WorldWideScience

Sample records for ain haas anfres

  1. Arthur E. Haas, His Life and Cosmologies

    Science.gov (United States)

    Wiescher, Michael

    2017-04-01

    This paper describes the life and scientific development of Arthur E. Haas, from his early career as young, ambitious Jewish-Austrian scientist at the University of Vienna to his later career in exile at the University of Notre Dame. Haas is known for his early contributions to quantum physics and as the author of several textbooks on topics of modern physics. During the last decade of his life, he turned his attention to cosmology. In 1935 he emigrated from Austria to the United States. There he assumed, on recommendation of Albert Einstein, a faculty position at the University of Notre Dame. He continued his work on cosmology and tried to establish relationships between the mass of the universe and the fundamental cosmological constants to develop concepts for the early universe. Together with Georges Lemaître he organized in 1938 the first international conference on cosmology, which drew more than one hundred attendants to Notre Dame. Haas died in February 1941 after suffering a stroke during a visit in Chicago.

  2. Ain Kivisaar : äärelinn pole kvaliteetne investeering / Ain Kivisaar ; interv. Enn Tosso

    Index Scriptorium Estoniae

    Kivisaar, Ain, 1978-

    2007-01-01

    Ilmunud ka: Delovõje Vedomosti : Nedvizhimost 24. okt. lk. 2-3. Küsimustele kinnisvaraturu olukorra ja investeeringute kohta vastab Metro Capital Managementi finantsjuht Ain Kivisaar. CV: Ain Kivisaar

  3. The Zygosaccharomyces bailii transcription factor Haa1 is required for acetic acid and copper stress responses suggesting subfunctionalization of the ancestral bifunctional protein Haa1/Cup2.

    Science.gov (United States)

    Palma, Margarida; Dias, Paulo Jorge; Roque, Filipa de Canaveira; Luzia, Laura; Guerreiro, Joana Fernandes; Sá-Correia, Isabel

    2017-01-13

    The food spoilage yeast species Zygosaccharomyces bailii exhibits an extraordinary capacity to tolerate weak acids, in particular acetic acid. In Saccharomyces cerevisiae, the transcription factor Haa1 (ScHaa1) is considered the main player in genomic expression reprogramming in response to acetic acid stress, but the role of its homologue in Z. bailii (ZbHaa1) is unknown. In this study it is demonstrated that ZbHaa1 is a ScHaa1 functional homologue by rescuing the acetic acid susceptibility phenotype of S. cerevisiae haa1Δ. The disruption of ZbHAA1 in Z. bailii IST302 and the expression of an extra ZbHAA1 copy confirmed ZbHAA1 as a determinant of acetic acid tolerance. ZbHaa1 was found to be required for acetic acid stress-induced transcriptional activation of Z. bailii genes homologous to ScHaa1-target genes. An evolutionary analysis of the Haa1 homologues identified in 28 Saccharomycetaceae species genome sequences, including Z bailii, was carried out using phylogenetic and gene neighbourhood approaches. Consistent with previous studies, this analysis revealed a group containing pre-whole genome duplication species Haa1/Cup2 single orthologues, including ZbHaa1, and two groups containing either Haa1 or Cup2 orthologues from post-whole genome duplication species. S. cerevisiae Cup2 (alias Ace1) is a transcription factor involved in response and tolerance to copper stress. Taken together, these observations led us to hypothesize and demonstrate that ZbHaa1 is also involved in copper-induced transcriptional regulation and copper tolerance. The transcription factor ZbHaa1 is required for adaptive response and tolerance to both acetic acid and copper stresses. The subfunctionalization of the single ancestral Haa1/Cup2 orthologue that originated Haa1 and Cup2 paralogues after whole genome duplication is proposed.

  4. Baudelaire Eestis : märkmeid. III / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    2013-01-01

    Ants Orase loodud eesti aleksandriinist. Artiklis tuuakse välja Charles Baudelaire luuletuse "Correspondances" eri tõlked (Ants Oras, Ain Kaalep) ja luuletuse "Le rêve d'un curieux" tõlked (Ilmar Laaban, Ain Kaalep)

  5. Baudelaire Eestis : märkmeid. III / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    2004-01-01

    Ants Orase loodud eesti aleksandriinist. Artiklis tuuakse välja Charles Baudelaire luuletuse "Correspondances" eri tõlked (Ants Oras, Ain Kaalep) ja luuletuse "Le rêve d'un curieux" tõlked (Ilmar Laaban, Ain Kaalep)

  6. Overexploitation and cumulative drought trend effect on Ras El Ain ...

    Indian Academy of Sciences (India)

    Boulos Abou Zakhem

    2017-10-06

    Oct 6, 2017 ... The effects of climate change and overexploitation are being strongly perceived in the studied area and the springs discharge is obviously affected. In this paper, Ras El Ain spring discharge and precipitation were analyzed by normalized methods on an yearly timescale. The deficit of Ras El Ain spring ...

  7. Magnetoresistance and Shubnikov-de Haas oscillation in YSb

    Science.gov (United States)

    Yu, Qiao-He; Wang, Yi-Yan; Lou, Rui; Guo, Peng-Jie; Xu, Sheng; Liu, Kai; Wang, Shancai; Xia, Tian-Long

    2017-07-01

    YSb crystals are grown and the transport properties under magnetic field are measured. The resistivity exhibits metallic behavior under zero magnetic field and the low-temperature resistivity shows a clear upturn once a moderate magnetic field is applied. The upturn is greatly enhanced by increasing magnetic field. At low temperature (2.5 K) and high field (14 T), the transverse magnetoresistance (MR) is quite large (3.47×10^4%) . In addition, the Shubnikov-de Haas (SdH) oscillation has also been observed in YSb. The possible trivial Berry phase extracted from the SdH oscillation, the band structure revealed by angle-resolved photoemission spectroscopy (ARPES) and first-principles calculations demonstrate that YSb is a topologically trivial material. The extremely large MR (XMR) in YSb may originate from the electron-hole compensation.

  8. Põhikooli ainesõnastikud / Heiki Jaan Kaalep, Jaan Mikk

    Index Scriptorium Estoniae

    Kaalep, Heiki-Jaan, 1962-

    2008-01-01

    Eesti vene õppekeelega koolidele keskastme ainesõnastike loomise konkursi tulemustest, kirjeldatakse koostatud sõnastike eesmärke ja kirjestruktuuri, samuti loomisprotsessi etappe. Vaadeldakse ka morfoloogiaalase tarkvara kasutamisvõimalusi sõnastiku loomisel

  9. Baudelaire Eestis : märkmeid. II / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    2013-01-01

    Ants Orasest eesti luuletõlkekultuuri arendamisel. Ka Baudelaire'i luuletuse Bénédiction ("Õnnistus") kahe esimese stroofi kolm tõlget eesti keelde: Johannes Semperi, Indrek Hirve ja Ain Kaalepi versioonid

  10. Baudelaire Eestis : märkmeid. II / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    2002-01-01

    Ants Orase aleksandriini tõlkepõhimõtetest. Ch. Baudelaire'i luuletuse Bénédiction ("Õnnistus") kahe esimese stroofi kolm tõlget eesti keelde - Johannes Semperi, Indrek Hirve ja Ain Kaalepi eestindused

  11. Dozhivjom do võborov / Ain Seppik ; interv. Tatjana Opekina

    Index Scriptorium Estoniae

    Seppik, Ain, 1952-

    2007-01-01

    Riigikogu liige vastab küsimustele, mis puudutavad Keskerakonna poliitikat, parlamendivalimisi, aprillisündmusi, korruptsiooni, riigieelarvet. Ain Seppik leiab, et Keskerakonna missiooniks on arendada riiki ja kaitsta nõrku

  12. Profilaxis de la úlcera gastrointestinal producida por AINES

    Directory of Open Access Journals (Sweden)

    Carlos Bustamante Rojas

    1998-04-01

    Full Text Available Como grupo, los AINES son los fármacos más frecuentemente  relacionados con informes acerca de Reacciones Adversas en varios países, se considera que más de 30 millones de personas en el mundo toman a diario AINES por  prescripción médica o por autoprescripción y que un alto porcentaje de dichas personas corresponden al grupo de edad mayor de 60 años. Diversos metaanálisis revelan que el riesgo de presentar eventos gastrointestinales graves en consumidores regulares de AINES puede ser de 3 a 4 veces mayor que en no usuarios al cabo de 30 dias y que dicho riesgo relativo estimado puede elevarse a 5.5 en pacientes ancianos (7 y a valores cercanos a 8.0 cuando se usan altas dosis del AINE (I, 8. También se ha relacionado el empleo crónico de AINES con un aumento en la mortalidad en ancianos.

  13. Improvement of yeast tolerance to acetic acid through Haa1 transcription factor engineering: towards the underlying mechanisms.

    Science.gov (United States)

    Swinnen, Steve; Henriques, Sílvia F; Shrestha, Ranjan; Ho, Ping-Wei; Sá-Correia, Isabel; Nevoigt, Elke

    2017-01-09

    Besides being a major regulator of the response to acetic acid in Saccharomyces cerevisiae, the transcription factor Haa1 is an important determinant of the tolerance to this acid. The engineering of Haa1 either by overexpression or mutagenesis has therefore been considered to be a promising avenue towards the construction of more robust strains with improved acetic acid tolerance. By applying the concept of global transcription machinery engineering to the regulon-specific transcription factor Haa1, a mutant allele containing two point mutations could be selected that resulted in a significantly higher acetic acid tolerance as compared to the wild-type allele. The level of improvement obtained was comparable to the level obtained by overexpression of HAA1, which was achieved by introduction of a second copy of the native HAA1 gene. Dissection of the contribution of the two point mutations to the phenotype showed that the major improvement was caused by an amino acid exchange at position 135 (serine to phenylalanine). In order to further study the mechanisms underlying the tolerance phenotype, Haa1 translocation and transcriptional activation of Haa1 target genes was compared between Haa1 mutant, overproduction and wild-type strains. While the rapid Haa1 translocation from the cytosol to the nucleus in response to acetic acid was not affected in the Haa1 S135F mutant strain, the levels of transcriptional activation of four selected Haa1-target genes by acetic acid were significantly higher in cells of the mutant strain as compared to cells of the wild-type strain. Interestingly, the time-course of transcriptional activation in response to acetic acid was comparable for the mutant and wild-type strain whereas the maximum mRNA levels obtained correlate with each strain's tolerance level. Our data confirms that engineering of the regulon-specific transcription factor Haa1 allows the improvement of acetic acid tolerance in S. cerevisiae. It was also shown that the

  14. Prevalence of vancomycin-resistant entercocci at Ain Shams ...

    African Journals Online (AJOL)

    Prevalence of vancomycin-resistant entercocci at Ain Shams University Hospital. ATA Rahman, SMI Zaki, AGEA Ghany, AM Aboul-Fotouh. Abstract. No Abstract. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · http://dx.doi.org/10.4314/ejmls.v9i2.46810 · AJOL African ...

  15. Keila Tervisekeskus. Ujula = Keila Health Club. Swimming Pool / Ain Padrik

    Index Scriptorium Estoniae

    Padrik, Ain, 1947-

    2001-01-01

    Projekteerija: Arhitektuuribüroo Künnapu & Padrik. Arhitektid Ain Padrik ja Kristi Alamaa, sisearhitekt Sirje Männik. Konstruktsioonid: Jaan Laks, A-Grupp. Ujulas on võistlus- ja lastebassein, suvel on avatud välibassein. 5 ill.: I korruse plaan, ristlõige, vaated

  16. Overexploitation and cumulative drought trend effect on Ras El Ain ...

    Indian Academy of Sciences (India)

    The deficit of Ras El Ain spring discharge due to overexploitation factors and drought effects was estimated. ... Accordingly, it requires the development of sustainable water resources management program to reduce long-term drought risks, restore the groundwater reservoir and minimize the overexploitation effects on ...

  17. De Haas-van Alphen Experiments Under Pressure in UGe2

    International Nuclear Information System (INIS)

    Settai, R.; Nakashima, M.; Shishido, H.; Haga, Y.; Yamagami, H.; Onuki, Y.

    2003-01-01

    We have studied the electronic state in UGe 2 via the de Haas--van Alphen effect under pressure. The cyclotron masses are determined in the strongly polarized phase and in the paramagnetic phase for magnetic field along the c-axis and the results are compared with those along a- and b-axes. (author)

  18. Quantitative assessment of S. mutans and C. albicans in patients with Haas and Hyrax expanders

    Directory of Open Access Journals (Sweden)

    Matheus Melo Pithon

    2012-06-01

    Full Text Available OBJECTIVE: To assess and compare the number of Streptococcus mutans and Candida albicans colonies in patients with Haas and Hyrax appliances before and after insertion. METHODS: The sample consisted of 84 patients requiring orthodontic treatment. For all patients a midpalatal suture expansion was indicated. Patients were randomly divided into Group HA, who used the Haas appliance (n = 42 and Group HY, who used the Hyrax appliance (n = 42. Initially and thirty days after appliance insertion all patients were submitted to saliva collections. The saliva was diluted followed by seeding in Mitis Salivarius and CHROMagar media, for growth of S. mutans and C. albicans respectively. RESULTS: Results showed statistically significant difference between groups HA and HY for Streptococcus mutans and Candida albicans (p <0.05. Haas appliance promoted greater S. mutans and C. albicans proliferation when compared to Hyrax appliance. CONCLUSION: The Haas appliance favored greater proliferation of S. mutans and C. albicans when compared with the Hyrax appliance. Insertion of the appliances resulted in greater buildup of microorganisms.

  19. Turism on/ei ole eksport?! / Ain Hinsberg

    Index Scriptorium Estoniae

    Hinsberg, Ain

    2008-01-01

    Autor tõdeb, et riik ei soovi tunnistada turismi kui eksportiva sektori olulisust Eesti majanduses. Turismisektori konkurentsivõimele mõjuks pärssivalt majutusteenuste käibemaksu määra tõstmine, mida märkis oma kirjas Riigikogule ja valitsusele ka Eesti Hotellide ja Restoranide Liit. Vt. ka: Ain Hinsberg. Tunnustuseta kuuendik Eesti majandusest riigiga ümarlaua taga. Ärielu (2000) juuli, nr. 7-8, lk. 77-79

  20. Study on the TOC concentration in raw water and HAAs in Tehran's water treatment plant outlet.

    Science.gov (United States)

    Ghoochani, Mahboobeh; Rastkari, Noushin; Nabizadeh Nodehi, Ramin; Mahvi, Amir Hossein; Nasseri, Simin; Nazmara, Shahrokh

    2013-11-12

    A sampling has been undertaken to investigate the variation of haloacetic acids formation and nature organic matter through 81 samples were collected from three water treatment plant and three major rivers of Tehran Iran. Changes in the total organic matter (TOC), ultraviolet absorbance (UV254), specific ultraviolet absorbance (SUVA) were measured in raw water samples. Haloacetic acids concentrations were monitored using a new static headspace GC-ECD method without a manual pre-concentration in three water treatment plants. The average concentration of TOC and HAAs in three rivers and three water treatment plants in spring, summer and fall, were 4, 2.41 and 4.03 mg/L and 48.75, 43.79 and 51.07 μg/L respectively. Seasonal variation indicated that HAAs levels were much higher in spring and fall.

  1. Shubnikov de Haas quantum oscillation of the surface states in the metallic Bismuth Telluride sheets

    OpenAIRE

    Chen, Taishi; Han, Junhao; Li, Zhaoguo; Song, Fengqi; Zhao, Bo; Wang, Xuefeng; Wang, Baigeng; Wan, Jianguo; Han, Min; Zhang, Rong; Wang, Guanghou

    2013-01-01

    Metallic Bi2Te3 crystalline sheets with the room-temperature resistivity of above 10 m{\\Omega} cm were prepared and their magnetoresistive transport was measured in a field of up to 9 Tesla. The Shubnikov de Haas oscillations were identified from the secondly-derived magnetoresistance curves. While changing the angle between the field and normal axis of the sheets, we find that the oscillation periods present a cosine dependence on the angle. This indicates a two-dimensional transport due to ...

  2. NiAl-Base Composite Containing High Volume Fraction of AIN Particulate for Advanced Engines

    Science.gov (United States)

    Hebsur, Mohan G.; Whittenberger, J. D.; Lowell, C. E.; Garg, A.

    1995-01-01

    Cryomilling of prealloyed NiAl containing 53 at. % AJ was carried out to achieve high nitrogen levels. The consolidation of cryomilled powder by extrusion or hot pressing/ hot isostatic pressing resulted in a fully dense NiAl-base composite containing 30 vol. % of inhomogeneously distributed, nanosized AIN particulate. The NiAl-30AIN composite exhibited the highest compression yield strengths at all temperatures between 300 and 1300 K as compared with other compositions of NiAl-AIN composite. The NiAl-30AIN specimens tested under compressive creep loading between 1300 and 1500 K also exhibited the highest creep resistance with very little surface oxidation indicating also their superior elevated temperature oxidation resistance. In the high stress exponent regime, the strength is proportional to the square root of the AIN content and in the low stress exponent regime, the influence of AIN content on strength appears to be less dramatic. The specific creep strength of this material at 1300 K is superior to a first generation Ni-base single crystal superalloy. The improvements in elevated temperature creep strength and oxidation resistance have been achieved without sacrificing the room temperature fracture toughness of the NiAl-base material. Based on its attractive combination of properties, the NiAl-30AIN composite is a potential candidate for advanced engine applications,

  3. Casein Kinase I Isoform Hrr25 Is a Negative Regulator of Haa1 in the Weak Acid Stress Response Pathway in Saccharomyces cerevisiae.

