guidance. The present paper very briefly summarizes the talks presented.
Fractal dimension and image statistics of anal intraepithelial neoplasia
International Nuclear Information System (INIS)
Ahammer, H.; Kroepfl, J.M.; Hackl, Ch.; Sedivy, R.
2011-01-01
Research Highlights: → Human papillomaviruses cause anal intraepithelial neoplasia (AIN). → Digital image processing was carried out to classify the grades of AIN quantitatively. → The fractal dimension as well as grey value statistics was calculated. → Higher grades of AIN yielded higher values of the fractal dimension. → An automatic detection system is feasible. - Abstract: It is well known that human papillomaviruses (HPV) induce a variety of tumorous lesions of the skin. HPV-subtypes also cause premalignant lesions which are termed anal intraepithelial neoplasia (AIN). The clinical classification of AIN is of growing interest in clinical practice, due to increasing HPV infection rates throughout human population. The common classification approach is based on subjective inspections of histological slices of anal tissues with all the drawbacks of depending on the status and individual variances of the trained pathologists. Therefore, a nonlinear quantitative classification method including the calculation of the fractal dimension and first order as well as second order image statistical parameters was developed. The absolute values of these quantitative parameters reflected the distinct grades of AIN very well. The quantitative approach has the potential to decrease classification errors significantly and it could be used as a widely applied screening technique.
2010-12-01
position.36 In 1951, Mosaddeq was elected 34 Roger M. Savory , “Religious Dogma and the...42 Pollack, The Persian Puzzle, 42. 43 Yonah Alexander and Allan Nanes, The United States and Iran: A...Alexander, Yonah, and Allan Nanes. The United States and Iran: A Documentary History. Frederick, Md. : University Publication of America, 1980. Al
KaufmanFest 2007: Plasma theory, wave kinetics, and nonlinear dynamics
Energy Technology Data Exchange (ETDEWEB)
Brizard, A J [Saint Michael' s College, Colchester, VT 05439 (United States); Tracy, E R [Department of Physics, College of William and Mary, Williamsburg, VA 23187-8795 (United States)
2009-05-01
A symposium in honor of Professor Allan N. Kaufman's 80th year was held at the University of California at Berkeley on October 5-7, 2007. The meeting celebrated Allan's contributions to plasma physics as well as his friendship and guidance. The present paper very briefly summarizes the talks presented.
Directory of Open Access Journals (Sweden)
Saula Goulart Chaud
2007-06-01
Full Text Available Os índices séricos de glicose e lipídios, a microbiota intestinal e a produção de ácidos graxos voláteis de cadeias curtas (AGV foram determinados em ratos Wistar submetidos às dietas: padrão (AIN-P, padrão modificada (AIN-M e às dietas contendo frações de parede celular de levedura: glicana insolúvel (GI, manana (M e glicana mais manana (G+M, como única fonte de fibra alimentar. O fracionamento da parede celular (PC foi realizado por processos físicos e químicos de extração, centrifugação e secagem em "spray dryer". Os índices séricos foram dosados através de "kits" comerciais. A microbiota e a produção de AGV foram determinadas nos conteúdos intestinais, incluindo cólon, ceco e reto. Considerando os níveis de colesterol no tempo (T0 e no tempo 28 (T28, as dietas AIN-P, AIN-M e M apresentaram efeito hipocolesterolêmico, tendo em vista que a composição das dietas eram de natureza hipercolesterolêmica. Em relação à glicose sérica, no tempo (T0 observou-se uma elevação geral da glicemia, sugerindo um efeito hiperglicêmico das dietas estudadas. A dieta G+M foi a que apresentou valores significantemente mais elevados de lipídios séricos no tempo T14, e os níveis mais baixos foram observados na dieta M e na dieta GI no T14 e nas dietas AIN-M e AIN-P. A dieta AIN-P foi a que apresentou valor significantemente mais elevado de triacilgliceróis nos tempos T14 e T28. Os níveis mais baixos nos tempos T14 foram constatados para as dietas G+M e GI e no tempo T28 para as dietas AIN-M e M. De um modo geral, não houve modificações significativas na microbiota intestinal dos animais em nenhuma das dietas. Dentre os AGV, o ácido acético foi o predominante, seguido do propiônico e do butírico, em todas as dietas estudadas.The blood serum indexes of glucose and lipids, the intestinal microbiota and the production of volatile fatty acids (VFA were determined in Wistar rats which were fed a standard (AIN-P diet, a
Kebbouche-Gana, Salima; Gana, Mohamed Lamine; Ferrioune, Imen; Khemili, Souad; Lenchi, Nesrine; Akmouci-Toumi, Sihem; Bouanane-Darenfed, Nabila Amel; Djelali, Nacer-Eddine
2013-11-01
A bacterial strain E21 was isolated from a sample of water collected in the salt lake located close to Ain Salah, Algeria. The analysis of 16S rRNA gene sequence had indicated that the strain had 93 % sequence similarity with the genus Natrialba sp. strain E21 (GenBank, FR750525.1) and was considered extremely halophilic. Production of biosurfactant by the strain E21 with free and entrapped cells was investigated using soluble starch in the saline conditions. Biosurfactant synthesis was followed by measuring the surface tension and emulsifying index 9 days under optimal conditions (40 °C, pH 7). Some diffusional limitations in alginate and agar beads affected the kinetics of biosurfactant production when compared to that obtained with free cells culture. The minimum values of surface tension were 27 and 30 mN m(-1) achieved after 9 days with free and immobilized cells, respectively, while the corresponding maximum E24 values were 65.3 and 62.3 %, respectively. The re-use of bacterial cells along with the limited cell losses provided by the immobilized system might lead to significant reduction of the biosurfactant production cost.
Microstructure of Nitrided Aluminum Alloys Using an Electron-Beam-Excited-Plasma (EBEP)
Institute of Scientific and Technical Information of China (English)
L. Liu; A. Yamamoto; T. Hishida; H. Shoyama; T. Hara; T. Hara
2004-01-01
Nitriding of surface of aluminum alloys was carried out with using an electron-beam-excited-plasma (EBEP)technique. The EBEP is sustained by electron impact ionization with energetic electron beam. Two kinds of substrates,aluminum alloys AA5052 and AA5083, were exposed to the down flow of EBEP source at 843 K for 45min. The specimens were characterized with respect to following properties: crystallographic structure (XRD), morphology (SEM) and the cross sectional microstructures of the nitrided layer was observed using a scanning electron microscopy (SEM). There are some Al2O3 particles on the surface of the nitrided AA5052 and AA5083. The AIN layers were formed on the substrates with the thickness of 4.5 μ m for AA5052 and 0.5 μ m for AA5083. A relatively uniform nitrided surface layer composed of AIN can be observed on the AA5052 substrate. The grains size near the interfaces between the substrate and AIN layer were smaller than that near the surface. On the surface of AIN layer, the concentration of nitrogen was high and in the middle of AIN layer it had a constant concentration like the aluminum and the concentration was decreased with approaching to the interface. On the surface of nitrided AA5083, a uniform AIN layer was not formed as the reason for the high nitriding temperature.
Azab, Sonya M. S.; Hirshon, Jon Mark; Hayes, Bryan D.; El-Setouhy, Maged; Smith, Gordon S.; Sakr, Mahmoud Lotfy; Tawfik, Hany; Klein-Schwartz, Wendy
2016-01-01
Introduction Pediatric poisonings represent a major and preventable cause of morbidity and mortality throughout the world. Epidemiologic information about poisoning among children in many lower- and middle-income countries is scarce. This study describes the epidemiology of acute poisonings in children presenting to Ain Shams University's Poisoning Treatment Center (ASU-PTC) in Cairo and determines the causative agents and characteristics of acute poisoning in several pediatric age groups. Methods This retrospective study involved acutely poisoned patients, 0 to 18 years of age, who presented to the ASU-PTC between 1/1/2009 and 12/31/2013. Data were extracted from electronic records maintained by the ASU-PTC. Collected data included demographics, substance of exposure, circumstances of the poisoning, patient disposition, and outcome. Results During the 5-year study period, 38,470 patients meeting our criteria were treated by the ASU-PTC; 19,987 (52%) were younger than 6 years of age; 4,196 (11%) were 6 to 12 years; and 14,287 (37%) were >12 years. Unintentional poisoning accounted for 68.5% of the ingestions, though among adolescents 84.1% of ingestions were with self-harm intent. In all age groups, the most frequent causative drugs were non-opioid analgesics, antipyretics, and antirheumatics. The most common nonpharmaceutical agents were corrosives in preschool children and pesticides in adolescents. Most patients had no/minor effects (29,174 [75.8%]); hospitalization rates were highest among adolescents. There were 119 deaths (case fatality rate of 0.3), primarily from pesticide ingestion. Conclusion Poisoning in preschool children is mainly unintentional and commonly due to nonpharmaceutical agents while poisoning in adolescents is mainly intentional (self-harm). Pesticides, mainly organophosphorous compounds and carbamates, were the most frequent agent leading to morbidity and mortality. PMID:26653953
In situ EELS and TEM observation of Al implanted with nitrogen ions
International Nuclear Information System (INIS)
Hojou, K.; Furuno, S.; Kushita, K.N.; Otsu, H.; Izui, K.
1995-01-01
Formation processes of Aluminum nitride (AIN) in Aluminum (AI) implanted with nitrogen were examined by in situ EELS and TEM observations during nitrogen ion implantation in an electron microscope at room temperature and 400 deg C. AIN phase was identified both by EDP and EELS after nitrogen ion implantation to 6 x 10 20 (N + )/m 2 . The observed peak (20.8 eV) in EELS spectra was identified as plasmon loss peak of AIN formed in AI. The binding energy of N ls in AI was found to shift by about 4 eV to the lower side with increasing nitrogen-ion fluence. Unreacted AI was also found to remain in the AIN films after high fluence implantation both at room temperature and 400 deg C. (authors). 11 refs., 5 figs., 2 tabs
Teatrilugu nendest, kes teatris ei käi / Tuuli Koch
Koch, Tuuli
2000-01-01
Nr. 52/1999. Martin McDonaghi "Mägede iluduskuninganna" Vanemuises, lavastaja Ain Mäeots. Esietendus oli 5. nov. Ka Ain Mäeotsa ja näitlejate Liina Tennosaare ning Margus Jaanovitsi arvamusi näidendist
Wirth, Eva K; Roth, Stephan; Blechschmidt, Cristiane; Hölter, Sabine M; Becker, Lore; Racz, Ildiko; Zimmer, Andreas; Klopstock, Thomas; Gailus-Durner, Valerie; Fuchs, Helmut; Wurst, Wolfgang; Naumann, Thomas; Bräuer, Anja; de Angelis, Martin Hrabé; Köhrle, Josef; Grüters, Annette; Schweizer, Ulrich
2009-07-29
Thyroid hormone transport into cells requires plasma membrane transport proteins. Mutations in one of these, monocarboxylate transporter 8 (MCT8), have been identified as underlying cause for the Allan-Herndon-Dudley syndrome, an X-linked mental retardation in which the patients also present with abnormally high 3',3,5-triiodothyronine (T(3)) plasma levels. Mice deficient in Mct8 replicate the thyroid hormone abnormalities observed in the human condition. However, no neurological deficits have been described in mice lacking Mct8. Therefore, we subjected Mct8-deficient mice to a comprehensive immunohistochemical, neurological, and behavioral screen. Several behavioral abnormalities were found in the mutants. Interestingly, some of these behavioral changes are compatible with hypothyroidism, whereas others rather indicate hyperthyroidism. We thus hypothesized that neurons exclusively dependent on Mct8 are in a hypothyroid state, whereas neurons expressing other T(3) transporters become hyperthyroid, if they are exposed directly to the high plasma T(3). The majority of T(3) uptake in primary cortical neurons is mediated by Mct8, but pharmacological inhibition suggested functional expression of additional T(3) transporter classes. mRNAs encoding six T(3) transporters, including L-type amino acid transporters (LATs), were coexpressed with Mct8 in isolated neurons. We then demonstrated Lat2 expression in cultured neurons and throughout murine brain development. In contrast, LAT2 is expressed in microglia in the developing human brain during gestation, but not in neurons. We suggest that lack of functional complementation by alternative thyroid hormone transporters in developing human neurons precipitates the devastating neurodevelopmental phenotype in MCT8-deficient patients, whereas Mct8-deficient mouse neurons are functionally complemented by other transporters, for possibly Lat2.
Richel, Olivier; de Vries, Henry J C; van Noesel, Carel J M; Dijkgraaf, Marcel G W; Prins, Jan M
2013-04-01
Anal cancer is an increasing issue in HIV-positive men who have sex with men (MSM). Screening for its precursor, anal intraepithelial neoplasia (AIN), is subject of discussion. Current treatment options are suboptimum and have not been compared in a prospective trial. We compared efficacy and side-effects of imiquimod, topical fluorouracil, and electrocautery for the treatment of AIN. In this open-label randomised trial, we included HIV-positive MSM older than 18 years visiting the HIV outpatient clinic of the Academic Medical Center, Amsterdam, Netherlands. Patients with histologically confirmed AIN were randomly assigned to receive either 16 weeks of imiquimod (three times a week), 16 weeks of topical fluorouracil (twice a week), or monthly electrocautery for 4 months. Randomisation was done with random block sizes of three and six, stratified for AIN grade (AIN grades 1, 2, or 3) and AIN location (peri-anal or intra-anal). Participants were assessed by high-resolution anoscopy 4 weeks after treatment. Responding patients returned for follow-up 24 weeks, 48 weeks, and 72 weeks after treatment. The primary endpoint was histological resolution of AIN measured 4 weeks after treatment and AIN recurrence at week 24, week 48, and week 72 after treatment. The primary analysis was done in a modified intention-to-treat population, including all patients who had received their assigned treatment at least once. The trial is registered at the Netherlands Trial Register, number NTR1236. Between Aug 12, 2008, and Dec 1, 2010, we screened 388 HIV-positive MSM for AIN by high resolution anoscopy. Of the 246 (63%) patients who had AIN, 156 (63%) were randomly assigned to either receive imiquimod (54 patients), topical fluorouracil (48 patients), or electrocautery (46 patients) following withdrawing of consent by eight patients. Modified intention-to-treat analysis showed a complete response in 13 (24%, 95% CI 15-37) patients in the imiquimod group, eight (17%, 8-30) of patients
Determination of aluminium nitride or free nitrogen in low carbon steel
International Nuclear Information System (INIS)
Guetaz, V.; Soler, M.; Massardier, V.; Merlin, J.; Ravaine, D.
2001-01-01
As the aluminium nitrides play an important role in the manufacturing of steel sheets, a specific methodology was developed based on the thermoelectric power (TEP) technique, in order to determine the AIN nitrogen by an indirect method. The free nitrogen was determined and then the AIN nitrogen was calculated by the difference between the total nitrogen and the free nitrogen. Indeed, it is easier to determine the dissolved nitrogen, the content of which gradually decreases during the AIN precipitation, than the AIN nitrogen. A low carbon aluminium killed steel was employed with 580 ppm of aluminium and 50 ppm of nitrogen. A comparison of the results obtained by TEP with those obtained by other techniques (hot hydrogen extraction, electrochemical dissolution followed by a mineralization, electrochemical dissolution followed by a sodic decomposition and the Beeghly method) was conducted, in order to determine a reliable technique likely to quantify the amount of aluminium nitrides in aluminium killed steels. With these techniques, it is possible to determine either free nitrogen or precipitated nitrogen. From an experimental point of view, the precipitation kinetics of AIN was followed during an annealing performed at 973 K (700 C) by TEP and then different precipitation states of AIN were investigated to compare the different techniques: three annealing states (when no nitrogen, half the nitrogen and the total nitrogen has precipitated) and two soaking states (1403 and 1523 K). Thus, it was possible to compare states where the AIN precipitates are in various forms (different shapes, crystallographic structures, sizes, distributions in the matrix). This work showed that the quantification by TEP, hot hydrogen extraction and electrochemical dissolution followed by a mineralization seem reliable whereas the Beeghly method gives good results only for the precipitates formed at high temperatures. In contrast, the quantification by electrochemical dissolution followed by
Directory of Open Access Journals (Sweden)
Guillaume Jannot
2016-12-01
Full Text Available MicroRNAs and Argonaute form the microRNA induced silencing complex or miRISC that recruits GW182, causing mRNA degradation and/or translational repression. Despite the clear conservation and molecular significance, it is unknown if miRISC-GW182 interaction is essential for gene silencing during animal development. Using Caenorhabditis elegans to explore this question, we examined the relationship and effect on gene silencing between the GW182 orthologs, AIN-1 and AIN-2, and the microRNA-specific Argonaute, ALG-1. Homology modeling based on human Argonaute structures indicated that ALG-1 possesses conserved Tryptophan-binding Pockets required for GW182 binding. We show in vitro and in vivo that their mutations severely altered the association with AIN-1 and AIN-2. ALG-1 tryptophan-binding pockets mutant animals retained microRNA-binding and processing ability, but were deficient in reporter silencing activity. Interestingly, the ALG-1 tryptophan-binding pockets mutant phenocopied the loss of alg-1 in worms during larval stages, yet was sufficient to rescue embryonic lethality, indicating the dispensability of AINs association with the miRISC at this developmental stage. The dispensability of AINs in miRNA regulation is further demonstrated by the capacity of ALG-1 tryptophan-binding pockets mutant to regulate a target of the embryonic mir-35 microRNA family. Thus, our results demonstrate that the microRNA pathway can act independently of GW182 proteins during C. elegans embryogenesis.
Wireless intelligent network: infrastructure before services?
Chu, Narisa N.
1996-01-01
The Wireless Intelligent Network (WIN) intends to take advantage of the Advanced Intelligent Network (AIN) concepts and products developed from wireline communications. However, progress of the AIN deployment has been slow due to the many barriers that exist in the traditional wireline carriers' deployment procedures and infrastructure. The success of AIN has not been truly demonstrated. The AIN objectives and directions are applicable to the wireless industry although the plans and implementations could be significantly different. This paper points out WIN characteristics in architecture, flexibility, deployment, and value to customers. In order to succeed, the technology driven AIN concept has to be reinforced by the market driven WIN services. An infrastructure suitable for the WIN will contain elements that are foreign to the wireline network. The deployment process is expected to seed with the revenue generated services. Standardization will be achieved by simplifying and incorporating the IS-41C, AIN, and Intelligent Network CS-1 recommendations. Integration of the existing and future systems impose the biggest challenge of all. Service creation has to be complemented with service deployment process which heavily impact the carriers' infrastructure. WIN deployment will likely start from an Intelligent Peripheral, a Service Control Point and migrate to a Service Node when sufficient triggers are implemented in the mobile switch for distributed call control. The struggle to move forward will not be based on technology, but rather on the impact to existing infrastructure.
Sikk, Allan, 1975-
2014-01-01
Ülevaade Eesti poliitilisest elust 2013. aastal. Käsitletakse kohalikke valimisi, muutusi valitsuse kooseisus, Riigikogu tegemisi, aga ka rahvakogu ettepanekuid, Reformierakonna rahastusskandaali jt sündmusi.
Sikk, Allan, 1975-
2013-01-01
Ülevaade Eesti valitsuses 2012. aastal toimunud muutustest, sisepoliitika olulisematest arengutest (protestid ACTA vastu, Rahvakogu kokkutulek, Silvergate, opositsiooni tegevus, arutelud ESM-i ümber, venekeelsest koolist Eestis)
Sikk, Allan, 1975-
2012-01-01
Ülevaade Eesti poliitika olulisematest sündmustest 2011. aastal, mille hulgas on nii Riigikogu kui ka presidendi valimised, märgitakse skandaali ja korruptsiooni seoses viisavaba liikumise võimaldamisega Shengeni viisaruumis, muutused põhiseaduses seoses Kaitsejõudude ülemjuhataja koha kaotamisega
Sikk, Allan, 1975-
2011-01-01
Ülevaade Eesti poliitika olulisematest sündmustest 2010. aastal, mille hulgas märgitakse skandaale erakondade rahaasjades, korruptsiooni seoses maamüügitehingutega, muutusi valimisseaduses seoses valimistega Euroopa Parlamenti
Soome kosmoseprojekt / Allan Valge
Valge, Allan
2006-01-01
Soome läbi aegade kõige vaadatum film on soome tudengite valmistatud ingliskeelne täispikk internetifilm - "Star Treki" paroodia "Star Wreck : In the Pirkinning" : režissöör Timo Vuorensola : peaosas Samuli Torssonen. Filmi tehti seitse aastat
Rodríguez Bernardino, Ángel
2003-01-01
La insuficiencia cardiaca congestiva (ICC) es una patología con una alta prevalencia en nuestro medio. Se ha establecido una posible relación entre la acción de los antiinflamatorios no esteroideos (AINEs) sobre la síntesis de prostaglandinas y la aparición de ICC en individuos susceptibles. Nuestro objetivo fue evaluar la asociación entre el ingreso hospitalario por ICC y el consumo previo de AINEs, estimado la contribución individual de los distintos de AINEs. Se realizó un estudio multicén...
Indian Academy of Sciences (India)
Admin
word possibly having its origin in Sanskrit). W hat is ... History and Some Perspectives on Intermolecular Forces. E Arunan. Keywords van der Waals forces, hydrogen bonding. ... A tom s have rem ained a dom ain of physics, rather than.
Pärast kõike / intervjueerinud Veiko Märka
1998-01-01
Vestlusring: Ain Mäeots, Merle Jääger, Helena Merzin, Margus Jaanovits, Riho Kütsar. Madis Kõivu võrukeelse näidendi 'Omavahelisi jutuajamisi tädi Elliga' lavastamisest Vanemuise teatris, lavastaja Ain Mäeots. Ka Kauksi Ülle kommentaar
Kaalep, Ain, 1926-
2003-01-01
Sisu: Eeslid ; Luuletaja Koghazi ; Elav kuningas ; Neli legendi : Mungasuudlus ; Dorzhiin ; Legend meister Albrechtist ; Aafrika muld. Ballaad kombaini armastusest ; Kuningakatse ; Rapsoodiad : Draakoni talveuni ; Klaassepa poeg. Kaks indiaani metamorfoosi : Roti metamorfoos ; Ahvnaine. Paani surm ; Valgjärve legend ; Katsikõsõ'
Turundusteenistus / Ain Kaljurand
Kaljurand, Ain, 1965-
2004-01-01
Ilmunud ka: 2003 : annual report : [Eesti Raudtee]. - Tallinn, 2004, lk. 15-20; 2003 : godovoi ottshjot : [Eesti Raudtee]. - Tallinn, 2004, lk. 15-20. Ülevaade AS-i Eesti Raudtee 2003. a. kaubaveost veomahtude ja kaubagruppide järgi, turundusteenistusest, hinnapoliitikast
Exegi monumentum ehk palee Tallinnas / Siim Sultson
Sultson, Siim
2007-01-01
Tallinnas Narva mnt. 7 endisest Tsentrosojuzprojektist ümber ehitatud Triumph Plazast (arhitektid Vilen Künnapu ja Ain Padrik). Maja kavandati 1981. a. büroohooneks (arhitektid Olga Bruns ja Mart Kalling). Kommenteerivad Mart Port, Dmitri Bruns, Kristiina Möldre ja Ain Padrik
The Problem of Disobedience and the Intelligence Community
1990-06-01
focus on the technological and analytical aspects of the profession. Despite some highly successful but less-than- savory operations in the past,3 there... Allan Bloom, The Closing of the American Mind (New York: Simon & Schuster, 1987), p. 26. 23. Thomas B. Allen and Norman Polmar, Merchants of Treason...Waldo Emerson. New York: Modern Library, 1940. Bloom, Allan . The Closing of the American Mind. New York: Simon & Schuster, 1942. Carter, Jimmy
Automating the AFROTC Four-Year Scholarship Program.
1986-04-01
ATCH 2 b1 C -d C4 4" %C N 0" cl4 es C4 CN 1 onin %DG C1 06 0 -0 40 V 44-4 LIU-4- c4 A: U. -4 La 4 E vt a-’ iv El "l 04 0 0.I t b U El 4 V do v 0 CoU. -4...CEEB CLAS~S BOARD 1ST 2ND DCF QEP/ STRT,"’ HWFADC CfI3; PEL SCORES SCORE COMP SCOPE STAND RAMK".,H~DC ’ PREF PREF RACE PREY" rTL B1 = 46/1 C hiroms...A/N 88 Fencing 4 AIN 89 La Crosse 4 AIN 90 Rifle/Pistol 4 AIN 91 Rugby 4 AIN 92 Track 4 A/N 93 Wrestling 4 A/N 94 Others (Name and Codes) 15 A/N 95
NUOVO, Gerard J.; GRINSZTEJN, Beatriz; FRIEDMAN, Ruth K.; VELOSO, Valdiléa G.; CUNHA, Cynthia B.; COUTINHO, José R.; VIANNA-ANDRADE, Cecilia; OLIVEIRA, Nathalia S.; WOODHAM, Andrew W.; DA SILVA, Diane M.; KAST, W. Martin
2016-01-01
Objective The aim of the current study was to evaluate secretory leukocyte protease inhibitor (SLPI) expression in anal biopsies from HIV-positive (HIV+) individuals, and compare that to anal intraepithelial neoplasia (AIN) diagnoses and human papillomavirus (HPV) status. Design This is a cross-sectional study of a cohort of 54 HIV+ (31 males and 23 females) from an AIDS clinic in Rio de Janeiro, Brazil. Methods The study material consisted of anorectal tissue biopsies obtained from HIV+ subjects, which were used to construct tissue microarray paraffin blocks for immunohistochemical analysis of SLPI expression. Biopsies were evaluated by an expert pathologist and classified as low-grade anal intraepithelial neoplasia (AIN1), high-grade anal intraepithelial neoplasia (AIN2/3), or normal squamous epithelium. Additionally, DNA from the biopsies was extracted and analyzed for the presence of low- or high-risk HPV DNA. Results Histologically normal squamous epithelium from the anorectal region showed strong positive SLPI staining in 17/20 (85%) samples. In comparison, 9/17 (53%) dysplastic squamous epithelial samples from AIN1 patients showed strong SLPI staining, and only 5/17 (29%) samples from AIN2-3 patients exhibited strong SPLI staining, which both were significantly fewer than those from normal tissue (p=0.005). Furthermore, there was a significantly higher proportion of samples in which oncogenic high-risk HPV genotypes were detected in low SLPI expressing tissues than that in tissues with high SLPI expression (p=0.040). Conclusion Taken together these results suggest that low SLPI expression is associated with high-risk HPV infections in the development of AIN. PMID:27149102
Richel, Olivier; Quint, Koen D.; Lindeman, Jan; van Noesel, Carel J. M.; de Koning, Maurits N. C.; van den Munckhof, Henk A. M.; de Vries, Henry J. C.; Prins, Jan M.; Quint, Wim G. V.