    Science.gov (United States)

    Collins, Morgan E; Black, Joshua J; Liu, Zhengchang

    2017-07-01

    Haa1 is a transcription factor that adapts Saccharomyces cerevisiae cells to weak organic acid stresses by activating the expression of various genes. Many of these genes encode membrane proteins, such as TPO2 and YRO2 How Haa1 is activated by weak acids is not clear. Here, we show that casein kinase I isoform Hrr25 is an important negative regulator of Haa1. Haa1 is known to be multiply phosphorylated. We found that mutations in HRR25 lead to reduced Haa1 phosphorylation and increased expression of Haa1 target genes and that Hrr25 interacts with Haa1. The other three casein kinase I isoforms, Yck1, Yck2, and Yck3, do not seem to play critical roles in Haa1 regulation. Hrr25 has a 200-residue C-terminal region, including a proline- and glutamine-rich domain. Our data suggest that the C-terminal region of Hrr25 is required for normal inhibition of expression of Haa1 target genes TPO2 and YRO2 and is important for cell growth but is not required for cell morphogenesis. We propose that Hrr25 is an important regulator of cellular adaptation to weak acid stress by inhibiting Haa1 through phosphorylation. IMPORTANCE Our study has revealed the casein kinase I protein Hrr25 to be a negative regulator of Haa1, a transcription factor mediating the cellular response to stresses caused by weak acids. Many studies have focused on the target genes of Haa1 and their roles in weak acid stress responses, but little has been reported on the regulatory mechanism of Haa1. Weak acids, such as acetic acid, have long been used for food preservation by slowing down the growth of fungal species, including S. cerevisiae In the biofuel industry, acetic acid in the lignocellulosic hydrolysates limits the production of ethanol, which is undesirable. By understanding how Haa1 is regulated, we can make advances in the field of food sciences to better preserve food and engineer acetic acid-resistant strains that will increase productivity in the biofuel industry. Copyright © 2017 American

  4. Impacted incisors associated with supernumerary teeth treated with a modified Haas appliance.

    Science.gov (United States)

    Sant'Anna, Eduardo Franzotti; Marquezan, Mariana; Sant'Anna, Claudia Franzotti

    2012-12-01

    Tooth impaction involves factors such as lack of space in the alveolar process, trauma, ankylosis, and mechanical barriers such as abnormal frenum, supernumerary teeth, tumors, and local cysts. When impaction occurs in the anterior region, esthetics are compromised. This report describes the successful approach to treatment for a young boy who had 2 supernumerary teeth associated with impaction of the left central and lateral permanent incisors. Treatment consisted of extracting the supernumerary teeth and performing maxillary expansion with a modified Haas appliance to guide the left central incisor into its appropriate position. The teeth erupted spontaneously after maxillary expansion and an increase in space. A fixed edgewise appliance was placed incrementally to correct the maxillary anterior tooth positions and finish the treatment. Adequate esthetics and function were achieved. Copyright © 2012 American Association of Orthodontists. Published by Mosby, Inc. All rights reserved.

  5. De Haas-van Alphen effect of a two-dimensional ultracold atomic gas

    Science.gov (United States)

    Farias, B.; Furtado, C.

    2016-01-01

    In this paper, we show how the ultracold atom analogue of the two-dimensional de Haas-van Alphen effect in electronic condensed matter systems can be induced by optical fields in a neutral atomic system. The interaction between the suitable spatially varying laser fields and tripod-type trapped atoms generates a synthetic magnetic field which leads the particles to organize themselves in Landau levels. Initially, with the atomic gas in a regime of lowest Landau level, we display the oscillatory behaviour of the atomic energy and its derivative with respect to the effective magnetic field (B) as a function of 1/B. Furthermore, we estimate the area of the Fermi circle of the two-dimensional atomic gas.

  6. Shubnikov-de Haas effect study of InAs after transmutation doping at low temperatures

    International Nuclear Information System (INIS)

    Gerstenberg, H.; Mueller, P.

    1990-01-01

    Degenerate InAs single crystals have been irradiated by thermal neutrons below 6 K. The Shubnikov-de Haas effect and the electrical resistivity have been measured as a function of the neutron dose and the annealing temperature. The effects of transmutation doping and simultaneous introduction of lattice defects have been analysed in terms of the conduction electron density and the scattering rates τ ρ -1 - ρne 2 /m * and τ x -1 2πkub(B)X/h/2π (where X is the Dingle temperature). The measured conduction electron density after irradiation and thermal annealing agreed well with the values calculated from the experimental and materials parameters. The effects of radiation damage may qualitatively be explained assuming neutral In vacancies to be the most common type of defect in thermal-neutron-irradiated InAs. A comparison with similar experiments on InSb is given. (author)

  7. 75 FR 28654 - Chrysler LLC; St. Louis North Assembly Plant, Including On-Site Leased Workers From HAAS TCM, Inc...

    Science.gov (United States)

    2010-05-21

    ... Workers From HAAS TCM, Inc., Logistics Services, Inc., Robinson Solutions, and Yazaki North America... again on October 30, 2009 to include on-site leased workers from Robinson Solutions, and again March 31... request of the State Agency, the Department reviewed the certification for workers of the subject firm...

  8. 75 FR 20382 - Chrysler LLC, St. Louis North Assembly Plant, Including On-Site Leased Workers From HAAS TCM, Inc...

    Science.gov (United States)

    2010-04-19

    ... North Assembly Plant, Including On-Site Leased Workers From HAAS TCM, Inc., Logistics Services, Inc., Diversified Contract Service, Inc. 639, and Logistics Management Services, Inc., Fenton, MO; Amended... 9, 2008 to include on-site leased workers from Logistics Services, Inc., and amended on October 30...

  9. 75 FR 20384 - Chrysler LLC, St. Louis North Assembly Plant, Including On-Site Leased Workers From Haas TCM, Inc...

    Science.gov (United States)

    2010-04-19

    ... North Assembly Plant, Including On-Site Leased Workers From Haas TCM, Inc., Logistics Services, Inc. Diversified Contract Service, Inc. 639, and Logistics Management Services, Inc. Fenton, MO; Amended... 9, 2008 to include on-site leased workers from Logistics Services, Inc., and amended on October 30...

  10. Aineüleste pädevuste koolitus Pestalozzi programmi raames / Tiia Pukk, Tiiu Vaher

    Index Scriptorium Estoniae

    Pukk, Tiia

    2011-01-01

    1969 alguse saanud Pestalozzi koolitusprogramm on suunatud Euroopa kultuurikonventsiooniga ühinenud 49 riigi haridustöötajatele. Seekordne üritus toimus Tartus, koolituse teemaks aineülesed pädevused

  11. Tumedad ained kirjanduses ja päriselt / Mare Müürsepp

    Index Scriptorium Estoniae

    Müürsepp, Mare

    2007-01-01

    Analüüsitud on Philip Pullmani triloogiasse "Tema tumedad ained" kuuluvaid romaane : Pullman, Philip. Kuldne kompass. Tallinn : Tiritamm, 2002; Pullman, Philip. Inglite torn. Tallinn : Tiritamm, 2004; Pullman, Philip. Vaigust kiiker. Tallinn : Tiritamm, 2005

  12. Läti firma seljatas esimeses astmes Gildi / Anne Oja ; kommenteerinud Ain Kalme

    Index Scriptorium Estoniae

    Oja, Anne, 1970-

    2009-01-01

    Harju maakohtu otsusest, millega kohustati Gild Financial Advisory Servicest võimaldama Latvias Naftas Tranzitsit tutvuda 15 miljoni dollarilise ülekande aluseks olnud dokumentidega. Kommenteerib advokaadibüroo LEXTAL vandeadvokaat Ain Kalme

  13. Study on the TOC concentration in raw water and HAAs in Tehran’s water treatment plant outlet

    Science.gov (United States)

    2013-01-01

    A sampling has been undertaken to investigate the variation of haloacetic acids formation and nature organic matter through 81 samples were collected from three water treatment plant and three major rivers of Tehran Iran. Changes in the total organic matter (TOC), ultraviolet absorbance (UV254), specific ultraviolet absorbance (SUVA) were measured in raw water samples. Haloacetic acids concentrations were monitored using a new static headspace GC-ECD method without a manual pre-concentration in three water treatment plants. The average concentration of TOC and HAAs in three rivers and three water treatment plants in spring, summer and fall, were 4, 2.41 and 4.03 mg/L and 48.75, 43.79 and 51.07 μg/L respectively. Seasonal variation indicated that HAAs levels were much higher in spring and fall. PMID:24283403

  14. Oxidation behaviour of Ti2AIN films composed mainly of nanolaminated MAX phase.

    Science.gov (United States)

    Wang, Q M; Garkas, W; Renteria, A Flores; Leyens, C; Kim, K H

    2011-10-01

    In this paper, we reported the oxidation behaviour of Ti2AIN films on polycrystalline Al2O3 substrates. The Ti2AIN films composed mainly of nanolaminated MAX phase was obtained by first depositing Ti-Al-N films using reactive sputtering of two elemental Ti and Al targets in Ar/N2 atmosphere and subsequent vacuum annealing at 800 degrees C for 1 h. The Ti2AIN films exhibited excellent oxidation resistance and thermal stability at 600-900 degrees C in air. Very low mass gain was observed. At low temperature (600 degrees C), no oxide crystals were observed on film surface. Blade-like Theta-Al2O3 fine crystals formed on film surfaces at 700-800 degrees C. At high temperature (900 degrees C), firstly Theta-Al2O3 formed on film surface and then transformed into alpha-Al2O3. At 700-900 degrees C, a continuous Al2O3 layer formed on Ti2AIN films surface, acting as diffusion barrier preventing further oxidation attack. The mechanism of the excellent oxidation resistance of Ti2AIN films was discussed based on the experimental results.

  15. Tensile strained gray tin: Dirac semimetal for observing negative magnetoresistance with Shubnikov-de Haas oscillations

    Science.gov (United States)

    Huang, Huaqing; Liu, Feng

    2017-05-01

    The extremely stringent requirement on material quality has hindered the investigation and potential applications of exotic chiral magnetic effect in Dirac semimetals. Here, we propose that gray tin is a perfect candidate for observing the chiral anomaly effect and Shubnikov-de-Haas (SdH) oscillation at relatively low magnetic field. Based on effective k .p analysis and first-principles calculations, we discover that gray tin becomes a Dirac semimetal under tensile uniaxial strain, in contrast to a topological insulator under compressive uniaxial strain as known before. In this newly found Dirac semimetal state, two Dirac points which are tunable by tensile [001] strains lie in the kz axis and Fermi arcs appear in the (010) surface. Due to the low carrier concentration and high mobility of gray tin, a large chiral anomaly induced negative magnetoresistance and a strong SdH oscillation are anticipated in this half of the strain spectrum. Comparing to other Dirac semimetals, the proposed Dirac semimetal state in the nontoxic elemental gray tin can be more easily manipulated and accurately controlled. We envision that gray tin provides a perfect platform for strain engineering of chiral magnetic effects by sweeping through the strain spectrum from positive to negative and vice versa.

  16. De Haas-van Alphen oscillations in the charge-density wave compound lanthanum tritelluride (LaTe3)

    Energy Technology Data Exchange (ETDEWEB)

    Ru, N.; /Stanford U., Geballe Lab.; Borzi, R.A.; Rost, A.; Mackenzie, A.P.; /St. Andrews U., Phys. Astron.; Laverock, J.; Dugdale, S.B.; /Bristol U.; Fisher, I.R.; /Stanford U., Geballe Lab.

    2009-12-14

    De Haas-van Alphen oscillations were measured in lanthanum tritelluride (LaTe{sub 3}) to probe the partially gapped Fermi surface resulting from charge density wave (CDW) formation. Three distinct frequencies were observed, one of which can be correlated with a FS sheet that is unaltered by CDW formation. The other two frequencies arise from FS sheets that have been reconstructed in the CDW state.

  17. Improved ethanol production from xylose in the presence of acetic acid by the overexpression of the HAA1 gene in Saccharomyces cerevisiae.

    Science.gov (United States)

    Sakihama, Yuri; Hasunuma, Tomohisa; Kondo, Akihiko

    2015-03-01

    The hydrolysis of lignocellulosic biomass liberates sugars, primarily glucose and xylose, which are subsequently converted to ethanol by microbial fermentation. The rapid and efficient fermentation of xylose by recombinant Saccharomyces cerevisiae strains is limited by weak acids generated during biomass pretreatment processes. In particular, acetic acid negatively affects cell growth, xylose fermentation rate, and ethanol production. The ability of S. cerevisiae to efficiently utilize xylose in the presence of acetic acid is an essential requirement for the cost-effective production of ethanol from lignocellulosic hydrolysates. Here, an acetic acid-responsive transcriptional activator, HAA1, was overexpressed in a recombinant xylose-fermenting S. cerevisiae strain to yield BY4741X/HAA1. This strain exhibited improved cell growth and ethanol production from xylose under aerobic and oxygen limited conditions, respectively, in the presence of acetic acid. The HAA1p regulon enhanced transcript levels in BY4741X/HAA1. The disruption of PHO13, a p-nitrophenylphosphatase gene, in BY4741X/HAA1 led to further improvement in both yeast growth and the ability to ferment xylose, indicating that HAA1 overexpression and PHO13 deletion act by different mechanisms to enhance ethanol production. Copyright © 2014 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

  18. Aine y riesgo cardiovascular: los menos posibles, a la menor dosis posible y durante el menor tiempo posible

    Directory of Open Access Journals (Sweden)

    Ferrán Catalá-López

    2014-09-01

    Conclusiones: Existe poca evidencia para sugerir que alguno de los AINE estudiados es seguro en términos de riesgo cardiovascular. Naproxeno parece ser menos perjudicial que el resto. El riesgo cardiovascular asociado al uso de AINE debe ser tenido en cuenta en la prescripción de cualquiera de estos medicamentos.

  19. Kurja lilled / Charles Baudelaire ; prantsuse k. tlk. Ain Kaalep ja Märt Väljataga

    Index Scriptorium Estoniae

    Baudelaire, Charles

    2000-01-01

    Sisu: Õnnistamine ; "Jumaldan Sind ma siin, öist taevavõlvi nägev / tlk. Ain Kaalep ; Palkon / tlk. Märt Väljataga ; Kodukäija ; Kassid / tlk. A. Kaalep ; Armastades valet / tlk. M. Väljataga ; Üksildase vein ; Päeva lõpp / tlk. Ain Kaalep. Orig.: Bénédiction ; "Je t'adore ̉ l'égal de la vo͠te nocturne ; Le balcon ; Les chats ; L'amour du mensonge ; Le vin du solitaire ; La fin de la journée

  20. Efectos adversos asociados con los fármacos antiinflamatorios no esteroides (AINES)

    OpenAIRE

    Lahoud Salem, Victor

    2014-01-01

    La toxicidad gastrointestinal inducida por los antinflamatorios no esteroides (AINES) se encuentra entre los acontecimientos medicamentosos adversos graves más frecuentes entre los países industrializados Fries J, Williams C5. La exploración endoscópica alta muestra una prevalencia del 15% - 30% de úlceras en el estómago o el duodeno de los pacientes que toman regularmente AINE, Paulus H13 y la incidencia anual de complicaciones gastrointestinales clínicamente importantes puede aproximarse al...

  1. GarcÍa Lorca luulest ja Ain Kaalepi tõlkest / Jüri Talvet

    Index Scriptorium Estoniae

    Talvet, Jüri, 1945-

    1998-01-01

    Arvustus: GarcÍa Lorca, Federico. Mu kätes põleb tuli : valitud luuletused / tlk. ja saateks: Ain Kaalep. 2. tr. Tallinn : Vagabund, 1997. Ilmunud ka kogumikus: Talvet, Jüri. Tõrjumatu äär. Tartu : Ilmamaa, 2005, lk. 442-453

  2. New frameshift CF mutation 3729delAinsTCT in a Tunisian cystic ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics; Volume 92; Issue 1. New frameshift CF mutation 3729delAinsTCT in a Tunisian cystic fibrosis patient. Sondess Hadj Fredj Monia Boudaya Sabrine Oueslati Safa Sahnoun Chaima Sahli Hajer Siala Khedija Boussetta Amina Bibi Taieb Messaoud. Research Note Volume 92 Issue 1 April ...

  3. New frameshift CF mutation 3729delAinsTCT in a Tunisian cystic

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics; Volume 92; Issue 1. New frameshift CF mutation 3729delAinsTCT in a Tunisian cystic fibrosis patient. Sondess Hadj Fredj Monia Boudaya Sabrine Oueslati Safa Sahnoun Chaima Sahli Hajer Siala Khedija Boussetta Amina Bibi Taieb Messaoud. Research Note Volume 92 Issue 1 April ...

  4. ISO sertifikaat kuulutab tootja mainet üle maailma / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2006-01-01

    Ilmunud ka: Delovõje Vedomosti 12. apr. lk. 24-25. ISO standardi rakendamine tagab toodangu kvaliteedi ja annab firmale usaldusväärsuse. Kommenteerib Ain Noormägi. Vt. samas: ISO 9001; ISO 14 001; Universaalne standard kohandub ettevõtte vajadustega

  5. The Scientific Method Ain't What It Used to Be

    Science.gov (United States)

    Herreid, Clyde Freeman

    2010-01-01

    Remember the time when all you had to do was memorize these five steps: ask a question, formulate a hypothesis, perform experiment, collect data, and draw conclusions? And you received full credit for defining the scientific method. Well, those days are gone. This article discusses why the "scientific method ain't what it used to be." (Contains 2…

  6. Poolsajandi õnnesoovid Jaak Aaviksoole / Ain Heinaru, Jaak Kangilaski, Tõnu Lehtsaar...[jt.

    Index Scriptorium Estoniae

    2004-01-01

    Mõtteid Tartu Ülikooli rektorist tema 50. sünnipäeva puhul : Ain Heinaru, Jaak Kangilaski, Tõnu Lehtsaar, Indrek Reimand, Toomas Kiho, Leelo Kriisa, Peeter Olesk, Risto Tammelo, Birute Klaas, Peeter Saari, Andrus Ansip, Mait Klaassen, Marika Kullamaa, Kaupo Bend

  7. Electronic structure of palladium-hydrogen and palladium-deuterium from de Haas-van Alphen experiments

    International Nuclear Information System (INIS)

    Venema, W.J.

    1980-01-01

    A detailed experimental study of the electronic structure of a transition metal-hydrogen interstitial alloy is presented in this thesis. Data on the Fermi surface and on the electron scattering rates of palladium-hydrogen and palladium-deuterium are obtained from de Haas-van Alphen experiments using a torque balance spectrometer and a field modulation spectrometer. The present results suggest that the isotope effect observed in the superconductive transition temperature of concentrated PdH(D)sub(x) is, at least partly, due to a difference in the electronic structure of PdHsub(x) compared to that of PdDsub(x). (Auth.)

  8. Coexistence of Two- and Three-dimensional Shubnikov-de Haas Oscillations in Ar^+ -irradiated KTaO_3

    Energy Technology Data Exchange (ETDEWEB)

    Harashima, S.; Bell, C.; Kim, M.; Yajima, T.; Hikita, Y.; Hwang, H.Y.

    2012-05-16

    We report the electron doping in the surface vicinity of KTaO{sub 3} by inducing oxygen-vacancies via Ar{sup +}-irradiation. The doped electrons have high mobility (> 10{sup 4} cm{sup 2}/Vs) at low temperatures, and exhibit Shubnikov-de Haas oscillations with both two- and three-dimensional components. A disparity of the extracted in-plane effective mass, compared to the bulk values, suggests mixing of the orbital characters. Our observations demonstrate that Ar{sup +}-irradiation serves as a flexible tool to study low dimensional quantum transport in 5d semiconducting oxides.

  9. Note on de Haas-van Alphen diamagnetism in thin, free-electron films

    Science.gov (United States)

    Grzesik, J. A.

    2012-03-01

    We revisit the problem of de Haas-van Alphen (dHvA) diamagnetic susceptibility oscillations in a thin, free-electron film trapped in a synthetic harmonic potential well. A treatment of this phenomenon at zero temperature was announced many years ago by Childers and Pincus (designated hereafter as CP), and we traverse initially much the same ground, but from a slightly different analytic perspective. That difference hinges around our use, in calculating the Helmholtz free energy F, of an inverse Laplace transform, Bromwich-type contour integral representation for the sharp distribution cutoff at Fermi level μ. The contour integral permits closed-form summation all at once over the discrete orbital Landau energy levels transverse to the magnetic field, and the energy associated with the in-plane canonical momenta ℏ k x and ℏ k z. Following such summation/integration, pole/residue pairs appear in the plane of complex transform variable s, a fourth-order pole at origin s = 0, and an infinite ladder, both up and down, of simple poles along the imaginary axis. The residue sum from the infinite pole ladder automatically engenders a Fourier series with period one in dimensionless variable μ/ ℏ ω (with effective angular frequency ω suitably defined), series which admits closed-form summation as a cubic polynomial within any given periodicity slot. Such periodicity corresponds to Landau levels slipping sequentially beneath Fermi level μ as the ambient magnetic field H declines in strength, and is manifested by the dHvA pulsations in diamagnetic susceptibility. The coëxisting steady contribution from the pole at origin has a similar cubic structure but is opposite in sign, inducing a competition whose outcome is a net magnetization that is merely quadratic in any given periodicity slot, modulated by a slow amplitude growth. Apart from some minor notes of passing discord, these simple algebraic structures confirm most of the CP formulae, and their graphic display

  10. Note on de Haas-van Alphen diamagnetism in thin, free-electron films

    Directory of Open Access Journals (Sweden)

    J. A. Grzesik

    2012-03-01

    Full Text Available We revisit the problem of de Haas-van Alphen (dHvA diamagnetic susceptibility oscillations in a thin, free-electron film trapped in a synthetic harmonic potential well. A treatment of this phenomenon at zero temperature was announced many years ago by Childers and Pincus (designated hereafter as CP, and we traverse initially much the same ground, but from a slightly different analytic perspective. That difference hinges around our use, in calculating the Helmholtz free energy F, of an inverse Laplace transform, Bromwich-type contour integral representation for the sharp distribution cutoff at Fermi level μ. The contour integral permits closed-form summation all at once over the discrete orbital Landau energy levels transverse to the magnetic field, and the energy associated with the in-plane canonical momenta ℏ k x and ℏ k z. Following such summation/integration, pole/residue pairs appear in the plane of complex transform variable s, a fourth-order pole at origin s = 0, and an infinite ladder, both up and down, of simple poles along the imaginary axis. The residue sum from the infinite pole ladder automatically engenders a Fourier series with period one in dimensionless variable μ/ ℏ ω (with effective angular frequency ω suitably defined, series which admits closed-form summation as a cubic polynomial within any given periodicity slot. Such periodicity corresponds to Landau levels slipping sequentially beneath Fermi level μ as the ambient magnetic field H declines in strength, and is manifested by the dHvA pulsations in diamagnetic susceptibility. The coëxisting steady contribution from the pole at origin has a similar cubic structure but is opposite in sign, inducing a competition whose outcome is a net magnetization that is merely quadratic in any given periodicity slot, modulated by a slow amplitude growth. Apart from some minor notes of passing discord, these simple algebraic structures confirm most of the CP formulae, and their

  11. Expérience béninoise de la prise en charge des hernies de l'aine ...

    African Journals Online (AJOL)

    La cure des hernies de l'aine est fréquente dans notre pratique. Notre but était de rapporter les aspects épidémiologiques, diagnostiques et thérapeutiques des hernies de l'aine dans notre milieu. Une étude rétrospective en chirurgie viscérale au Centre National Hospitalier et Universitaire-Hubert Koutoukou Maga de ...

  12. Tshelovek metshtõ i dela / Ain Järve ; interv. Lev Livshits

    Index Scriptorium Estoniae

    Järve, Ain

    2005-01-01

    Kadrioru pargi direktori Ain Järvega tema aednikuks saamisest, 1990. aastal Kadriorus tööle asumisest ja viimase 15 aasta jooksul pargis tehtud töödest. Kadrioru ajaloost. Barokkaia rajas Niccolo Michetti projekti järgi vene aednik Ilja Surmin. 19. saj. lõpus täiendati parki Riia arhitekti G. Kuphaldti plaanide alusel. 1930-ndatel heakorrastati parki A. Kotli ja A. Soansi projekti järgi

  13. Burkhardti avaldus paneb oravad tänaseni vassima / Ain Seppik, Rein Lang

    Index Scriptorium Estoniae

    Seppik, Ain, 1952-

    2009-01-01

    Baltic Rail Servic'i (BRS) üks omanikest ja nõukogu esimees Edward Burkhardt kinnitas avalikkuse ees, et Reformierakonna esindajad nõudsid BRS-lt raudtee aktsiate tagasiostmise eest pistist 1 miljon eurot. Prokuratuur ja kaitsepolitsei keelduvad pistiseküsimise kahtlust uurimast. Lisa: Riigikogu liikme Ain Seppiku küsimused, justiitsministri Rein Langi vastused ja Kesknädala kommentaarid

  14. T his article is m ainly about using sim ple trigonom etric identities ...

    Indian Academy of Sciences (India)

    T his article is m ainly about using sim ple trigonom etric identities and basic calculus to deduce som e new and interesting series. In particular, I use basic aspects of. G am m a and B eta integrations to deduce these series. T hese lead to interesting series for ¼ or functions of ¼ . O ne form ofbeta integration w hich is often ...

  15. Pavel Haas Study Day a IMR Study Day: Inter-War Avant-Garde across National and Disciplinary Borders, 30. a 31. ledna 2016, Cardiff University School of Music, Cardiff, Velká Británie

    Czech Academy of Sciences Publication Activity Database

    Kratochvílová, Markéta; Zapletal, Miloš

    2016-01-01

    Roč. 53, č. 1 (2016), s. 101-102 ISSN 0018-7003. [Pavel Haas Study Day. Cardiff, 30.01.2016] R&D Projects: GA ČR(CZ) GP14-35842P Institutional support: RVO:68378076 Keywords : Pavel Haas * conference * music * inter-war * avantgarde Subject RIV: AL - Art, Architecture, Cultural Heritage

  16. [A forgotten chapter in the prehistory of psychoanalysis in Cologne. The emigration of Hans Erich Haas (1896-1990)].

    Science.gov (United States)

    Schultz-Venrath, Ulrich

    2007-01-01

    Haas was the first medical doctor from the Rhineland who was trained at the Berlin Psychoanalytic Institute and established himself as a "specialist for psychoanalysis" in Cologne. For nearly ten years he had a flourishing practice there with a particular interest in the treatment of schizophrenia. He was Jewish and in 1936 he emigrated to England where he was the first and for a long time only psychoanalyst in Birmingham. He specialised in treating patients with personality disorders and psychosomatic diseases and was increasingly consulted as a forensic expert. As a result of his association with a hospital and with the university, he was instrumental in the foundation of the West Midlands Institute for Psychotherapy. At the time of his death in 1990, the psychoanalytic study group of Cologne lacked any knowledge of his life or work.

  17. Measurement of the de Haas-van Alphen oscillations in YBCO using pulsed ultra-high magnetic fields

    International Nuclear Information System (INIS)

    Bykov, A.I.; Dolotenko, M.I.; Kolokolchikov, N.P.; Kudasov, Yu.B.; Platonov, V.V.; Tatsenko, O.M.; Golovashkin, A.I.; Ivanenko, O.M.; Mitsen, K.V.

    1995-01-01

    The measurement of magnetization for YBCO samples with the c-axis oriented along the magnetic field direction have been carried out at liquid helium temperature in ultrahigh pulsed magnetic fields up to 300 T. The magnetic fields were obtained with magnetocumulative generator MC-1 by compression of the magnetic flux by cylindrical detonation wave. The Fourier analysis of the magnetization signal has revealed the existence of oscillation with four well-defined frequencies at 3.8, 10, 13 and 20 kT. The frequencies 3.8 and 10 kT are consistent with calculated frequencies of the de Haas-van Alphen effect in YBCO. The appearance of two other frequencies calls for further investigation. (orig.)

  18. ANALISA MODA DAN EFEK KEGAGALAN (FAILURE MODE AND EFFECTS ANALYSIS / FMEA PADA PRODUK KURSI LIPAT CHITOSE YAMATO HAA

    Directory of Open Access Journals (Sweden)

    Denny Nurkertamanda

    2012-02-01

    Full Text Available Chitose Indonesia Manufacturing merupakan perusahaan yang memproduksi dan menjual furniture dari logam dengan kerjasama negara Jepang. Berdasarkan data penjualan Chitose Indonesia Manufacturing pada tahun 2003, kursi lipat Chitose Yamato merupakan jenis kursi lipat yang memiliki angka penjualan sebesar 59% dari keseluruhan jenis produk yang diproduksi. Kursi lipat Chitose Yamato HAA merupakan salah satu sarana untuk duduk yang dilengkapi dengan sandaran sesuai dengan bentuk punggung manusia dan dapat dilipat untuk memudahkan penyimpanannya. Selain itu juga rangka kakinya yang berbentuk H sehingga dapat digunakan pada permukaan yang datar atau bergelombang. Material yang digunakan pada rangka kursi lipat Chitose Yamato HAA adalah berupa elemen struktur rangka yang bersifat isotropik, yakni memiliki keseragaman sifat dan bahan suatu elemen (regangan, tegangan, mekanis, dsb. Pada analisa moda kegagalan dilakukan identifikasi moda kegagalan yang potensial, keparahan yang ditimbulkan, dan frekuensi kejadian moda kegagalan. Dengan menggunakan analisa moda kegagalan, maka diharapkan kualitas produk akan meningkat dan dapat digunakan sesuai dengan fungsinya. RPN adalah indikator kekritisan untuk menentukan tindakan koreksi yang sesuai dengan moda kegagalan. RPN digunakan oleh banyak prosedur FMEA untuk menaksir resiko menggunakan tiga kriteria yaitu Keparahan efek (Severity S, Kejadian penyebab (Occurrence O, Deteksi penyebab (Detection D. Angka prioritas RPN merupakan hasil kali rating keparahan, kejadian, dan deteksi. Angka ini hanyalah menunjukkan rangking atau urutan defisiensi desain sistem. Kata kunci : Moda Kegagalan, Efek Kegagalan, Penyebab Kegagalan, Deteksi, Kejadian, Keparahan, RPN (Risk Priority Number.     Chitose Manufacturing Indonesia is a company that produce and sells furniture made from alloy in cooperation with Japan. Based on Sales data by Chitose Indonesia Manufacturing in 2003, Chitose Yamato foldable chair has a sales number

  19. HAA1 and PRS3 overexpression boosts yeast tolerance towards acetic acid improving xylose or glucose consumption: unravelling the underlying mechanisms.

    Science.gov (United States)

    Cunha, Joana T; Costa, Carlos E; Ferraz, Luís; Romaní, Aloia; Johansson, Björn; Sá-Correia, Isabel; Domingues, Lucília

    2018-04-02

    Acetic acid tolerance and xylose consumption are desirable traits for yeast strains used in industrial biotechnological processes. In this work, overexpression of a weak acid stress transcriptional activator encoded by the gene HAA1 and a phosphoribosyl pyrophosphate synthetase encoded by PRS3 in a recombinant industrial Saccharomyces cerevisiae strain containing a xylose metabolic pathway was evaluated in the presence of acetic acid in xylose- or glucose-containing media. HAA1 or PRS3 overexpression resulted in superior yeast growth and higher sugar consumption capacities in the presence of 4 g/L acetic acid, and a positive synergistic effect resulted from the simultaneous overexpression of both genes. Overexpressing these genes also improved yeast adaptation to a non-detoxified hardwood hydrolysate with a high acetic acid content. Furthermore, the overexpression of HAA1 and/or PRS3 was found to increase the robustness of yeast cell wall when challenged with acetic acid stress, suggesting the involvement of the modulation of the cell wall integrity pathway. This study clearly shows HAA1 and/or, for the first time, PRS3 overexpression to play an important role in the improvement of industrial yeast tolerance towards acetic acid. The results expand the molecular toolbox and add to the current understanding of the mechanisms involved in higher acetic acid tolerance, paving the way for the further development of more efficient industrial processes.

  20. Transverse effect of Haas and Hyrax appliances on the upper dental arch in patients with unilateral complete cleft lip and palate: A comparative study

    Directory of Open Access Journals (Sweden)

    Anna Júlia de Oliveira Façanha

    2014-04-01

    Full Text Available Objective: The aim of the present study was to evaluate the transverse effect of rapid maxillary expansion in patients with unilateral complete cleft lip and palate while comparing the Haas and Hyrax appliances. Methods: The sample consisted of 48 patients divided into two groups: Group I - 25 patients treated with modified Haas appliance (mean age: 10 years 8 months; and Group II - 23 patients treated with Hyrax appliance (mean age: 10 years 6 months. Casts were taken during pre-expansion and after removal of the appliance at the end of the retention period. The models were scanned with the aid of the 3 Shape R700 3D scanner. Initial and final transverse distances were measured at cusp tips and cervical-palatal points of maxillary teeth by using the Ortho Analyzer(tm 3D software. Results: The mean expansion obtained between cusp tips and cervical-palatal points for inter-canine width was 4.80 mm and 4.35 mm with the Haas appliance and 5.91 mm and 5.91 mm with the Hyrax appliance. As for first premolars or first deciduous molars, the values obtained were 6.46 mm and 5.90 mm in the Haas group and 7.11 mm and 6.65 mm in the Hyrax group. With regard to first molars, values were 6.11 mm and 5.24 mm in the Haas group and 7.55 mm and 6.31 mm in the Hyrax group. Conclusion: Rapid maxillary expansion significantly increased the transverse dimensions of the upper dental arch in patients with cleft palate, with no significant differences between the Hass and Hyrax expanders.

  1. Pamidronato endovenoso en espondilitis anquilosante refractaria a antiinflamatorios no esteroideos (AINES y sulfasalazina

    Directory of Open Access Journals (Sweden)

    Augusto García-Poma

    2007-03-01

    Full Text Available Objetivo: Evaluar la terapia con pamidronato, en pacientes con espondilitis anquilosante (EA activa, con respuesta subóptima o falla a los antiinflamatorios no-esteroideos (AINES y sulfasalazina. Diseño: Estudio clínico comparativo. Lugar: Hospital Nacional Edgardo Rebagliati Martins, EsSalud, Lima, Perú. Participantes: Pacientes con espondilitis anquilosante. Intervenciones. Se incluyó 9 pacientes con EA (6 varones, con enfermedad activa (BASDAI > o = 4, actividad axial y falta de respuesta a los Aines y sulfasalazina a dosis de 3g/d. Todos los pacientes recibieron 60 mg de pamidronato mensual, en infusión endovenosa, durante 6 meses, y continuaron tomando AINES y sulfasalazina. La mejoría clínica fue evaluada usando el ASAS 20. En forma secundaria se evaluó el ASAS 40, BASDAI 50, BASDAI, BASFI Y BASMI, a las 24 y 48 semanas (32 a 86 semanas. La diferencia entre el índice de pre y postratamiento fue evaluada usando la prueba de Wilcoxon. Principales medidas de resultados: Evaluación del ASAS 20. Resultados: El 67% alcanzó un Asas 20 a las 24 semanas y 78% a las 48 semanas; 33,3% y 55,6% tuvieron ASAS 40 y 33,3%; y 44,4% alcanzó BASDAI 50 a las 24 y 48 semanas, respectivamente. Un paciente recayó a la semana 20. Tres pacientes (33,3% permanecieron sin cambios. A las 24 y 48 semanas, la media de BASDAI disminuyó en 45,1% (p=0,007 y en 52,1% (p=0,01, la media de BASFI en 38,2% (p=0,007 y en 52,3% (p=0,007, y la media de BASMI en 39,2% (p=0,01 y 39,2% (p=0,01, respectivamente. Los eventos adversos no fueron importantes con esta terapia. Conclusiones: El tratamiento con pamidronato demostró ser efectivo en este grupo de pacientes con EA, refractaria a AINES y a sulfasalazina.

  2. Monsieur Philippe Galli Préfet de l’Ain France

    CERN Multimedia

    Maximilien Brice

    2011-01-01

    Photo 35: Le chef du département Physique P. Bloch, le porte-parole de la Collaboration CMS G. Tonelli,le Sous-Préfet de Gex O. Laurens-Bernard, le chef du département Technologie F. Bordry, le Péfet de l'Ain P. Galli et le Directeur-général R. Heuer. Photo 62: signature du livre d'or avec le Directeur de la recherche et de l'informatique S. Bertolucci.

  3. Analysis of Urban Expansion of the Resort City of Al Ain Using Remote Sensing and GIS

    Science.gov (United States)

    Issa, S.; Al Shuwaihi, A.

    2009-12-01

    The urban growth of AL Ain city has been investigated using remote sensing data for three different dates, 1972, 1990 and 2000. We used three Landsat images together with socio-economic data in a post-classification analysis to map the spatial dynamics of land use/cover changes and identify the urbanization process in Al Ain resort city, United Arab Emirates. Land use/cover statistics, extracted from Landsat Multi-spectral Scanner (MSS). Thematic Mapper (TM) and Enhanced Thematic Mapper plus (ETM +) images for 1972. 1990 and 2000 respectively, revealed that the built-up area has expanded by about 170.53km2. The city was found to have a tendency for major expansion in four different directions: along the Abu Dhabi highway, along Dubai highway, Myziad direction and Hafeet recreational area. Expansion in any direction was found to be governed by the availability of road network, suitability for construction, utilities, economic activities, geographical constraints, and legal factors (boundary with Sultanate of Oman). The road network in particular has influenced the spatial patterns and structure of urban development, so that the expansion of the built-up areas has assumed an accretive as well as linear growth along the major roads. The research concludes that the development is based on conservation of agricultural areas (oases) and reclamation of the desert for farming and agricultural activities. The integration of remote sensing and GIS was found to be effective in monitoring LULC changes and providing valuable information necessary for planning and research.