2014-01-01
High-grade anal intraepithelial neoplasia (AIN) is present in many human immunodeficiency virus (HIV)-positive men who have sex with men. The major etiologic factor is infection with an oncogenic human papillomavirus (HPV) genotype. We investigated whether individual components of high-grade AIN are
Veronezi, Regina de Cássia [UNESP
2007-01-01
Os antiinflamatórios não esteroidais (AINEs) são rotineiramente usados na medicina eqüina como analgésicos e antiinflamatórios, sendo potentes controladores da dor. Entretanto, estes fármacos provocam alguns efeitos indesejáveis, como por exemplo, lesões renais e gastrointestinais. Os efeitos adversos dos AINEs ocorrem com a inibição da COX-1, enquanto os efeitos benéficos são observados com a inibição da enzima COX-2. Com o surgimento dos AINEs seletivos para COX-2, os efeitos adversos são c...
International Nuclear Information System (INIS)
Yue, Ruirui; Zhang, Qiang; Wang, Caiqin; Du, Yukou; Yang, Ping; Xu, Jingkun
2013-01-01
Highlights: • Electropolymerization of 5-aminoindole (AIn) in the presence of graphene (GE). • Significant catalytic effect of GE on the polymerization of AIn. • PAIn/GE/GC used as Pt catalyst support. • The enhanced catalytic activity of Pt/PAIn/GE/GC for methanol electrooxidation. -- Abstract: 5-Aminoindole (AIn) was electropolymerized on graphene (GE) modified glass carbon (GC) electrode in 0.5 M H 2 SO 4 aqueous solution containing 0.01 M AIn. Because of the catalytic effect of GE, the polymerization efficiency of AIn and the electrochemical activity of as-formed poly(5-aminoindole) (PAIn) were significantly improved on GE/GC electrode as compared to that on the bare GC electrode. The prepared PAIn/GE/GC electrode was used as substrate for Pt particle electrodeposition. SEM, EDX and Raman spectral were used to characterize the prepared electrodes. Electrocatalytic experiments demonstrate that the Pt/PAIn/GE/GC electrode possesses high catalytic activity toward methanol electrooxidation in alkaline medium, due to the good dispersion of Pt particles on PAIn/GE/GC and the electronic interactions between the metal particles and the polymer matrixes. Thus, PAIn can be a promising alternative for polymeric catalyst support in direct alcohol fuel cells
Energy Technology Data Exchange (ETDEWEB)
Dewar, R L; Mills, R; Hole, M J, E-mail: robert.dewar@anu.edu.a [Department of Theoretical Physics and Plasma Research Laboratory, Research School of Physics and Engineering, Australian National University, Canberra ACT 0200 (Australia)
2009-05-01
The celebration of Allan Kaufman's 80th birthday was an occasion to reflect on a career that has stimulated the mutual exchange of ideas (or memes in the terminology of Richard Dawkins) between many researchers. This paper will revisit a meme Allan encountered in his early career in magnetohydrodynamics, the continuation of a magnetohydrodynamic mode through a singularity, and will also mention other problems where Allan's work has had a powerful cross-fertilizing effect in plasma physics and other areas of physics and mathematics. To resolve the continuation problem we regularize the Newcomb equation, solve it in terms of Legendre functions of imaginary argument, and define the small weak solutions of the Newcomb equation as generalized functions in the manner of Lighthill, i.e. via a limiting sequence of analytic functions that connect smoothly across the singularity.
Dewar, R. L.; Mills, R.; Hole, M. J.
2009-05-01
The celebration of Allan Kaufman's 80th birthday was an occasion to reflect on a career that has stimulated the mutual exchange of ideas (or memes in the terminology of Richard Dawkins) between many researchers. This paper will revisit a meme Allan encountered in his early career in magnetohydrodynamics, the continuation of a magnetohydrodynamic mode through a singularity, and will also mention other problems where Allan's work has had a powerful cross-fertilizing effect in plasma physics and other areas of physics and mathematics. To resolve the continuation problem we regularize the Newcomb equation, solve it in terms of Legendre functions of imaginary argument, and define the small weak solutions of the Newcomb equation as generalized functions in the manner of Lighthill, i.e. via a limiting sequence of analytic functions that connect smoothly across the singularity.
International Nuclear Information System (INIS)
Dewar, R L; Mills, R; Hole, M J
2009-01-01
The celebration of Allan Kaufman's 80th birthday was an occasion to reflect on a career that has stimulated the mutual exchange of ideas (or memes in the terminology of Richard Dawkins) between many researchers. This paper will revisit a meme Allan encountered in his early career in magnetohydrodynamics, the continuation of a magnetohydrodynamic mode through a singularity, and will also mention other problems where Allan's work has had a powerful cross-fertilizing effect in plasma physics and other areas of physics and mathematics. To resolve the continuation problem we regularize the Newcomb equation, solve it in terms of Legendre functions of imaginary argument, and define the small weak solutions of the Newcomb equation as generalized functions in the manner of Lighthill, i.e. via a limiting sequence of analytic functions that connect smoothly across the singularity.
Chairman of the Joint Chiefs of Staff Strategy Essay Competition: Essays 2002
2002-10-01
onset of hostilities, one overarching concern is the very nature of the surrogate. Allies of convenience may not be great people or savory characters, and...government were invariably failures.”51 Williamson Murray and Allan Millett observed in their work on net as- sessments, “If it is difficult to calculate...Military Innovation in Peacetime,” in Williamson Murray and Allan R. Millett, eds., Military Innovation in the Interwar Period (New York: Cambridge
DEFF Research Database (Denmark)
Nielsen, Ann; Plum, Christian Edinger Munk; Kjaer, Susanne K
2012-01-01
The aim of the study was to determine the incidences of anal cancer and high-grade anal intraepithelial neoplasia (AIN2/3) over time in Danish women and men. Describing the burden of anal cancer and AIN may be valuable in future evaluations of the human papillomavirus (HPV) vaccine. We included all...... anal cancers in the Danish Cancer Register in the period 1978-2008 and all cases of AIN2/3 in the Danish Registry of Pathology. Overall and age-, period- and histology-specific incidence rates were estimated. During the 30-year period, 2187 anal cancers were identified, two thirds of which were...... in women. Between 1978-1982 and 2003-2008, the age-standardized incidence rate of anal cancer increased from 0.68 to 1.48 per 100 000 person-years in women and from 0.45 to 0.80 per 100 000 person-years in men. Although there is no systematic screening for AIN in Denmark, we nevertheless identified 608...
Surface morphology of Al0.3Ga0.7N/Al2O3-high electron mobility transistor structure.
Cörekçi, S; Usanmaz, D; Tekeli, Z; Cakmak, M; Ozçelik, S; Ozbay, E
2008-02-01
We present surface properties of buffer films (AIN and GaN) and Al0.3Gao.zN/Al2O3-High Electron Mobility Transistor (HEMT) structures with/without AIN interlayer grown on High Temperature (HT)-AIN buffer/Al2O3 substrate and Al2O3 substrate. We have found that the GaN surface morphology is step-flow in character and the density of dislocations was about 10(8)-10(9) cm(-2). The AFM measurements also exhibited that the presence of atomic steps with large lateral step dimension and the surface of samples was smooth. The lateral step sizes are in the range of 100-250 nm. The typical rms values of HEMT structures were found as 0.27, 0.30, and 0.70 nm. HT-AIN buffer layer can have a significant impact on the surface morphology of Al0.3Ga0.7N/Al2O3-HEMT structures.
Feng, C; Wang, S G; Yang, M Y; Zhang, E; Zhan, Q; Jiang, Y; Li, B H; Yu, G H
2012-02-01
Based on interfacial manipulation of the MgO single crystal substrate and non-magnetic AIN compound, a L1(0)-FePt perpendicular ultrathin film with the structure of MgO/FePt-AIN/Ta was designed, prepared, and investigated. The film is comprised of L1(0)-FePt "magnetic islands," which exhibits a perpendicular magnetic anisotropy (PMA), tunable coercivity (Hc), and interparticle exchange coupling (IEC). The MgO substrate promotes PMA of the film because of interfacial control of the FePt lattice orientation. The AIN compound is doped to increase the difference of surface energy between FePt layer and MgO substrate and to suppress the growth of FePt grains, which takes control of island growth mode of FePt atoms. The AIN compound also acts as isolator of L1(0)-FePt islands to pin the sites of FePt domains, resulting in the tunability of Hc and IEC of the films.
Pap smears for men: a vision of the future?
LENUS (Irish Health Repository)
Oon, S F
2012-02-01
BACKGROUND: Anal intraepithelial neoplasia (AIN) rarely receives as much publicity as its neighbouring orifice, the cervix. As in the cervix, intraepithelial neoplasias are precursors to cancer in the anal canal. AIN and cervical interstitial neoplasia (CIN) undergo dysplasia as a consequence of human papillomavirus (HPV) infection. Since the advent of screening with the Pap smear in CIN, cervical cancer has plummeted to a fifth of its initial incidence. Anal cancer, however, has been rising, with a predilection for human immunodeficiency virus-infected men. HPV causes a squamous epithelial dysplasia and converts healthy tissue into AINs of increasing severity until anal cancer manifests. CLINICAL CASE: This article describes a clinical case of anogenital HPV infection refractory to medical and surgical therapy. It also describes an effective surgical excision technique associated with a good cosmetic outcome. CONCLUSIONS: The paper concludes by briefly discussing the implications of a national screening programme against AIN in the future.
Hypothyroidism could be the only manifestation of mitochondrial ...
African Journals Online (AJOL)
Hoda Tomoum
2012-11-24
Nov 24, 2012 ... Hypothyroidism could be the only manifestation of mitochondrial T8993C mutation in Leigh syndrome. Hoda Tomoum a. , Solaf M. Elsayed b,. *, Elizabeth Berry-Kravis c a Department of Pediatrics, Ain Shams University, Cairo, Egypt b Genetics Unit, Department of Pediatrics, Ain Shams University, Cairo, ...
AVALIAÇÃO DA DISPENSAÇÃO DE FÁRMACOS PARCIALMENTE SELETIVOS PARA COX-2
Directory of Open Access Journals (Sweden)
Cícero Cardoso VALLE FILHO
2015-12-01
Full Text Available Uma pesquisa foi realizada com o objetivo de avaliar um potencial aumento na venda de fármacos anti-inflamatórios não esteroidais (AINEs parcialmente seletivos para a COX-2 durante o período de julho de 2009 a junho de 2011, em uma drogaria localizada no município de Itaperuna, estado do Rio de Janeiro. Durante o período estudado foi dispensado um total de 802 AINEs parcialmente seletivos para a COX-2, dentre os quais 59,85% foram de nimesulida, 5,74% de etodolaco e 34,41% de meloxicam. No primeiro semestre avaliado a dispensação total de AINEs parcialmente seletivos foi equivalente a 92, no segundo semestre a dispensação total foi equivalente a 159, no terceiro semestre a dispensação total foi de 219 AINEs parcialmente seletivos para COX-2 e no quarto semestre foram dispensados 332. Os resultados indicaram maior dispensação dos medicamentos desta classe no mês de abril de 2011 sendo que tanto a nimesulida, quanto o meloxicam e o etodolaco foram mais dispensados no último semestre do estudo. De acordo com a metodologia utilizada pode-se concluir que a dispensação dos AINEs parcialmente seletivos vem crescendo a cada ano e que a nimesulida apresenta o maior índice de crescimento; a maior indicação da nimesulida tem sido para crianças; os meses correspondentes ao período de inverno apresentam maior dispensação de AINEs parcialmente seletivos para a COX-2.
Hydrogeological and isotopic studies for selected springs in Sinai Peninsula
Energy Technology Data Exchange (ETDEWEB)
Hamza, M S; Awad, M A; El-gamal, S A [Atomic Energy Authority, Cairo Egypt and Middle Eastern Regional Radioisotope Center for The Arab Countries, Dokki, 12311, Cairo (Egypt); Hammad, F A [Desert Research Centre, Materia, Cairo, (Egypt)
1995-10-01
This paper deals with the hydrogeology and isotopic composition of water samples collected from selected spring in sinai (e.g. Algudierate, Alqusiema, qidis and Isram) in order to identify their genesis, their interaction with the host rocks and mixing trend. Results of isotopic composition have indicated the similarity in the hydrogeologic situation of Ain qidis and Ain-al-gudierate, while Ain Isram has shown a marked difference in its stable isotope and this could be due to evaporation effect. The isotopic and hydrochemical constituents of the studied springs reflect eater of a meteoric origin with a possible contamination from surficial materials (evaporates) and deeper aquifers. 6 figs., 2 tabs.
2007-12-14
University Press, 1997), 90-92. 5House, 47-48. 6Kier, 89-90. 7Brian Bond and Williamson Murray, The British Armed Forces, 1918-39 in Allan R. Millet ...Figure 5. The German Defenses on June 6, 1944. nage, Jean -Pierre Benamou, BSource: Georges Ber ernard Crochet, François de Lannoy, Laurent Mari, and...Murray, “British Military Effectiveness in the Second World War” Military Effectiveness, Vol. 3, ed. Allan R. Millet and Williamson Murray (Boston
1984-05-01
said area resident now, or some type of private finmc- taxes are from the River Park Terence Savory . One piece of his land ing may have to be...Mrs Mary Hutchinson Syto McLo Chuck Forter Robert Kirkwood Founder Arthur J. POuUl Allan B. Jacobs’ "£xecufte Com"Who Gerrie Kretimer Dorothy Erskin t...KLIEWER, Dixon ALLAN WITT. Vice President- Fairfield MILTON WALLACE. Rio Vista GUIDO!E. COLLA. Secretary - Suisun DON MUSANTE. Benicia ..., RAYMOND
Directory of Open Access Journals (Sweden)
YOUCEF BENMOUSSA
2015-07-01
Full Text Available Resources And Water Sharing In The Oasis Of Kenadsa (Southwest Algeria; Historical Approach And Findings. Kenadsa, a peaceable oasis in southwestern Algeria, with the discovery and exploitation of coal (1917 - 1956, underwent graft of Western models for its development. That has cleared the oasis of the spatial dimension and tr ansformed into a mining village by excellence. These networks of foggaras draining groundwater, enclosed in a multilayer aquifer, which becomes free on the northern border of the Ksar. There were 25 foggaras of sources (Ain, each of which had its own drai nage channels to downstream gardens of Ksar. The distribution of water from these sources was ensured by a complex network, fed by drainage galleries that meander the alleys of Ksar and gives place to access points for domestic uses. The right to water is generally private property; one could dispose of according to modes of transmission of a property. It’s sharing for irrigation is governed by the volume and time. Currently, only some ten foggaras of sources that are still alive (Ain Sidi Mbarek, Ain Dir, Belkaid Ain, Ain Sheikh ..... These waters are characterized by mediocre quality (pH 7.31, CE: 4.88 ms / cm, RS 2420 mg / l Ca ++: 288.2 mg / l, SO4 -- : 468 83 mg / l..
Bulletin of Materials Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Laboratoire de Physique Fondamentale et Applique (LPFA), Faculté des Sciences Ain Chock, Université Hassan II, B.P. 5366 Mâarif, Casablanca, Maroc; Laboratoire de Physique des Matériaux, Micro-électronique, Automatique et Thermique (LPMMAT), Faculté des Sciences Ain Chock, Université Hassan II, B.P. 5366 ...
A Strong Impact of Genetic Background on Gut Microflora in Mice
Directory of Open Access Journals (Sweden)
R. Steven Esworthy
2010-01-01
Full Text Available Genetic background affects susceptibility to ileocolitis in mice deficient in two intracellular glutathione peroxidases, GPx1 and GPx2. The C57BL/6 (B6 GPx1/2 double-knockout (DKO mice have mild ileocolitis, and 129S1/Sv (129 DKO mice have severe inflammation. We used diet to modulate ileocolitis; a casein-based defined diet with AIN76A micronutrients (AIN attenuates inflammation compared to conventional LabDiets. Because luminal microbiota induce DKO ileocolitis, we assessed bacterial composition with automated ribosomal intergenic-spacer analysis (ARISA on cecal DNA. We found that mouse strain had the strongest impact on the composition of microbiota than diet and GPx genotypes. In comparing AIN and LabDiet, DKO mice were more resistant to change than the non-DKO or WT mice. However, supplementing yeast and inulin to AIN diet greatly altered microflora profiles in the DKO mice. From 129 DKO strictly, we found overgrowth of Escherichia coli. We conclude that genetic background predisposes mice to colonization of potentially pathogenic E. coli.
Análisis coste-efectividad del empleo de celecoxib en el tratamiento de la artrosis
Directory of Open Access Journals (Sweden)
Moreno A.
2003-01-01
Full Text Available Antecedentes: Los antiinflamatorios no esteroideos (AINE, utilizados en el tratamiento de la artrosis, pueden producir reacciones adversas gastrointestinales (GI graves. Celecoxib, un inhibidor específico de la ciclooxigenasa 2 (COX-2, ha demostrado una eficacia equivalente a los AINE convencionales con un mejor perfil de tolerabilidad y seguridad. Objetivo: La finalidad de este estudio ha sido realizar un análisis coste-efectividad sobre el uso de celecoxib frente a los AINE clásicos en el tratamiento de la artrosis. Material y métodos: El análisis coste-efectividad se ha diseñado mediante un modelo farmacoeconómico, definiéndose como unidad de efectividad a cada año de vida ganado tras la toma de celecoxib o AINE. La probabilidad de que aparezcan los diferentes resultados clínicos se ha obtenido de artículos publicados y de asunciones incorporadas. Sólo se han valorado los costes directos médicos (medicación, hospitalización, pruebas complementarias, analíticas, visitas extras, etc., sin haberse incluido otros costes. La perspectiva del estudio ha sido la del Sistema Nacional de Salud y el horizonte temporal elegido ha sido de 6 meses. Resultados: El coste adicional por cada año de vida ganado secundario al uso de celecoxib frente a los AINE clásicos asciende a 8.017 ? (1.333.834 ptas.. El análisis de sensibilidad muestra cómo estos valores son sensibles a la modificación del coste de AINE y gastroprotector, así como a la inclusión de grupos poblacionales con edades más bajas. Conclusiones: Celecoxib puede ser considerado como una opción coste-efectiva en el tratamiento de la artrosis, ya que va a evitar muertes y a ganar años de vida para los pacientes con un coste adicional razonable y moderado, cuando se compara con los AINE. Su eficiencia aumenta a medida que se utiliza en poblaciones con menor edad media y, probablemente, en aquellas con mayor riesgo de desarrollar complicaciones GI.
Há uma associação entre anti-inflamatórios não-esteroides e nefropatia induzida por contraste?
Directory of Open Access Journals (Sweden)
Luciano Passamani Diogo
Full Text Available FUNDAMENTO: A associação entre o uso de anti-inflamatórios não-esteroides (AINEs e insuficiência renal aguda ou crônica é bem documentada, mas evidências sobre a associação entre AINEs e nefropatia induzida por contraste (NIC não são encontradas na literatura. OBJETIVO: Avaliar uma possível associação entre AINEs e NIC. MÉTODOS: Em um estudo de coorte, através da entrevista clínica de pacientes que foram submetidos à cateterização cardíaca, analisamos o uso de AINEs e sua associação com desenvolvimento de NIC, através da alteração dos níveis de creatinina sérica ou taxa de filtração glomerular em 48 ou 72 horas. RESULTADOS: No período de julho de 2005 a julho de 2006, 236 pacientes foram incluídos no estudo, dos quais 29 foram posteriormente excluídos. A incidência de NIC foi 10,37% (20 de 207 e 42% dos pacientes estavam recebendo AINEs até o momento da avaliação. Não houve associação entre o uso de AINEs e o desenvolvimento de NIC com OR de 1,293; IC95% (0,46-4,2. O estudo detectou fatores de risco conhecidos para o desenvolvimento de NIC, tais como diabete, com OR de 2,77; IC95% (1,05-7,47 e insuficiência renal crônica com OR de 3,48; IC95% (1,1-11,07 e também sugeriu uma ação protetora da hidratação com solução salina com OR de 0,166; IC95% (0,03-0,92. CONCLUSÃO: Com base nos dados obtidos, concluímos que não houve associação entre NIC e uso prévio de AINEs, pelo menos com um OR > 2,85, o qual nossa amostra detectou.
1991-03-01
REINFUSION SYSTEM IN REDUCING THE NEED FOR WHOLE BLOOD TRANSFUSION (HSC) PRINCIPAL INVESTIGATOR: Allan L. Bucknell, M.D. AUTHORS: Michael B. Simpson, M.D...einfysion SVt8T in Reducing the Need for whole Blood rans uson , 61102A Allan L. Bucknell, M.D.; Michael B. Simpson, M.D. 3MI61102BS12.ZZ Kevin P...for transfusion. J Bone Joint Suig. 1987; 6,QA:319). 3. Tlhomson JD), C al laghan JJ, Savory C’G, Stanton RP, Pierce RN. P’rior deposition of
Valge, Allan
2005-01-01
Täispikk arvutianimatsioon "Valiant" : stsenarist George Webster : režissöör Gary Chapman : produtsent John Williams : Suurbritannia 2005. Lisatud Jaan Ruusi poolt kogutud väljavõtteid arvustustest inglise meedias
Hollywood kohtu ette / Allan Espenberg
Espenberg, Allan
2005-01-01
Uruguay plaanib kohtusse kaevata mängufilmi "Sügavuses" ("Submerged") tegijad, kuna linalugu loob sellest Lõuna-Ameerika riigist väära ning mõnitava pildi. Režissöör Anthony Hickox, peaosas Steven Seagal : USA 2005
Musta Mandri filmikunst / Allan Espenberg
Espenberg, Allan
2008-01-01
Aafrika tähtsaim ja suurejoonelisim filmifestival FESPACO (Aafrika filmi- ja televisioonifestival). Toimumispaigaks Burkina Faso pealinn Ouagadougou. Ka teistest Aafrika mandril toimuvatest filmifestivalidest
Prantsuskeelsete poliitikute lahkumine / Allan Espenberg
Espenberg, Allan
2007-01-01
Kolm hiljuti lahkunud prantsuskeelset poliitikut, Prantsusmaa endised peaministrid Pierre Messmer ja Raymond Barre ning Luksemburgi endine peaminister Gaston Thorn andsid suure panuse nii Euroopa kui oma kodumaa poliitikasse ja majandusse
Psychophysics of associative learning: Quantitative properties of subjective contingency.
Maia, Susana; Lefèvre, Françoise; Jozefowiez, Jérémie
2018-01-01
Allan and collaborators (Allan, Hannah, Crump, & Siegel, 2008; Allan, Siegel, & Tangen, 2005; Siegel, Allan, Hannah, & Crump, 2009) recently proposed to apply signal detection theory to the analysis of contingency judgment tasks. When exposed to a flow of stimuli, participants are asked to judge whether there is a contingent relation between a cue and an outcome, that is, whether the subjective cue-outcome contingency exceeds a decision threshold. In this context, we tested the following hypotheses regarding the relation between objective and subjective cue-outcome contingency: (a) The underlying distributions of subjective cue-outcome contingency are Gaussian; (b) The mean distribution of subjective contingency is a linear function of objective cue-outcome contingency; and (c) The variance in the distribution of subjective contingency is constant. The hypotheses were tested by combining a streamed-trial contingency assessment task with a confidence rating procedure. Participants were exposed to rapid flows of stimuli at the end of which they had to judge whether an outcome was more (Experiment 1) or less (Experiment 2) likely to appear following a cue and how sure they were of their judgment. We found that although Hypothesis A seems reasonable, Hypotheses B and C were not. Regarding Hypothesis B, participants were more sensitive to positive than to negative contingencies. Regarding Hypothesis C, the perceived cue-outcome contingency became more variable when the contingency became more positive or negative, but only to a slight extent. (PsycINFO Database Record (c) 2018 APA, all rights reserved).