  4. Determinants of Diabetes and Hypertension Control in Ambulatory Healthcare in Al Ain, United Arab Emirates

    Directory of Open Access Journals (Sweden)

    Latifa M. Baynouna

    2014-05-01

    Full Text Available bjectives: This study aims to study determinants for the control of diabetes and hypertension in Al Ain Ambulatory Healthcare patients. Method: This is a cross sectional observational study of patients attending ambulatory healthcare centers in Al Ain, United Arab Emirates in 2009. From a yearly audit evaluating the care of patients with diabetes and hypertension, the determinants for improved diabetes and hypertension outcomes were identified from a total of 512 patients and its association with glycemic and blood pressure control were studied. Results: From all variables studied, only the clinic where the patient was treated helped predict both improved blood sugar and blood pressure control. For patients with diabetes, poor control the year before (p<0.001, the number of chronic disease clinic visits (p=0.042 and triglyceride levels (p=0.007 predicted worse control of diabetes. A predictor of poor control of blood pressure (p<0.001 for patients with hypertension was poor control of blood pressure in the year before. Conclusion: In this population, the healthcare system and the team played major roles as determinants in the control of patient’s diabetes and blood pressure more than any of the other factors examined.

  5. Experimental determination of Rashba and Dresselhaus parameters and g *-factor anisotropy via Shubnikov-de Haas oscillations

    Science.gov (United States)

    Herzog, F.; Hardtdegen, H.; Schäpers, Th; Grundler, D.; Wilde, M. A.

    2017-10-01

    The spin splitting of conduction band electrons in inversion-asymmetric InGaAs/InP quantum wells (QWs) is studied by Shubnikov-de Haas measurements combining the analysis of beating patterns and coincidence measurements in doubly tilted magnetic fields. The method allows us to determine the absolute values of the Rashba and linear Dresselhaus spin-orbit interaction (SOI) coefficients, their relative sign and the full Landé g-tensor. This is achieved by analyzing the anisotropy of the beat node positions with respect to both polar and azimuthal angles between the magnetic field direction and the QW normal. We show that the SOI is dominated by a large Rashba coefficient together with a linear Dresselhaus coefficient that is 10% of the Rashba coefficient. Their relative sign is found to be positive. The g-tensor is found to have a marked out-of-plane anisotropy and a smaller but distinct in-plane anisotropy due to SOI.

  6. Experimental determination of Rashba and Dresselhaus parameters and g *-factor anisotropy via Shubnikov-de Haas oscillations

    International Nuclear Information System (INIS)

    Herzog, F; Grundler, D; Wilde, M A; Hardtdegen, H; Schäpers, Th

    2017-01-01

    The spin splitting of conduction band electrons in inversion-asymmetric InGaAs/InP quantum wells (QWs) is studied by Shubnikov-de Haas measurements combining the analysis of beating patterns and coincidence measurements in doubly tilted magnetic fields. The method allows us to determine the absolute values of the Rashba and linear Dresselhaus spin–orbit interaction (SOI) coefficients, their relative sign and the full Landé g-tensor. This is achieved by analyzing the anisotropy of the beat node positions with respect to both polar and azimuthal angles between the magnetic field direction and the QW normal. We show that the SOI is dominated by a large Rashba coefficient together with a linear Dresselhaus coefficient that is 10% of the Rashba coefficient. Their relative sign is found to be positive. The g-tensor is found to have a marked out-of-plane anisotropy and a smaller but distinct in-plane anisotropy due to SOI. (paper)

  7. Angular-Dependent Phase Factor of Shubnikov-de Haas Oscillations in the Dirac Semimetal Cd3As2

    Science.gov (United States)

    Xiang, Z. J.; Zhao, D.; Jin, Z.; Shang, C.; Ma, L. K.; Ye, G. J.; Lei, B.; Wu, T.; Xia, Z. C.; Chen, X. H.

    2015-11-01

    We measure the magnetotransport properties of the three-dimensional Dirac semimetal Cd3As2 single crystal under magnetic fields up to 36 T. Shubnikov-de Haas (SdH) oscillations are clearly resolved and the n =1 Landau level is reached. A detailed analysis on the intercept of the Landau index plot reveals a significant dependence of the SdH phase factor on the orientation of the applied magnetic field. When the magnetic field is applied in the [001] direction, i.e., along the fourfold screw axis of the tetragonal crystal structure, a nontrivial π Berry phase, as predicted for the Dirac fermions, is observed. However, in a magnetic field tilted away from the [001] direction, the π Berry phase is evidently reduced, and a considerable enhancement of the effective mass is also revealed. Our observations demonstrate that the Dirac dispersion in Cd3As2 is effectively modified in a tilted magnetic field, whereas the preserved π Berry phase in a magnetic field along the [001] direction can be related to the realization of the Weyl fermions. The sudden change of the SdH phase also indicates a possible topological phase transition induced by the symmetry-breaking effect.

  8. Shubnikov - de Haas oscillations, weak antilocalization effect and large linear magnetoresistance in the putative topological superconductor LuPdBi

    Science.gov (United States)

    Pavlosiuk, Orest; Kaczorowski, Dariusz; Wiśniewski, Piotr

    2015-01-01

    We present electronic transport and magnetic properties of single crystals of semimetallic half-Heusler phase LuPdBi, having theoretically predicted band inversion requisite for nontrivial topological properties. The compound exhibits superconductivity below a critical temperature Tc = 1.8 K, with a zero-temperature upper critical field Bc2 ≈ 2.3 T. Although superconducting state is clearly reflected in the electrical resistivity and magnetic susceptibility data, no corresponding anomaly can be seen in the specific heat. Temperature dependence of the electrical resistivity suggests existence of two parallel conduction channels: metallic and semiconducting, with the latter making negligible contribution at low temperatures. The magnetoresistance is huge and clearly shows a weak antilocalization effect in small magnetic fields. Above about 1.5 T, the magnetoresistance becomes linear and does not saturate in fields up to 9 T. The linear magnetoresistance is observed up to room temperature. Below 10 K, it is accompanied by Shubnikov-de Haas oscillations. Their analysis reveals charge carriers with effective mass of 0.06 me and a Berry phase very close to π, expected for Dirac-fermion surface states, thus corroborating topological nature of the material. PMID:25778789

  9. Microwave radiation absorption and Shubnikov-de Haas oscillations in semimetal InAs/GaSb/AlSb composite quantum wells

    Czech Academy of Sciences Publication Activity Database

    Mikhailova, M. P.; Veinger, A.I.; Kochman, I.V.; Semenikhin, P.V.; Kalinina, K.V.; Parfeniev, R.V.; Berezovets, V.A.; Safonchik, M.O.; Hospodková, Alice; Pangrác, Jiří; Zíková, Markéta; Hulicius, Eduard

    2016-01-01

    Roč. 10, č. 4 (2016), 1-8, č. článku 046013. ISSN 1934-2608 R&D Projects: GA ČR GA13-15286S; GA MŠk LO1603 Institutional support: RVO:68378271 Keywords : Shubnikov-de Haas oscillations * microwave absorption * electron-paramagnetic resonance * composite quantum wells * InAs/GaSb/AlSb * MOVPE Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.325, year: 2016

  10. A expansão rápida da maxila com haas e a fala na fissura labiopalatina transforame Rapid maxillary expansion with Haas and the speech in people with cleft lip and palate

    Directory of Open Access Journals (Sweden)

    Christiane Moraes Lazzari

    2009-01-01

    Full Text Available OBJETIVO: verificar os efeitos da Expansão Rápida da Maxila (ERM, com aparelho Haas, na fala do paciente com fissura labiopalatina (FLP Transforame. MÉTODOS: 12 indivíduos entre sete e 14 anos, sendo seis meninos e seis meninas, divididos em dois grupos. O Grupo 1 (G1, submetido à ERM com protocolo de ativação convencional e, o Grupo 2 (G2, submetido à ERM com protocolo de ativação preconizado por Liou e Tsai (2005 com expansões e constrições alternadas. Realizou-se avaliação da fala, análise acústica com programa Praat e avaliação perceptivo-auditiva por julgadores fonoaudiólogos e leigos. RESULTADOS: a medição dos tempos de emissão das vogais por análise acústica mostrou diferença estatisticamente significante na avaliação pós-ERM da vogal /i/ no G1 e da vogal /a/ no G2. Na avaliação perceptivo-auditiva, não houve diferenças estatisticamente significantes entre os grupos nas avaliações de Nasalidade e Clareza na Articulação, porém, na medida em que os julgadores atribuíram melhora à Nasalidade, também atribuíram melhora à Articulação e, assim também em relação as variáveis "Melhor", "Igual" e "Pior". CONCLUSÃO: a diminuição dos tempos de emissão pós-ERM, indica que o aumento no escape aéreo nasal ocasiona menores tempos de emissão. A análise perceptivo-auditiva mostrou-se um instrumento eficaz de avaliação, havendo concordância entre julgadores leigos e fonoaudiólogos. Essa avaliação indicou também, que na medida em que a nasalidade diminui ocorre maior clareza na articulação.PURPOSE: to check the effects of rapid maxillary expansion (RME with Haas, made by orthodontistic, in speech of the patient with cleft lip and palate. METHODS: 12 subjects, 6 boys and 6 girls, with age between 7 and 14-year old, divided in two groups. Group 1 (G1, was submitted to conventional activation RME protocol and Group 2 (G2, was submitted to activation ERM protocol in accordance with Liou and Tsai

  11. Teaduskeskus Ahhaa = Ahhaa Science Centre / Vilen Künnapu, Ain Padrik, Malle Jürgenson, Tea Tammelaan ; intervjueerinud Margit Mutso

    Index Scriptorium Estoniae

    2012-01-01

    Tartus Sadama 1 auva Ahhaa teaduskeskuse arhitektuurist ja sisearhitektuurist. Arhitektid: Ain Padrik ja Vilen Künnapu, kaasa töötasid Kristjan Tõlk, Kristiin Keernik, Siim Tuksam, Hannes Tilk (Künnapu & Padrik). Sisearhitektid: Tea Tammelaan, Krista Lepland ja Malle Jürgenson (Laika, Belka & Strelka). Infograafika: Alar Pikkorainen

  12. An activity-based cost analysis of the Honduras community-based, integrated child care (AIN-C) programme.

    Science.gov (United States)

    Fiedler, John L; Villalobos, Carlos A; De Mattos, Annette C

    2008-11-01

    The Honduras AIN-C programme is a preventive health and nutrition programme of the Honduras Ministry of Health (MOH) that relies on volunteers to help mothers monitor and maintain the adequate growth of young children. A quasi-experimental, design-based evaluation found that the programme achieved near-universal coverage and was effective in improving mothers' child-rearing knowledge, attitudes and practices, including feeding and appropriate care-giving and care-seeking practices for children with diarrhoea and acute respiratory illness. The programme is widely regarded as a model. This study was undertaken to provide the first comprehensive estimates of the cost of the AIN-C programme, with the goal of providing a programme and financial planning tool for Honduras. An additional comparison of study findings was also undertaken to determine the cost of the AIN-C programme's community-based services relative to a similar facility-based service. Expressed in mid-2005 US dollars, the study found that after the programme is phased-in: (1) the annual, recurrent cost per child under 2 years participating in the programme is $6.43; (2) the annual, incremental budget requirements per child under 2 years participating in the programme are $3.90; (3) the cost of an AIN-C monthly growth monitoring and counselling session per child is 11% of the cost of a traditional MOH, facility-based growth and development consultation per child; and (4) the effect of mothers substituting AIN-C monitor care for MOH facility-based care 'saves' 203 000 outpatient visits a year, with a potential cost saving of $1.66 million, the equivalent of 60% of the recurrent cost of the programme and roughly equal to the annual incremental budget requirements of the programme. Sensitivity analysis of the cost estimates is performed to provide insight, for countries considering introducing a similar programme, into how modifications of key characteristics of the programme affect its costs.

  13. Knowledge of periconceptional folic acid use among pregnant women at Ain Shams University Hospital, Cairo, Egypt.

    Science.gov (United States)

    Al-Darzi, W; Al-Mudares, F; Farah, A; Ali, A; Marzouk, D

    2014-10-12

    Egypt has a high incidence of neural tube defects. Folic acid supplementation in the periconceptional period is known to lower the risk of such defects. This cross-sectional study aimed to measure the level of knowledge about periconceptional folic acid use among pregnant women attending for antenatal care at Ain Shams University Hospital, Cairo, Egypt in 2012. Questionnaires were filled through personal interviews with 660 pregnant women. Of the respondents, 62.4% had heard of folic acid and 39.2% knew about the role of folic acid supplementation in prevention of congenital anomalies. Knowledge about using folic acid before and in the first trimester of pregnancy was highest among university-educated women and those working in professional occupations. Only 18.8% of women reported taking folic acid, and 8.8% had used it before conception. Awareness campaigns are suggested to improve knowledge about folic acid among women in the childbearing period in Egypt.

  14. Management of toxic cyanobacteria for drinking water production of Ain Zada Dam.

    Science.gov (United States)

    Saoudi, Amel; Brient, Luc; Boucetta, Sabrine; Ouzrout, Rachid; Bormans, Myriam; Bensouilah, Mourad

    2017-07-01

    Blooms of toxic cyanobacteria in Algerian reservoirs represent a potential health problem, mainly from drinking water that supplies the local population of Ain Zada (Bordj Bou Arreridj). The objective of this study is to monitor, detect, and identify the existence of cyanobacteria and microcystins during blooming times. Samples were taken in 2013 from eight stations. The results show that three potentially toxic cyanobacterial genera with the species Planktothrix agardhii were dominant. Cyanobacterial biomass, phycocyanin (PC) concentrations, and microcystin (MC) concentrations were high in the surface layer and at 14 m depth; these values were also high in the treated water. On 11 May 2013, MC concentrations were 6.3 μg/L in MC-LR equivalent in the drinking water. This study shows for the first time the presence of cyanotoxins in raw and treated waters, highlighting that regular monitoring of cyanobacteria and cyanotoxins must be undertaken to avoid potential health problems.

  15. Seltskond / Annika Haas

    Index Scriptorium Estoniae

    Haas, Annika

    2007-01-01

    Turundusagentuur PNG (loovjuhiks Jüri Peetson) ühendas tänuõhtu oma klientidele ja koostööpartneritele hispaania laulja Enrique Iglesiase esinemisega 1. dets. Tallinnas Saku Suurhalli restoranis Platoo

  16. Seltskond / Annika Haas

    Index Scriptorium Estoniae

    Haas, Annika

    2008-01-01

    8. aug. Tallinnas kinos Sõprus ja klubis Juuksur tähistati 30 aasta möödumist ansambli Joy Divison sünnist ja Anton Corbijni debüütfilmi "Control" jõudmist Eesti kinodesse (näidati dokumentaalfilmi "Joy Divison")

  17. Hepatic artery aneurysms (HAAs)

    International Nuclear Information System (INIS)

    Nosratini, H.

    2004-01-01

    The hepatic artery aneurysms are rare, especially in interahepatic branches, The frequency consists of 75-80% extrahepatic and 20-25% intrahepatic. Catheterization is achieved usually from common femoral artery, other methods implemented in the case of unsuccessful catheterization from femoral artery, are translumbar and brachial catheterization. The study consist of 565 patients that were referred to the angiography ward, During seven years of assessment, five cases of hepatic artery aneurysm were found; this is a rare condition reported in the English literature. In the literature as well as in this case report the hepatic artery aneurysms are rare. In reported series the extrahepatic artery aneurysms are found more often than in the intrahepatic artery aneurysm but in this case report intrahepatic artery aneurysms are more than extrahepatic one. (author)

  18. Seltskond / Annika Haas

    Index Scriptorium Estoniae

    Haas, Annika

    2008-01-01

    Intellektipuudega noortele rajatava Maarja küla toetuseks toimunud kontserdist 17. nov. Tallinnas Vene Teatris (järgmised kontserdid on 23. nov. Pärnu teatris Endla ja 30. nov. Tartu Vanemuise suures majas)

  19. SUB’HAA

    Directory of Open Access Journals (Sweden)

    Harisnal Hadi

    2017-08-01

    Full Text Available The preparation of the artwork entitled "Subhaa", is inspired by the Minangkabau cultural phenomenon. This work focuses on the feelings of children who will be circumcised, the pressure and fear felt by the child who will be circumcised tilled in the form of Polymetrik art works. Circumcision or commonly called Basunaik by Minangkabau society is a Sunna that must be run boys of Islam; indirectly circumcision is also required for boys in Minangkabau. In the area of darek (mainland khitan has its own ceremony, begins with a child who will be circumcised is brought to the bako house to change his clothes, then paraded around the village, after arriving at home circumcised will be held. In the evening there will be entertainment in the form of randai and bagurau saluang. This piece of music is in the form of a new composition. The performance focuses more on the composition of sound as a contextual meaning to be conveyed to the appreciator. This work is a little contrary to the aesthetics that have been awakened in the brain and soul of the arts in the Sendratasik Department of FBS Universitas Negeri Padang. But it cannot be denied that a new works will create its own aesthetic realm. Keywords: Basunaik, Artwork Music. Abstrak Penyusunan karya seni yang berjudul “Subhaa”, ini terinspirasi dari fenomena budaya Minangkabau. Karya ini menitik beratkan garapan pada perasaan anak yang akan dikhitan, tekanan dan ketakutan yang dirasakan oleh anak yang akan dikhitan digarap dalam bentuk penggarapan Polymetrik. Khitan atau biasa disebut Basunaik oleh masyarakat Minangkabau merupakan sunah yang harus dijalankan anak laki-laki Islam, secara tidak langsung khitan juga diwajibkan bagi anak laki-laki di Minangkabau. Di daerah darek (daratan khitan memiliki upacara tersendiri, diawali dengan anak yang akan dikhitan dibawa ke rumah bako untuk mengganti baju, lalu diarak keliling kampung, setelah sampai di rumah baru diadakan khitan, malamnya diadakan hiburan berupa randai dan bagurau saluang. Karya musik ini berbentuk komposisi garapan baru. Penggarapan lebih menitik beratkan kepada penggarapan bunyi sebagai makna kontekstual yang akan disampaikan kepada apresiator. Karya ini memang sedikit bertolak belakang dengan estetika yang sudah terbangun dalam otak dan jiwa kalangan seni di jurusan pendidikan sendratasik FBS Universitas Negeri Padang. Namun tidak bisa dipungkiri sebuah karya garapan baru akan menciptakan ranah estetikanya sendiri. Kata Kunci: Basunaik, Karya seni Musik.

  20. Seltskond / Annika Haas

    Index Scriptorium Estoniae

    Haas, Annika

    2006-01-01

    Tallinna Ülikoolis toimunud ameerika kultuurantropoloogi Clifford Geertzi mälestusõhtust, kus esinesid rektor Rein Raud, Eesti Humanitaarinstituudi dotsent Lorenzo Cañás Bottos ja kultuuriteooria lektor Marek Tamm

  1. Seltskond / Annika Haas

    Index Scriptorium Estoniae

    Haas, Annika

    2006-01-01

    Inglise rocklaulja Gordon Matthew Sumneri raamatu "Sting. Murtud muusika" esitlusest Tallinnas Viru Keskuse Rahva Raamatu kaupluses ja kontserdist Saku Suurhallis Broken Musicu nimelise tuuri raames 28. juulil

  2. De Haas-van Alphen oscillations near B{sub c2} in the organic superconductor {kappa}-(ET){sub 2}Cu(NCS){sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Wel, P.J. van der [H.H. Wills Physics Lab., Univ. of Bristol (United Kingdom); Caulfield, J. [Clarendon Lab., Univ. of Oxford (United Kingdom); Hayden, S.M. [H.H. Wills Physics Lab., Univ. of Bristol (United Kingdom); Singleton, J. [Clarendon Lab., Univ. of Oxford (United Kingdom); Springford, M. [H.H. Wills Physics Lab., Univ. of Bristol (United Kingdom); Meeson, P. [H.H. Wills Physics Lab., Univ. of Bristol (United Kingdom); Hayes, W. [Clarendon Lab., Univ. of Oxford (United Kingdom); Kurmoo, M. [Royal Institution, London (United Kingdom); Day, P. [Royal Institution, London (United Kingdom)

    1995-03-15

    We report a study of the de Haas-van Alphen effect near the upper critical field in the organic superconductor {kappa}-(ET){sub 2}Cu(NCS){sub 2}. The experiments have been carried out for a range of sample orientations with respect to the magnetic field and of temperatures down to 20 mK. On entering the vortex state, an attenuation of the dHvA signal is observed relative to an extrapolation of the standard Lifshitz-Kosevich formula using band parameters measured in the normal state. (orig.)

  3. Antiinflamatorios no esteroideos (AINES.: Consideraciones para su uso estomatológico

    Directory of Open Access Journals (Sweden)

    Andrés A. Pérez Ruiz

    2002-08-01

    Full Text Available Se realiza una revisión extensa y actualizada sobre los antiinflamatorios no esteroideos (AINEs, con el fin de actualizar al estomatólogo en su uso. Para ello se revisan aspectos importantes del proceso inflamatorio en estructuras de la boca que como las pulpitis, presentan sus peculiaridades. Se identifica a una de las 2 familias de autacoides provenientes de los fosfolípidos de membrana celular, es decir, los eicosanoides derivados a partir de algunos ácidos grasos polisaturados, en particular, ácido araquidónico, que tras la acción de enzimas da lugar a la formación de prostaglandinas, prostaciclinas, tromboxeno A2 y leucotrienos. Conocidos estos antecedentes, nos ocupamos de fármacos usados para combatir los síntomas y signos de la inflamación. Casi todos los antiinflamatorios no esteroideos utilizados en la actualidad, casi todos, inhiben las actividades de la ciclooxigenasa 1 constitutiva y la ciclooxigenasa 2, inducida en el sitio de la inflamación y con ello, la síntesis de prostaglandinas y tromboxanos. Se alude a la ventaja terapéutica de los inhibidores de la COX-2 que aparecen hoy en el mercado. Se expone las dosis y frecuencias de los AINEs, sus interacciones, así como las reacciones adversas al medicamento y contraindicaciones, y se proponen aquellos que son de interés en la práctica estomatológica.Non-steroidal anti-inflammatory drugs. Considerations about their dental use. An extensive updated review of non-steroidal anti-inflammatory agents (NSAIN was made to give an updated information to the dentist about their use. To this purpose, important aspects of the inflammatory process in mouth structures like pulpitis that present with their own peculiarities are reviewed. We identified one of the two autacoid families from cell membrane phospholipids, that is, eicosanoids derived from some polysaturated fatty acids, in particular, arachidonic acid, which, after the action of enzymes, give rise to the formation of

  4. Qualité de la source Ain Hamma et effet du déversement de ses ...

    African Journals Online (AJOL)

    Les eaux de l'Oued Khoumane ont été prélevées mensuellement, entre août 2010 et mars 2011, au niveau de deux stations (amont et aval de sa confluence avec les eaux de la source thermale Ain Hamma Moulay Idriss) afin d'effectuer des analyses physico-chimiques et bactériologiques. L'analyse descriptive a montré ...

  5. Vitamin D deficiency among healthy adolescents in Al Ain, United Arab Emirates

    Science.gov (United States)

    2013-01-01

    Background Although vitamin D deficiency has been studied in various adult populations, there are few data on the prevalence of this nutritional deficiency among healthy adolescents in the United Arab Emirates (UAE). This study was conducted to determine the prevalence of vitamin D deficiency and to examine its correlates in adolescents aged 15 to 18 years. Methods This was a cross-sectional study in urban schools. Healthy adolescents (N=315) from a sample of 8 schools were randomly selected from the 142 schools in Al Ain, Abu Dhabi Emirate. Outcomes measured included serum concentrations of 25-hydroxy vitamin D (25OHD), plasma lipids, blood sugar, blood pressure and anthropometric data, nutrition and lifestyle variables. Results Fourty-one participants (19.7%) were vitamin D deficient (serum 25OHD level ≤15 ng/mL [≤37.5 nmol/L]. Using a cutoff level of 25(OH) D of ≤20 ng/ml [≤50 nmol/l] 143 participants (45.4%) were vitamin D insufficient. Overall 65.1% of study participants were either vitamin D deficient or insufficient. The prevalence of vitamin D deficiency varied between boys (10%) and girls (28%). In a final multivariate model, serum 25(OH) D concentrations were inversely correlated with female gender, consumption of fast food per week, and body mass index and positively correlated with physical activity scores after adjustment for age. Conclusions Vitamin D deficiency and insufficiency were highly prevalent in adolescents, and more common in girls. PMID:23311702

  6. Climate change and their consequences on coastal zone of Ain el Turck in Oran

    Directory of Open Access Journals (Sweden)

    Mohammed Tewfik Bouroumi

    2017-12-01

    Full Text Available Algeria does not escape the problem of the climate change, its geographical position in zone of transition, and its dry and semi-arid climate, in fact a very vulnerable space. In Algeria, approximately two thirds of the population is concentrated on the coast which represents only 4 % of the territory. The Mediterranean coast, in particular in Algeria, is subjected to pressures: financial stakes, climatic risks, pollutions and conservation of the water. It is on the basis of the critical and objective report with regard to a wild urbanization of the Algerian coast as well as the influence of the demographic pressure that the choice of the search for this article was held. This publication has for objective to raise (to draw up a current situation (inventory of fixtures of the sector of the environment in Algeria and to present through the case of the coastal city of Oran the consequences of climate change. We propose, to review the situation through the case of the municipality of Ain El Türck, by basing itself on data relative to the evolution of the temperatures and the sea level.

  7. Pediatric and youth traffic-collision injuries in Al Ain, United Arab Emirates: a prospective study.

    Directory of Open Access Journals (Sweden)

    Michal Grivna

    Full Text Available AIM: To study the mechanism of road traffic collisions (RTC, use of safety devices, and outcome of hospitalized pediatric and youth RTC injured patients so as to give recommendations regarding prevention of pediatric RTC injuries. METHODS: All RTC injured children and youth (0-19-year-olds who were admitted to Al Ain City's two major trauma centers or who died after arrival to these centers were prospectively studied from April 2006 to October 2007. Demography of patients, road-user and vehicle types, crash mechanism, usage of safety devices, injured body regions, injury severity, Revised Trauma Score, Glasgow Coma Scale, intensive care unit admissions, hospital stay and mortality were analyzed. RESULTS: 245 patients were studied, 69% were vehicle occupants, 15% pedestrians, 9% motorcyclists and 5% bicyclists. 79% were males and 67% UAE citizens. The most common mechanism of RTC was rollover of vehicle (37% followed by front impact collision (32%. 32 (13% of vehicle occupants were ejected from car. 63% of ejected occupants and 70% of motorcyclists sustained head injuries. Only 2% (3/170 vehicle passengers used seatbelts and 13% (3/23 motorcyclists a helmet. CONCLUSIONS: Male drivers and UAE nationals were at high risk of RTC as drivers and as motorcyclists. Ejection rate was high because safety restraint use was extremely low in our community. More education and law enforcement focusing especially on car/booster seat use is needed.

  8. Incidence of emergency peripartum hysterectomy in Ain-shams University Maternity Hospital, Egypt: a retrospective study.

    Science.gov (United States)

    Allam, Ihab Serag; Gomaa, Ihab Adel; Fathi, Hisham Mohamed; Sukkar, Ghada Fathi Mahmoud

    2014-11-01

    To estimate the incidence of emergency peripartum hysterectomy over 6 years in Ain-shams University Maternity Hospital. Detailed chart review of all cases of emergency peripartum hysterectomy, 2003-2008, including previous obstetric history, details of the index pregnancy, indications for emergency peripartum hysterectomy, outcome of the hysterectomy and infant morbidity. The overall rate of emergency peripartum hysterectomy was 149 of 66,306 or 2.24 per 1,000 deliveries. The primary indications for hysterectomies were placenta accreta/increta 59 (39.6 %), uterine atony 37 (24.8 %), uterine rupture 35 (23.5 %) and placenta previa without accreta 18 (12.1 %). After hysterectomy, 115 (77 %) women were admitted to the intensive care unit. Women were discharged home after a mean 11.2 day length of stay. Using multifactorial logistic regression analysis, we found that woman's age, atonic uterus, placenta accreta/increta, previous cesarian section and ruptured uterus were independent predictors for peripartum hysterectomy Abnormal placentation was the main indication for peripartum hysterectomy. The risk factors for peripartum hysterectomy were morbid adherence of placentae in scared uteri, uterine atony and uterine rupture. The most important step in prevention of major postpartum hemorrhage is recognizing and assessing women's risk. The risk of peripartum hysterectomy seems to be significantly decreased by limiting the number of cesarean section deliveries, thus reducing the occurrence of abnormal placentation in the form of placenta accreta, increta or percreta.

  9. Knowledge, attitude and practice of medical students towards self medication at Ain Shams University, Egypt.

    Science.gov (United States)

    El Ezz, N F A; Ez-Elarab, H S

    2011-12-01

    Self medication is usually defined as intake of any type of drugs for treating oneself without professional supervision to relieve an illness or a condition. Self medication is an issue with serious global implications. In this study it was aimed to determine the knowledge, attitudes and behavior of self medication by the near coming physicians. A cross-sectional study was conducted on a sample of randomly selected medical students from Ain Shams University. Data was collected using self administered questionnaire. Verbal consent was ensured before applying the questionnaire. The Chi square was performed using SPSS 16 to identify associations and differences. The sample consisted of 300 students 67% females and 33% male students. Prevalence of self medication was 55%. Out of which 58.8%, 54.4%, 87.2%, 12%, 28% took antibiotic, vitamins, analgesics, sedatives, herbal products respectively without physician prescription. As regards the personal behavior towards following any prescription 14.4% always followed properly the prescription compared to 63.3% always discontinued the drug on feeling improvement, and 13.6% always repeated the prescription without seeking medical advice. Also 60% said that they increased the dose without medical advice. As regards the reported side effects 4.8%, 1.6%, 12% as a result of interaction between drugs, increase dose without medical advice and early stopping of treatment respectively. Self medication by medical students is an important issue to be avoided and need to be added to the curriculum of undergraduate students and raise the community awareness about these hazards and drawbacks.

  10. BACTERIOLOGICAL ANALYSIS AND PUBLIC PERCEPTION ABOUT DRINKING WATER OF BOREHOLES IN ARIB (AIN DEFLA, ALGERIA

    Directory of Open Access Journals (Sweden)

    F. C. Hamaidi

    2016-05-01

    Full Text Available Water from boreholes in Arib (Ain Defla, south-west of Algeria was investigated to ascertain its quality status and suitability for drinking and domestic uses. Fifty six water samples were collected from four boreholes. The analyses of the Coliform counts obtained from various boreholes samples ranged between 0 and 200 CFU/ 100 ml with regard to total Coliforms and between 0 and 8 CFU/ 100 ml with regard to fecal Coliforms. Three of the boreholes samples showed contamination by Streptococcus sp. Pathogens like Salmonella were not identified but some low levels of sulfite-reducing bacteria was found. The interviews were done to assess perceptions on water taste problems, odour, colour, and turbidity and health problems. The respondents were taken from people in the community using random sampling technique. Sixty people were sampled at each area surrounding the boreholes. It was found out that 43.3% of the respondents rated their drinking water safe for consumption as well as absence of illness after drinking as indicators for judging the quality of the water. The others respondents (56.7% reported having at least some concerns with safety of their water.  More  than 20% of the households reported at least one household member having suffered some water related illness in the past two years. Respondents were asked to judge the quality of the water, based on four sensory characteristics of drinking water. Many respondents rated the smell (33.3%, taste (20%, colour (23.3% and turbidity (23.3%. These results showed that all the samples did not satisfy the WHO requirements for bacteriological characteristics in human consumption.

  11. Shubnikov-de Haas-like Quantum Oscillations in Artificial One-Dimensional LaAlO3/SrTiO3 Electron Channels

    Science.gov (United States)

    Cheng, Guanglei; Annadi, Anil; Lu, Shicheng; Lee, Hyungwoo; Lee, Jung-Woo; Huang, Mengchen; Eom, Chang-Beom; Irvin, Patrick; Levy, Jeremy

    2018-02-01

    The widely reported magnetoresistance oscillations in LaAlO3/SrTiO3 heterostructures have invariably been attributed to the Shubnikov-de Haas (SdH) effect, despite a pronounced inconsistency with low-field Hall resistance measurements. Here we report SdH-like resistance oscillations in quasi-1D electron waveguides created at the LaAlO3/SrTiO3 interface by conductive atomic force microscopy lithography. These oscillations can be directly attributed to magnetic depopulation of magnetoelectric subbands. Our results suggest that the SdH oscillations in 2D SrTiO3 -based systems may originate from naturally forming quasi-1D channels.

  12. Quantum oscillations without a Fermi surface. The anomalous de Haas-van Alphen effect and relation to SmB{sub 6}

    Energy Technology Data Exchange (ETDEWEB)

    Knolle, Johannes; Cooper, Nigel [T.C.M. Group, Cavendish Laboratory, J. J. Thomson Avenue, Cambridge CB3 0HE (United Kingdom)

    2016-07-01

    The de Haas-van Alphen effect (dHvAE), describing oscillations of the magnetization as a function of magnetic field, is commonly assumed to be a definite sign for the presence of a Fermi surface (FS). Indeed, the effect forms the basis of a well-established experimental procedure for accurately measuring FS topology and geometry of metallic systems, with parameters commonly extracted by fitting to the Lifshitz-Kosevich (LK) theory based on Fermi liquid theory. Here we show that, in contrast to this canonical situation, there can be quantum oscillations even for band insulators of certain types. We provide simple analytic formulas describing the temperature dependence of the quantum oscillations in this setting, showing strong deviations from LK theory. We draw connections to recent experiments on the tentative topological Kondo insulator SmB{sub 6}.

  13. Estudio biofarmacéutico de geles antiinflamatorios no esteroideos (AINES

    Directory of Open Access Journals (Sweden)

    Margarita Restrepo

    2000-02-01

    Full Text Available

    Los antiinflamatorios no esteroideos (AINES son un grupo heterogéneo de compuestos con actividad analgésica, antipirética y antiinflamatoria que comparten efectos secundarios indeseables, tales como: ulceración gástrica e intestinal, anemia, bloqueo de la agregación plaquetaria, inhibición de la motilidad uterina e hipersensibilidad. Los AINES se utilizan por vía tópica con el fin de aliviar lesiones en tejidos blandos a los cuales puede llegarse directamente a través de la piel, evitando así los efectos colaterales indeseables.

    Actualmente para la gran mayoría de los medicamentos se exige valorar la Biodisponibilidad como criterio de calidad. Biodisponibilidad se define como la cantidad de fármaco que llega a sangre o plasma después de la administración del medicamento que lo contiene y la velocidad a la cual este proceso ocurre; esta determinación de Biodisponibilidad no resulta útil en el caso de medicamentos que se administran a través de la piel y no alcanzan circulación sistémica; la biodisponibilidad relativa o Bioequivalencia es la comparación de las biodisponibilidades de dos medicamentos para determinar si son similares en su comportamiento farmacocinético dentro del organismo.

    El presente trabajo pretende estandarizar y validar un método que permita determinar concentraciones de fármaco en tejidos, en este tipo de medicamentos administrados por vía tópica, que no alcanzan circulación sistémica y por lo tanto no pueden ser cuantificados en sangre o plasma; además pretendemos que esta metodología pueda ser propuesta como una técnica para determinar biodisponibilidad y/o bioequivalencia para este tipo de productos. Para lograr estos objetivos, inicialmente, se induce la inflamación a un grupo

  14. Eripedagoogid ootavad poliitilisi otsuseid / Plado, Kaja; Karlep, Karl; Ostrat, Ain; Maila, Meelika; Binsol, Hene; Kontor, Ana; küsitlenud Martin Krõlov

    Index Scriptorium Estoniae

    2007-01-01

    Eripedagoogide vestlusringis osalevad: Tartu Ülikooli eripedagoogika osakonna juhataja Kaja Plado, emeriitdotsent pedagoogikadoktor Karl Karlep, Tartu Kroonuaia Kooli direktor Ain Ostrat ja õppealajuhataja Meelike Maila, Tartu Hiie Kooli õppealajuhataja Hene Binsol ning Tartu Nõustamis- ja õpiabi keskuse juhataja Ana Kontor

  15. Fracaso renal agudo secundario a combinación de inhibidores del sistema renina-angiotensina, diuréticos y AINES. “La Triple Whammy”1

    Directory of Open Access Journals (Sweden)

    Rosa Maria Garcia Camin

    2015-03-01

    Conclusiones: El tratamiento con IECA, ARA II, diuréticos y/o AINES presenta elevada incidencia de ingreso por FRA, siendo los diuréticos en monoterapia, doble y triple terapia combinada los que ocasionan la mayor incidencia. El FRAETW supone elevados costes sanitarios y muertes evitables.