Indrek Saar kehastub Pilistveres Rasputiniks / Aarne Mäe
Mäe, Aarne, 1967-
2008-01-01
7. aug. esietendub Pilistvere vanas rehehoones Ain Saviaugu kirjutatud ja lavastatud suvetükk "Rasputin". Suvelavastuse tõi välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas mängib näitlejast riigikogulane Indrek Saar. Lisaks lühike intervjuu lavastajaga "Lavastaja Ain Saviauk : "Ajalugu on karm" ja fakte Rasputinist - "Grigori Jefimovitsh Rasputin-Novõhh"
Pose de la première pierre du bâtiment SMA18 du Cern
CERN Press Office. Geneva
1999-01-01
On 30 April 1999, Jean Pépin, Sénateur for the Department of the Ain and President of the Conseil Général, and Professor Luciano Maiani the Director-General of CERN will lay the foundation stone of Building SMA18, financed by the Department of the Ain in the framework of France's special contribution to CERN's Large Hadron Collider (LHC) project.
Hirm, raha ja armastus / Margot Visnap, Kadi Herkül, Immo Mihkelson
Visnap, Margot, 1959-
1999-01-01
Teleteatri aastaringist - ETV kaheksa lavastust seitsmelt lavastajalt : Toomas Hussar/Ervin Õunapuu "Linnapea ehk Hirmu põhivormid". Rezh. T. Hussar. Eetris 1. jaan. 1998; A.H. Tammsaare/Ain Prosa "Ma armastasin sakslast". Rezh. A. Prosa. Eetris 24. veebr. 1998; Dennis Potter "Sa oled koor minu kohvis". Rezh. Vilja Palm. Eetris 1. jaan. 1999; Ain Prosa/Karl Ristikivi "lihtne lugu, lõpuga". Rezh. Ain Prosa. Eetris 28. nov. 1998; Betti Alver/Margus Kasterpalu "Tuulearmuke". Rezh. Elo Selirand. Eetris 23. mail 1998; Faama Filmi ja ETV teleteatri koostöö "Isa", sts. ja rezh. Mart Kivastik. Eetris 28. märtsil 1998; "Lilled Leale", sts. ja rezh. Olle Mirme Toomas Vindi novelli põhjal; Rein Saluri "Andke neile andeks", lav. Talvo Pabut. Eetris 19. okt. 1998
Allan Martinson: vajame 10 000 tarka välismaalast / Allan Martinson ; intervjueerinud Toivo Tänavsuu
Martinson, Allan, 1966-
2010-01-01
Riskikapitalifirma MTVP asutaja ja tegevjuhi arvates peaks Eestisse meelitama tarku välismaalasi. Võiksime suurendada Eesti lojaalset kodanikkonda, jagades mõnelekümnele tuhandele Eesti patrioodile mujal maailmas Eesti kodakondsuse. Startup-liikumisest ja selle üritusest Garage48
Rahvusvaheline turismikonverents / Ain Hinsberg
Hinsberg, Ain
2011-01-01
Radisson Blu Hotel Olümpias 28. aprillil korraldatud konverentsist "Läänemere regiooni turismiteadmuse toetus turismimajandusele ja -ettevõtlusele 2011-2026", millega tähistati Eesti Hotelli- ja Turismikõrgkooli EHTE 15. sünnipäeva. Thomas Mielke, Maritta Hiltuneni, Kristian Sieversi, Pauli Santala, Inese Šīrava, Maija Rozite ja Kestutis Ambrozaitise konverentsil peetud ettekannetest ja paneeldiskussioonist
DEFF Research Database (Denmark)
Di Nucci, Ezio
2016-01-01
I argue against various versions of the 'attitude' view of consent and of the 'action' view of consent: I show that neither an attitude nor an action is either necessary or sufficient for consent. I then put forward a different view of consent based on the idea that, given a legitimate epistemic ...
Oit, Ave
2012-01-01
Öko- ja looduskosmeetikas keelatud või piirangutega lubatud koostisainetest: silikoonid, etoksüleeritud emulgaatorained (PEG-ühendid), toorõli baasil valmistatud rasvained ja emulgaatorid s.h mineraalõlid ja -vahad
Directory of Open Access Journals (Sweden)
Jorge Enrique Machado-Alba
Full Text Available Con el objetivo de determinar la frecuencia de uso prolongado de antiinflamatorios no esteroideos (AINES en pacientes colombianos de alto riesgo cardiovascular (ARC se desarrolló un estudio retrospectivo en el cual se identificaron pacientes de ARC que usaron AINES por más de cinco meses continuos entre enero de 2011 y marzo de 2013. Se identificó a los pacientes que recibían crónicamente nitratos, digitálicos, y clopidogrel y ácido acetil salicílico (ASA, quienes fueron identificados como de ARC. Se realizó un análisis de frecuencias de uso según la comedicación recibida. Se encontró uso concomitante de AINES en el 0,35% de los consumidores de nitratos (tiempo promedio: 9,5 ± 4,4 meses, en el 0,36% de los consumidores de clopidogrel y ASA (tiempo promedio: 9,3 ± 3,4 meses, y en el 0,4% de los consumidores de digitálicos (10,2 ± 4,6 meses. Se concluye que existe una baja proporción de uso de AINES de manera crónica en pacientes de alto riesgo cardiovascular.
LENUS (Irish Health Repository)
Mansur, Abdurrezagh
2011-01-01
Acute interstitial nephritis (AIN) is a common cause of acute kidney injury and is characterised by a dense interstitial cellular infiltrate, which has not been well defined. Previous studies have demonstrated a correlation between Epstein-Barr virus (EBV) infection and AIN. The purpose of our study was to define the nature of the interstitial immune infiltrate and to investigate the possibility of renal infection with EBV.
Directory of Open Access Journals (Sweden)
Monsalve, A.
2005-10-01
Full Text Available An important feature of aluminium killed steels is the strong influence that aluminium nitride precipitates produce in both the mechanical properties and the final microstructural characteristics of the steel. This influence is related to the different stages of the fabrication process. This paper deals with a study of the effects of aluminium nitrides on the kinetics of recrystallisation. Different heat treatments were carried out, in one case to dissolve AIN, and in the other in order to precipitate AIN. These steels were subjected to cold rolling, followed by a batch annealing process. The recrystallised fraction was measured, thus obtaining the kinetic curves. The activation energy for recrystallisation was computed in each case. The results showed that AIN precipitation during recrystallisation produces a delay in recrystallisation kinetics through a change in the activation energy value.
Los aceros calmados con aluminio presentan como característica importante, la gran influencia que ejercen los nitruros de aluminio en las propiedades mecánicas y características microestructurales finales. Esta influencia está, a su vez, relacionada con cada una de la etapas del proceso de fabricación. En el presente trabajo se ha abordado el estudio del efecto de los nitruros de aluminio sobre la cinética de recristalización. Para ello, se han llevado a cabo diversos tipos de tratamientos térmicos, con el objeto de disolver todo el AIN y, en el otro caso, de precipitar todo el AIN. A continuación, los aceros estudiados se deformaron en frío y se les realizó un recocido convencional. Se midió la fracción recristalizada evaluando la energía de activación para la recristalización. Los resultados mostraron que la precipitación de AIN durante la recristalización produce un retraso en la cinética de recristalización, a través del cambio en el valor de la energía de activación
Teatriekspressiga Äksist Põltsamaale / Riina Mägi
Mägi, Riina, 1957-
2007-01-01
Jõgevamaa harrastus- ja projektitruppide vabaõhulavastuste esietendustest 2006. aastal : Priit Aimla "Saadjärve saamise lugu" (Tabivere Harrastusteater, lavastaja Tõnis Lepp), Oskar Lutsu loomingust inspireeritud Veiko Märka "Sabani sõlmes Luts" (Palamuse Amatöörteater, lavastaja Raivo Adlas), Marina Carri "Kassirabal" projektitrupi esituses, lavastaja Ain Saviauk, Mati Tiku "Legend" (Saare Valla Metsateater, lavastaja autor), Ain Saviaugu "Ulm ehk Unistus Liivimaast" (Põltsamaa teater Ellunäod, lavastaja autor)
AnAnalytical Study of Chinese Salt (MSG: Is it Halal or Haram (Urdu
Directory of Open Access Journals (Sweden)
Dr. Junaid Akbar
2017-01-01
Full Text Available Monosodium Glutamate is the scientific name of Chinese salt, which also called Ajinomoto. Monosodium Glutamate was first discovered by the Japanese chemist Ikeda Kibunae in 1908. The MSG was firstly derived from seaweed. Later on MSG was got from meat, gluten,and vegetables etc. It can be derived from Najasul‘ain and GherNajasul‘ain things. If it was got from Najasul ‘ain, then there is a question about MSG that is it Halal(permissible/ lawful or Haram(non-permissible/unlawful. This research in this article is concluded that if the culture of MSG is Halal or the properIsti Halah has been done in Najas; MSG will be Halal(permissible/ lawful. However, where no such details are available about the culture of MSG, it should be avoid, although it cannot be declared Haram as per Islamic Jurisprudence rules
Tawfik, Hatem A; Fouad, Yousef A; Hafez, Rashad
2015-01-01
Hatem A Tawfik,1 Yousef A Fouad,2 Rashad Hafez3 1Department of Ophthalmology, Oculoplastics Service, Ain Shams University, 2Faculty of Medicine, Ain Shams University, 3Eye Subspecialty Centre, Cairo, Egypt Objective: To introduce and evaluate the safety of a novel dual-sided electrosurgery handpiece design for simultaneous tissue cutting and coagulation. Methods: We designed a prototype double-sided handpiece allowing automatic switching between two electrodes with a simple handpiece flip. T...
Directory of Open Access Journals (Sweden)
Juan Villa
2014-11-01
Conclusiones: Algunos AINE pueden disminuir la efectividad del tratamiento antihipertensivo cuando se utilizan simultáneamente con antihipertensivos, en especial con inhibidores de la enzima conversora de angiotensina, diuréticos, bloqueadores beta y antagonistas de los receptores de angiotensina. No se encontró evidencia de la modificación del efecto de los antagonistas de los canales de calcio, especialmente dihidropiridínicos, por el uso simultáneo con AINE.
Synthesis of TiCuAg thick film inks for glass frit free metallization of aluminium nitride
International Nuclear Information System (INIS)
Adlassnig, A.; Schuster, J. C.; Smetana, W.; Reicher, R.
1997-01-01
A glas frit free screen printing ink for metallization of AIN was developed. Bonding to the substrate is achieved by active metal additives. The metallic component consists of Cu and Ag powder synthesized from inorganic salts by the polyol process, and Cu-Ti powder synthesized by arc melting, milling and ultracentrifugation. This ternary powder mixture was introduced to a specifically developed organic vehicle and screen printed onto AIN. The detailed development process and the results will be presented. (author)
International Nuclear Information System (INIS)
Telesca, Luciano
2011-01-01
Research highlights: → Time-clustering behaviour in seismicity can be detected by applying the Allan Factor. → The reservoir-induced seismicity at Koyna-Warna (India) is time-clusterized. → Pre- and co-seismic increases of the time-clustering degree are revealed. - Abstract: The time-clustering behavior of the 1996-2005 seismicity of Koyna-Warna region (India), a unique site where reservoir-triggered earthquakes have been continuously occurring over the last about 50 year, has been analyzed. The scaling exponent α, estimated by using the Allan Factor method, a powerful tool to investigate clusterization in point processes, shows co-seismic and pre-seismic enhancements associated with the occurrence of the major events.
Colman, A. J.
2017-12-01
Title Food-water and society Dr. Tony Colman and Professor Tony Allan Abstract The purpose of the paper is to highlight some key relationships between water resources and society. First, water is an very important resource for society in that it provides an essential input to society's food supply chains. Secondly, it is an essential input to farmer livelihoods. About half of the families of the world still work in agriculture - albeit a declining proportion. Thirdly, farmers manage about 92% of the water consumed by society - including the blue water (surface and groundwater) for irrigation and the green water (effective rainfall) consumed on rainfed farms. They also account for about 66% of society's impacts on biodiversity and about 25% of emissions. Finally it will be argued that those who analyse allocation and management of water must recognise that farming practices and the decisions made by those who operate food supply chains - including corporates and those making public policy - must recognise that it is farmers and food consumers who determine how water is stewarded. It will be suggested that we need to understand that well informed consumers could be the regulators.
International Nuclear Information System (INIS)
Wong, R.K.
2000-01-01
After implantation of As, As + Be, and As + Ga into GaN and annealing for short durations at temperatures as high as 1500 C, the GaN films remained highly resistive. It was apparent from c-RBS studies that although implantation damage did not create an amorphous layer in the GaN film, annealing at 1500 C did not provide enough energy to completely recover the radiation damage. Disorder recovered significantly after annealing at temperatures up to 1500 C, but not completely. From SIMS analysis, oxygen contamination in the AIN capping layer causes oxygen diffusion into the GaN film above 1400 C. The sapphire substrate (A1203) also decomposed and oxygen penetrated into the backside of the GaN layer above 1400 C. To prevent donor-like oxygen impurities from the capping layer and the substrate from contaminating the GaN film and compensating acceptors, post-implantation annealing should be done at temperatures below 1500 C. Oxygen in the cap could be reduced by growing the AIN cap on the GaN layer after the GaN growth run or by depositing the AIN layer in a ultra high vacuum (UHV) system post-growth to minimize residual oxygen and water contamination. With longer annealing times at 1400 C or at higher temperatures with a higher quality AIN, the implantation drainage may fully recover
Energy Technology Data Exchange (ETDEWEB)
Wong, Raechelle Kimberly [Univ. of California, Berkeley, CA (United States)
2000-04-01
After implantation of As, As + Be, and As + Ga into GaN and annealing for short durations at temperatures as high as 1500 C, the GaN films remained highly resistive. It was apparent from c-RBS studies that although implantation damage did not create an amorphous layer in the GaN film, annealing at 1500 C did not provide enough energy to completely recover the radiation damage. Disorder recovered significantly after annealing at temperatures up to 1500 C, but not completely. From SIMS analysis, oxygen contamination in the AIN capping layer causes oxygen diffusion into the GaN film above 1400 C. The sapphire substrate (A1203) also decomposed and oxygen penetrated into the backside of the GaN layer above 1400 C. To prevent donor-like oxygen impurities from the capping layer and the substrate from contaminating the GaN film and compensating acceptors, post-implantation annealing should be done at temperatures below 1500 C. Oxygen in the cap could be reduced by growing the AIN cap on the GaN layer after the GaN growth run or by depositing the AIN layer in a ultra high vacuum (UHV) system post-growth to minimize residual oxygen and water contamination. With longer annealing times at 1400 C or at higher temperatures with a higher quality AIN, the implantation drainage may fully recover.
Ecuador pagendas neljanda riigipea / Allan Espenberg
Espenberg, Allan
2005-01-01
Ecuadori parlament tagandas riigipea Lucio Gutierreze. L. Gutierrez, kellele sai saatuslikuks kolmele ekspresidendile amnestia andmine, pages koos perega Brasiiliasse. Lisa: Kontinendi üks sportlikumaid presidente
Jabur jaht Sudaani presidendile / Allan Espenberg
Espenberg, Allan
2009-01-01
Haagis tegutsev Rahvusvaheline Kriminaalkohus andis käsu Sudaani presidendi Omar Hassan Ahmad al-Bashiri vahistamiseks, keda süüdistatakse inimsusevastastes ja sõjakuritegudes ning Darfuri provintsis tsiviilelanike genotsiidi organiseerimises
Hiinlased upitavad Venezuelat kosmosesse / Allan Espenberg
Espenberg, Allan
2005-01-01
Mullu kirjutasid Venezuela ja Hiina on alla kirjutanud kosmosekokkuleppele, lisaks sõlmiti veel kümmekond lepingut kahepoolsete sidemete tihendamiseks põllumajanduses, mäetööstuses, transpordis, energeetikas, telekommunikatsioonis ja turismis
Eesti sai oma koorealgoritmi / Allan Sims
Sims, Allan, 1975-
2016-01-01
Kuna senised meetodid puude koore paksuse mõõtmiseks polnud Eesti oludes kasutamiseks piisavalt täpsed, töötasid teadlased välja algoritmi, mille abil oskavad harvesterid mahavõetud puude koore paksust edaspidi täpsemalt hinnata
Bangladeshis madistab kaks naist / Allan Espenberg
Espenberg, Allan
2006-01-01
Sisepoliitilised pinged Bangladeshis, kus kehtib maailmas küllaltki ainulaadne süsteem, mis näeb ette mõni kuu enne üldvalimisi valitud valitsuse lahkumist ning võimu üleandmist ajutisele üleminekukabinetile
Skandaalne visioon : Portugal kaob / Allan Espenberg
Espenberg, Allan
2007-01-01
Välismaal elav Portugali kirjanik Jose Saramago tegi ettepaneku, mille kohaselt muudetaks Portugali riik üheks Hispaania provintsiks, tekkinud uus riik võiks aga kanda Iberia nime. Kaart: Uus Euroopa riik? Lisa: Õpetab ka teisi riike
contemplating allan boesak's fascination with preaching
African Journals Online (AJOL)
... there is not always sufficient emphasis upon ... how that Word can become a living ... democracy, we can get a picture of how political power is structured. With ... South African society, there seem to be no prospects for a better future other than ..... own transgressions and we don't remember our own sins and we miss the ...
Mali president kaotaks surmanuhtluse / Allan Espenberg
Espenberg, Allan
2007-01-01
Mali president Amadou Tourmani Toure pöördus riigi iseseisvuse väljakuulutamise 47. aastapäeva puhul rahva poole läkitusega, kus teatas surmanuhtluse likvideerimise seaduseelnõu parlamenti saatmisest. Presidendi säärane initsiatiiv pole aga meeltmööda Mali moslemivaimulikele. Praeguseks on Amnesty Internationali andmetel umbes pooled maailma riikidest surmanuhtluse tühistanud
Angola üllatas valimistega / Allan Espenberg
Espenberg, Allan
2008-01-01
Angolas toimusid peale 16 aastast vaheaega parlamendivalimised, kus ülekaaluka võidu saavutas Angola Vabastamise Rahvaliikumine (MPLA). Uus peaminister teatas Antonio Paulo Kassoma, et tema prioriteedid on MPLA programmi elluviimine ja lähtumine Jose Eduardo dos Santose antud suunistest
Directory of Open Access Journals (Sweden)
Luciano Passamani Diogo
2010-12-01
Full Text Available FUNDAMENTO: A associação entre o uso de anti-inflamatórios não-esteroides (AINEs e insuficiência renal aguda ou crônica é bem documentada, mas evidências sobre a associação entre AINEs e nefropatia induzida por contraste (NIC não são encontradas na literatura. OBJETIVO: Avaliar uma possível associação entre AINEs e NIC. MÉTODOS: Em um estudo de coorte, através da entrevista clínica de pacientes que foram submetidos à cateterização cardíaca, analisamos o uso de AINEs e sua associação com desenvolvimento de NIC, através da alteração dos níveis de creatinina sérica ou taxa de filtração glomerular em 48 ou 72 horas. RESULTADOS: No período de julho de 2005 a julho de 2006, 236 pacientes foram incluídos no estudo, dos quais 29 foram posteriormente excluídos. A incidência de NIC foi 10,37% (20 de 207 e 42% dos pacientes estavam recebendo AINEs até o momento da avaliação. Não houve associação entre o uso de AINEs e o desenvolvimento de NIC com OR de 1,293; IC95% (0,46-4,2. O estudo detectou fatores de risco conhecidos para o desenvolvimento de NIC, tais como diabete, com OR de 2,77; IC95% (1,05-7,47 e insuficiência renal crônica com OR de 3,48; IC95% (1,1-11,07 e também sugeriu uma ação protetora da hidratação com solução salina com OR de 0,166; IC95% (0,03-0,92. CONCLUSÃO: Com base nos dados obtidos, concluímos que não houve associação entre NIC e uso prévio de AINEs, pelo menos com um OR > 2,85, o qual nossa amostra detectou.FUNDAMENTO: La asociación entre el uso de antiinflamatorios no esteroides (AINEs e insuficiencia renal aguda o crónica está bien documentada, pero evidencias sobre la asociación entre AINEs y nefropatía inducida por contraste (NIC no son encontradas en la literatura. OBJETIVO: Evaluar una posible asociación entre AINEs y NIC. MÉTODOS: En un estudio de cohorte, a través de la entrevista clínica de pacientes que fueron sometidos a cateterismo cardíaco, analizamos el
Impôts Français : CRDS - French version only
2003-01-01
Avis de dégrèvements IMPORTANT : Cette note d'information concerne uniquement : - les membres du personnel de nationalité française ou résidents permanents1 , domiciliés en France dans le département de l'Ain et rémunérés par le CERN (titulaires, boursiers, attachés payés et de projet) ; - Les anciens membres du personnel de l'Organisation, bénéficiaires de la Caisse de Pensions du CERN, domiciliés ou ayant été domiciliés en France dans le département de l'Ain. Ces personnes ont récemment reçu, ou sont sur le point de recevoir, un avis de dégrèvement émanant de la Direction des Services Fiscaux de l'Ain (DSFA) et portant sur la Contribution au Remboursement de la Dette Sociale (CRDS). I. Informations général...
Külmetav haigekassa / Ain Aaviksoo
Aaviksoo, Ain, 1974-
2008-01-01
Autori hinnangul on suur oht, et Eesti patsiente ootab ees Läti saatus, kus on 40-50% tervishoiukuludest patsientide endi kanda. Eesti ees seisvaid valikuid analüüsides oleks parim valik ravikindlustuse reservide läbimõeldud kasutuselevõtt, kuid eeldusel, et otsitakse ravikindlustuse rahastamisele pikaajalisi sisulisi lahendusi. Graafik: Haigekassa kulude suhteline muutus
Zamerzajushtshaja Bolnitshnaja kassa / Ain Aaviksoo
Aaviksoo, Ain, 1974-
2008-01-01
Autori hinnangul on suur oht, et Eesti patsiente ootab ees Läti saatus, kus on 40-50% tervishoiukuludest patsientide endi kanda. Eesti ees seisvaid valikuid analüüsides oleks parim valik ravikindlustuse reservide läbimõeldud kasutuselevõtt, kuid eeldusel, et otsitakse ravikindlustuse rahastamisele pikaajalisi sisulisi lahendusi
Hinsberg, Ain
2001-01-01
Helsingi ja Tallinna vahel liikuvate laevafirmade konkurents: Silja Line, Nordic Jet Line, Tallink ja Linda Line. Tabelid: reisijad laevaliinil Helsingi-Tallinn 1998-2001; Helsingi-Tallinna liinil kiirlaevade turuosad 1999-2000
Piperazine side-effects in a patient with pre-existing renal insufficiency
Directory of Open Access Journals (Sweden)
Majid Malaki
2014-01-01
Full Text Available Piperazine as an antihelminth has many adverse effects, especially on patients with renal insufficiency. We report the use of piperazine in a girl with a moderately severe kidney disease due to Biedl Bardet syndrome. She developed coma and acute kidney injury due to acute interstitial nephritis (AIN, anemia and thrombocytopenia. The presence of fever, proteinuria, acidosis, anemia, sterile pyuria and non-oliguric renal failure strongly suggested AIN. Her problems abated mostly by discontinuing of piperazine and supportive therapy, except anemia and thrombocytopenia.
"If it works, you can break it" / Joshua Levine
Levine, Joshua
2004-01-01
Ülevaade Eesti infotehnoloogilisest arengust ning edusammudest: mobiilteenused, e-valitsus, edukamad tarkvaraarendusprojektid. Arvamust avaldavad Linnar Viik, Niklas Zennström, Allan Martinson, Steve Jürvetson jt. Tabel. Kaart
Gene : CBRC-GGOR-01-1448 [SEVENS
Lifescience Database Archive (English)
Full Text Available ain Friedlin] 1e-79 49% MCLALGSAGTADDVKLHPVACADTARSTPGTSAPSTPGTSAPSTPGTSAPSTSGISAPSTSGTSAPSTLGTSAPSKPGTSAPSKPGISAPSTSGISAPSTSGTSA...PSTSGTSAPSTPGTSAPSKPGTSAPSKPGISAPYTPGTSAPSTLGTSAPSTPGTSAPSTPGTSAPSKPGTSAPSKPGTSA...PSTPGTSAPSTLGTSAPSTPGTTAPSTAGTSAPSTSGTSAPSTSGTSAPSKPTTSAPYTPGTSAPSIPGTSAPSTTGTSAPSTPGTSAPSTPGTSAPSKPGTSAPSTPGTSA...PSTLGTSAPSTPGTSAPSTPGTSAPSKPGTSAPSMSGTSAPSTPGTSVPSKAGTSAPVDPGVLWGLERPLTDTEGRWLPPYVLL
Aluminium nitrate ceramics: A potential UV dosemeter material
DEFF Research Database (Denmark)
Trinkler, L.; Bøtter-Jensen, L.; Berzina, B.
2002-01-01
The ceramic material AIN-Y2O3 is proposed as a potential ultraviolet radiation (UVR) dosemeter using optically stimulated luminescence (OSL) and thermally stimulated luminescence (TL). Experimental studies have shown that AIN ceramics exhibit attractive characteristics suitable for practical UV...... dosimetry applications. The features are: (1) the spectral sensitivity covers the 200-350 nm range, in the UV-B region it is similar to that of human skin: (2) the angular dependence of the incident radiation follows the cosine law; (3) high yields of both UVR-induced OSL and TL signals compared to those...
CybermarketingInEstonia.ee / interv. Oksana Kostina
2005-01-01
Vestlusringis reklaamist ja turundusest Internetis osalesid Sten Klemm, Mihkel Vabrit, Esme Kassak, Aivar Laan, Andrei Korobeinik, Üllar Tamm, Raiko Raie, Martin Orav, Priit A. Heinsalu ja Allan Sombri
Gutierrez, K; Kasimanickam, R; Tibary, A; Gay, J M; Kastelic, J P; Hall, J B; Whittier, W D
2014-04-15
The objective was to determine the effects of reproductive tract score (RTS) on reproductive performance in beef heifers bred by timed artificial insemination followed by natural service (AI-NS) or by natural service only (NSO). Angus cross beef heifers (n = 2660) in the AI-NS group were artificially inseminated at a fixed time (5- or 7-day CO-Synch + controlled internal drug release protocol) once, then exposed to bulls 2 weeks later (bull-to-heifer ratio = 1:40-1:50) for the reminder of the 85-day breeding season. Angus cross beef heifers (n = 1381) in NSO group were submitted to bulls (bull-to-heifer ratio = 1:20-1:25) for the entire 85-day breeding season. Heifers were reproductive tract scored from 1 (prepubertal) to 5 (cyclic) 4 weeks before, and were body condition scored (BCS) from 1 (emaciated) to 9 (obese) at the beginning of breeding season. Pregnancy diagnosis was performed 70 days after AI for AI-NS group and 2 months after the end of breeding season for both groups. Heifers in both groups were well managed and of similar age (14.9 ± 0.4 [AI-NS] and 14.7 ± 0.8 [NSO] months). Pregnancy rates (PRs) and number of days to become pregnant were calculated using PROC GLIMMIX and PROC LIFETEST procedures of SAS. Adjusting for BCS (P = 0.07), expressed estrus (P < 0.05), year (P < 0.05), and BCS by year interaction (P < 0.05), the AI-PR was greater for heifers in AI-NS group with higher RTS (P < 0.0001; 40.7%, 48.3%, 57.6%, and 64.6% for RTS of 2 or less, 3, 4, and 5, respectively). Controlling for BCS (P < 0.05), year (P < 0.05) and the breeding season pregnancy rates (BS-PRs) were greater for heifers in the AI-NS group with higher RTS (P < 0.01; 81.2%, 86.5%, 90.4%, and 95.2% for RTS of 2 or less, 3, 4, and 5, respectively). Similarly, adjusting for BCS, year (P < 0.05), the BS-PR was greater for heifers in NSO group with higher RTS (P < 0.01; 79.7%, 84.3%, 88.4%, and 90.2% for RTS of 2 or less, 3, 4, and 5, respectively). Heifers with higher RTS
Teist korda kodus kodus käimas / Sven Karja
Karja, Sven, 1968-
1999-01-01
Harold Pinteri "Kojutulek" Tallinna Linnateatris, lavastaja Andres Noormets, kunstnik Aime Unt, osades Ago Roo, Marko Matvere, Andres Raag, Allan Noormets, Jaan Tätte, Triinu Meriste. Esietendus 24. märtsil
Suvemaja käiakivide-Gotlandilt / Shanti Broeng
Broeng, Shanti
2008-01-01
Disainer Ulla Christianssoni ja tema abikaasa Lars E. Petterssoni suvekodust. 19. saj. ehitatud maja renoveeriti arhitekt Allan Wahlby projekti järgi, sisustuses domineerib minimalism. 14 värv. ill.
Low Median Nerve Palsy as Initial Manifestation of Churg-Strauss Syndrome.
Roh, Young Hak; Koh, Young Do; Noh, Jung Ho; Gong, Hyun Sik; Baek, Goo Hyun
2017-06-01
Anterior interosseous nerve (AIN) syndrome is typically characterized by forearm pain and partial or complete dysfunction of the AIN-innervated muscles. Although the exact etiology and pathophysiology of the disorder remain unclear, AIN syndrome is increasingly thought to be an inflammatory condition of the nerve rather than a compressive neuropathy because the symptoms often resolve spontaneously following prolonged observation. However, peripheral neuropathy can be 1 of the first symptoms of systemic vasculitis that needs early systemic immunotherapy to prevent extensive nerve damage. Churg-Strauss syndrome (CSS; eosinophilic granulomatosis with polyangiitis) is 1 type of primary systemic vasculitis that frequently damages the peripheral nervous system. CSS-associated neuropathy usually involves nerves of the lower limb, and few studies have reported on the involvement of the upper limb alone. We report on a rare case of low median nerve palsy as the initial manifestation of CSS. The patient recovered well with early steroid treatment for primary systemic vasculitis. Copyright © 2017 American Society for Surgery of the Hand. Published by Elsevier Inc. All rights reserved.
Time Domain Frequency Stability Estimation Based On FFT Measurements
National Research Council Canada - National Science Library
Chang, P
2004-01-01
.... In this paper, the biases of the Fast Fourier transform (FFT) spectral estimate with Hanning window are checked and the resulting unbiased spectral density are used to calculate the Allan variance...
ORF Alignment: NC_003212 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ain Clip11262) ... Length = 200 ... Query: 88 ... NAGLIKIGISEPSASLVLPQILKQFLTDFP...KLMVNVSVDDANTCSQKLIDGEIDFAICGE 147 ... NAGLIKIGISEPSASLVLPQILKQFLTDFPKLMVNVSVDDANTCSQKLIDGEIDFAICGE Sbjct: 1 ... NAGLIKIGISEPS
Directory of Open Access Journals (Sweden)
Michel Batlouni
2010-04-01
Full Text Available Os anti-inflamatórios não esteroides (AINEs encontram-se entre os medicamentos mais prescritos em todo o mundo. Essa classe heterogênea de fármacos inclui a aspirina e vários outros agentes inibidores da ciclo-oxigenase (COX, seletivos ou não. Os AINEs não seletivos são os mais antigos, e designados como tradicionais ou convencionais. Os AINEs seletivos para a COX-2 são designados COXIBEs. Nos últimos anos, tem sido questionada a segurança do uso dos AINEs na prática clínica, particularmente dos inibidores seletivos da COX-2. As evidências sobre o aumento do risco cardiovascular com o uso de AINEs são ainda incompletos, pela ausência de ensaios randomizados e controlados com poder para avaliar desfechos cardiovasculares relevantes. Entretanto, os resultados de estudos clínicos prospectivos e de meta-análises indicam que os inibidores seletivos da COX-2 exercem importantes efeitos cardiovasculares adversos, que incluem aumento do risco de infarto do miocárdio, acidente vascular cerebral, insuficiência cardíaca, insuficiência renal e hipertensão arterial. O risco desses efeitos adversos é maior em pacientes com história prévia de doença cardiovascular ou com alto risco para desenvolvê-la. Nesses pacientes, o uso de inibidores da COX-2 deve ser limitado àqueles para os quais não há alternativa apropriada e, mesmo assim, somente em doses baixas e pelo menor tempo necessário. Embora os efeitos adversos mais frequentes tenham sido relacionados à inibição seletiva da COX-2, a ausência de seletividade para essa isoenzima não elimina completamente o risco de eventos cardiovasculares, de modo que todos os fármacos do largo espectro dos AINEs somente devem ser prescritos após consideração do balanço risco/benefício.Los antiinflamatorios no esteroides (AINEs se encuentran entre los medicamentos más prescriptos en todo el mundo. Esta clase heterogénea de fármacos incluye la aspirina y varios otros agentes
Heard, Isabelle; Etienney, Isabelle; Potard, Valérie; Poizot-Martin, Isabelle; Moore, Catherine; Lesage, Anne-Carole; Ressiot, Emmanuelle; Crenn-Hebert, Catherine; Fléjou, Jean-François; Cubie, Heather; Costagliola, Dominique; Darragh, Teresa M
2015-05-15
Although human immunodeficiency virus (HIV)-infected women are at high risk for anal cancer, few data have been published on prevalence of and risk factors for anal precancer and potential screening strategies in this risk group. A cross-sectional anal screening study was nested in a gynecological cohort of HIV-infected women. Anal swab specimens were collected for cytology and human papillomavirus (HPV) testing. High-resolution anoscopy, with biopsy when indicated, was systematically performed. Among the 171 enrolled women, median age was 47.3 years and 98% were receiving combination antiretroviral therapy. Median CD4(+) count was 655 cells/µL and HIV load was associated with increased risk of HG-AIN+. Abnormal anal cytology and HPV-16 infection performed best as a screening strategy for HG-AIN+ histology, with positive likelihood ratios of 3.4 (95% CI, 2.3-5.1) and 4.7 (95% CI, 2.5-8.7) and negative likelihood ratios of 0.2 (95% CI, .07-.8) and 0.4 (95% CI, .2-.9), respectively. HIV-infected women with a history of HPV-associated cervical disease are at increased risk for HG-AIN+ and should be offered anal cancer screening. Anal cytology and HPV-16 genotyping had the best screening performance. Anal cytology is easy to perform routinely; it may be the best candidate for screening for HG-AIN among HIV-infected women. © The Author 2015. Published by Oxford University Press on behalf of the Infectious Diseases Society of America. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.
Dun, Wang-Huan; Yang, Jing; Yang, Ling; Ding, Dun; Ma, Xue-Ying; Liang, Feng-Li; von Deneen, Karen M; Ma, Shao-Hui; Xu, Xiao-Ling; Liu, Jixin; Zhang, Ming
2017-12-01
Neuroimaging studies have demonstrated the critical role of the insula in pain pathways and its close relation with the perceived intensity of nociceptive stimuli. We aimed to identify the structural and functional characteristics of the insula during periovulatory phase in women with primary dysmenorrhea (PDM), and further investigate its association with the intensity of perceived pain during menstruation. Optimized voxel-based morphometry and functional connectivity (FC) analyses were applied by using 3-dimensional T1-weighted and resting functional magnetic resonance imaging (fMRI) in 36 patients at the peri-ovulation phase and 29 age-, education-, and gender-matched healthy controls (HC). A visual analogue scale (VAS) was used to examine the intensity of the abdominal pain at periovulation and menstruation. In our results, PDM patients had significant higher VAS-rating during menstruaion than periovulation. Compared with the HC, PDM patients had lower gray matter density in the left anterior insula (aINS). Taken the left aINS as a seed region, we further found hypoconnectivity between aINS and medial prefrontal cortex (mPFC), which showed negative relation with the VAS during menstruation. As the aINS is a key site of the salience network (SN) and the mPFC is a critical region in the default mode network (DMN), it's implicated a trait-related central-alteration that communications between pain attention and perception networks were disrupted without the ongoing menstrual pain. Moreover, result of correlation analysis, at least in part, suggested a possible role of altered FC (pain-free period) in predicting pain perception (menstruation).
Konverents avardas osalejate silmaringi / Liis Lukk
Lukk, Liis
2010-01-01
Viljandis peeti 26. märtsil rakendusteatriteemalist konverentsi "Teater kogukonna hüvanguks" ettekannete, töötubade ja etendustega, kus peakülaline Allan Owens korraldas protsessidraama töötoa.
KRYMCHANTOWSKI, ABOUCH V.; BARBOSA, JACKELINE
1999-01-01
Alguns antinflamatórios não esteroidais (AINE) orais são eficientes para o tratamento dos ataques de migrânea ou enxaqueca. A despeito de sua eficiência para o tratamento destas cefaléias e de outras dores, existem comercialmente poucos antinflamatórios não esteroidais disponíveis para administração parenteral. O clonixinato de lisina (CL) é um AINE derivado do ácido nicotínico que foi comprovadamente eficiente em vários tipos de síndromes álgicas como cólica renal, dor de compressão nervosa,...
Tissot, B; Lamy, A; Perraudeau, F; Manouvrier, J L; Imbert, Y
2002-07-13
We report the case of severe colitis occurring during treatment with non-steroid anti-inflammatories (NSAI). A 57 year-old woman was hospitalized for lumbar pain that had not been relieved by AINS, tramadol and then morphine. The patient presented with septic shock and peritonitis by rectal perforation, followed by acute rectorrhagia. The endoscopic aspect evoked Crohn's disease with a recto-vaginal fistula. Progression was further complicated by two episodes of collapse because of acute rectorrhagia, requiring hemostasis colectomy and abdominal-perineal amputation. The diagnosis retained was AINS-induced colitis complicated by acute colectasia on a fecaloma with recto-vaginal fistula.
2003-01-01
Pöördumises tehakse valitsusele ettepanek kavandada kodugaasiseadmete väljavahetamise projekt koos finantseerimise kavaga. Pöördumisele on alla kirjutanud Jaanus Tamkivi, Toomas Välimäe, Marit Otsing ja Allan Sepp
Clinical Action against Drunk Driving.
Directory of Open Access Journals (Sweden)
Donald A Redelmeier
2017-02-01
Full Text Available In advance of a safety campaign on 17 March 2017, Donald Redelmeier and Allan Detsky call on physicians and clinical colleagues to reduce the chances that patients will drive drunk.
ORF Alignment: NC_003212 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ain ... Clip11262) ... Length = 73 ... Query: 8 ... ASALLELIGGKENISSVTHCATRMRFV...LLDPDNADVEAIEDIPAVKGTFTQAGQFQVIIG 67 ... ASALLELIGGKENISSVTHCATRMRFVLLDPDNADVEAIEDIPAVKGTFTQAGQFQ...VIIG Sbjct: 1 ... ASALLELIGGKENISSVTHCATRMRFVLLDPDNADVEAIEDIPAVKGTFTQAGQFQVIIG 60 ...
Oma last juhendava treeneri dilemma - kas sõimata või poputada / Ann Hiiemaa, Inga Höglund
Hiiemaa, Ann
2008-01-01
Korvpallitreener Allan Dorbek tunnistab, et oma lastelt nõuab ja ootab ta paratamatult rohkem. Oma laste treenimisest räägivad ka Rein Kirsipuu, Keete Puri, Riho Aljand, Hille Saarepuu ja Janika Mölder
Kunstnikukeskne näitus / Heie Treier
Treier, Heie, 1963-
2016-01-01
Näitus "Pseudo" EKKMis. Kuraator Marten Esko, kujundaja Allan Appelberg, kunstnikud Dénes Farkas ja Taavi Talve, Dora García, Flo Kasearu, Jevgeni Zolotko, Kristiina Hansen ja Sigrid Viir ning Neeme Külm
Joakim Helenius ajab Eestis juuri laiali / Joakim Helenius ; interv. Priit Pullerits
Helenius, Joakim, 1957-
2006-01-01
Ida-Euroopa suurima kodu- ja aianduskeskuse Eestisse rajanud Trigon Gardeningi juht Joakim Helenius peab aiandust kõige kiiremini arenevaks äriks maailmas. Kommenteerib Martsinson Trigon Venture Partnersi juhataja Allan Martinson. Lisa: Joakin Helenius (48).
Uudised : Juuksur - uus live-muusika lokaal. Madonna tögas Bushi. Andrea Bocelli Helsingis
2006-01-01
Kontserdil 19. mail Tallinnas (Vaimu 1) õhtulokaali "Juuksur" avamisel esineb jazzrokki viljelev ansambel Wrupk Urei ja 26. mail Allan Vainola sooloprojektiga. Ameerika poplauljast Madonnast. Itaalia tenori Andrea Bocelli kontserdist 19. nov. Hartwall Arenal Helsingis
Ladina-Ameerika saab elektroonilise valuuta / Allan Espenberg
Espenberg, Allan
2008-01-01
Ladina-Ameerika riikide Venezuela, Kuuba, Boliivia, Hondurase, Nicaragua, Dominica ja Ecuadori ühendus ALBA on alustanud ettevalmistustega ühise virtuaalse valuuta, sucre, sisseseadmiseks ning ühtse majandus- ja rahandustsooni loomiseks
Hämarad tehingud kurnavad riiki / Allan Espenberg
Espenberg, Allan
2008-01-01
Bulgaarias lokkab kuritegevus ja korruptsioon. Opositsioon on algatanud viimase kahe aasta jooksul eri põhjustel viiel korral umbusaldushääletuse organiseeritud kuritegevusega seotuses kahtlustatava koalitsioonivalitsuse vastu. Aprillis astus tagasi siseminister Rumen Petkov
Venezuela paneb kokku regionaalset energeetikaliitu / Allan Espenberg
Espenberg, Allan
2007-01-01
Venezuela pealinnas toimus organisatsiooni Petrocaribe kolmas tippkohtumine. Petrocaribe, mis liidab peamiselt Kariibi mere riike ja tegeleb energeetikaküsimustega, algatas 2 aastat tagasi Venezuela president Hugo Chavez. Organisatsiooni kuulub 16 riiki
A demographic outline / Kalev Katus, Allan Puur
Katus, Kalev, 1955-2008
2002-01-01
Ajalooline ülevaade Eesti elanikkonna kujunemisest ning Eestit läbinud migratsioonivoogudest Nõukogude okupatsiooni perioodil, mis on suuresti mõjutanud Eesti tänast demograafilist olukorda. Tabel ja diagrammid: Eestlaste ja välismaalaste arv Eestis 1922-2000; Välismaalaste osakaal Eestis päritolumaa järgi; Rahvusvahelised migratsioonivood Eestis 1946-1999; Välismaalaste osakaal valitud Euroopa riikides. Kaart.
Tutanhamon saab uue viimse puhkepaiga / Allan Espenberg
Espenberg, Allan
2005-01-01
Egiptuses hakatakse ehitama hiigelsuurt muuseumi, mis eksponaatide kõrval mahutaks ka kunstiteoste restaureerimise töökodasid ja Ramses II 12 m kõrguse kuju. Muuseum tuleks Giza püramiididest põhja poole. Projekti autor Iirimaa arhitektuuribüroo Heneghan Peng Architects
Organisatsioon otsib peasekretäri / Allan Espenberg
Espenberg, Allan
2005-01-01
Ameerika Riikide Organisatsiooni peasekretär Miguel Angel Rodriguez astus tagasi, kuna päevavalgele tuli mitu korruptsioonijuhtu, millesse ta Costa Rica presidendina oli segatud. Uuteks kandidaatideks on Tšiili siseminister Jose Miguel Insulza, Mehhiko välisminister Luis Ernesto Derbez ja El Salvadori ekspresident Francisco Flores
Uruguay valitsus hakkab riiki korrastama / Allan Espenberg
Espenberg, Allan
2005-01-01
Esimest korda tuleb nii valitsuse kui parlamendi tasandil Uruguays võimule vasakpoolne koalitsioon, mis suutis eemale tõrjuda kokku 174 aastat võimul olnud kahte parteid. Uueks presidendiks sai Tabare Vazquez, kelle poolt hääletasid pooled valijad
Sotsialistide suur edu asendumas kaotusega / Allan Espenberg
Espenberg, Allan
2006-01-01
Portugali senise võimuerakonna, peaminister Jose Socrates Carvalho Pinto de Sousa juhitud sotsialistliku valitsuse populaarsus on tunduvalt vähenenud. Tõenäoliselt peab peaminister välja kuulutama ennetähtaegsed parlamendivalimised
Island otsib sõjalisi kaitseingleid / Allan Espenberg
Espenberg, Allan
2007-01-01
Islandil toimuvatel parlamendivalimistel peaks arvamusküsitluste kohaselt enam kui 40% valijatest toetama Iseseisvusparteid, teisele kohale jäävad sotsiaaldemokraadid 23,5% ning neile järgnevad rohelised 17,6 ja Progressiivne Partei 10%-ga. Ka Islandi-Norra kahepoolsest lepingust, mis tihendab kaitse- ja julgeolekualast koostööd
Genetics Home Reference: Allan-Herndon-Dudley syndrome
... cells in the developing brain. This hormone, called triiodothyronine or T3, is produced by a butterfly-shaped ... with X-linked psychomotor retardation and elevated serum triiodothyronine. J Clin Endocrinol Metab. 2007 Jun;92(6): ...
Mehhikos on ametis kaks presidenti / Allan Espenberg
Espenberg, Allan
2006-01-01
Senine seaduslik riigipea Vicente Fox lahkus küll uue presidendi Felipe Calderon Hinojosa inauguratsiooni järel 1. detsembril ametist, kuid Mehhiko 1910. aasta revolutsiooni aastapäeval 20. novembril kuulutas end presidendiks ka juulikuiste presidendivalimiste kaotaja Andres Manuel Lopex Obrador
Colonia Dignidadi kuulsusetu lõpp / Allan Espenberg
Espenberg, Allan
2004-01-01
Ligi kaheksa aastat kestnud juurdlus Colonia Dignidadi üle jõudis Tšiili kohtusaalis konkreetsete tulemusteni - 23 kohtualust mõisteti vangi koloonia juhi Paul Schäfer'i asukoha varjamise ja kohtuorganite uurimistöö takistamise eest. P. Schäferit süüdistatakse lisaks lasteahistamisele inimröövides, piinamistes ning tapmistes
Angola : valimisi oodatakse ja kardetakse / Allan Espenberg
Espenberg, Allan
2008-01-01
Angolas pole 16 aastat toimunud parlamendi- ja presidendivalimisi. 30 aastat võimul olnud president Jose Eduardo dos Santos kuulutas riigis välja valimised, mis peaksid toimuma käesoleval aastal 5. ja 6. septembril
Costa Ricat vapustavad ekspresidendi kuriteod / Allan Espenberg
Espenberg, Allan
2004-01-01
Ameerika Riikide Organisatsiooni juhiks vannutatud Costa Rica endine president Miguel Angel Rodriguez leiti olevat süüdi korruptiivsetes tehingutes. Teisigi Costa Rica endisi presidente on süüdistatud korruptsioonis
Rwanda kuningas igatseb kodumaale tagasi / Allan Espenberg
Espenberg, Allan
2007-01-01
Ameerika Ühendriikides Washingtonis elav Rwanda kuningas Kigeli V pole kodumaad külastanud 48 aastat. Riigi praegune president Paul Kagame sõnul võib pagenduses viibiv kuningas naasta kodumaale vaid tavakodanikuna ning mingit eristaatust talle ei anta
Adiponectin in early and chronic rheumatoid arthritis and osteoarthritis
DEFF Research Database (Denmark)
Laurberg, Trine Bay
Dato 31. januar 2006Title Adiponectin in early and chronic rheumatoid arthritis and osteoarthritisAuthors:Trine Bay Laurberg,Torkell Ellingsen,Jan Frystyk,Ib Hansen,Anette Jørgensen,Ulrik Tarp,Merete Lund Hetland,Kim Hørslev-Petersen,Nete Hornung,Jørgen Hjelm Poulsen,Allan Flyvbjerg,Kristian St...... Dato 31. januar 2006Title Adiponectin in early and chronic rheumatoid arthritis and osteoarthritisAuthors:Trine Bay Laurberg,Torkell Ellingsen,Jan Frystyk,Ib Hansen,Anette Jørgensen,Ulrik Tarp,Merete Lund Hetland,Kim Hørslev-Petersen,Nete Hornung,Jørgen Hjelm Poulsen,Allan Flyvbjerg......,Kristian Stengaard-PedersenBackground: Rheumatoid arthritis (RA) is a systemic, chronic, autoimmune disease, which affects the joints with inflammation leading to destruction of cartilage and bone. Osteoarthritis (OA) is a degenerative joint disease characterised by low level of chronic inflammation, slow...
Directory of Open Access Journals (Sweden)
Khadija OUAISSA
2017-05-01
Full Text Available The objective of our study is to test the efficacy of an extruded food on the growth performance of rainbow trout (Oncorhynchus mykiss Walbaum, 1792 at the fish farm Ain Aghbal in Azrou (Morocco. Generally, only the biochemical composition (percentages of moisture, proteins, lipids and carbohydrates and the (digestible and crude energies of the food are previously known, which is insufficient for the choice of the food in terms of growth performance and quality/environment. The rainbow trout breeding tanks used for this test are 222 days (15 June 2015 - 28 February 2016 are fed with water directly taken from the water of the Oum Er-Rbia sources according to an open circuit with a Renewal of water every half hour. The flow rate is 11.04m3/h. The initial breeding conditions, the density (Kg per volume 1.58kg/m3 and the initial charge with respect to the flow rate is 1.05 m3 / h. Fish are fed by ratios two to three times per day depending on the rearing stage. The frequency of sampling is biweekly where we measured the zootechnical performances of the fish and taken water samples for physicochemical analyzes in order to assess the quality of the waters of exit of the basins before their rejection in the Oum-Er-Rbia river. The results show that the test food shows a better growth of the rainbow trout and a conversion index not exceeding 0.9 for a size of 1043 g of trout.
2011-06-01
186 Eric Micheletti, French Special Forces: Special Operations Command (Paris: Histoire & Collections, 1999), 16. 187 NSCC, NATO SOF...University, September 2008. Micheletti, Eric. French Special Forces: Special Operations Command. Paris: Histoire & Collections, 1999. Millet, Allan
Film põhineb koomiksil / Märt Milter
Milter, Märt
2002-01-01
Mängufilm "Road To Perdition" Max Allan Collinsi koomiksi teemadel : režissöör Sam Mendes :Tom Hanks, Jude Law, Paul Newman : Ameerika Ühendriigid 2002. Ka teistest koomiksite põhjal loodud filmidest
Directory of Open Access Journals (Sweden)
Arcadio Díaz Quiñones
2011-01-01
Full Text Available Este ensaio explora a importância do espiritismo de Kardec para os princípios de Fernando Ortiz e para seu longo, por vezes tortuoso, inquérito que o leva à noção de "transculturação". Em seus anos de formação, Ortiz foi profundamente influenciado por Lombroso, mas também, como tantos outros escritores e intelectuais, por Kardec. Ele publicou ensaios fundamentais sobre o espiritismo, especialmente sobre as implicações da reencarnação para hierarquias espirituais e sociais. A doutrina de Kardec sobre o progresso espiritual da alma permitiu a Ortiz defender um projeto nacional mais inclusivo. O kardecismo também forneceu metáforas que correm como um fio por seus trabalhos mais importantes sobre as culturas africanas em Cuba, e também por sua poética. A "transmigração" das almas, com suas possibilidades de constantes novos princípios, permitiu a Ortiz introduzir um elemento espiritual e político na ideia de largo alcance que é a transculturação.This essay explores the importance of Kardec's Spiritism in Fernando Ortiz's beginnings and in his long, often roundabout, inquiry leading to the notion of "transculturation". In his formative years Ortiz was deeply influenced by Lombroso but also, like so many other writers and intellectuals, by Kardec. He published fundamental essays on Spiritism, especially on the implications of reincarnation for spiritual and social hierarchies. Kardec's doctrine of the spiritual progress of the soul allowed Ortiz to argue for a more inclusionary national project. Kardecism also provided metaphors that run like a thread through Ortiz's major works on African cultures in Cuba and in his poetics. The "transmigration" of the souls, with its possibilities of endless new beginnnings, enabled Ortiz to introduce a spiritual and political element into the far-ranging idea of transculturation.