  16. Overexploitation and cumulative drought trend effect on Ras El Ain karstic spring discharge (Khabour Sub-basin, Syria)

    Science.gov (United States)

    Abou Zakhem, Boulos; Kattaa, Bassam

    2017-10-01

    The effects of climate change and overexploitation are being strongly perceived in the studied area and the springs discharge is obviously affected. In this paper, Ras El Ain spring discharge and precipitation were analyzed by normalized methods on an yearly timescale. The deficit of Ras El Ain spring discharge due to overexploitation factors and drought effects was estimated. Cumulative drought analyses were carried out using SPI10 and SQI10. Finally, the decreasing trends of the spring discharge due to the deficiency in rainfall were analyzed. The main results reveal that the annual mean deficit of Ras El Ain spring discharge due to overpumping was between 32 and 45%, whereas, annual mean deficit related to drought was between 22 and 35% on average, during the last 30 years (post-1984). The moving averages of SPI and SQI delineate very well the drought periods during last three decades. The cumulative droughts using SPI10 and SQI10 reveal that wet period (pre-1984) with positive values was characterized by high precipitation and spring discharge. Overexploitation period (1984-1989) is distinguished by decreasing SQI10 values whereas, SPI10 is almost stable. The response of the karst system to the precipitation signal has been changed, during the drought period (1990-2000), and the spring behaviour has been modified due to the first overexploitation period. Finally, overexploitation period (2001-2008) is related to the second phase of groundwater intensive pumping for irrigation purposes. Consequently, this period is completely catastrophic causing the drying up of the spring. The decreasing trends analyzed using DPI and DQI showed annual decreasing rates relative to the mean values of -0.268% and -0.105%, respectively. Thus, the results of theoretical model reveal that precipitation will decrease by about DPI = -20.7% and the discharge will decline by about -9.2% by 2050. Consequently, the declining discharge due to climatic variation under natural conditions as

  17. Hepatitis C virus infection and risk factors in health-care workers at Ain Shams University Hospitals, Cairo, Egypt.

    Science.gov (United States)

    Okasha, O; Munier, A; Delarocque-Astagneau, E; El Houssinie, M; Rafik, M; Bassim, H; Hamid, M Abdel; Mohamed, M K; Fontanet, A

    2015-05-19

    The objectives of this study were to document the background prevalence and incidence of HCV infection among HCWs in Ain Shams University Hospitals in Cairo and analyse the risk factors for HCV infection. A cross-sectional survey was conducted in 2008 among 1770 HCWs. Anti-HCV prevalence was age-standardized using the Cairo population. A prospective cohort was followed for a period of 18 months to estimate HCV incidence. The crude anti-HCV prevalence was 8.0% and the age-standardized seroprevalence was 8.1%. Risk factors independently associated with HCV seropositivity were: age, manual worker, history of blood transfusions and history of parenteral anti-schistosomiasis treatment. The estimated incidence of HCV infection was 7.3 per 1000 person-years. HCWs in this setting had a similar high HCV seroprevalence as the general population of greater Cairo.

  18. Haematology and biochemistry values of captive sand cats (Felis margarita in Al Ain Wildlife Park and Resort, United Arab Emirates

    Directory of Open Access Journals (Sweden)

    Stephen Chege

    2013-09-01

    Full Text Available Objective: To investigate the haematology and biochemistry values of apparently healthy captive sand cats kept in Al Ain Wildlife Park and Resort, United Arab Emirates, with a view to establishing baseline values. Methods: Blood was collected from the femoral vein using aseptic techniques, kept in a cool box and sent to laboratory for analysis. The blood was analysed for haematological and biochemical values using veterinary hematology and chemistry analysers (ABX ABC Vet, Horiba ABX SAS ® Montpellier, France. Results: Haematological values were within the normal ranges recorded in domestic cats and there was no statistical difference between values found in males and females. Aspartate aminotransferase values were higher (P0.05 between males and females values. Conclusions: Our results present reference ranges for haematology and biochemistry parameters in captive sand cats. These values will be important for diagnosis of various diseases and monitoring of treatments.

  19. Contribution to the hydrogeological, geochemical and isotopic study of Ain El Beidha and Merguellil (Kairouan plain) aquifers: Implication for the dam-aquifer relationship

    International Nuclear Information System (INIS)

    Ben Ammar, Safouan

    2007-01-01

    In the semiarid central part of Tunisia the water resources are becoming increasingly rare because of the scarcity and irregularity of the precipitation and a steadily growing need for fresh water. This study addresses the use of geochemical and isotopic data to analyze the relationship between the El Haouareb dam and the Ain El Beidha and the Kairouan alluvial plain aquifers systems for durable groundwater management. In the Ain El Beidha basin the hydrogeological and geochemical investigations showed that: - The general direction of the groundwater flow is mainly from the SW to the NE, i.e. towards the hydraulic sill of El Haouareb which allows the connection between the Ain El Beidha basin and the Kairouan plain, - The salinity distribution displays a zonation in apparent relationship with the lithological variation of the aquifer formation, - Mineral exchange between groundwater and the aquifer matrix is the dominant process in determining groundwater salinity. The isotopic data confirm the flow directions of groundwater and shows that the recharge of Ain El Beidha aquifers takes place from the floods of the Khechem and Ben Zitoun wadies and also by preferential infiltration of runoff at the front of hill slopes area. Close to preferential recharge areas, groundwater 3H contents reflect a recent input of surface water, whereas the radiocarbon data indicate a longer residence time downstream. The isotopic characteristics of Ain El Beidha groundwater (small space and temporal changes) authorize the use of averaged values for the dam-aquifer water exchange. Under natural conditions, groundwater recharge of the alluvial aquifer of Kairouan plain occurs by infiltration of the Merguellil floods and from the Ain el Beidha groundwater flow close the karstic hydraulic sills. Since the construction of the El Haouareb dam, these natural mechanisms have been strongly modified: the dam waters infiltrate into the karst, mix with the Ain el Beidha groundwater, and feed the

  20. Shubnikov-de Haas Oscillations of filled skutterudite compounds CeOs4Sb12andNdOs4Sb12

    Science.gov (United States)

    Ho, P.-C.; Singleton, J.; Balakirev, F. F.; Maple, M. B.; Yanagisawa, T.

    2015-03-01

    The filled skutterudite compounds CeOs4Sb12, PrOs4Sb12,andNdOs4Sb12 are respectively a 1 K antiferromagnetic (AFM) Kondo insulator, a 1.85 K unconventional superconductor (SC), and a 1 K mean-field type ferromagnet (FM). Since SC in PrOs4Sb12 exhibits non-BCS properties, it may originate from proximity to AFM and FM quantum-critical points. Therefore, Fermi-surface measurements of NdOs4Sb12andCeOs4Sb12 become crucial in understanding the SC pairing mechanism in PrOs4Sb12. MHz skin-depth measurements of single crystals of CeOs4Sb12andNdOs4Sb12 were performed for temperatures down to 1.3 K and magnetic fields of up to 60 tesla in the Pulsed Field Facility at NHMFL/LANL. Proximity detection oscillator (PDO) data are taken in the 60 tesla generator-driven magnet (~ 1 s) using a rotational probe. Shubnikov-de Haas oscillations were detected for various direction of the magnetic field with respect to the crystalline orientations. The results indicate that NdOs4Sb12 has similar Fermi surfaces to those of PrOs4Sb12andLaOs4Sb12 but that the Fermi surface of CeOs4Sb12 is much different from those of the other three compounds. Research at CSU-Fresno is supported by NSF DMR-1104544; at UCSD by NSF DMR-1206553 and US DOE DE-FG02-04ER46105; at at NHMFL by DOE, NSF, and FL; at Hokkaido U by MEXT, Jpn.

  1. Angle dependence of Shubnikov-de Haas effect of filled skutterudite compounds CeOs4Sb12 and NdOs4Sb12

    Science.gov (United States)

    Ho, P.-C.; Singleton, J.; Balakirev, F. F.; Maple, M. B.; Yanagisawa, T.

    Intriguingly the three filled skutterudite compounds CeOs4Sb12, PrOs4Sb12, and NdOs4Sb12 span the range from the Kondo insulator with a 1K antiferromagnetic (AFM) order, a 1.85K unconventional superconductor (SC), to a 1K mean-field type ferromagnet (FM), indicating that they reside near quantum critical points of AFM and FM with unconventional SC induced within this regime. Therefore, understanding the Fermi surfaces of NdOs4Sb12 and CeOs4Sb12 becomes crucial in elucidating the superconducting pairing mechanism in PrOs4Sb12. Penetration depths of single crystals of CeOs4Sb12 and NdOs4Sb12 were measured for temperatures down to 1.3 K and magnetic fields up to 60 tesla by using proximity detection oscillators in the Pulsed Field Facility at NHMFL/LANL. Angle dependence of Shubnikov-de Haas oscillations was detected for rotating the field with respect to the crystalline orientations [010] and [0-10]. The results indicate that LaOs4Sb12, PrOs4Sb12 and NdOs4Sb12 have similar Fermi surfaces. The Fermi surface of CeOs4Sb12 is rather isotropic and is much different from the other three compounds. Research at CSU-Fresno is supported by NSF DMR-1506677; at UCSD by NSF DMR-1206553 and US DOE DE-FG02-04ER46105; at NHMFL by DOE, NSF, and FL; at Hokkaido U by Graint-In-Aid No. 2600342,Jpn.

  2. Aine või toote ravimina määratlemine Eestis Euroopa Liidu õiguse valguses : [magistritöö] / Kaili Lellep ; Tartu Ülikool, õigusteaduskond ; juhendaja Ants Nõmper

    Index Scriptorium Estoniae

    Lellep, Kaili

    2010-01-01

    Aine või toote määratlemisest toiduna, kosmeetikatootena, meditsiiniseadmena, ravimina. Määratlustest Eestis ja nende vastavusest Euroopa Liidu õigusega, määratluste tagajärgedest, ettepanekutest vastuolulise õigusakti muutmiseks

  3. Use of tritium for estimation of groundwater mean residence time, a case study of the Ain Al-Samak Karst springs (Central Syria)

    International Nuclear Information System (INIS)

    Kattan, Z.

    2003-01-01

    This work is an attempt to estimate the mean residence time of groundwater in the Ain Al-Tanour and Ain-Samak, which are the major karst springs in the Upper Orontes Basin (Central Syria). This estimate, which consists on the application of a mathematical modeling approach, was based on the use of tritium, as a natural radioisotope tracer and a tool for ground water age dating. By adopting a completely mixed reservoir model, linked with exponential time distribution function, the mean residence time (turnover time) of these two springs was evaluated to be about 50 years. This result is in good agreement with previous estimation obtained for the Figeh main spring, which belongs to the same aquifer (Cenomanian-Turonian complex) in the Damascus Basin. On the basis of this evaluation, a value of about 800 million m 3 was obtained for the maximum groundwater reservoir size

  4. Consumption of the total Western diet differentially affects the response to green tea in rodent models of chronic disease compared to the AIN93G diet.

    Science.gov (United States)

    Ward, Robert E; Benninghoff, Abby D; Healy, Brett J; Li, Minghao; Vagu, Bharath; Hintze, Korry J

    2017-04-01

    In pre-clinical studies investigating bioactive components, the efficacy of the bioactive is likely influenced by the basal diet provided to rodents. In this study, we hypothesized that a model bioactive, green tea extract (GTE), would have different effects on colon carcinogenesis, body composition, and lipid metabolism in mice fed a basal diet formulated to promote animal health and growth (AIN93G) as compared to a Western diet that emulates typical American intakes of micro- and macronutrients, the total Western diet (TWD). Mice were fed either AIN93G or TWD, with or without GTE added to drinking water for 18 weeks. Aberrant crypt foci (ACF) in azoxymethane-initiated mice was nearly three times greater in mice fed TWD compared to AIN93G. Consumption of GTE suppressed ACF development only in mice fed the TWD. Similarly, supplementation with GTE suppressed weight gain and fasted glucose only in mice fed TWD, while GTE suppressed fat mass in mice fed either diet. Irrespective of diet, GTE supplementation increased cecum weight and decreased cecal SCFA concentration. Collectively, these observations indicate that the TWD influences the bioactivity of GTE in rodent models of obesity, metabolism, and carcinogenesis. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  5. EXIGENCES TECHNIQUES DANS LA CONSTRUCTION ET REGLEMENTATION : ETUDE D’UN EXEMPLE DE LOGEMENT COLLECTIF A AIN-SMARA (ALGERIE

    Directory of Open Access Journals (Sweden)

    B BENRACHI

    2002-12-01

    Full Text Available La construction d’un édifice de qualité standard et répondant aux exigences techniques est   obtenue grâce au développement du savoir-faire et au respect des règles de l’art et de la réglementation en vigueur.  Une étude détaillée sur les  exigences techniques et le respect de la réglementation  d’un logement en collectif  nouvellement construit et inhabité à Ain-Smara, nous a montré  qu’il y a une satisfaction pour certaines d'entre-elles et une non-conformité pour d’autres. Il en résulte que le degré de satisfaction de ce logement est inférieur à celui recommandé dans le cadre de la réglementation, ce qui diminue sa qualité par rapport au standard exigé.

  6. Meie esimesed naisfotograafid / Annika Haas

    Index Scriptorium Estoniae

    Haas, Annika, 1974-

    2015-01-01

    Eesti naisfotograafid Hilja Riet ja Lydia Tarem. Fotomuuseumi aastanäitus "Varjust välja. Esimesed naisfotograafid Eestis", kus tutvustatakse Hilja Rieti, Lydia Taremi, Anna Kuke ja Evi Lembergi loomingut. Näituse kuraatorid Betty Ester-Väljaots, Merili Reinpalu

  7. Transport properties and giant Shubnikov-de Haas oscillations in the first organic conductor with metal complex anion containing selenocyanate ligand, (ET){sub 2}TlHg(SeCN){sub 4}

    Energy Technology Data Exchange (ETDEWEB)

    Laukhin, V.N. [Service National des Champs Magnetiques Pulses du CNRS et Laboratoire de Physique des Solides, URA CNRS 074, Complexe Scientifique de Rangueil, 31077 Toulouse (France)]|[Institute of Chemical Physics in Chernogolovka, Russian Academy of Sciences, Chernogolovka, MD 142432 (Russian Federation); Audouard, A. [Service National des Champs Magnetiques Pulses du CNRS et Laboratoire de Physique des Solides, URA CNRS 074, Complexe Scientifique de Rangueil, 31077 Toulouse (France); Rakoto, H. [Service National des Champs Magnetiques Pulses du CNRS et Laboratoire de Physique des Solides, URA CNRS 074, Complexe Scientifique de Rangueil, 31077 Toulouse (France); Broto, J.M. [Service National des Champs Magnetiques Pulses du CNRS et Laboratoire de Physique des Solides, URA CNRS 074, Complexe Scientifique de Rangueil, 31077 Toulouse (France); Goze, F. [Service National des Champs Magnetiques Pulses du CNRS et Laboratoire de Physique des Solides, URA CNRS 074, Complexe Scientifique de Rangueil, 31077 Toulouse (France); Coffe, G. [Service National des Champs Magnetiques Pulses du CNRS et Laboratoire de Physique des Solides, URA CNRS 074, Complexe Scientifique de Rangueil, 31077 Toulouse (France); Brossard, L. [Service National des Champs Magnetiques Pulses du CNRS et Laboratoire de Physique des Solides, URA CNRS 074, Complexe Scientifique de Rangueil, 31077 Toulouse (France); Redoules, J.P. [Service National des Champs Magnetiques Pulses du CNRS et Laboratoire de Physique des Solides, URA CNRS 074, Complexe Scientifique de Rangueil, 31077 Toulouse (France); Kartsovnik, M.V. [Institute of Solid State Physics, Russian Academy of Sciences, Chernogolovka, MD 142432 (Russian Federation); Kushch, N.D. [Institute of Chemical Physics in Chernogolovka, Russian Academy of Sciences, Chernogolovka, MD 142432 (Russian Federation); Buravov, L.I.

    1995-05-01

    Temperature dependence of the resistivity in various crystallographic directions and high pulsed field magnetoresistance of organic metal {alpha}-(ET){sub 2}TlHg(SeCN){sub 4} have been studied at temperatures down to 80 mK. Giant Shubnikov-de Haas oscillations, which are attributed to the two-dimensional nature of the cylindrical Fermi surface with a very small warping along the direction of the lowest conductivity have been observed. Four harmonics of the fast oscillations with fundamental frequency F{sub 0}=653{+-}3 T and slow frequency oscillations with F{sub s}=38{+-}5 T have been revealed. (orig.).

  8. The impact of weathering on the uranium-bearing phosphates of Ain Laylon in the Syrian coast, using radon and gamma ray surveys

    International Nuclear Information System (INIS)

    Jubeli, Y.; Al-Hilal, M.; Al-Ali, A.

    1998-06-01

    A combination of several exploration techniques was carried out at the main phosphatic outcrop of Ain Laylon in the Syrian coastal region. The survey was extended along an E-W profile parallel to Wadi Al-Mzeraa over a distance of about 23 km from Ain Laylon site towards the shoreline of the Mediterranean Sea. The techniques used in this survey included soil radon emanometry, gamma ray spectrometry and soil geochemistry, with the purpose of evaluating the effects of weathering and erosion on the uranium-hearing phosphate formations in the study ares. Soil radon concentration and gamma ray total count rates found to be ranging between 115-472 pCi/l and 52-520 cps over the main phosphate deposit of Ain Layton and between 16-241 pCi/l and 15-300 cps along the profile of Wadi Al-Mzeraa - Rwemiyeh respectively. Some suitable elements such as U, Zn, Pb, Cr, Fe and Sr were also analyzed to trace the dispersion pattern of uranium and its controls throughout the area. The results showed that the distribution of both radon emission and gamma ray activity, in accordance with chemical uranium and some associated trace elements, were almost identical over the study area. The anomalously high values in all cases were basically found to be related to the main phosphatic outcrop and to the reprecipitation processes at their vicinity following the alteration of the phosphates. The prevailing topographic conditions of the drainage system has probably played a crucial role in carrying the uraniferous solutions from its phosphatic source down to the nearby sedimentary environment. This appears to be sufficient enough to produce an anomalous halo resulting in the detection of some relatively high radon and gamma values of about 7 and 15 times the background respectively, especially close to the main phosphate outcrop. A notable gradual decrease was then observed at the following sampling sites along the pathway west of Ain Laylon site approaching the background level at a distance of

  9. Time Management and Its Relation To Students’ Stress, Gender and Academic Achievement Among Sample of Students at Al Ain University of Science and Technology, UAE

    OpenAIRE

    Ahmad Saleh Al Khatib

    2014-01-01

    The objective of the present study was to investigate the relationship between time management, perceived stress, gender and academic achievement among United Arab Emirates college students. The respondents were 352 college students from Al Ain University of Science and Technology. The sample was stratified by sex. Among the respondents, 52.5% were female students and 47.5% were male students. The mean age of the sample was 23.4 years ranging from 18 to 39. Time management was measured by Tim...