Skype-hyped ja Eesti IT-sektori väljakutsed
2006-01-01
Eesti IT-sektori potentsiaali ja tulevikuväljavaadete üle arutlevad Martinson Trigon Venture Partners partner Allan Martinson, Helmese juht Jaan Pillesaar, Skype Eesti juht Sten Tamkivi ja EMT tehnoloogia- ja arendusjuht Tõnu Grünberg
Rotary klubi tuli rannarahvale appi / Anu Jürisson
Jürisson, Anu
2005-01-01
Tallinna Vanalinna Rotary klubi kinkis kolmele Rannametsa perele kümme tuhat krooni jaanuaritormi kahjustuste likvideerimiseks. Klubi presidendiks on Allan Martinson, nimekirjas ka Tõnis Palts, Toomas Hendrik Ilves, Rein Kilk, Hans H. Luik, Vahur Kraft jt.
Directory of Open Access Journals (Sweden)
Jeremiah T. Steed
2017-01-01
Full Text Available Arthroscopic rotator cuff tendon repair is a common elective procedure performed by trained orthopaedic surgeons with a relatively low complication rate. Specifically, isolated neuropraxia of the anterior interosseous nerve (AIN is a very rare complication of shoulder arthroscopy. An analysis of peer-reviewed published literature revealed only three articles reporting a total of seven cases that describe this specific complication following standard shoulder arthroscopic procedures. This article reports on three patients diagnosed with AIN neuropraxia following routine shoulder arthroscopy done by a single surgeon within a three-year period. All three patients also underwent open biceps tenodesis immediately following completion of the arthroscopic procedures. The exact causal mechanism of AIN neuropraxia following shoulder arthroscopy with biceps tenodesis is not known. This case report reviews possible mechanisms with emphasis on specific factors that make a traction injury the most likely etiology in these cases. We critically analyze our operating room setup and patient positioning practices in light of the existing biomechanical and cadaveric research to propose changes to our standard practices that may help to reduce the incidence of this specific postoperative complication in patients undergoing elective shoulder arthroscopy with biceps tenodesis.
Non-nitric oxide based metallovasodilators: synthesis, reactivity and biological studies.
Sá, Denise S; Fernandes, André F; Silva, Carlos D S; Costa, Paula P C; Fonteles, Manassés C; Nascimento, Nilberto R F; Lopes, Luiz G F; Sousa, Eduardo H S
2015-08-14
There is an increasing number of compounds developed to target one or more pathways involved in vasodilation. Some studies conducted with azaindole and indazole derivatives showed cardiovascular activity associated with these compounds. Fast and easy structural modification of these organic molecules can be achieved using metal complexes promoting a much larger spatial change than organic strategies, potentially leading to novel drugs. Here, we have prepared a series of complexes with a formula cis-[RuCl(L)(bpy)(2)]PF(6), where L = 7-azaindole (ain), 5-azaindole (5-ain), 4-azaindole (4-ain), indazole (indz), benzimidazole (bzim) or quinoline (qui), which were characterized by spectroscopic and electrochemical techniques (CV, DPV). These compounds showed reasonable stability exhibiting photoreactivity only at low wavelength along with superoxide scavenger activity. Cytotoxicity assays indicated their low activity preliminarily supporting in vivo application. Interestingly, vasodilation assays conducted in rat aorta exhibited great activity that largely improved compared to free ligands and even better than the well-studied organic compound (BAY 41-42272), with IC(50) reaching 55 nM. These results have validated this strategy opening new opportunities to further develop cardiovascular agents based on metallo-bicyclic rings.
Investorid on dilemma ees / Ain Kivisaar
Kivisaar, Ain, 1978-
2007-01-01
Keskmise kuupalga eest ei saa enam ruutmeetritki elamispinda ei meil ega mujal. Aktiivsel investoril pole muud teha, kui heita kõrvale tavatarkus ja usaldada enda sisetunnet. Diagramm: Keskmise kuupalga ja korteri ruutmeetri hinna suhe
Euroopa abiraha igatseb taotlejaid / Ain Alvela
Alvela, Ain, 1967-
2008-01-01
Aastatel 2007-2013 saab Eesti Euroopa Liidult toetusi 78 miljardit krooni, millele toetudes on võimalik rasked ajad üle elada. Vt. samas: Tuhahoidlast asula jäätmepunktini; Suurima toetuse saab keskkond. Kommenteerivad Antti Tooming ja Kai Niels Willadsen
Teacher Tenure "Ain't" the Problem.
Hansen, Kenneth; Ellena, William J.
The concept of "tenure," with all its clumsy and confusing burden of historic and current misinterpretation, will probably soon disappear. However, what tenure laws intended, and have failed to do, will almost surely be preserved in other forms of administrative procedure. To be effective, administrative procedures must be (1) clear and detailed,…
VJ annab muusikale visuaalsuse / Ain Kivesti
Kivesti, Ain
2008-01-01
Videograafikast. Video jockey ehk videokunstnik maalib kunstiteoseid piltide ja visuaalsete elementide abil, tehes seda muusika taustal, tavaliselt paralleelselt disco jockey'ga. Toomas Altnurme, Taavi Varmi, Sten Saluveeri ja Erki Kannuse kommentaare
Makita kalmistu antropoloogiline aines / Luule Heapost
Heapost, Luule
1993-01-01
Tabel : Makita koljude keskmised mõõtmed ; Tabel : 13.-15. sajandi Makita koljud ja võrdlusmaterjalid Eestist ; Tabel 3 : 13. -15. sajandi Makita koljud ning võrdlusandmeid soome-ugri hõimude asualadelt ; Tabel 4 : 15.- 17. sajandi Makita koljud ja võrdlusandmed ; Tabel 5 : Makita koljude võrdlusandmed (Pernose'i meetodil) ; Tabel 6 : Makita luustike pikkade luude keskmine pikkus ; Tabel 7 : Kehapikkuse võrdlusandmed
Globaalsus + lennundus = Star Alliance? / Ain Hinsberg
Hinsberg, Ain
2002-01-01
Erinevad koostöövormid lennufirmade vahel, alliansside teke ja areng maailmas. Maailma juhtivad lennundusalliansid ja nende poolt kaetud riigid ja sihtkohad. Kommenteerib Estonian Airi president Erki Urva
Walhof, Gert
Omtrent technologiebedrijven konden we in december 2016 veel lezen over wat artificial intelligence, virtual reality, machine-to-machine automation, machine-to-machine learning en chatbots ons de komende jaren gaan brengen. Als inkoper zou je kunnen wachten tot duidelijk wordt wat de blijvertjes
Brain damage associated with apraxia of speech: evidence from case studies.
Moser, Dana; Basilakos, Alexandra; Fillmore, Paul; Fridriksson, Julius
2016-08-01
The site of crucial damage that causes acquired apraxia of speech (AOS) has been debated in the literature. This study presents five in-depth cases that offer insight into the role of brain areas involved in AOS. Four of the examined participants had a primary impairment of AOS either with (n = 2) or without concomitant mild aphasia (n = 2). The fifth participant presented with a lesion relatively isolated to the left anterior insula (AIns-L), damage that is rarely reported in the literature, but without AOS. Taken together, these cases challenge the role of the AIns-L and implicate the left motor regions in AOS.
Linn otsib logo ja tunnusmuusikat / Erki Varma
Varma, Erki
2003-01-01
Konkursile Tallinna linna logo ja tunnusmuusika saamiseks laekunud töid ei peetud õnnestunuiks. Žüriis Aavo Ermel, Jüri Kass ja Riho Rõõmus. Kommentaar Allan Alakülalt. Reklaamibüroo Zoom 6 kavandit
Speaking out for America's poor
DEFF Research Database (Denmark)
Jensen, Niels Rosendal
2008-01-01
The review of Edward Allan Brawley's biography on the life, work and struggle of Robert Hunter (1874-1941), one of the forgotten American social workers (settlement movement), social theoretists (poverty and revolution) as well as welfare protagonists....
Kirjandus ja vabamüürlus / Paavo Matsin
Matsin, Paavo, 1970-
2009-01-01
Loetletakse vabamüürlastest kirjanikke (pikemalt Jules Verne'ist, Gustav Meyrinkist, Rudyard Kiplingist ja Mait Metsanurgast) ning vabamüürlikke tegelasi või motiive kasutanud kirjanikke (Lev Tolstoi, Fjodor Dostojevski, Mihhail Bulgakov, Edgar Allan Poe)
Teng, Fei; Jin, Jing; Li, Yong; Zhang, Chunxi
2018-05-01
The contribution of modulator drive circuit noise as a 1/f noise source to the output noise of the high-sensitivity interferometric fiber optic gyroscope (IFOG) was studied here. A noise model of closed-loop IFOG was built. By applying the simulated 1/f noise sequence into the model, a gyroscope output data series was acquired, and the corresponding power spectrum density (PSD) and the Allan variance curve were calculated to analyze the noise characteristic. The PSD curve was in the spectral shape of 1/f, which verifies that the modulator drive circuit induced a low frequency 1/f phase noise into the gyroscope. The random walk coefficient (RWC), a standard metric to characterize the noise performance of the IFOG, was calculated according to the Allan variance curve. Using an operational amplifier with an input 1/f noise of 520 nV/√Hz at 1 Hz, the RWC induced by this 1/f noise was 2 × 10-4°/√h, which accounts for 63% of the total RWC. To verify the correctness of the noise model we proposed, a high-sensitivity gyroscope prototype was built and tested. The simulated Allan variance curve gave a good rendition of the prototype actual measured curve. The error percentage between the simulated RWC and the measured value was less than 13%. According to the model, a noise reduction method is proposed and the effectiveness is verified by the experiment.
2003-01-01
Kaheosaline teledraama "Reaganid" ("The Reagans") : režissöör Robert Allan Ackerman : Ronald Reagani rollis James Brolin : Ameerika Ühendriigid 2003. Omanik CBS ei soovi filmi praegu laiemalt näidata. Demokraadid on selle otsuse vastu
Directory of Open Access Journals (Sweden)
Francesc Torres
2016-10-01
Full Text Available Micro and nano electromechanical resonators have been widely used as single or multiple-mass detection sensors. Smaller devices with higher resonance frequencies and lower masses offer higher mass responsivities but suffer from lower frequency stability. Synchronization phenomena in multiple MEMS resonators have become an important issue because they allow frequency stability improvement, thereby preserving mass responsivity. The authors present an array of five cantilevers (CMOS-MEMS system that are forced to vibrate synchronously to enhance their frequency stability. The frequency stability has been determined in closed-loop configuration for long periods of time by calculating the Allan deviation. An Allan deviation of 0.013 ppm (@ 1 s averaging time for a 1 MHz cantilever array MEMS system was obtained at the synchronized mode, which represents a 23-fold improvement in comparison with the non-synchronized operation mode (0.3 ppm.
Data of evolutionary structure change: 1ONAD-2GDFC [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 1ONAD-2GDFC 1ONA 2GDF D C ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAK...WNMQNGKVGTAHIIYNSVDKRLSAVVSYPNADSATVSYDVDLDNVLPEWVRVGLSASTGLYKETNTILSWSFTSKLKT-NALHFMFNQFSKDQKDLILQGDATTGTDG...ain> 1ONA D 1ONAD
Data of evolutionary structure change: 1ONAD-2GDFA [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 1ONAD-2GDFA 1ONA 2GDF D A ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAK...WNMQNGKVGTAHIIYNSVDKRLSAVVSYPNADSATVSYDVDLDNVLPEWVRVGLSASTGLYKETNTILSWSFTSKLKT-NALHFMFNQFSKDQKDLILQGDATTGTDG...ain> 1ONA D 1ONAD
Eestlaste loodud südamestimulaator meelitas rikkad jänkid meie meditsiini juurde / Kerli Nõu
Nõu, Kerli
2005-01-01
Eesti teadlaste leiutis on nüüdseks mitu korda omanikku vahetanud, praegu arendatakse TTÜ Elektroonikainstituudis südamelihaste isheemiat ja infarkti ennetavat seadet edasi USA meditsiinitehnoloogia firmas St Jude Medicali lipu all. Kommenteerivad Taavi Lepmets ja Allan Martinson
Talvik, Artur, 1964-
2007-01-01
Dokumentaalfilm "Vastutuulesaal" Tõnu Kaljuste poolt Naissaarele Nargen Opera saali ehitamisest. Produtsent ja idee autor Artur Talvik, režissöör Priit Valkna räägivad filmi saamisloost. Lisaks "Teised Tõnu Kaljustest" : Arvo Aun ja Allan Vurma
Ostrich: Journal of African Ornithology - Vol 75, No 3 (2004)
African Journals Online (AJOL)
Craig Symes, Mark Brown, Louise Warburton, Michael Perrin, Colleen Downs, 106-109 ... The Birds of Hispaniola (an annotated checklist) by Allan R Keith, James W Wiley, Steven C Latta and JosE9 A Ottenwalder ... WRJ Dean, 184-185.
Eestlased rahastavad Venemaa arvutimänguäri / Toivo Tänavsuu
Tänavsuu, Toivo
2008-01-01
Allan Martinsonile ja Joakim Heleniusele kuuluv riskikapitalifond MartinsonTrigon investeeris koos partneritega Venemaa suurimasse arvutimängude tootja- ja levifirmasse Novõi Disk 200 miljonit krooni, Skype'i endine juhtinsener Toivo Annus paigutas kaks miljonit dollarit Singapuri tarkvarafirmasse Garena
Rändlinnud tulevad kevadel, plaadid nokas / Mart Niineste
Niineste, Mart, 1983-
2008-01-01
Uute heliplaatide tutvustus: Pia Fraus "After Summer", Taak "Läbi halli kivi", Vaiko Eplik ja Eliit "3. Kosmoseodüsseia", HU? "Film", Kolumbus Kris "Eesti roki annaalid", Me, Myself and I "Aastaajad", "The Nymph", Allan Vainola & Kelder "Vikerkaar ja latimeeria"
Tusov tegi sõber Kruudaga head äri / Agnes Ojala
Ojala, Agnes
2008-01-01
Kalev Real Estate Company (Kalev REC) müüs BCA Center OÜ OÜ-le Raldon. Kalevi õigusteeninduse juht Allan Viirma selgitab ettevõtte müümist. Vt. samas: Kalev Spordis jääb spordile vähem ruumi
Pruul, Priit
2006-01-01
Uutest heliplaatidest Tutty Moreno ft Joyce "Magica", Five O'Clock Heroes "Bend to the breaks", The Game "Doctor's Advocate", Allan Vainola "Unenäopüüdja", Snax "Love pollution", Zhuut "Vagiina ja 49 kuuli", Lucie Silvas "The Same Side"
Huvitav läbikukkumine / Mari Laaniste
Laaniste, Mari, 1977-
2006-01-01
Allan Moore'i ja Eddie Campbelli koomiksil põhinev õuduspõnevik "Otse põrgust" ("From Hell") : režissöörid Allen ja Albert Hughes, peaosas Johnny Depp : Ameerika Ühendriigid - Suurbritannia 2001. Pikemalt A. Moore'ist (s. 1953)
Directory of Open Access Journals (Sweden)
Helena Lúcia Alves Pereira
2006-06-01
Full Text Available Os antiinflamatórios não-esteroidais (AINEs orais são eficazes no alívio da dor na osteoartrite (OA, porém têm o risco de efeitos adversos sistêmicos. Para diminuir a toxicidade é necessário reduzir a concentração plasmática uma vez que os efeitos adversos são dose-dependentes. Os AINEs de uso tópico, em teoria, alcançam altas concentrações nos tecidos-alvo com concentrações plasmáticas baixas, sendo portanto uma alternativa terapêutica, especialmente para pacientes de risco. Nossa revisão dos ensaios clínicos randomizados mostrou que os AINEs tópicos foram mais efetivos que o placebo e tão eficazes quanto os AINEs orais. Porém, o pequeno número de ensaios e falhas na metodologia nos impossibilita de fazer conclusões definitivas, sendo necessários estudos bem desenhados e de maior duração.Oral non-steroidal anti-inflammatories drugs (NSAIDs are effective in pain relief in osteoarthritis (OA, but are also associated with risks of adverse systemic side effects. In order to reduce its toxicity, it would be desirable to decrease the plasmatic levels of NSAIDs since those side effects are dose-dependent. Topical NSAIDs would be a therapeutic alternative in theory, because while they reach high levels in local tissues, they also produce low plasmatic levels. Our review analyzed clinical randomized and shown that topical NSAIDs were superior to placebo and have similar efficacy to oral NSAIDs, but due a few number of trials and methodological weaknesses we can't make definitive conclusions. Further well designed, long term studies are required.
Onodera, Rie; Kurita, Emi; Taniguchi, Kikuyo; Karakawa, Shuhei; Okada, Satoshi; Kihara, Hirotaka; Fujii, Teruhisa; Kobayashi, Masao
2017-11-01
Anti-human neutrophil antigen (HNA) antibodies have been implicated in the development of neonatal alloimmune neutropenia (NAN) and autoimmune neutropenia (AIN). There are many conventional assay methods that detect anti-HNA antibodies. However, a method to measure multiple samples and detect several anti-HNA antibodies simultaneously is needed. We developed a new method, the extracted granulocyte antigen immunofluorescence assay (EGIFA), to analyze anti-HNA-1a, -1b, and -2 antibodies in sera. The results obtained by EGIFA were evaluated in comparison with those from several standard assay methods. Anti-HNA antibodies in serum samples from nine familial cases with suspected NAN (n = 19) and children with suspected AIN (n = 88) were also measured by EGIFA. The evaluation of nine serum samples with anti-HNA antibodies suggested that EGIFA demonstrated equivalent specificity and superior sensitivity to monoclonal antibody-specific immobilization of granulocyte antigens and had comparable sensitivity to the granulocyte indirect immunofluorescence test. EGIFA successfully detected anti-HNA-1a or -1b antibodies in seven of nine familial cases with suspected NAN. EGIFA detected anti-HNA antibodies in 40.9% of children with suspected AIN. Among them, isolated anti-HNA-1a or -1b antibody was detected in 4.5 or 12.5% of children, respectively, and anti-HNA-2 antibody was identified in 3.4% of children. The 30.8% (16 of 52) of children negative for anti-HNA antibody by EGIFA were positive for anti-HLA antibody. EGIFA facilitated the measurement of anti-HNA-1a, -1b, and/or -2 antibodies in sera. The prompt measurement of anti-HNA antibodies will improve the diagnosis and clinical management of patients with suspected NAN or AIN. © 2017 AABB.
Sikora, Elżbieta; Bodziarczyk, Izabela
2013-01-01
Organism's lipid peroxidation is one of the most often examined and known physiological process evoked by free radicals. It concerns oxidation reaction of unsaturated fatty acid and/or other lipids leading to lipid oxidation products (LOP), which as a result of further changes generate among others the malondialdehyde molecules. The aim of the work was an estimation if raw or cooked kale addition to rat's diet influences antioxidant defense efficiency in their organisms in comparison to rats fed with standard AIN-93G diet. The experiment was conducted with 36 Wistar strain, male rats over 21 days. The rats were divided into 3 groups (each 12 stuck) which were fed with: standard diet AIN-93G (2 groups), AIN-93G diet with 10% addition of raw kale (2 groups), and AIN-93G with 10% addition of cooked lyophilised kale. The total content of polyphenols (FC method) and antioxidant activity (ABTS+•) were previously determined in raw and then in cooked kale. On the 20th day of experiment, half of rats (6 stuck) of each kind of the diet were injected intraperitoneally by the solution of paraquat (PQ) in physiological salt to evoke the oxidative stress. The next day animals were stunned and blood from their hearts was sampled. In the obtained serum, the levels of lipid oxidation products (LOP) and malondialdehyde (MDA) were assessed. It was observed that in blood serum of rats fed with modified diet with raw and cooked lyophilised kale addition the lipid oxides level was lower in comparison to control group fed with standard diet (p kale addition. Diet with kale, both raw and cooked, efficiently inhibited the lipid peroxidation process in rats' organisms, ongoing during natural metabolism and during evoked oxidative stress.
Directory of Open Access Journals (Sweden)
R Ramachandran
2015-01-01
Full Text Available Steroids are used in the management of drug-induced acute interstitial nephritis (AIN. The present study was undertaken to compare the efficacy of pulse methyl prednisolone with oral prednisolone in the treatment of drug-induced AIN. Patients with biopsy-proven AIN with a history of drug intake were randomized to oral prednisolone (Group 1 1 mg/kg for 3 weeks or a pulse methyl prednisolone (Group II 30 mg/kg for 3 days followed by oral prednisolone 1 mg/kg for 2 weeks, tapered over 3 weeks. Kidney biopsy scoring was done for interstitial edema, infiltration and tubular damage. The response was reported as complete remission (CR (improvement in estimated glomerular filtration rate [eGFR] to ≥60 ml/min/1.73 m 2 , partial remission (PR (improvement but eGFR <60 ml/min/1.73 m 2 or resistance (no CR/PR. A total of 29 patients, Group I: 16 and Group II: 13 were studied. Offending drugs included nonsteroidal anti-inflammatory drugs, herbal drugs, antibiotics, diuretic, rifampicin and omeprazole. There was no difference in the baseline parameters between the two groups. The biopsy score in Groups I and II was 5.9 1.1 and 5.1 1.2, respectively. At 3 months in Group I, eight patients each (50% achieved CR and PR. In Group II, 8 (61% achieved CR and 5 (39% PR. This was not significantly different. Percentage fall in serum creatinine at 1 week (56% was higher in CR as compared to (42% those with PR. ( P = 0.14. Patients with neutrophil infiltration had higher CR compared to patients with no neutrophil infiltration ( P = 0.01. Early steroid therapy, both oral and pulse steroid, is equally effective in achieving remission in drug-induced AIN.
Kaks debüüti / Lilian Vellerand
Vellerand, Lilian, 1932-
1997-01-01
"Shakespeare'i kogutud teosed" ("The Complete Works of William Shakespeare") Rakvere Teatris, lavastaja Ain Prosa ja Friedebert Tuglase - Ingomar Vihmari "Hei, Luciani!" Ugalas, lavastaja Ingomar Vihmar
Physical and mental health: from youth to age in Ohio prisons.
Lynd, Alice
2014-01-01
Who cares about health care in prisons? You do if you have a son or a granddaughter in prison. Maybe you care anyway if you have had to wait a long time to see a doctor or if you could not have the treatment you needed because it cost too much. Maybe you have run into the attitude, "You ain't bleedin', you ain't needin'." Maybe you have found it hard to face the future with little or no hope that you could ever be in a better place. Or maybe you, like some older prisoners, have been able to develop new interests, new skills, to review your life and review it, and to redefine what matters.
Data of evolutionary structure change: 1ONAD-2D3PB [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 1ONAD-2D3PB 1ONA 2D3P D B ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAK...WNMQNGKVGTAHIIYNSVDKRLSAVVSYPNADSATVSYDVDLDNVLPEWVRVGLSASTGLYKETNTILSWSFTSKLKT------NALHFMFNQFSKDQKDLILQGDAT...ain> 1ONA D 1ONAD TR
Keratosis reduces sensitivity of anal cytology in detecting anal intraepithelial neoplasia.
ElNaggar, Adam C; Santoso, Joseph T; Xie, Huiwen Bill
2012-02-01
To identify factors that may contribute to poor sensitivity of anal cytology in contrast to the sensitivity of anoscopy in heterosexual women. We analyzed 324 patients with biopsy confirmed diagnosis of genital intraepithelial neoplasia (either vulva, vaginal, or cervical) from 2006 to 2011 who underwent both anal cytology and anoscopy. Cytology, anoscopy, and biopsy results were recorded. Biopsy specimens underwent independent analysis for quality of specimen. Also, biopsy specimens were analyzed for characteristics that may contribute to correlation, or lack thereof, between anal cytology and anoscopic directed biopsy. 133 (41%) patients had abnormal anoscopy and underwent directed biopsy. 120 patients with normal anal cytology had anoscopy directed biopsies, resulting in 58 cases of AIN (sensitivity 9.4%; 0.039-0.199). This cohort was noted to have extensive keratosis covering the entire dysplastic anal lesion. 18 patients yielded abnormal anal cytology. Of these patients, 13 had anoscopic directed biopsies revealing 6 with AIN and absent keratosis (specificity 88.6%; 0.78-0.95). The κ statistic for anal cytology and anoscopy was -0.0213 (95% CI=-0.128-0.086). Keratosis reduces the sensitivity of anal cytology. Furthermore, anal cytology poorly correlates with anoscopy in the detection of AIN (κ statistic=-0.0213). Copyright © 2011 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Megan C. Hallam
2016-01-01
Full Text Available The Thrifty Phenotype Hypothesis proposes that the fetus takes cues from the maternal environment to predict its postnatal environment. A mismatch between the predicted and actual environments precipitates an increased risk of chronic disease. Our objective was to determine if, following a high fat, high sucrose (HFS diet challenge in adulthood, re-matching offspring to their maternal gestational diet would improve metabolic health more so than if there was no previous exposure to that diet. Animals re-matched to a high prebiotic fiber diet (HF had lower body weight and adiposity than animals re-matched to a high protein (HP or control (C diet and also had increased levels of the satiety hormones GLP-1 and PYY (p < 0.05. Control animals, whether maintained throughout the study on AIN-93M, or continued on HFS rather than reverting back to AIN-93M, did not differ from each other in body weight or adiposity. Overall, the HF diet was associated with the most beneficial metabolic phenotype (body fat, glucose control, satiety hormones. The HP diet, as per our previous work, had detrimental effects on body weight and adiposity. Findings in control rats suggest that the obesogenic potential of the powdered AIN-93 diet warrants investigation.
Caraban Gonzalez, Noemi
2018-01-01
The Synchrotron-Light for Experimental Science and Applications in the Middle East (SESAME) is an independent laboratory located in Allan in the Balqa governorate of Jordan, created under the auspices of UNESCO on 30 May 2002. December 2017, Jordan Picture: Noemi Caraban
77 FR 35475 - Internal Revenue Service
2012-06-13
... contributions, consideration does not include de minimis goods or services. It also provides guidance on how..., maintenance, and purchase of services to provide information. Approved: June 6, 2012. Allan Hopkins, Tax... DEPARTMENT OF THE TREASURY Internal Revenue Service Proposed Collection; Comment Request for...
Recent advances in the biogeochemistry of nitrogen in the ocean
Digital Repository Service at National Institute of Oceanography (India)
Naqvi, S.W.A.; Voss, M.; Montoya, J.P.
, K. O., Orr, W. L., and Rittenberg, S. C.: Nutrient budgets in the ocean, in: Essays in Natural Sciences in Honor of Captain Allan Hancock, University of Southern California Press, Los An- geles, pp. 299-309, 1955. Falcon, L. I., Carpenter, E. J...
Educational Reform: Critiquing the Critics.
Reid, Charles R.
1990-01-01
Reviews Walter Feinberg's criticisms of educational critics Allan Bloom and E. D. Hirsch. Supports Feinberg's argument that experimentation is the only course still open in education, but argues that his views are informed by the traditional obscurantism of the educational establishment. (FMW)
Forskning i mediesprog - teorier, modeller og analyser
DEFF Research Database (Denmark)
Frandsen, Finn
1996-01-01
Kritisk præsentation af den nyeste forskning i mediesprog med fokus på det teoretiske grundlag og de opstillede analysemodeller (Teun van Dijk og teorien om tematiske makrostrukturer/skematiske superstrukturer, Allan Bell og sociolingvistikken, Roger Fowler og den kritiske lingvistik samt Norman...
Nathan, George J.
1991-01-01
Discusses Allan Bloom's "The Closing of the American Mind," examining his critique of relativism, particularly cultural relativism. The paper states that the existence of cultural relativism is a cause and sign of significant fragmentation and separateness in modern society and the university. (SM)
78 FR 79061 - Noise Exposure Map Notice; Key West International Airport, Key West, FL
2013-12-27
... INFORMATION CONTACT: Allan Nagy, Federal Aviation Administration, Orlando Airports District Office, 5950 Hazeltine National Drive Citadel International Building, Suite 400, Orlando, FL 32822, 407-812-6331... Maps which meet applicable regulations and which depict non-compatible land uses as of the date of...
African Journals Online (AJOL)
raoul
2011-08-23
Aug 23, 2011 ... Reporting epidemics: newspapers, information dissemination and the story of Ebola in the Ugandan district of Luweero. Allan Mwesiga1,&. 1Pan African Medical Journal, African Field Epidemiology Network (AFENET), Kampala, Uganda. &Corresponding author: Pan African Medical Journal, African Field ...
Reconstruction of exposure histories of meteorites from Antarctica and the Sahara
International Nuclear Information System (INIS)
Neupert, U.; Neumann, S.; Leya, I.; Michel, R.; Kubik, P.W.; Bonani, G.; Hajdas, I.; Suter, M.
1997-01-01
10 Be, 14 C, and 26 Al were analyzed in H-, L-, and LL-chondrites from the Acfer region in the Algerian Sahara and from the Allan Hills/Antarctica. Exposure histories and terrestrial ages could be determined. (author) 3 figs., 2 refs
Class Counts: An Overview and Response to Mr. Cooper's Review
Ornstein, Allan
2009-01-01
This article presents Allan Ornstein's response to highly respected scholar, Bruce Cooper's review of Ornstein's 2007 book, "Class Counts: Education, Inequality and the Shrinking Middle Class." Here Ornstein attempts to elaborate on a few points that he felt Cooper missed in his review.
Heat Transfer Characteristics in High Power LED Packaging
Directory of Open Access Journals (Sweden)
Chi-Hung Chung
2014-03-01
Full Text Available This study uses the T3Ster transient thermal resistance measuring device to investigate the effects to heat transfer performances from different LED crystal grains, packaging methods and heat-sink substrates through the experimental method. The experimental parameters are six different types of LED modules that are made alternatively with the crystal grain structure, the die attach method and the carrying substrate. The crystal grain structure includes the lateral type, flip chip type and vertical type. The die attach method includes silver paste and the eutectic structure. The carrying substrates are aluminum oxide (Alumina and aluminum nitride (AIN ceramic substrates and metal core PCB (MCPCB. The experimental results show that, under the conditions of the same crystal grain and die attach method, the thermal resistance values for the AIN substrate and the Alumina substrate are 2.1K/W and 5.1K/W, respectively and the total thermal resistance values are 7.3K/W and 10.8K/W. Compared to the Alumina substrate, the AIN substrate can effectively lower the total thermal resistance value by 32.4%. This is because the heat transfer coefficient of the AIN substrate is higher than that of the Alumina substrate, thus effectively increasing its thermal conductivity. In addition, under the conditions of the same crystal grain and the same substrate, the packaging methods are using silver paste and the eutectic structure for die attach. Their thermal resistance values are 5.7K/W and 2.7K/W, respectively, with a variance of 3K/W. Comparisons of the crystal grain structure show that the thermal resistance for the flip chip type is lower than that of the traditional lateral type by 0.9K/W. This is because the light emitting layer of the flip chip crystal grain is closer to the heat-sink substrate, shortening the heat dissipation route, and thus lowering the thermal resistance value. For the total thermal resistance, the crystal grain structure has a lesser
Meie igapäevane paanika / Ott Karulin
Karulin, Ott, 1980-
2007-01-01
Kahest Vanemuise teatri lavastusest Tartus - Saksa Kultuuri Instituudis etendunud Ingvar Ambjornseni-Axel Hellsteniuse "Elling" Ain Mäeotsa lavastuses ja Laura Cunninghami "Beautiful Bodies" Vanemuises, lavastaja Jüri Lumiste
Case C-182/15, Proceedings Relating to the Extradition of Aleksei Petruhhin / Filippo Fontanelli
Fontanelli, Fillippo
2017-01-01
Euroopa Kohtu lahendist, mis puudutab Venemaa ametiasutuste poolt Läti ametiasutustele saadetud Eesti kodaniku Aleksei Petruhhini väljaandmise taotlust seoses narkootilise aine turustamise süüteoga
Leijen, Äli, 1979-
2013-01-01
Aineõpetaja magistriõppe üliõpilaste seas läbi viidud uurimusest, milles vaadeldakse, kuidas üliõpilased koordineerivad personaalset ja professionaalset mina-positsiooni erialaste ambivalentsete olukordade kontekstis
2008-01-01
Artikkel kirjeldab õpetajakoolituse olukorda Eestis aastal 2003. Aineõpetajate, klassiõpetajate ja koolieelsete lasteasutuste õpetajate ettevalmistusest Tallinna Ülikoolis ning nende karjääriperspektiive tööturul
Lõuna-Florida Pauluse Kogudus 20-aastane / foto: Edith Erton
2006-01-01
jaanuaris toimunud aastapäeva pühitsemisest Peace Lutheran Church kirikus, Ft. Lauderdale´is. Koguduse esimees Allan Pensa tegi ülevaate koguduse tekkeloost ja tegevusest tänaseni. Jutluse pidas praost Valdeko Kangro, pärast jumalateenistust oli pidulik koosviibimine kiriku kõrvalsaalis
The Closing of the "Bazaar of Cultures": Anthropology as Scapegoat.
Klass, Morton
1990-01-01
Notes Allan Bloom's attack on anthropologists and the concept of cultural relativism. Rejects the idea that the study of other cultures leads to giving up one's own culture. Suggests that Bloom represents a nativistic revitalization movement which has found that anthropologists make excellent scapegoats. (EVL)
Transporters MCT8 and OATP1C1 maintain murine brain thyroid hormone homeostasis
Mayerl, Steffen; Müller, Julia; Bauer, Reinhard; Richert, Sarah; Kassmann, Celia M.; Darras, Veerle M.; Buder, Katrin; Boelen, Anita; Visser, Theo J.; Heuer, Heike
2014-01-01
Allan-Herndon-Dudley syndrome (AHDS), a severe form of psychomotor retardation with abnormal thyroid hormone (TH) parameters, is linked to mutations in the TH-specific monocarboxylate transporter MCT8. In mice, deletion of Mct8 (Mct8 KO) faithfully replicates AHDS-associated endocrine abnormalities;
Reconstruction of exposure histories of meteorites from Antarctica and the Sahara
Energy Technology Data Exchange (ETDEWEB)
Neupert, U.; Neumann, S.; Leya, I.; Michel, R. [Hannover Univ. (Germany). Zentraleinrichtung fuer Strahlenschutz (ZfS); Kubik, P.W. [Paul Scherrer Inst. (PSI), Villigen (Switzerland); Bonani, G.; Hajdas, I.; Suter, M. [Eidgenoessische Technische Hochschule, Zurich (Switzerland)
1997-09-01
{sup 10}Be, {sup 14}C, and {sup 26}Al were analyzed in H-, L-, and LL-chondrites from the Acfer region in the Algerian Sahara and from the Allan Hills/Antarctica. Exposure histories and terrestrial ages could be determined. (author) 3 figs., 2 refs.
78 FR 23980 - Proposed Collection; Comment Request for Publication 1075
2013-04-23
... Publication 1075 AGENCY: Internal Revenue Service (IRS), Treasury. ACTION: Notice and request for comments... Publication 1075, Tax Information Security Guidelines for Federal, State, and Local Agencies. DATES: Written... copies of the publication should be directed to Allan Hopkins at Internal Revenue Service, Room 6129...
Slalomiste Oprjat ja Nurmbergi muserdavad rasked traumad / Priit Pullerits
Pullerits, Priit, 1965-
2006-01-01
Eesti mäesuusataja Deyvid Oprja selg ja Tiiu Nurmbergi põlv on nii tõsiselt viga saanud, et neid abistava kiropraktiku Allan Austin Oolo hinnangul on mõlema sportlase olukord äärmiselt tõsine. Tiiu Nurmberg lõpetas oma etteaste 44. kohaga
Oja, Martin, 1978-
2007-01-01
Sõjafilmide ideoloogilisest tasandist. Tähelepanekuid ja märkusi nelja filmi põhjal: "Casablanca" (rezh. Michael Curtiz, 1942), "Iwo Jima liivad" (rezh. Allan Dwan, 1949), "Reamees Ryani päästmine" (rezh. Steven Spielberg, 1998), "Vaenlane väravas" (rezh. Jean-Jacques Annaud, 2001)
X-chromosome inactivation and escape
Indian Academy of Sciences (India)
2015-11-06
Nov 6, 2015 ... tion and cancer in mice after a long period of time (Yildirim et al. 2013). ... chromosome of man has a short pairing seg- ment, that is not normally ..... Lyon M. F. 1988 The William Allan memorial award address: X-chromosome ...
Edgar Allan Poe's "Ligeia": an object-relational interpretation.
Zlotnick-Woldenberg, C
1999-01-01
This paper argues that Poe's short story "Ligeia," in which the narrator experiences the death of his adored first wife (Ligeia), a second marriage to the despised Rowena, and ultimately the death of Rowena and the revivification of Ligeia, is not a supernatural tale, but rather a psychological one. According to this reading, the poisoning of Rowena and the revivification of Ligeia are hallucinated by the narrator in the course of an opium-induced psychotic break. The antecedents to this break are explored in light of object relations theory, with particular emphasis placed on the way in which the two women function as part objects. Ligeia represents the narrator's romantic and spiritual side and is associated with the good mother, while Rowena, who represents his more mundane and materialistic side, is associated with the rejecting mother. It is argued that the narrator, functioning primarily in the schizoid position and employing such defense mechanisms as splitting and projection--which already require a high degree of fantasy--is not an unlikely candidate for such a break.
Väikese saareriigi ületamatu probleem / Allan Espenberg
Espenberg, Allan
2008-01-01
Küprose türklaste president Mehmet Ali Talat ja Kreeka-osa uus president Demetris Christofias pidasid läbirääkimisi, mille peateemaks oli võimufunktsioonide jaotumine ning türgi ja kreeka kogukondade staatus ühise föderatiivse riigi loomise korral
Ecuador ajas narkovastase baasi ära / Allan Espenberg
Espenberg, Allan
2009-01-01
2008. aastal võttis Ecuadori Asutav Kogu president Rafael Correa kihutusel vastu otsuse keelata välisriikidel Ecuadoris sõjaväebaase omada. 17. sept. lahkusidki viimased USA sõdurid Ecuadori sõjaväebaasist
Veretu retrobuum : [ka TPÜ AR kohvikust] / Allan Hmelnitski
Hmelnitski, Allan
2004-01-01
"Ka mina eelistan kõigi söögikohtade seast Teaduste Akadeemia puhvetit, mis on 100% breezhnevi aegne disain - kunstnahast lett, ümmargused madalad lauad, pikk-pikk nahkdiivan, kurgid ja tomatid mis maitsevad hästi ja tugevalt, täpselt nagu aastal 85, hallides ülikondades vanemad härrad vestlemas põlevkivist ja paeklindi ajaloost. Vot see on tõeline petlik naiivsus, turvalisus, rahu, muretus ja stabiilsus nagu aastal 76 ema süles."
Mosambiigi rikkaim mees presidendiks tõusmas / Allan Espenberg
Espenberg, Allan
2004-01-01
Presidendivalimistest Mosambiigis, kus valimas käis vaid 30% kodanikest. Enim hääli kogusid valitsust esindav ärimees Armandi Guebuza ja sissiorganisatsiooni ning opositsiooniliikumise RENAMO liider Alfonso Dhlakama
Rwandas võtsid võimu naised / Allan Espenberg
Espenberg, Allan
2008-01-01
Septembris toimunud parlamendivalimiste järel sai Aafrikas asuvast Rwandast esimene riik, kus parlamendiliikmete hulgas on rohkem naisi kui mehi. Ka parlamendi alamkoja etteotsa valiti naine - naisõiguslane ja õigusteaduste doktor Rose Mukantabana
Jalgpallisõjal polnud jalgpalliga mingit seost / Allan Espenberg
Espenberg, Allan
2005-01-01
14. juulil 1969 ründas El Salvador riigipea Fidel Sanchez Hernandeze korraldusel naaberriiki Hondurast. Rahulepinguni jõuti pärast ülikeerukaid ja mitmel korral katkenud läbirääkimisi alles 1980. aastal
Hudoi mir lutshshe dobroi ssorõ / Allan Soon
Soon, Allan, 1968-
2007-01-01
Eestlaste ja venelaste vahelistest suhetest pärast pronkssõduri teisaldamisega toimunud sündmusi. Autori arvates peaksid nii eestlased kui ka venelased astuma samme konflikti lahendamiseks, mitte jääma passiivselt ootama
Altkäemaksuskandaal kukutas Peruu valitsuse / Allan Espenberg
Espenberg, Allan
2008-01-01
Oktoobri algul puhkes Peruus ulatuslik korruptsiooniskandaal, millesse olid segatud riigi kõrged ametiisikud. Skandaali tulemusena vabastati peaminister ja tema juhitud valitsus. Uueks peaministriks nimetati vasakpoolsete vaadetega Yehude Simon Munaro
Briti eksimpeerium käib koos / Allan Espenberg
Espenberg, Allan
2007-01-01
Ugandas peeti Briti Rahvaste Ühenduse (e. Commonwealth) valitsusjuhtide tippkohtumist. Kohtumise avas Briti kuninganna Elizabeth II, kes on ühenduse paljude maade nominaalne riigipea. Seoses keerulise sisepoliitilise olukorraga Pakistanis ja sealse presidendi Pervez Musharaffi tegevusega otsustati Pakistan ühenduse koosseisust ajutiselt välja arvata
Aafrika saab endale esimese ühisarmee / Allan Espenberg
Espenberg, Allan
2007-01-01
Lõuna-Aafrika riikide majandusühenduse (Southern African Development Community) SADCi peaeesmärkidest ja tegevusest. Organisatsiooni 27. tippkohtumisel valiti uueks esimeheks Sambia president Levy Mwanawasa, samas otsustati moodustada ka regionaalne armee, mille peamiseks ülesandeks on rahumissioonide korraldamine ja elluviimine
Vanuatu-Taiwani sõprus masendab Hiinat / Allan Espenberg
Espenberg, Allan
2004-01-01
Taiwan hakkab laiendama ja tihendama majanduslikku, tehnilist, turismi- ja põllumajandusalast koostööd Vanuatuga. Hiina kasutab suhtlemisel maailma riikidega vastavalt vajadusele survepoliitikat eeskätt majanduse ja rahanduse vallas ning pakub riikidele Taiwaniga suhtlemise lõpetamise eest erinevat finants- ja majandusabi. Lisa: Vanuatu vabariik
Miljardär premeerib äraostmatuid / Allan Espenberg
Espenberg, Allan
2009-01-01
Sudaani päritolu ärimees Mo Ibrahim pani välja auhinna Aafrika riigijuhile, kes suudab valitseda demokraatlikult ja võidelda korruptsiooniga, kaks korda on seda välja antud, kuid sel aastal ei leitud ühtegi väärilist kandidaati
USA luure : Fidel Castro on suremas / Allan Espenberg
Espenberg, Allan
2006-01-01
Kuuba president Fidel Castro, Haiti president Rene Preval, Filipiinide president Gloria Macapagal-Arroyo, Türkmenistani president Saparmurat Nijazov, Guinea president Lansana Conte ja Itaalia ekspeaminister Silvio Berlusconi, Sambia ekspresident Frederick Chilubaga võitlevad terviseprobleemidega
Naise võim Bermudas : kubjas kukutati / Allan Espenberg
Espenberg, Allan
2003-01-01
Suurbritanniale kuuluva Bermuda saare parlamendivalimised vallandasid sündmuste ahela, mis võivad muuta asumaa poliitikat. Ametist tagandati peaminister Jennifer Meredith Smith ja uueks peaministriks sai senine tööminister William Alexander Scott
Kesk-Ameerika võitleb uimastimaffia vastu / Allan Espenberg
Espenberg, Allan
2008-01-01
USA parlament andis rohelise tee Merida initsiatiivile, mis näeb ette Mehhikole, Kesk-Ameerika riikidele ja Kariibi maadele organiseeritud kuritegevuse vastu võitlemiseks majanduslikku ja tehnilist abi
Maldiivide saareriigis kukutati igipresidendiks peetud mees / Allan Espenberg
Espenberg, Allan
2008-01-01
Maldiividel toimusid 8. oktoobril riigi ajaloo esimesed demokraatlikud valimised, sai valida mitme presidendikandidaadi vahel. 35 aastat riiki valitsenud president Maumoon Abdul Gayoom jäi valimistel alla opositsiooni kandidaadile Mohamed Nasheedile
Esteet Hartshenko contra mehed punases / Heili Vaus-Tamm
Vaus-Tamm, Heili, 1961-
2007-01-01
Tantsuetendustest Kumu Kunstimuuseumis: "Red ain't dead", koreograaf - lavastajad Kaarel Väli, Kristjan Rohioja; tantsuteatri Zick esituses "Piaf", koreograaf - lavastaja Dmitri Harchenko. Dominiiklaste kloostri klausuuris "Reisijuht", koreograaf - lavastaja Dmitri Harchenko
Stirlitzi leitmotiivist rõõmsalt süüdimatu jäneste lauluni / Jüri Aarma
Aarma, Jüri, 1951-
2010-01-01
Vene filmimuusika kontserdist "Seitseteist kevadist hetke", mis toimub Vanemuise kontserdimajas 2. aprillil, Jõhvi kontserdimajas 4. aprillil ja Estonia kontserdisaalis 6. aprillil, lavastaja Ain Mäeots. Näidatakse vastavaid filmilõike
Vahemets, Aivo
2006-01-01
Uutest heliplaatidest Waltari "Blood Sample", Anthony Hamilton "Ain't Nobody Worrying", Kismabande "Polüpale", Siiri Sisask "Kuu lõhn", Les Diamants "Fortune Fools", "The Voice Clubbin", Nits "Les Nuits"
Politicians spin attacks against methadone, syringe replacement / Milda Seputyte
Seputyte, Milda
2005-01-01
Leedu parlamendiliikmed osalevad kampaanias, millega võideldakse narkomaanidele tasuta süstalde jagamise ja sõltuvuse vastase aine metadooni vastu, kuna nende arvates need meetmed pigem süvendavad narkomaaniat
Kõnnivad köiel ja hoiavad kätt / Iir Hermeliin, Jaanus Vahtra ; intervju Sven Karja
Iir Hermeliin, pseud., 1973-
2000-01-01
Teatrikunstnikud Iir Hermeliin ja Jaanus Vahtra ning nende looming. Kunstnikud lavastajatest ja lavastajad Mati Unt ja Ain Mäeots koostööst kunstnikega lavastustes "Jacques ja tema isand"; "Laulatus"
CERN firemen share their expertise
Maximilien Brice
2002-01-01
Firemen from local fire brigades have been coming to CERN to learn modern fire-fighting techniques. The CERN fire brigade has some unique training equipment for two particularly dangerous fire hazards, flashover and backdraft. Flashover occurs when a room that is on fire reaches a temperature of 400 to 500°. Beyond this point, a fully developed fire breaks out. This series of photos shows recruits from the fire services of Ain (Service Départemental Incendie et Secours (SDIS)) taking part in a flashover training exercise at CERN. Photo 01: Christopher Griggs, Chief Instructor of the CERN fire brigade (seated in the centre), explains the technique of using a fire-hose during a flashover to the recruits from the Ain SDIS.