  10. Analyse des techniques de conservation de l’eau et du sol dans la zone aride cas bassin versant d’AIN SEFRA

    OpenAIRE

    MELALIH, Ahmed

    2011-01-01

    Malgré les lourds investissements que l’état Algérien a consentis pour la protection des bassins versants contre l’érosion hydrique dans les zones arides, les sols continuent de se dégrader. L’étude et l’analyse des techniques de conservation des eaux et du sol s dans la zone aride d’Ain sefra basé essentiellement sur les aménagements mécaniques (seuils en gabion et en pierre sèche et retenus collinaires) et des aménagements biologiques (reboisement, plantation rustique et fixation des ...

  11. Cyclotron resonance and De Haas-Van Alphen effect in (BEDT-TTF) sub 8 Hg sub 4 Cl sub 1 sub 2 (C sub 6 H sub 5 Cl) sub 2 organic conductor

    CERN Document Server

    Voskobojnikov, I B; Samarin, N A; Cluchanko, N E; Lyubovskaya, R N; Moshchalkov, V V

    2002-01-01

    Within 0.33-1.44 K temperature range at B <= 50 T magnetic field values one measured the De Haas-Van Alphen effect for (BEDT-TTF) sub 8 Hg sub 4 Cl sub 1 sub 2 (C sub 6 H sub 5 Cl) sub 2 organic quasi-two-dimensional conductor. Analysis of quantum oscillations with regard to data on cyclotron resonance derived for 40-120 GHz frequency interval enabled to determine that a complex spectrum of quantum oscillations was formed by alpha approx 256 T and beta approx 670-610 T fundamental frequencies as well as, by combination and multiple frequencies. It is shown that nature of temperature rearrangement of oscillation spectrum may be interpreted in terms of model taking account of occurrence of magnetic phase transition at T sub c approx 0.9 K and proximity of a fundamental frequency with m* = 1.48m sub 0 efficient mass to the spin dumping condition

  12. Keelatud ained / Ave Oit

    Index Scriptorium Estoniae

    Oit, Ave

    2012-01-01

    Öko- ja looduskosmeetikas keelatud või piirangutega lubatud koostisainetest: silikoonid, etoksüleeritud emulgaatorained (PEG-ühendid), toorõli baasil valmistatud rasvained ja emulgaatorid s.h mineraalõlid ja -vahad

  13. Turundusteenistus / Ain Kaljurand

    Index Scriptorium Estoniae

    Kaljurand, Ain, 1965-

    2004-01-01

    Ilmunud ka: 2003 : annual report : [Eesti Raudtee]. - Tallinn, 2004, lk. 15-20; 2003 : godovoi ottshjot : [Eesti Raudtee]. - Tallinn, 2004, lk. 15-20. Ülevaade AS-i Eesti Raudtee 2003. a. kaubaveost veomahtude ja kaubagruppide järgi, turundusteenistusest, hinnapoliitikast

  14. Eeslid / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    2003-01-01

    Sisu: Eeslid ; Luuletaja Koghazi ; Elav kuningas ; Neli legendi : Mungasuudlus ; Dorzhiin ; Legend meister Albrechtist ; Aafrika muld. Ballaad kombaini armastusest ; Kuningakatse ; Rapsoodiad : Draakoni talveuni ; Klaassepa poeg. Kaks indiaani metamorfoosi : Roti metamorfoos ; Ahvnaine. Paani surm ; Valgjärve legend ; Katsikõsõ'

  15. Jõekääru Jazz täitis eesmärgi nii korraldajate, esinejate kui publiku poolelt / Allan Liik, Hedvig Hanson, Andre Maaker, Ain Agan...[jt.] ; foto ja küsitl. Kaire Tensuda

    Index Scriptorium Estoniae

    2007-01-01

    Jõekääru Jazz'ile järgneval nädalal tõi ürituse peakorraldaja Allan Liik toimetusse seal esinenud muusikud. Vestlusringis olid: Allan Liik, Hedvig Hanson, Andre Maaker, Ain Agan, Raivo Tafenau ja Sergio Bastos

  16. Toidutööstus panustab detsembris jõulutoodetele. Pühad toovad käibelisa / Ain Alvela, Ketlin Rauk ; kommenteerinud Ruth Roht, Marek Viilol, Simmo Kruustük, Imre Sokk

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2011-01-01

    Spetsiaalsed jõulutooted aitavad aasta lõpul suurendada toiduainetööstuste käivet. ASi Atria Eesti müügi- ja turundusdirektori Margus Masingu, ASi Fazer Eesti juhatuse esimehe Kristjan Kongo ja ASi Salvest turundusdirektori Ain Nõlvaku kommentaare

  17. Narkootilise ja psühhotroopse aine suures koguses ebaseaduslik käitlemine suure varalise kasu saamise eesmärgil : [magistritöö] / Kerli Lepik ; Tartu Ülikool, õigusteaduskond ; juhendaja: Jaan Ginter

    Index Scriptorium Estoniae

    Lepik, Kerli, 1989-

    2013-01-01

    Suures koguses narkootilise ja psühhotroopse aine käsitlemisest, suure varalise kasu saamise eesmärgist, võrdlus teiste Euroopa riikidega (EL, Läti, Leedu, Soome, Norra, Tšehhi), suurest varalisest kasust kui koosseisutunnusest ja alternatiividest

  18. Madame Olga Givernet, Députée de la 3ème circonscription de l’Ain, République française, vendredi 16 février 2018

    CERN Multimedia

    Caraban Gonzalez, Noemi

    2018-01-01

    Madame Olga Givernet Députée 3ème circonscription de l’Ain. Participants CERN, Signature du livre d’or. M. Frédérick Bordry Directeur des accélérateurs et de la technologie Mme Fabiola Gianotti Directrice générale

  19. Evaluation of the impact of water harvesting techniques on the evolution of piezometric head of Ain El Bidha groundwater in Kairouan at the Central part of Tunisia

    Science.gov (United States)

    Mechergui, M. Mohamed; Henda Saoudi, Mme

    2016-04-01

    This study aims to assess the impact of water harvesting constructed hydraulic structures (big and small dams, terraces, seuils for recharge…) on the evolution of piezometric head of Ain El Beidha groundwater table. The measurements of depth of water table, taken at the end of rain season and at the end of irrigation season, in many piezometers and monitoring wells, for a long period of observation before and after implementation of all the hydraulic structures, were used with the cumulative rain to the highest water table to diagnostic the effect of natural recharge and constructed hydraulic structures. According to the analysis of curves illustrating the evolution of piezometric head and rainfall over time, it was shown that despite the fact that the same amount of rain fall on the total area in the limits of Ain El Beidha groundwater table, the piezometers respond differently. This is because there are many sources of recharge and many factors affecting the recharge. First of all, the aquifer is divided in four compartments (the calcareous formation of Djebel El Houyareb, the plio-quaternary formation, the Miocene formation: Baglia and Saouaf). All those respond differently to the recharge by their capacity of infiltration and their hydrodynamic characteristics. The recharge of the groundwater table was increased by the implementation of small soil and water conservation structures, artificial lakes, El Haouareb Dam, run off in the natural Oued bads and seuils for recharge installed in the bads of oueds. The different piezometric drown maps were used to determine the flow direction and hydraulic gradient in order to identify the recharge areas, while tracking maps for three equal piezometric heads 210 m 300 m and 370 m established over different years made it possible to assess the impact of hydraulic structures, namely the effect of SWC and Ben Zitoun Lake. To illustrate the impact of El Houareb dam on the groundwater, the piezometric maps and local values

  20. A specific mutation in the distant sonic hedgehog (SHH) cis-regulator (ZRS) causes Werner mesomelic syndrome (WMS) while complete ZRS duplications underlie Haas type polysyndactyly and preaxial polydactyly (PPD) with or without triphalangeal thumb.

    Science.gov (United States)

    Wieczorek, Dagmar; Pawlik, Barbara; Li, Yun; Akarsu, Nurten A; Caliebe, Almuth; May, Klaus J W; Schweiger, Bernd; Vargas, Fernando R; Balci, Sevim; Gillessen-Kaesbach, Gabriele; Wollnik, Bernd

    2010-01-01

    Werner mesomelic syndrome (WMS) is an autosomal dominant disorder with unknown molecular etiology characterized by hypo- or aplasia of the tibiae in addition to the preaxial polydactyly (PPD) of the hands and feet and/or five-fingered hand with absence of thumbs. We show that point mutations of a specific nucleotide within the sonic hedgehog (SHH) regulatory region (ZRS) cause WMS. In a previously unpublished WMS family, we identified the causative G>A transition at position 404 of the ZRS, and in six affected family members of a second WMS family we found a 404G>C mutation of the ZRS. The 404G>A ZRS mutation is known as the "Cuban mutation" of PPD type II (PPD2). Interestingly, the index patient of that family had tibial hypoplasia as well. These data provide the first evidence that WMS is caused by a specific ZRS mutation, which leads to strong ectopic SHH expression. In contrast, we show that complete duplications of the ZRS region lead to type Haas polysyndactyly or triphalangeal thumb-polysyndactyly syndrome, but do not affect lower limb development. We suggest the term "ZRS-associated syndromes" and a clinical subclassification for the continuum of limb malformations caused by different molecular alterations of the ZRS.

  1. Regulació del metabolisme de l'àcid araquidònic i senyalització cel·lular en un model d'asma i intolerància als AINEs

    OpenAIRE

    García García, Francesc J.

    2013-01-01

    [cat] L'aspirina i els fàrmacs antiinflamatoris no esteroïdals (AINEs ) es troben entre els fàrmacs més utilitzats en el món. En general són ben tolerats per la majoria dels individus, però hi ha una excepció en un subgrup particular de pacients asmàtics. Aquests pacients pateixen asma induïda per aspirina (AIA), una síndrome clínica caracteritzada per atacs d'asma provocats després de la ingestió d'AINEs. A més, aquests pacients sovint pateixen de rinosinusitis crònica acompanyada de poli...

  2. Application of a TiAIN coating for the increase wear resistance of a passage floodgate manufactured in steel T9; Aplicacion de un recubrimiento de TiAIN para el incremento de la resistencia al desgaste de una compuerta de paso fabricada en acero T9

    Energy Technology Data Exchange (ETDEWEB)

    Montes de Oca, J.; Gonzalez, H. J. [Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada, IPN, Unidad Altamira, Km. 14.5 Carretera Tampico-Puerto industrial Altamira, 89600 Altamira, Tamaulipas (Mexico); Solis, E. [Hy-Teck Fluid Power, Blvd. A. Lopez Mateos No. 310, Col. Nuevo Aeropuerto, 89337 Tampico, Tamaulipas (Mexico); Moreno, J. [Departamento de Ingenieria Metalurgica, Escuela Superior de Ingenieria Quimica e Industrias Extractivas, IPN, UPALM Unidad Zacatenco, 07730 Mexico D. F. (Mexico); Munoz S, J. [Centro de Investigacion y de Estudios Avanzados, Unidad Queretaro, Libramiento Norponiente No. 2000, Fracc. Real de Juriquilla, 76230 Santiago de Queretaro, Queretaro (Mexico)], e-mail: jmontedeocav@ipn.mx

    2009-07-01

    The present work reports a study to increase wear resistance of a ball passage floodgate (steel type T9) trough the application of a thick film (coating). This study have included a material and process selection, synthesis of the coating on steel plates as substrates and spherical device, assembling of the coated floodgate on the ball valves, and finally an evaluation of the valves in the process of a thermoelectric power station. Taking into account the different requirements, a TiAIN coating prepared by cathodic arc evaporation was finally retained. The crystal structure, morphology and chemical composition of the coating were evaluated by x-ray diffraction (XRD) and scanning electron microscopy equipped with an energy dispersive spectrometer (SEM-EDS). Finally, mechanical properties such as hardness and Young modulus were determined by nano indentation. (Author)

  3. Women's knowledge, attitude and practice towards menopause and hormone replacement therapy: a facility based study in Al-Ain, United Arab Emirates.

    Science.gov (United States)

    Hamid, Saima; Al-Ghufli, Fatma Rashid; Raeesi, Hanan Ali; Al-Dliufairi, Khawla Mohammed; Al-Dhaheri, Noura Salem; Al-Maskari, Fatma; Blair, Iain; Shah, Syed Mahboob

    2014-01-01

    Hormone replacement therapy (HRT) is an effective treatment for menopausal symptoms like vasomotor symptoms, sleep disturbances, mood alteration, depression, urinary tract infection, vaginal atrophy and increased health risks for osteoporosis, cardiovascular diseases and loss of cognitive function. This study was conducted to determine knowledge, attitude and practice toward menopause among women in UAE. A clinic-based cross-sectional study was carried out among women of age 40 and above. Study subjects were recruited from four Primary Health Care centres in Al Ain city. The participants were administered a questionnaire in Arabic and English, which included 33 items; socio-demographic variables, and questions related to knowledge, attitude and practices regarding menopause and HRT. Out of 177 study subjected selected, 150 (85%) completed the survey. Almost half of the participants (51%) had already experienced menopause. A substantial number of women had poor know knowledge about menopause (67%) and HRT (73%). Sixty percent of women had positive attitude towards menopause. Of the fifty three percent of women with symptoms, 35% of them did not use anything to relieve their symptoms. Knowledge about menopause varied significantly (pmenopause and HRT was found to be statistically significant. Women with reported symptoms that were bothersome had positive attitude towards HRT uptake. The study indicated that there is poor knowledge about menopause and HRT among the participants. Level of knowledge was associated with the level of education. There was a positive attitude towards menopause, with women suffering the most from menopausal symptoms showing positive attitude towards HRT.

  4. [Economic impact of etanercept and adalimumab biosimilars on hospitals scale covered by PharmAlp'Ain, a hospitals grouping of orders for health products].

    Science.gov (United States)

    Berreur, B; Guerin, F; Christophe, B; Limido, G; Paubel, P

    2018-01-01

    To evaluate the economic impact of future prescriptions of etanercept and adalimumab biosimilars at the territorial scale covered by PharmAlp'Ain, a hospitals grouping of orders for health products. Determination of the number and status of patients (naive or in continuation of treatment) from the National Database "Datamart de Consommation Inter-Régimes" of health insurance, concerned by a dispensation in a pharmacy of etanercept or adalimumab in 2015. Calculation of potential savings in case of biosimilar requirements according to 3 hypotheses: 63% (rate observed in a previous study) of initiations are treated with biosimiliaries and the others by princeps (H 1 ); all initiations under biosimilars and continuation therapy with the princeps (H 2 ) or all patients are treated with biosimilars (H 3 ). The annual savings are estimated at 237,000 € with the H 1 hypothesis. In the case of H 2 , the expected savings would be 376,200 € per year. In the case of H 3 , savings for the community could reach almost 1,282,800 € per year. The arrival of biosimilars allows significant savings for medicines market. According to the French recommendations in 2016, the expected savings are between the H 1 and H 2 hypothesis. The rate of penetration of biosimilars depends on many factors such as the involvement of health professionals, patient adherence, or health authority recommendations. Copyright © 2017 Académie Nationale de Pharmacie. Published by Elsevier Masson SAS. All rights reserved.

  5. Time Management and Its Relation To Students’ Stress, Gender and Academic Achievement Among Sample of Students at Al Ain University of Science and Technology, UAE

    Directory of Open Access Journals (Sweden)

    Ahmad Saleh Al Khatib

    2014-05-01

    Full Text Available The objective of the present study was to investigate the relationship between time management, perceived stress, gender and academic achievement among United Arab Emirates college students. The respondents were 352 college students from Al Ain University of Science and Technology. The sample was stratified by sex. Among the respondents, 52.5% were female students and 47.5% were male students. The mean age of the sample was 23.4 years ranging from 18 to 39. Time management was measured by Time Management Questionnaire” developed by Britton and Tesser (1991, while perceived stress was measured by The Perceived Stress Scale developed by Cohen (1985. The findings of the study showed that there was statistically significant negative relationship between time management and perceived stress. Females reported higher time management compared to their males counter mates. Higher time management and lower perceived stress were associated with high levels of academic achievement. However, time management was the most significant predictor of academic achievement accounting for 26 % of the variance while perceived stress accounted for an additional 11.2% of the variance in academic achievement. All three predictors explained 29.4% (R = .543 of total variance. The implications and limitations are reviewed as are the suggestions for future research.   Keywords: Time management, perceived stress, academic achievement, college students.

  6. Jebel Hafit and the Al Ain oases (Eastern Abu Dhabi, United Arab Emirates): an integrative approach of a cultural landscape through the scope of geodiversity

    Science.gov (United States)

    Giusti, Christian; Louchet, André; Beuzen-Waller, Tara; Ragala, Rachid; Pavlopoulos, Kosmas; Fouache, Éric; Cohen, Marianne; Desruelles, Stéphane; Gramond, Delphine

    2015-04-01

    human settlements and occupation, it is possible to characterize a threefold transition: first, the former transition between the pre-Islamic prehistoric societies and the development of Muslim societies; second, the more recent transition between the traditional historical society (farmers) and the contemporary society, characterized by the growth of urbanization, the creation of modern transport infrastructure and the concomitant growth of tourist flows; third, the current transition between the yesterday and tomorrow Al Ain City, due to the transformation of a local town centred on national economics all along the second half of the twentieth century, into an international town more open to the wider world with the management of a possible increased 20 % of tourist flow because of the inscription of Cultural Sites of Al Ain on the UNESCO's World Heritage List. It is not possible to completely ignore the fact that the Jebel Hafit and its foothills are partly crossed by an international boundary. In case of political tensions, this may cause some difficulties for the management of this territory, with contradictory requirements between security, tourism, traditional land use, and scientific research.