2006-01-01
Vanemuise teatri draamanäitlejad tunnistasid möödunud aasta parimaks lavastuseks augustis Setumaal Obinitsas etendunud "Taarka", mille lavastas Ain Mäeots. Parimaks naispeaosatäitjaks valiti Merle Jääger, parimaks meespeaosatäitjaks Indrek Taalmaa, parimaks naiskõrvalosatäitjaks Karin Tammaru, parimaks meeskõrvalosatäitjaks Tanel Jonas. Eesti Draamateatri 2005. aasta Antsud ehk kolleegipreemiate laureaadid : Ingomar Vihmar (parim lavastaja), Ervin Õunapuu (parim kunstnik), Ülle Kaljuste (parim naisnäitleja), Ain Lutsepp (parim meesnäitleja), Väikesed Antsud pälvisid Elina Reinold ja Taavi Teplenkov, Abi-Antsuks kuulutati teatri kirjandusala juhataja Ene Paaver. Endla 2005. aasta kolleegipreemiad said Lii Tedre (parim naisnäitleja), Tambet Seling (parim meesnäitleja), Tiit Palu (parim lavastaja) ja Silver Vahtre (parim kunstnik)
Kummitusmaja ja fusion-köök = Haunted House and Fusion Cuisine / Kai Lobjakas
Lobjakas, Kai, 1975-
2003-01-01
Tallinnas Rataskaevu 16 asuva jaapani toitu pakkuva restorani "Sushihouse" kujundus, ruumide restaureermine. Sisekujundajad Ain Nurmela ja Liina Link. Projekt 2001-2003, valmis 2003. Kõige muinsusteadlikumalt restaureeritud maja 2002. a. 3 ill
Materjalide jagamisest võidavad kõik / Maarja Soone
Soone, Maarja
2011-01-01
Koolitusest Colchesteris - Content and Language Integrated Learning, mis tähendab võõrkeelset aineõpet, kus vajadusel võetakse kasutusele ka emakeel, mistõttu viidatakse sellele tihti kui kakskeelsele õppele
Märkmeid uusima Preisi tsensuuriinstruktsiooni kohta / Karl Marx
Marx, Karl
2000-01-01
Preisi uue (1841. aasta) tsensuuriinstruktsiooni tõusikliku vaimu vastuolust vana (1818. aasta) tsensuurimääruse ratsionalismiga. Moraali ja religiooni vastuolust. Vt. ka Ain Kaalepi artiklit "Veel Karl Marxist ja tsensuurist
Tallinn pokupajet zemlju dlja prokladki shosse Põhjaväil
2007-01-01
Seoses Russalkast Ahtri tänavani ulatuva tee-ehitusega seisab linnal ees 16 maaküsimuse lahendamine. Probleemidest seoses väila osaliselt merre ehitamisega. Kommenteerivad Alo Brandt ja Ain Valdmann
Lifescience Database Archive (English)
Full Text Available oencephalopathy (CADASIL) CADASIL is a chronic cerebrovascular disorder characterized by recurrent ischemic attacks and frequent migr...aines associated with diffuse white-matter abnormalities. CADASIL is caused by muta
AHHAA keskus Tartus = The Ahhaa Science Centre in Tartu / Triin Ojari
Ojari, Triin, 1974-
2011-01-01
2011. a. valminud AHHAA teaduskeskuse arhitektid on Ain Padrik ja Vilen Künnapu (AB Künnapu & Padrik), sisearhitektid Tea Tammelaan, Krista Lepland ja Malle Jürgenson (Laika, Belka & Strelka). Projekt: 2008
Vene elu hõng Pilistvere rehealuses / Margot Visnap
Visnap, Margot, 1959-
2008-01-01
Pilistvere rehehoones etendunud Ain Saviaugu kirjutatud ja lavastatud suvetükist "Rasputin". Suvelavastuse tõi välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas Indrek Saar
Vek lovi - vek utshis / Hillar Jõõts ; interv. Kalju Hook
Jõõts, Hillar
2005-01-01
Keskkonnainspektsiooni Pärnumaa osakonna juhtivspetsialist Hillar Jõõts keskkonnaministeeriumi kalavarude osakonna juhataja Ain Soome, Eesti Kalurite Liidu juhatuse esimehe Andres Variku ja Eesti Mereinstituudi direktori Toomas Saati kohtumisest Pärnumaa kaluritega
Current Titles in Turkish Science. Volume 6. Numbers 7-9, July-August-September 1979
1979-01-01
19 (2) 173-177. (5 refs. Tu. , en.) (79-1882) KARACADAÜ §., BERlLGEN A. Dysphagia due to cervical osteophytes (A case report). Hacettepe...gulairova D. Tip Fak. Derg. (1979) 4 (I) 26-33. (19 refs. Tu., en. ) (79-1923) ONAT, Allan. Dradycardio-depondent Wolff- Parkinson -White
Kalev ja Rae vald tülitsevad tehase reovee pärast / Garel Püüa
Püüa, Garel
2006-01-01
Kalevi kommivabriku heitvee reostustase ületab kohati kümme korda tehase ehitamisel taotletud taset, Rae valla veepuhasti ei suuda nii suurt koormust taluda. Kalevi õigusteeninduse juhi Allan Viirma sõnul ei ole vald väljastanud Kalevile reovee eelpuhastite rajamiseks projekteerimistingimusi. Kommenteerib Rae vallavanem Raivo Uukkivi
2000
This collection of curriculum projects considers the change and modernization of China. The following 15 projects are in the collection: "Globalization in China" (Allan Cooper); "Religion and Identity in Contemporary China" (Wade H. Dazey); "China and the West: A Global Context for Chinese Immigration to the United…
Indian Academy of Sciences (India)
strengthening and restoration especially against environmental factors like corrosion. ... structures, they have successfully been applied as patches in aviation and marine industry (Allan ... be reached for the system investigated. .... Load–deflection diagrams for the middle of the span in control beams are shown in figures 8.
The savory method can not green deserts or reverse climate change
Mr. Allan Savory addressed one of the major environmental challenges of our time – rapidly increasing atmospheric CO2 concentrations and climate warming - in a video presentation entitled, "How to green the world's deserts and reverse climate change" that was presented at the 2013 TED (Technology, E...
International student mobility literature review
King, R.; Findlay, A.; Ahrens, J.
2010-01-01
To bring their understanding of patterns in students' study and work abroad up to date, HEFCE and the British Council, the UK National Agency for Erasmus, commissioned a review of international student mobility. Professor Russell King and Jill Ahrens of the University of Sussex, and Professor Allan
Antologi om Visuelle Felt-& Analyse Metoder
DEFF Research Database (Denmark)
Lundberg, Pia
andet baseret på det poetiske princip, af Edgar Allan Poe, som blev udgivet posthumt i 1850. Derudover anvendes antropologerne Victor Turner & Edward Bruners teoretiske arbejder om forskellige kulturæstetiske fænomener og udtryk (fx Bruner 1986). Sidst men ikke mindst anvendes de kulturvidenskabelige...
Book reviews | Malan | African Journal on Conflict Resolution
African Journals Online (AJOL)
CONFLICT AND RESOLUTION: PEACE-BUILDING THROUGH THE BALLOT BOX IN ZIMBABWE, NAMIBIAAND CAMBODIA GRIFFITH, Allen 1998. New Cherwell Press, Oxford. 337pp (Allan Griffith, who had been foreign policy adviser to Australian prime ministers or over 30 years, completed this book as Visiting Fellow of ...
Thyroid hormone resistance may course hypotonia in infancy
DEFF Research Database (Denmark)
Pivkovska, Julijana; Born, Alfred Peter; Nielsen, Claus Thøger
2014-01-01
Allan Herndon Dudley's syndrome (AHDS) is X-linked mental retardation and hypotonia caused by mutations in a thyroid hormone transporter gene - MCT8. The typical thyreoidea AHDS profile is elevated T3, low-normal T4 and normal or elevated thyroid stimulating hormone (TSH). Neonatal screening...
Martino, Wayne
2013-01-01
This essay provides a review of a resource guide written by Kristopher Wells, Gayle Roberts, and Carol Allan (2012) titled "Supporting Transgender and Transsexual Students in K-12 Schools: A Guide for Educators". The guide is an invaluable resource for educators in schools and teacher education programs.
Temperature tolerances and southern African distribution of a ...
African Journals Online (AJOL)
jars were covered with gas-permeable polythene sheeting to reduce evaporative losses. Water was not changed during the experiments, in view of their generally .... coastal systems where colder winter conditions prevail. Allanson, Ernst & Noble (1962) and Solomon & Allan- son (1968) have commented on an improved ...
Vene mõjukaim IT-guru soovitab Eesti uuendusi ida poole müüa / Henrik Roonemaa
Roonemaa, Henrik
2005-01-01
Eestit külastanud Venemaa mõjukamaid IT-gurusid Alexander Galitsky soovitab Eestis välja töötatud ja toimivaid innovaatilisi lahendusi pakkuda Venemaa turule. Alexander Galitsky nõustab Allan Martinsoni investeerimisfirmat Martinson Trigon Venture Partners. Vt. samas: E-riigi Akadeemia aitab firmade saavutused itta
Czech Academy of Sciences Publication Activity Database
Holanová, Markéta
2017-01-01
Roč. 65, č. 1 (2017), s. 48-71 ISSN 0009-0468 Institutional support: RVO:68378068 Keywords : Poe, Edgar Allan * Collins, Wilkie * Gaboriau, Émile * Doyle, Arthur Conan * detective prose * genre awareness * Czech literary culture Subject RIV: AJ - Letters, Mass-media, Audiovision OBOR OECD: Specific literatures
Occurrence of Gastrointestinal Helminths in rabbits with special ...
African Journals Online (AJOL)
2013-09-25
Sep 25, 2013 ... droppings to digest their food further and extract sufficient nutrients (Oaktreevet, 2010). Rabbits are generally infected with numerous parasites. Parasitic infections have caused considerable losses to rabbits in the region. Numbers of parasites are responsible for illness of rabbits (Allan et al., 1999).
Yeast Interacting Proteins Database: YOR171C, YOR034C [Yeast Interacting Proteins Database
Lifescience Database Archive (English)
Full Text Available ain base phosphates, which function as signaling molecules, regulates synthesis of ceramide from exogenous l...chain base phosphates, which function as signaling molecules, regulates synthesis of ceramide from exogenous
Bez kota mõsham razdolje / Jevgeni Kapov
Kapov, Jevgeni
2004-01-01
Sillamäe linnapea Ain Kiviorgi ja Vaivara vallavanema Veiko Luhalaidi kohtumisest Politseiameti peadirektori Robert Antropovi ja Ida politseiprefekti Kalev Prillopiga, kus arutati seoses politseireformiga Sillamäe regioonis tekkinud korrakaitse probleeme
President Meri annetas aumärke
1996-01-01
Riigivapi I klassi orden Jaan Krossile ja Kalju Lepikule; Riigivapi III klassi orden Ain Kaalepile, Hilja Rüütlile (Aili Helm); Riigivapi IV klassi orden Voldemar Millerile, Juhan Peeglile ja Ants Viiresele
Partii Reform ne bezrazlitshna sudba russkogo obrazovanija / Sergei Ivanov
Ivanov, Sergei, 1958-
2005-01-01
Riigikogu liige vastab küsimustele, mis puudutavad Tallinna Pedagoogikaülikoolis algavat vene koolide jaoks aineõpetajate ettevalmistamist ja selleks ettenähtud rahasummat, vene akadeemilise keskuse loomiseks eraldatud raha kulutamist
Lifescience Database Archive (English)
Full Text Available aine ... D01152 ... Oxethazaine (JP17/USAN); Oxetacaine (INN) ... D08311 ... Oxetacaine hydrochloride ... DG00801 ... Bupivacaine ... D07552 ... Bupiva...caine (USAN/INN) ... D01450 ... Bupivacaine hydrochloride (USP); Bupivacaine hydrochl
Biznes i obshtshestvo : Sillamäe võhodit iz desjatiletnei spjatshki / Artur Tooman
Tooman, Artur, 1971-
2006-01-01
Sillamäe linna eluolu, sadama mõju linna arengule. Arvamust avaldavad linnavolikogu liige Sergei Rjabkov, linnapea Ain Kiviorg ja kohalikud ettevõtjad. Lisa: diagrammid linna eelarve ja ettevõtluse kasvu kohta
Luuk, Erkki, 1971-
2004-01-01
Heliplaatidest: Current 909 "The price for existence is eternal warfare", Aapo Ilves "Pilpaküla kontsert", Yello "The Eye", Maian Kärmas, Ain Agan, Riho Sibul, Arvo Haasma "Tuigutuled", Manatark "Chaos Engine"
Üliohtliku laadungiga rongid plaanitakse Tallinnast välja saata / Signe Kalberg
Kalberg, Signe, 1959-
2006-01-01
Valitsusele esitatakse kolm Tallinna raudteeümbersõidu varianti, analüüsi koostamisse kaasati AS Deloitte&Touche Eesti. Kaart: Tallinna raudteeümbersõit. Kommenteerivad: Raivo Uukkivi, Ain Kaljurand, Toomas Vitsut
Лившиц, Лев, 1924-2013
2006-01-01
Ain Järvega Kadrioru pargist. Kadrioru Lastepargi tekkimise ajaloost ja uue Lastepargi rajamisest. Ehitatakse uus Lastemuuseumi hoone kuhu kolib Kotzebue tänavalt Tallinna Nukumuuseum. Nukumuuseumist ja muuseumidest Kadriorus, ka KUMU hoonest
Toodangu maht sõltub impordist / Ain Alvela
Alvela, Ain, 1967-
2002-01-01
Saematerjali tootjate TOP 30. Käibe TOP 10. Käibe kasvu TOP 10. Kasumi TOP 10. Kasumi kasvu TOP 10. Rentaabluse TOP 10. Varade tootlikkuse TOP 10. Kahjumi TOP 5. Saematerjali tootjate finantsnäitajad. Saematerjali tootjate üldandmed. Tabelid
Terve mõistusega ahnuse vastu / Ain Aaviksoo
Aaviksoo, Ain, 1974-
2005-01-01
Dokumentaalfilm "Ülisuur mina" ("Super Size Me") : režissöör Morgan Spurlock : Ameerika Ühendriigid 2004. Turumajandusest, dieedist ja toitumisest, filmi hoiatavast osast eelkõige teistmelistele ja nende kasvatajatele
Rumsfeldi ei ole kunagi unustatud / Ain Lember
Lember, Ain
2004-01-01
Väljaandes Teheran Times ilmunud Kian Mokhtari artiklist, milles käsitletakse USA kaitseministri Donald Rumsfeldi poliitikukarjääri, tema süüdistamist Iraagile massihävitusrelvade ja nendega seotud tehnoloogia müümise soodustamises 1980-ndatel aastatel, Iraagi-poolset keemiarelva kasutamist Iraani vastu
Puti povõshenija effektivnosti proizvodstva / Ain Alvela
Alvela, Ain, 1967-
2008-01-01
Kulude kokkuhoid aitab saavutada kõrgemat tootlikkust. Vt. samas: Indeks rosta proizvoditelnosti za period 2000-2007gg., %. Kommenteerivad: Aleksandr Miina, Ants Pak, Kaul Aulasmägi, Veljo Haube ja Kuido Kuntro
Norma Maja astub kindlalt tulevikku / Ain Alvela
Alvela, Ain, 1967-
2000-01-01
AS Norma Maja saavutas kõrged kasumi ja kasumi kasvu näitajad töötajate koondamisega. Tabel: Norma Maja valdused, AS Norma Maja areng, AS ETK Majad areng. Arvamused: Ero Toom, Ivar Lahi ja Rein Loo
Extensive Degradation and Low Bioavailability of Orally Consumed Corn miRNAs in Mice
Directory of Open Access Journals (Sweden)
Haiqiu Huang
2018-02-01
Full Text Available The current study seeks to resolve the discrepancy in the literature regarding the cross-kingdom transfer of plant microRNAs (miRNAs into mammals using an improved miRNA processing and detection method. Two studies utilizing C57BL/6 mice were performed. In the first study, mice were fed an AIN-93M diet and gavaged with water, random deoxynucleotide triphosphates (dNTP or isolated corn miRNAs for two weeks (n = 10 per group. In the second study, mice were fed an AIN-93M diet, or the diet supplemented with 3% fresh or autoclaved corn powder for two weeks (n = 10 per group. Corn miRNA levels were analyzed in blood and tissue samples by real-time PCR (RT-PCR following periodate oxidation and β elimination treatments to eliminate artifacts. After removing false positive detections, there were no differences in corn miRNA levels between control and treated groups in cecal, fecal, liver and blood samples. Using an in vitro digestion system, corn miRNAs in AIN-93M diet or in the extracts were found to be extensively degraded. Less than 1% was recovered in the gastrointestinal tract after oral and gastric phases. In conclusion, no evidence of increased levels of corn miRNAs in whole blood or tissues after supplementation of corn miRNAs in the diet was observed in a mouse model.
Interpersonal violence in the United Arab Emirates.
Osman, Ossama T; Abbas, Alaa K; Eid, Hani O; Salem, Mohamed O; Abu-Zidan, Fikri M
2014-01-01
We aimed to study the anatomical distribution, severity and outcome of hospitalised interpersonal violence-related injured patients in Al-Ain, United Arab Emirates so as to give recommendations regarding the magnitude of this problem, its causes and priorities of prevention. Data were retrieved from Al-Ain Hospital Trauma Registry, which was prospectively collected over three years. There were 75 patients (males = 85.3%) having a mean age of 30 years. Eighty-one percent had blunt trauma. The estimated annual injury hospitalisation of interpersonal violence in Al-Ain city was 6.7 per 100,000 population. Females were significantly more injured by a family member (p = 0.02), at home (p = 0.005), and had more severe injuries (p = 0.003). There was a trend for children less than 18 years old to have more penetrating trauma (p = 0.06) and to be injured by a family member (p = 0.09). There was only one case of woman sexual assault and two cases of child abuse. The mean (SD) hospital stay was 7.87 (14.1) days. Less than 3% (n = 2) were admitted to the intensive care unit with no deaths. In conclusion, the majority of patients in our study had minor injuries. Nevertheless, the psychological impact may be major. This highlights the need to develop suitable mental health services in support of victims of interpersonal violence.
1993-07-01
dimensions topics such as timing (e.g., Gibbon & Allan, from interresponse-time duration (e.g.. Alle- 1984), numerositv (e.g., Gallistel , 1989), and...Behavior, 51, 145-162. Snapper, A. G., & Inglis, G. B. (1985). SKED-li soft- Gallistel , C. R. (1989). Animal cognition: The repre- ware system. Kalamazoo
Celebrity Authorship and Afterlives in English and American Literature
Franssen, G.; Honings, R.
2016-01-01
This book maps the history of literary celebrity from the early nineteenth century to the present, paying special attention to the authors’ crafting of their writerly self as well as the afterlife of their public image. Case studies are John Keats, Edgar Allan Poe, Eliza Cook, Herman Melville, Oscar
Fire for Effect: Calling for a More Potent Energy System
2008-05-22
20080415Stratfor_Daily_Podcast-EDITED.mp3; Internet; Accessed 30 April 2008) quoted UN Special Rapporteur for the Right to Food Jean Ziegler’s comment on...Murray, Williamson and Allan R. Millet ed. Military Innovations in the Interwar Period. New York, NY: Cambridge University Press 1996 Naveh, Shimon, In
The Power and Pitfalls of Education Incentives. Discussion Paper 2011-07
Allan, Bradley M.; Fryer, Roland G., Jr.
2011-01-01
There is widespread agreement that America's school system is in desperate need of reform, but many educational interventions are ineffective, expensive, or difficult to implement. Recent incentive programs, however, demonstrate that well-designed rewards to students can improve achievement at relatively low costs. Fryer and Allan draw on…
Inkanyiso: Journal of Humanities and Social Sciences - Vol 7, No 1 ...
African Journals Online (AJOL)
Bipolar disorder, childhood bereavement, and the return of the dead in Edgar Allan Poe's Works · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT ... Applying Social Capital Theory and the Technology Acceptance Model in information and knowledge sharing research · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT
2013-07-26
.... Air Force, and other military organizations. Purpose of the Regulatory Action. Under the Endangered... change was supported by morphological and molecular data (Allan and Porter 2000, p. 1876; Sokoloff 2000.... Further details of this study are discussed below in the Five-Factor Analysis for A. d. var. traskiae...
2013-12-01
University) "Effectors of the DNA damage and radiotherapy response in cancer" 9:20 pm - 9:30 pm Discussion TUESDAY 7:30 am - 8:30 am Breakfast 9:00...M. Morris , Hideki Onagi, Timothy M. Altamore, Allan B. Gamble, Christopher J. Easton Prohormone-substrate peptide sequence recognition by
Modes of Learning: Whitehead's Metaphysics and the Stages of Education
Allan, George
2012-01-01
Educators are familiar with Alfred North Whitehead's three stages of education: romance, precision, and generalization. Philosophers are familiar with his metaphysical theories about the primacy of temporal processes. In "Modes of Learning," George Allan brings these two sides of Whitehead's thought together for the first time in a book…
2012-09-11
...: Allan Strand, Field Supervisor, U.S. Fish and Wildlife Service, Corpus Christi Ecological Services Field... angular teeth. Flowers are bright yellow and borne on scapes (leafless flowering stems or stalks arising..., the flowers occur on unbranched flower clusters that come off a single central stem from which the...
Administraatori lubatähega parteris / Mihkel Mutt
Mutt, Mihkel, 1953-
1996-01-01
Anthony Shafferi 'Mõrvar' Eesti Draamateatris (lav. Mati Unt); David Lee Coburni 'Džinnimäng' (loominguline ühendus 'Teine laine', lav. Allan Kress); Anton Tšehhovi 'Kajakas' (lavakunstikooli 17. lennu diplomilavastus, lav. Kalju Komissarov); Oskar Lutsu - Toomas Kalli 'Tagahoovis' (Eesti Draamateatri ja Vanalinnastuudio ühislavastus, lav. Eino Baskin)
Teaching Values: Thoughts on Hirsch, Bloom, and the Materials of the Classroom.
Eyler, Audrey S.
1989-01-01
Responds to E. D. Hirsch's "Cultural Literacy" and Allan Bloom's "The Closing of the American Mind," confronting questions of teaching values through literature. Argues that while teachers should deplore societal tyrannies, they can endorse the list proposed by Hirsch and allow students to develop their own responses to items…
Rael Artel Gallery Tartus ja Varssavis
2006-01-01
Rael Artel Gallery : Non-Profit Project Space'i tegevusest Tartus. 27.04-27.05. 2006 Varssavis Warszawski Aktyw Artystov'i ruumides näitus "Estonian Video Art. The blood project", osalesid Flo Kasearu, Gert Hatsukov, Külli K. Kaats, Allan Tõnissoo, Marko Nautras, Tanja Muravskaja ja Airi Triisberg
Greta Kaits 9. apr. 1928 - 29. aug. 1946 : [luuletused] / Mats Traat
Traat, Mats, 1936-
2008-01-01
Sisu : Greta Kaits 9. apr. 1928 - 29. aug. 1946 ; Villem Hänilane 1898 - 1952 ; Peeter Pedak 1897 - 1953 ; Max Äidse 1903 - 1959 ; Lavinia Laidam ; Buchard Pruus ; Sergei Krivokopõtov ; Allan Luht 5. VII 1962 - 17. V 2007 ; Karl Saarmets 9. III 1924 - 14. IX 1981 ; Raimo Ritsik
77 FR 59454 - Proposed Collection; Comment Request for Notice 2009-26
2012-09-27
... the new tax incentives for Build America Bonds under Sec. 54AA of the Internal Revenue Code (``Code... material in the administration of any internal revenue law. Generally, tax returns and tax return... provide information. Approved: September 21, 2012. Allan Hopkins, Tax Analyst. [FR Doc. 2012-23727 Filed 9...
2012-07-16
... time. The ROD grants only conditional ALP approval of the Long-Term AIP. This conditional ALP approval... Long-Term AIP at this time. FOR FURTHER INFORMATION CONTACT: Mr. Allan Nagy, Environmental Program... Preservation Officer (SHPO)) and the Keeper of the National Register of Historic Places (NRHP). The FAA also...
75 FR 76521 - Proposed Collection; Comment Request for Form 5884-B
2010-12-08
... a means for employers to calculate and claim the credit. This credit is a new non-Code general...: 1,125,000. Estimated Time Per Respondent: 12 hours 17 minutes. Estimated Total Annual Burden Hours... information. Approved: December 1, 2010. Allan Hopkins, IRS Reports Clearance Officer. [FR Doc. 2010-30733...
Structural and frequency dependencies of a.c. and dielectric ...
Indian Academy of Sciences (India)
6Thin Film Laboratory, Department of Physics, Faculty of Education, Ain Shams ... conductivity and its frequency exponents were interpreted in terms of correlated barrier hopping ... cations in high-electron-mobility and heterostructure bipolar.
African Journals Online (AJOL)
EL-HAKIM
Immunology Unit, Department of Pediatrics, Ain Shams University, Cairo ... the case with food allergies).7,8 The parentral route ..... molecular-weight agents. ... and lack positive controls. ..... Immunology; Joint Council of Allergy, Asthma and.
Ainevaldkond "Kehakultuur" / Leila Oja
Oja, Leila, 1966-
2006-01-01
Ainevaldkonnast "Kehakultuur" Tartu Ülikooli õppekava arenduskeskuses väljatöötatud põhikooli ja gümnaasiumi riiklikus õppekavas - ainevaldkonna kirjeldus, läbivad teemad, aineõpetuse struktuur ning vajalikud ressursid
R102G polymorphism of the complement component 3 gene in ...
African Journals Online (AJOL)
Nur Afiqah Mohamad
a Malaysian Research Institute on Ageing, Universiti Putra Malaysia, Serdang 43400, Selangor ... Peer review under responsibility of Ain Shams University. ..... b Student t-test, P < 0.01. ... The International ARM Epidemiological Study Group.
Analytical solutions for one-dimensional advection– dispersion ...
Indian Academy of Sciences (India)
Department of Mathematics, AinShams University, Cairo 0020, Egypt. ∗. Corresponding author. .... Applying Laplace transformation to equations (1 and 2) gives: D d2. ∼ ...... Land, Water & Environmental Management: Integrated. Systems for ...
ETV uus seriaal "Vistrik" kavatseb nime muuta / Anne Vetik
Vetik, Anne
2006-01-01
Toimuvad ETV uue krimisarja "Vistrik" võtted, stsenarist Mihkel Ulman, režissöör Ain Prosa, produtsent Raivo Suviste, kesksetes rollides Marko Matvere, Jaan Rekkor, Elisabet Tamm, tootjaks OÜ Balti Video
[Kirjandusetendusest "Meri kümnele häälele"] / Kätlin Kaldmaa ; küsinud D. K. [Doris Kareva
Kaldmaa, Kätlin, 1970-
2011-01-01
Luulelavastus sisaldab Álvaro de Campose (Fernando Pessoa) "Mereoodi" ning Ain Kaalepi, Kalju Kruusa, fs-i jt. eesti luuletajate tekste. Lavastaja Anne Türnpu, etendused toimuvad kinos Sõprus. Vt. ka kuulutust lk. 30
Ohtlikud lennud / Simo Meinert
Meinert, Simo
2006-01-01
ETV uus algupärane krimisari "Ohtlik lend" : stsenarist Mihkel Ulman : lavastaja Ain Prosa : produtsent Raivo Suviste : peaosades Elisabet Tamm, Marko Matvere : Balti Video. Sama ka : Teleleht nr. 38, lk. 6-7 : ill
Time to Revisit the Heterogeneous Telescope Network
Hessman, F. V.
The "Heterogeneous Telescope Network" (HTN) was founded in 2005 as a loose collaboration of people somehow associated with robotic telescopes and/or projects interested in the transient universe. Other than being a very interesting forum for the exchange of ideas, the only lasting contribution of the HTN was a proposed protocol for the operation of a loose e-market for the exchange of telescope time (Allan et al. 2006; White & Allan 2007). Since the last formal meeting in 2007, the HTN has gone into a "Dornröschenschlaf" (a better word than "hibernation") : the players and interest are there, but the public visibility and activity is not. Although the participants knew and know that global networking is the way of the future for many types of science, various things have kept the HTN from taking the idea and actually implementing it: work on simply getting one's own system to work (e.g. myself), career paths of major players (e.g. Allan), dealing with the complexity of ones' own network (TALONS, RoboNet, LCO), and - most importantly - no common science driver big enough to push the participants to try it in earnest. Things have changed, however: robotic telescopes have become easier to create and operate, private networks have matured, large-scale consortia have become more common, event reporting using VOEvent has become the global standard and has a well-defined infrastructure, and large-scale sources of new objects and events are operating or will soon be operating (OGLE, CSS, Pan-STARRs, GAIA). I will review the scientific and sociological prospects for re-invigorating the HTN idea and invite discussion.
Directory of Open Access Journals (Sweden)
Gandra S
2015-01-01
Full Text Available Sumanth Gandra, Aline Azar, Mireya WessolosskyDivision of Infectious Disease and Immunology, University of Massachusetts Medical School, Worcester, MA, USABackground: Although anal high-risk human papillomavirus (HR-HPV infection and anal cytological abnormalities are highly prevalent among human immunodeficiency virus (HIV-infected men who have sex with men (MSM, there are insufficient data on these abnormalities among HIV-infected heterosexual men (HSM and women. In this study, we evaluated the prevalence of anal HR-HPV, cytological abnormalities, and performance of these screening tests in detecting high-grade anal intraepithelial neoplasia (AIN2+ among our cohort of HIV-infected MSM and non-MSM (HSM and women.Methods: A single-center, retrospective cohort study was conducted with HIV-infected individuals who underwent anal cancer screening with anal cytology and HR-HPV testing from January 2011 to January 31, 2013.Results: Screening of 221 HIV-infected individuals for both HR-HPV and anal cytology showed the presence of HR-HPV in 54% (abnormal anal cytology 48% of MSM, 28% (abnormal anal cytology 28% of HSM, and 27% (abnormal anal cytology 34% of women. Among 117 (53% individuals with abnormal results (HR-HPV-positive and/or cytology was atypical squamous cells of undetermined significance or above, 67 underwent high resolution anoscopy. Of these 67 individuals, 22 individuals had AIN2+ (17 MSM, four women, and one HSM. HR-HPV correlated better with AIN2+ than with anal cytology on biopsy in both MSM (r=0.29 versus r=0.10; P=0.05 versus P=0.49 and non-MSM (r=0.36 versus r=-0.34; P=0.08 versus P=0.09.Conclusion: Given the presence of AIN2+ in screened HIV-infected HSM and women, routine anal cancer screening in all HIV-infected individuals should be considered. HR-HPV merits further evaluation for anal cancer screening among non-MSM.Keywords: human immunodeficiency virus, anal human papillomavirus, heterosexual men, women, anal cancer
Evaluación in vitro de tabletas orales de complejos de cobre con antiinflamatorios no esteroideos
Directory of Open Access Journals (Sweden)
Julie Fernanda Benavides Arévalo
Full Text Available Introducción: los antiinflamatorios no esteroideos (AINES, son un grupo diverso y químicamente heterogéneo de fármacos analgésicos, antipiréticos y antiinflamatorios; sin embargo, su funcionamiento se ve afectado por su baja solubilidad acuosa y por la incidencia de efectos secundarios gastrointestinales. Como una alternativa a este problema, la formulación de tabletas orales con complejos de cobre con AINES muestra un adecuado comportamiento in vitro y podría tener efectos secundarios reducidos comparados con el fármaco antiinflamatorio no complejado. Objetivo: evaluar los procesos de desintegración y de disolución de tabletas orales de complejos de cobre con AINES. Métodos: luego de la síntesis y la caracterización instrumental de los complejos, se evaluó por microscopia óptica el efecto de la morfología, el tamaño de partícula y las características superficiales en el proceso de disolución; estos resultados fueron considerados para la formulación de los complejos y permitieron junto con la adecuada elección de un desintegrarte, un modificador de flujo, un lubricante y un aglutinante, la obtención de tabletas por compresión directa. Finalmente, en los comprimidos se evaluaron propiedades fisicomecánicas y los procesos de desintegración y disolución. Resultados: las tabletas de los complejos mostraron tiempos de desintegración entre 5 y 15 min y una liberación in vitro del 75 al 93 %. Conclusiones: la disolución de los AINES se vio favorecida por la formación de complejos, el menor tamaño de partícula, la presencia de poros y grietas en la superficie de las partículas y la inclusión de excipientes para la formulación de tabletas orales.
Jänes, Liina, 1977-
2000-01-01
Eesti kolhoosikeskuste arhitektuurist. Vaadeldakse aastail 1957-1990 ehitatud 24 keskusehoonet. Arhitektid Nikolai Kusmin, Harri Kingo, Toomas Rein, Vilen Künnapu, Ain Padrik, Maara Metsal, Meeli Truu jt. 17 välisvaadet, 3 joon., kaart
Mis saab maaärist? / Ester Šank
Šank, Ester, 1956-
2000-01-01
Maaostu piirava seaduseelnõu Riigikogu menetlusest välja arvamist kommenteerib Vootele Hansen. Lisatud ka eelnõu autorite Jaanus Marrandi, Harri Õunapuu ja töörühma liikme Ain Kendra seisukohad
Intel Corporation osaleb Eesti koolitusprogrammis / Raivo Juurak
Juurak, Raivo, 1949-
2001-01-01
Haridusministeeriumis tutvustati infotehnoloogiaalast koolitusprogrammi, milles osaleb maailma suuremaid arvutifirmasid Intel Corporation. Koolituskursuse käigus õpetatakse aineõpetajaid oma ainetundides interneti võimalusi kasutama. 50-tunnised kursused viiakse läbi kõigis maakondades
2008-01-01
Laseringi kauplustes müügilolevatest heliplaatidest: Compromise Blue "Loomad on lahti", Mari Boine "Remixed vol. 2 - It Ain't Necessarily Evil", Me, Myself and I "Aastaajad", Whitesnake "Good To Be Bad", Estelle "Shine"
African Journals Online (AJOL)
Pediatrics Department, Faculty of Medicine, Ain Shams University corresponding author: ..... imaging studies: The diagnosis of CMV pneumonia can be suggested by chest radiograph find- ... dictive value and can aid in identifying children who ...
Lugedes Pilve ja Pazi / Mathura
Mathura, pseud., 1973-
2007-01-01
Võrdlevalt Aare Pilve luulekogust "Näoline" (kirj. Tuum, 2007) ja Octavio Pazi luulekogust "Alati on olevik" (hispaania k. tlk. Ain Kaalep, Jaan Kaplinski, Asta Põldmäe ja Jüri Talvet, kirj. Perioodika, 1984)
The effects of composition and firing cycle on sintering of aluminium nitride
International Nuclear Information System (INIS)
Hewett, C.; Trigg, M.B.
1992-01-01
A central composite design was used to evaluate the relative effects of temperature, time and Y 2 O 3 content on the densification behaviour of a commercial aluminium nitride (AIN). Over the range of the independent variables studied, temperature was found to exert the dominate influence. Low levels of Y 2 O 3 were found to be effective for the densification of AIN. After firing, cubic 3Y 2 O 3.5 Al 2O3 (YAG) was detected for the lower levels of Y 2 O 3 addition. At the higher levels both YAG and 2Y 2 O 3 .Al 2 O 3 were detected. For a dense sample the values obtained for hardness and fracture toughness were comparable to those reported in the literature. 11 refs., 1 tab
Emanuelsson, B. D.; Baisden, W. T.; Bertler, N. A. N.; Keller, E. D.; Gkinis, V.
2014-12-01
Here we present an experimental setup for water stable isotopes (δ18O and δD) continuous flow measurements. It is the first continuous flow laser spectroscopy system that is using Off-Axis Integrated Cavity Output Spectroscopy (OA-ICOS; analyzer manufactured by Los Gatos Research - LGR) in combination with an evaporation unit to continuously analyze sample from an ice core. A Water Vapor Isotopic Standard Source (WVISS) calibration unit, manufactured by LGR, was modified to: (1) increase the temporal resolution by reducing the response time (2) enable measurements on several water standards, and (3) to reduce the influence from memory effects. While this setup was designed for the Continuous Flow Analysis (CFA) of ice cores, it can also continuously analyze other liquid or vapor sources. The modified setup provides a shorter response time (~54 and 18 s for 2013 and 2014 setup, respectively) compared to the original WVISS unit (~62 s), which is an improvement in measurement resolution. Another improvement compared to the original WVISS is that the modified setup has a reduced memory effect. Stability tests comparing the modified WVISS and WVISS setups were performed and Allan deviations (σAllan) were calculated to determine precision at different averaging times. For the 2013 modified setup the precision after integration times of 103 s are 0.060 and 0.070‰ for δ18O and δD, respectively. For the WVISS setup the corresponding σAllan values are 0.030, 0.060 and 0.043‰ for δ18O, δD and δ17O, respectively. For the WVISS setup the precision is 0.035, 0.070 and 0.042‰ after 103 s for δ18O, δD and δ17O, respectively. Both the modified setups and WVISS setup are influenced by instrumental drift with δ18O being more drift sensitive than δD. The σAllan values for δ18O of 0.30 and 0.18‰ for the modified (2013) and WVISS setup, respectively after averaging times of 104 s (2.78 h). The Isotopic Water Analyzer (IWA)-modified WVISS setup used during the
27. V kell 16 avatakse Niguliste kirikus...
2002-01-01
EKA interdistsiplinaarsete kunstide eriala magistritööde näitus "Nagu aamen kirikus". Eksponeeritud Kristin Kalamehe lühimängufilm "Igavene tuli", Mirja-Mari Smidti video ja maaliseeria "Kaaluta olek", Allan Tõnissoo videoskulptuur "Kristus", Avangardi (Sandra Jõgeva, Margus Tamm) fotoseeria ja video "Sõda ja rahu". Avamisel Avangardi performance
2012-05-16
... with hairs (Munz and Johnston 1924, p. 296). Flowers are clustered in the uppermost leaf axils, forming... bushy habit and elongated fruits (Allan 1999, p. 88). Acmispon dendroideus var. traskiae is typically... and are a recurrent source of wildfires. Fuel breaks are applied each year prior to fire season to...
Goicoechea, David L.
1991-01-01
According to author Allan Bloom, problems in today's university stem from lack of belief in the university's vocation. The paper evaluates his Socratic solution which states the country must recover a belief in and response to the university's primary calling (the promotion of discussion and speculation in a Socratic manner). (SM)
America's Opinion Leader Historians on Behalf of Success.
Carpenter, Ronald H.
1983-01-01
Examines the rhetorical role of several twentieth century historians who were opinion leaders on behalf of the American way of achieving success: by emulating the earlier qualities of our frontier and founding fathers. Discusses the role of Frederick Turner Jackson, Charles A. Beard, Carl Becker, Allan Nevins, and others. (PD)
Clarke, Kendall; Denton, Marijke
2013-01-01
Supporting children in their early development and learning has long-term benefits for both them and the broader community. Yet in Australia we still have significant examples of inequality of opportunity (Allan, 2010) and other structural barriers to family wellbeing, particularly in Indigenous and rural and remote communities (Bourke, Humphreys,…
1992-09-01
Deex Zero Corp. August 3 Frank Allan EM Industries, Hawthorne, NY August 17 Dr. Kazutami Sakamoto Ajinomoto Co., Teaneck, NJ August 25 Dr. David Casasent...Sakamoto Ajinomoto , Teaneck, NJ Dr. K. Yamada Dr. T. Takahashi June 14 Dr. Hundi P. Kamath Raychem Corp., Menlo Park, CA Dr. Stephen Moore Dr. Phil
Erootikaga tembitud / Aita Kivi
Kivi, Aita, 1954-
2001-01-01
Sisu : Ian McEwan. Tsementaed; Enn Vetemaa. Neitsist sündinud; Kerttu Rakke. Seitse päeva; Edward Rutherfurd. London; David Guterson. Lumi langeb seedritele; Allan ja Barbara Pease. Miks mehed ei kuula ja naised ei suuda kaarti lugeda; Barbara Erskine. Kesköö - üksildane paik; Poul Anderson. Kõrge ristiretk
Directory of Open Access Journals (Sweden)
A. Moreno
2003-02-01
Full Text Available Antecedentes: Los antiinflamatorios no esteroideos (AINE, utilizados en el tratamiento de la artrosis, pueden producir reacciones adversas gastrointestinales (GI graves. Celecoxib, un inhibidor específico de la ciclooxigenasa 2 (COX-2, ha demostrado una eficacia equivalente a los AINE convencionales con un mejor perfil de tolerabilidad y seguridad. Objetivo: La finalidad de este estudio ha sido realizar un análisis coste-efectividad sobre el uso de celecoxib frente a los AINE clásicos en el tratamiento de la artrosis. Material y métodos: El análisis coste-efectividad se ha diseñado mediante un modelo farmacoeconómico, definiéndose como unidad de efectividad a cada año de vida ganado tras la toma de celecoxib o AINE. La probabilidad de que aparezcan los diferentes resultados clínicos se ha obtenido de artículos publicados y de asunciones incorporadas. Sólo se han valorado los costes directos médicos (medicación, hospitalización, pruebas complementarias, analíticas, visitas extras, etc., sin haberse incluido otros costes. La perspectiva del estudio ha sido la del Sistema Nacional de Salud y el horizonte temporal elegido ha sido de 6 meses. Resultados: El coste adicional por cada año de vida ganado secundario al uso de celecoxib frente a los AINE clásicos asciende a 8.017 € (1.333.834 ptas.. El análisis de sensibilidad muestra cómo estos valores son sensibles a la modificación del coste de AINE y gastroprotector, así como a la inclusión de grupos poblacionales con edades más bajas. Conclusiones: Celecoxib puede ser considerado como una opción coste-efectiva en el tratamiento de la artrosis, ya que va a evitar muertes y a ganar años de vida para los pacientes con un coste adicional razonable y moderado, cuando se compara con los AINE. Su eficiencia aumenta a medida que se utiliza en poblaciones con menor edad media y, probablemente, en aquellas con mayor riesgo de desarrollar complicaciones GI.Background: Non
Energy Technology Data Exchange (ETDEWEB)
Jiang, Hongxing
2008-10-31
Investigations have been conducted focused on the fundamental material properties of AIN and high AI-content AIGaN alloys and further developed MOCVD growth technologies for obtaining these materials with improved crystalline quality and conductivities.
Sekulariseeruv sakraalarhitektuur / Piret Lindpere
Lindpere, Piret, 1963-
2002-01-01
Moodsatest kirikutest, sajandilõpu eesti sakraalarhitektuurist. Pikemalt Tallinna metodisti kirikust (Vilen Künnapu, Ain Padrik), Püha Brigitta keskusest (projekteerimist juhtis Ra Luhse) ja ehitama hakatavast Viimsi Püha Jaakobi kirikust (Erkki Ristoja, Martin Aunin)
Valme, Valner, 1970-
2006-01-01
Uutest heliplaatidest Graham Coxon "Love Travels At Illegal Speeds", Gabriel Rios "Ghostboy", "Sounds Of India", John Hughes "Wild Ocean", Ain Agan & Tallinn Chamber Orchestra/Toomas Vavilov, Ashanti "Collectables By Ashanti", Liv Kristine "Enter My Religion"
Itaalia seadustab ainuõige pitsa / Kaivo Kopli
Kopli, Kaivo
2004-01-01
Pizza Napolitana ained, valmistusviis ja tulemus peavad vastama nõuetele. Itaalia põllumajandusministeeriumis välja töötatud pitsareeglid on osa Itaalia pingutustest kaitsta oma kuulsat kööki. Lisaks: Pitsavalmistamise reeglid
Sumerki klassitsizma / Iosef Kats
Kats, Iosef
2004-01-01
Tallinna Viru Keskuse juurde püstitatud Mare Mikofi kavandatud hiigelskulptuurist. Kuju on Mikofi versioon Weizenbergi "Hämarikust". Viru Keskuse arhitektide Vilen Künnapu ja Ain Padriku arvates peaks naiseskulptuur mahendama kaubakeskuse kubistlikku ja maskuliinset arhitektuuri
Vahemets, Aivo
2005-01-01
Uutest heliplaatidest The All-American Rejects "Move Along", Devendra Banhart "Criple Crow", Rod Stewart "Thank For The Memory", Him "Dark Light", Status Quo "the Party Ain't Over Yet", Ricky Martin "Life", Barbara Streisand "Guilty Pleasures"
Emajõe äärde kerkib Tartu tulevane sümbol : Kroodo-Tower / Nils Niitra
Niitra, Nils, 1975-
2005-01-01
ASi Linnaehitus nõukogu liige Alar Kroodo plaanib Emajõe äärde 23-korruselise kõrghoone ehitamist, mille ehitusmaksumuseks kujuneb 100 kuni 200 miljonit krooni. Kõrghoone on projekteerinud arhitektid Ain Padrik ja Vilen Künnapu
"Arvuti koolis" ja arvutiõpetus õppekavas / Helen Vanganen, Jevgeni Košelev
Vanganen, Helen
2002-01-01
Ligi 1500 aineõpetajat osales 2001/2002 õppeaastal kursusel "Arvuti koolis". Õpetajad tutvusid Oxfordi Ülikooli jätkukursusega - originaalprogramm kannab nime "Intelʼ Teach to the Future", mis on otseselt seotud infotehnoloogia rakendamisega õppekavas
Kes kaitseks Eesti ohvitsere NKVD-KGB laimu eest? / Peep Varju
Varju, Peep
2008-01-01
Autor polemiseerib Eesti Ekspressis ilmunud artiklitega Eesti endiste ohvitseride kohta, kus käsitletakse nende väidetavat koostööd KGBga. Vaatluse all on ohvitserid Ain Mere, Harald Nugiseks, Alfons Rebane ja Harald Riipalu
Nigel saak ähvardab kalureid pankrotiga / Jüri E Kukk
Kukk, Jüri E., 1961-
2004-01-01
Tänavune kalasaak Võrtsjärvest on jäänud väga kesiseks. Võrtsjärve Limnologiajaama juhataja Ain Järvalt peab kalade vähesuse põhjuseks heitlikke ilmastikuolusid. Lisa: Kalasaagid [1999-2003
The transformations of disease in expert and lay medical cultures
Directory of Open Access Journals (Sweden)
Maarten Bode
2011-01-01
Full Text Available Every culture has rules for translating signs into symptoms, for linking symptomatologies to etiologies and interventions, and for using the evidence provided by interventions to confirm translations and legitimize outcomes. The path a person follows from translation to socially significant outcome constitutes his sickness (Allan Young 1982. p. 270.
1990-06-01
1935. McNair, Leslie J., memorandun dated 12 July 1944, subject: "Recommendations on the Post-War National GuLard". Millet , Allan R., Semper...Moenk, Jean R., A History of Large Scale Maneuvers in the US. 1933-1964, (Ft Monroe, VA: HQ, CONARC, 1969). Moskin, J. Robert, The US Marine Corps
2012-01-01
Lühidalt heliplaatidest: Wagner, Strauss, Seeger. Eesti Rahvusmeeskoor, eesti Kaitseväe Orkester; Kalinka. Lembit Tolga; Cesena. Graindelavoix, Björn Schmelzer; Igavene suvi. Allan Vainola & Unenäopüüdjad; Odysseia. European Jazz Motion. Meie aeg on käes. August Hunt; Maksmata võlad. legshaker; Magnificat. Kammerkoor Studio Vocale
Stevenson, Rosnisha D.; Kritsonis, William Allan
2009-01-01
This article will seek to utilize Dr. William Allan Kritsonis' book "Ways of Knowing Through the Realms of Meaning" (2007) as a framework to improve a campus's standardized test scores, more specifically, their TAKS (Texas Assessment of Knowledge and Skills) scores. Many campuses have an improvement plan, also known as a Campus…
CERN - better than science fiction!
2007-01-01
From left to right: Allan Cameron (Production Designer), Sam Breckham (Location Manager), James Gillies (Head of Communication at CERN), Jacques Fichet (from the CERN audiovisual service), Rolf Landua (former spokesman of the ATHENA antihydrogen experiment at CERN and Head of CERN's Education Group), Ron Howard, and Renilde Vanden Broeck (CERN press officer).
Book Review: Non-racialism in South Africa | Smith | New Agenda ...
African Journals Online (AJOL)
Non-racialism in South Africa. The Life and Times of Neville Alexander. Allan Zinn (ed.) SUN MeDIA: Stellenbosch, 2016. 163 pp + dvd. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians ...
Ojari, Triin, 1974-
2005-01-01
Kahekorruselise lehisega vooderdatud raamatukoguhoone üks külg on klaasist. Projekteerija: Arhitektid Muru & Pere. Autorid: Urmas Muru, Peeter Pere. Konstruktor Ago-Allan Kuddu. Sisekujundus: Katrin Kaevats, Urmas Muru, Peeter Pere. Projekt: 2002-2003, valmis: 2005. Ill.:4 värv. välis ja 2 sisevaadet, I ja II korruse plaan
Non vi sed arte / Karin Paulus
Paulus, Karin, 1975-
2007-01-01
Eesti Betooniühing valis 2006. aasta parimaks betoonehitiseks Tallinnas Tartu maantee ääres asuva Luku-Experdi büroohoone (arhitekt Hindrek Kesler, konstruktor Ago-Allan Kuddu, ehitaja Ahti Väin Konsult OÜ, betooni autor AS E-Betoonelement). Ehitaja eriauhinna pälvis "Eesti Ehitus" Muuga viadukti eest. Kommenteerib Aadu Kana
Reexamining the Structure of Hemingway's "The Doctor and the Doctor's Wife."
Mulvey, James
2003-01-01
Considers how Hemingway's "The Doctor and the Doctor's Wife" is a model of Edgar Allan Poe's aesthetic of the short story. Examines this work on many levels. Concludes that great writers, such as Ernest Hemingway, challenge readers to find the clues, to connect the dots, to pay attention to the "little details." (SG)
Spordipreemiad leidsid omaniku / Anne Põder
Põder, Anne, 1973-
2007-01-01
Järvamaa omavalitsuste liit ja spordiliit tunnustasid maakonna parimaid sportlasi, kelleks osutusid Ain-Alar Juhanson, Mikko Vanaisak, Viktoria Leks ja Grit Shadeiko. Spordiedendaja preemia sai Tiit Kavak, spordi elutöö preemia pälvis Enn Sõmeri
Teatrid murravad päid ja piike / Dea Martinjonis
Martinjonis, Dea
2000-01-01
Eesti Televisiooni ekraanile jõuab teatriteemaline teleturniir "Bläkkpoks" : stsenarist Villu Kangur : režissöör Ain Prosa : saatejuht Sepo Seeman : toimetaja Anne Tuuling : produtsent Priit Vaher. Ka : Teleleht nr. 50, lk. 36-37
African Journals Online (AJOL)
rme
1Medical Genetic Center, Faculty of Medicine, Ain Shams University,. 2Community ... indications for amniocentesis in 60.8% were history of having previous child .... best location for placing the needle ..... leukemia, 8.5% for neural tube defects.
Geochemistry of dark coastal heavy-mineral beaches sand (Annaba ...
African Journals Online (AJOL)
Acer
3 Institute of Earth and Environmental Science, University of Potsdam, ... Some beaches are characterized by a red-brownish sand colour, the Ain Achir and the ... The occurrence of clays has been determined using the methyl-blue method.
9. II avati taas von Krahli Akna galerii
2004-01-01
Näitusel "Mute - a Register of Dreams" on vaadata Aine Phillipsi (Iirimaa), Avangardi, Diane Dwyer & Tillamook Cheddari (USA), Evelin Urmi, Kiwa, Lee Adamsi (Inglismaa), Marcello Mercado (Saksamaa), Miguel Rodriguez Sepulveda (Mehhiko) ja Renato Meneghetti (Itaalia) töid
2008-01-01
Aleksius II meenutavad: Kornelius, Tallinna ja kogu Eesti metropoliit ; Karin Jaani ; Marina Kaljurand ; Dmitri Medvedev, Venemaa president ; Helene Kamzol, Aleksius II sugulane ; Ain Seppik ; Vladimir Illjashevitsh ; Edgar Savisaar ; Jevgeni Tomberg ; Ene Ergma ; Toomas Hendrik Ilves, Eesti Vabariigi president
Lifescience Database Archive (English)
Full Text Available aine hydrochloride Neuropsychiatric agent ... DG02030 ... Anesthetics ... DG01675 ... Local anesthetic ... DG01673 ... Amide type local anesthetic... ... DG01675 ... Local anesthetic ... DG01673 ... Amide type local anesthetic ATC code: N01BB07 Local anesthetic
deletion polymorphism of ACE gene and Alzheimerв€™s disease
African Journals Online (AJOL)
Omayma M. Hassanin
2014-06-27
Jun 27, 2014 ... ease, 45 males and 39 females aged 65 ± 7 years from the Geriatric Department at Ain-Shams Uni- ..... alternative therapy provided by the ACE protein. .... enzyme (ACE) gene polymorphism in relation to physical perfor-.
Egyptian Journal of Pediatric Allergy and Immunology (The): Journal ...
African Journals Online (AJOL)
Publisher. Contact: Professor Ihab Z. El-Hakim. Email ihab.elhakim@gmail.com. Phone +201111224974. Fax … +202 33045060. Children's Hospital, Ain Shams University, Ramses Street, Abbassiya, Cairo 11566, Egypt. The Egyptian Society of Pediatric Allergy and Immunology ...