  7. Epidemiology of acute poisoning in children presenting to the poisoning treatment center at Ain Shams University in Cairo, Egypt, 2009–2013

    Science.gov (United States)

    Azab, Sonya M. S.; Hirshon, Jon Mark; Hayes, Bryan D.; El-Setouhy, Maged; Smith, Gordon S.; Sakr, Mahmoud Lotfy; Tawfik, Hany; Klein-Schwartz, Wendy

    2016-01-01

    Introduction Pediatric poisonings represent a major and preventable cause of morbidity and mortality throughout the world. Epidemiologic information about poisoning among children in many lower- and middle-income countries is scarce. This study describes the epidemiology of acute poisonings in children presenting to Ain Shams University's Poisoning Treatment Center (ASU-PTC) in Cairo and determines the causative agents and characteristics of acute poisoning in several pediatric age groups. Methods This retrospective study involved acutely poisoned patients, 0 to 18 years of age, who presented to the ASU-PTC between 1/1/2009 and 12/31/2013. Data were extracted from electronic records maintained by the ASU-PTC. Collected data included demographics, substance of exposure, circumstances of the poisoning, patient disposition, and outcome. Results During the 5-year study period, 38,470 patients meeting our criteria were treated by the ASU-PTC; 19,987 (52%) were younger than 6 years of age; 4,196 (11%) were 6 to 12 years; and 14,287 (37%) were >12 years. Unintentional poisoning accounted for 68.5% of the ingestions, though among adolescents 84.1% of ingestions were with self-harm intent. In all age groups, the most frequent causative drugs were non-opioid analgesics, antipyretics, and antirheumatics. The most common nonpharmaceutical agents were corrosives in preschool children and pesticides in adolescents. Most patients had no/minor effects (29,174 [75.8%]); hospitalization rates were highest among adolescents. There were 119 deaths (case fatality rate of 0.3), primarily from pesticide ingestion. Conclusion Poisoning in preschool children is mainly unintentional and commonly due to nonpharmaceutical agents while poisoning in adolescents is mainly intentional (self-harm). Pesticides, mainly organophosphorous compounds and carbamates, were the most frequent agent leading to morbidity and mortality. PMID:26653953

  8. Epidemiology of acute poisoning in children presenting to the poisoning treatment center at Ain Shams University in Cairo, Egypt, 2009-2013.

    Science.gov (United States)

    Azab, Sonya M S; Hirshon, Jon Mark; Hirshon, John Mark; Hayes, Bryan D; El-Setouhy, Maged; Smith, Gordon S; Sakr, Mahmoud Lotfy; Tawfik, Hany; Klein-Schwartz, Wendy

    2016-01-01

    Pediatric poisonings represent a major and preventable cause of morbidity and mortality throughout the world. Epidemiologic information about poisoning among children in many lower- and middle-income countries is scarce. This study describes the epidemiology of acute poisonings in children presenting to Ain Shams University's Poisoning Treatment Center (ASU-PTC) in Cairo and determines the causative agents and characteristics of acute poisoning in several pediatric age groups. This retrospective study involved acutely poisoned patients, 0-18 years of age, who presented to the ASU-PTC between 1 January 2009 and 31 December 2013. Data were extracted from electronic records maintained by the ASU-PTC. Collected data included demographics, substance of exposure, circumstances of the poisoning, patient disposition, and outcome. During the 5-year study period, 38 470 patients meeting our criteria were treated by the ASU-PTC; 19 987 (52%) were younger than 6 years of age; 4196 (11%) were 6-12 years; and 14 287 (37%) were >12 years. Unintentional poisoning accounted for 68.5% of the ingestions, though among adolescents 84.1% of ingestions were with self-harm intent. In all age groups, the most frequent causative drugs were non-opioid analgesics, antipyretics, and antirheumatics. The most common nonpharmaceutical agents were corrosives in preschool children and pesticides in adolescents. Most patients had no/minor effects (29 174 [75.8%]); hospitalization rates were highest among adolescents. There were 119 deaths (case fatality rate of 0.3), primarily from pesticide ingestion. Poisoning in preschool children is mainly unintentional and commonly due to nonpharmaceutical agents whereas poisoning in adolescents is mainly intentional (self-harm). Pesticides, mainly organophosphorous compounds and carbamates, were the most frequent agents leading to morbidity and mortality.

  9. Engagine me, engaging you ....Ah Haa

    OpenAIRE

    Rooke, S; Brooke, C; Crossley, V

    2017-01-01

    As a non-traditional research office, we have been heavily involved in dissemination activity and, increasingly, rather than just academic staff who are already interested in the outcome of research projects, this means attempting to engage, involve and inspire the public. Public engagement involves a range of approaches that universities or research institutes can take to involve the public with their work. An important part of any public engagement work is to think about the people you want...

  10. Seltskond : [fotod] / tekst ja fotod Annika Haas

    Index Scriptorium Estoniae

    2008-01-01

    29. mail tutvustasid autorid oma lasteraamatuid Eesti Lastekirjanduse Keskuses: Kass, Kristiina. Petra lood. [Tallinn] : Tänapäev, 2008 ; Vainola, Kätlin. Mia, Konrad ja avanevad uksed : [jutustus] / pildid joonistanud Toomas Pääsuke. [Tallinn] : Tänapäev, 2008 ; Saarna, Meelike. Mattias ja mamma. [Tallinn] : Tänapäev, 2008

  11. Fantaasia killapeod : [rets.] / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    1997-01-01

    Ilm.: Looming 1968, nr. 10, lk. 1592-1595 . Rets. rmt.: Alliksaar, Artur. Nimetu saar. Tallinn : Perioodika, 1966. 80 lk. (Loomingu Raamatukogu; 1966, 7); Alliksaar, Artur. Olematus võiks ju ka olemata olla. Tallinn ; Perioodika, 1968. 80 lk. (Loomingu Raamatukogu; 1968, 9/10).

  12. Consent ain't anything

    DEFF Research Database (Denmark)

    Di Nucci, Ezio

    2016-01-01

    I argue against various versions of the 'attitude' view of consent and of the 'action' view of consent: I show that neither an attitude nor an action is either necessary or sufficient for consent. I then put forward a different view of consent based on the idea that, given a legitimate epistemic ...

  13. Endasse kapseldunud aine / Edgar Krull

    Index Scriptorium Estoniae

    Krull, Edgar, 1948-

    2002-01-01

    IEA (International Association for Evaluation of Educational Achievement = Rahvusvaheline Assotsiatsioon Haridussaavutuste Hindamiseks) kodanikuõpetuse uurimusest 28 riigis. Kodanikuõpetuse teadmiste, sellest arusaamise tasemest Euroopas, postsotsialistlikes riikides, Eestis

  14. Eesti luuletaja päris oma prantsuse luuleraamat. August Sanga, Jaan Krossi ja Ain Kaalepi loomingust 1960. aastail / An Estonian Poet’s Own Book of French Poetry. About the Works of August Sang, Jaan Kross and Ain Kaalep in the 1960s

    Directory of Open Access Journals (Sweden)

    Katre Talviste

    2013-12-01

    Full Text Available This article positions the translations of French verse works (plays and selected collections of individual poets that August Sang, Jaan Kross and Ain Kaalep made in the 1960s, onto the background of their own original works. At that time, August Sang translated four plays by Molière (The Misanthrope, Tartuffe, The School for Wives in 1961; Amphitryon in 1961, which have already been discussed in relation to the tradition of translating the French syllabic verse into Estonian, because these translations form a considerable part of the body of Estonian translations of French verse poetry. For Jaan Kross and Ain Kaalep, the wider context is created by the so-called free verse battles in the 1950s, to which we can link Kross’ translation of a selected collection of Éluard (Veel enne kostma peab, 1969 and Kaalep’s translation of a selected collection of Prévert (Kuidas portreteerida lindu, 1965. One of the two remaining translations by Kross, (Rostand’s Cyrano de Bergerac, 1964, can also be examined in relation to the problems of translating verse, but the other, (Béranger’s Laulud, 1963, should be discussed in the framework of intellectual and cultural resistance, a part of which was also the struggle put up for the existence of free verse in the 1950s and 1960s. Of August Sang’s original work, the article examines his collection of poems Võileib suudlusega (1963, written simultaneously with his translations of Molière’s plays and published right after them. Both the translations and the collection of original poems have attracted critics’ attention with their remarkable lack of linguistic constraint and simplicity. Although Sang has rarely voiced theoretical ideas about translation or explained his method, both his poetic image, outlined in the collection Võileib suudlusega, and his search for right words, reflected in the drafts of his translations, let us believe that the simplicity of expression and the avoidance of marked

  15. APPORT DES S.I.G. DANS LA CARACTERISATION HYDRODYNAMIQUE ET HYDROCHIMIQUE DE LA NAPPE DU CRETACE INFERIEUR DE LA REGION D'AIN-SEFRA (ATLAS SAHARIEN OCCIDENTAL —ALGERIE—)

    OpenAIRE

    Abderrahmane, RAHMANI

    2014-01-01

    RESUME L'étude a porté sur la reconnaissance des eaux souterraines de la nappe des grés du Crétacé inférieur, principale ressource de l'alimentation en eau potable et l'irrigation de la région d'Ain Sefra. Les débits des forages d'une profondeur allant de 150 m à 250 m, varie entre 05 l/s et 851/s. Des analyses physico-chimiques effectuées à travers les forages, puits et sources captant les grés du Crétacé inférieur de la région, ont permis d'identifier des faciès chimiques ...

  16. Syntheses, structural variants and characterization of AInM′S4 (A=alkali metals, Tl; M′ = Ge, Sn) compounds; facile ion-exchange reactions of layered NaInSnS4 and KInSnS4 compounds

    International Nuclear Information System (INIS)

    Yohannan, Jinu P.; Vidyasagar, Kanamaluru

    2016-01-01

    Ten AInM′S 4 (A=alkali metals, Tl; M′= Ge, Sn) compounds with diverse structure types have been synthesized and characterized by single crystal and powder X-ray diffraction and a variety of spectroscopic methods. They are wide band gap semiconductors. KInGeS 4 (1-β), RbInGeS 4 (2), CsInGeS 4 (3-β), TlInGeS 4 (4-β), RbInSnS 4 (8-β) and CsInSnS 4 (9) compounds with three-dimensional BaGa 2 S 4 structure and CsInGeS 4 (3-α) and TlInGeS 4 (4-α) compounds with a layered TlInSiS 4 structure have tetrahedral [InM′S 4 ] − frameworks. On the other hand, LiInSnS 4 (5) with spinel structure and NaInSnS 4 (6), KInSnS 4 (7), RbInSnS 4 (8-α) and TlInSnS 4 (10) compounds with layered structure have octahedral [InM′S 4 ] − frameworks. NaInSnS 4 (6) and KInSnS 4 (7) compounds undergo facile topotactic ion-exchange, at room temperature, with various mono-, di- and tri-valent cations in aqueous medium to give rise to metastable layered phases. - Graphical abstract: NaInSnS 4 and KInSnS 4 compounds undergo, in aqueous medium at room temperature, facile topotactic ion-exchange with mono, di and trivalent cations. Display Omitted - Highlights: • Ten AInM′S 4 compounds with diverse structure types were synthesized. • They are wide band gap semiconductors. • NaInSnS 4 and KInSnS 4 compounds undergo facile topotactic ion-exchange at room temperature.

  17. The first evidence of cut marks and usewear traces from the Plio-Pleistocene locality of El-Kherba (Ain Hanech), Algeria: implications for early hominin subsistence activities circa 1.8 Ma.

    Science.gov (United States)

    Sahnouni, Mohamed; Rosell, Jordi; van der Made, Jan; Vergès, Josep María; Ollé, Andreu; Kandi, Nadia; Harichane, Zoheir; Derradji, Abdelkader; Medig, Mohamed

    2013-02-01

    The current archaeological data on early hominin subsistence activities in Africa are derived chiefly from Sub-Saharan Plio-Pleistocene sites. The recent studies at El-Kherba (Ain Hanech) in northeastern Algeria expand the geographic range of evidence of hominin subsistence patterns to include the earliest known archaeological sites documented in North Africa. Dated to 1.78 million years ago (Ma), excavations from El-Kherba yielded an Oldowan industry associated with a savanna-like fauna contained in floodplain deposits. The faunal assemblage is dominated by large and medium-sized animals (mainly adults), especially equids, which are represented by at least 11 individuals. The mammalian archaeofauna preserves numerous cut-marked and hammerstone-percussed bones. Made of primarily limestone and flint, the stone assemblage consists of core forms, débitage, and retouched pieces. Evidence of usewear traces is found on several of the flint artifacts, indicating meat processing by early hominins. Overall, our subsistence analysis indicates that early hominins were largely responsible for bone modification at the site, which is also corroborated by other relevant taphonomic evidence. Moreover, at 1.78 Ma, the cutmarked bones recovered from El-Kherba represent the earliest known evidence for ancestral hominin butchery activities and large animal foraging capabilities in northern Africa. Copyright © 2012 Elsevier Ltd. All rights reserved.

  18. Concilier développement agricole et usage pérenne des eaux souterraines : un dialogue multi-acteurs dans la zone d’Ain Timguenay (province de Séfrou

    Directory of Open Access Journals (Sweden)

    Issam Sellika

    2016-10-01

    Full Text Available Au Maroc, l’utilisation des eaux souterraines pour l’irrigation a permis un développement agricole rapide dans de nombreuses régions, mais a aussi fait émerger des situations de baisse des niveaux piezométriques des nappes qui menacent la durabilité de cette agriculture irriguée. L’article présente une action de recherche portant sur la conception d’un projet de territoire agricole durable alliant développement agricole et usage pérenne des ressources en eau souterraine. L’étude a eu lieu dans la zone d’Ain Timguenay (province de Séfrou, qui connait un fort développement de la production de pommes et de prunes depuis une quinzaine d’années. Le programme de recherche a impliqué les agriculteurs, la commune rurale d’Ain Timguenay, les institutions du Ministère de l’Agriculture et l’Agence de bassin hydraulique du Sébou. Une analyse des dynamiques agricoles locales et des tendances nationales a servi de support aux discussions. L’étude de l’aquifère et de ses usages a permis d’établir un bilan sommaire et un ordre de grandeur des surfaces qui pourraient encore être plantées sans que les consommations en eau soient supérieures à la recharge de l’aquifère en année pluviométrique moyenne. Une réflexion prospective menée avec les agriculteurs a mis en évidence deux scénarios possibles à l’échelle locale: 1 un scénario où les difficultés économiques que rencontrent actuellement les exploitations de la zone se renforcent, conduisant à un ralentissement des nouvelles plantations, d’où une pression limitée sur la nappe ; 2 un scénario où les exploitations réussissent à faire face aux défis actuels de production et de commercialisation et de ce fait continuent à planter, ce qui conduit à une consommation en eau bien supérieure à la recharge de la nappe. L’ensemble des acteurs impliqués a participé à l’élaboration d’un troisième scénario permettant de concilier d

  19. USA kiidetud noise-rock Eestis / Annika Haas

    Index Scriptorium Estoniae

    Haas, Annika

    2008-01-01

    Müra-rock'i viljelevast USA duost Magik Markers (ansambel osaleb režissöör Veiko Õunapuu uue mängufilmi "Püha Tõnu kiusamine" võtetel ja annab kaks kontserti - 13. nov. Tallinnas klubis Tapper ja 15. nov. Tartus klubis Trehv)

  20. Miks on kutseharidus oluline / Ain Karjus

    Index Scriptorium Estoniae

    Karjus, Ain

    2006-01-01

    Kiire majanduskasvu jätkumise üheks oluliseks eelduseks on eelkõige kõrge produktiivsusega töö, milline nõuab inimestelt üheaegselt nii häid teoreetilisi teadmisi kui ka praktilisi oskusi, väidab autor

  1. Investorid on dilemma ees / Ain Kivisaar

    Index Scriptorium Estoniae

    Kivisaar, Ain, 1978-

    2007-01-01

    Keskmise kuupalga eest ei saa enam ruutmeetritki elamispinda ei meil ega mujal. Aktiivsel investoril pole muud teha, kui heita kõrvale tavatarkus ja usaldada enda sisetunnet. Diagramm: Keskmise kuupalga ja korteri ruutmeetri hinna suhe

  2. Makita kalmistu antropoloogiline aines / Luule Heapost

    Index Scriptorium Estoniae

    Heapost, Luule

    1993-01-01

    Tabel : Makita koljude keskmised mõõtmed ; Tabel : 13.-15. sajandi Makita koljud ja võrdlusmaterjalid Eestist ; Tabel 3 : 13. -15. sajandi Makita koljud ning võrdlusandmeid soome-ugri hõimude asualadelt ; Tabel 4 : 15.- 17. sajandi Makita koljud ja võrdlusandmed ; Tabel 5 : Makita koljude võrdlusandmed (Pernose'i meetodil) ; Tabel 6 : Makita luustike pikkade luude keskmine pikkus ; Tabel 7 : Kehapikkuse võrdlusandmed

  3. Lahesõjas viik / Ain Hinsberg

    Index Scriptorium Estoniae

    Hinsberg, Ain

    2001-01-01

    Helsingi ja Tallinna vahel liikuvate laevafirmade konkurents: Silja Line, Nordic Jet Line, Tallink ja Linda Line. Tabelid: reisijad laevaliinil Helsingi-Tallinn 1998-2001; Helsingi-Tallinna liinil kiirlaevade turuosad 1999-2000

  4. Norma Maja astub kindlalt tulevikku / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2000-01-01

    AS Norma Maja saavutas kõrged kasumi ja kasumi kasvu näitajad töötajate koondamisega. Tabel: Norma Maja valdused, AS Norma Maja areng, AS ETK Majad areng. Arvamused: Ero Toom, Ivar Lahi ja Rein Loo

  5. Euroopa abiraha igatseb taotlejaid / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2008-01-01

    Aastatel 2007-2013 saab Eesti Euroopa Liidult toetusi 78 miljardit krooni, millele toetudes on võimalik rasked ajad üle elada. Vt. samas: Tuhahoidlast asula jäätmepunktini; Suurima toetuse saab keskkond. Kommenteerivad Antti Tooming ja Kai Niels Willadsen

  6. Globaalsus + lennundus = Star Alliance? / Ain Hinsberg

    Index Scriptorium Estoniae

    Hinsberg, Ain

    2002-01-01

    Erinevad koostöövormid lennufirmade vahel, alliansside teke ja areng maailmas. Maailma juhtivad lennundusalliansid ja nende poolt kaetud riigid ja sihtkohad. Kommenteerib Estonian Airi president Erki Urva

  7. Syntheses, structural variants and characterization of AInM′S{sub 4} (A=alkali metals, Tl; M′ = Ge, Sn) compounds; facile ion-exchange reactions of layered NaInSnS{sub 4} and KInSnS{sub 4} compounds

    Energy Technology Data Exchange (ETDEWEB)

    Yohannan, Jinu P.; Vidyasagar, Kanamaluru, E-mail: kvsagar@iitm.ac.in

    2016-06-15

    Ten AInM′S{sub 4} (A=alkali metals, Tl; M′= Ge, Sn) compounds with diverse structure types have been synthesized and characterized by single crystal and powder X-ray diffraction and a variety of spectroscopic methods. They are wide band gap semiconductors. KInGeS{sub 4}(1-β), RbInGeS{sub 4}(2), CsInGeS{sub 4}(3-β), TlInGeS{sub 4}(4-β), RbInSnS{sub 4}(8-β) and CsInSnS{sub 4}(9) compounds with three-dimensional BaGa{sub 2}S{sub 4} structure and CsInGeS{sub 4}(3-α) and TlInGeS{sub 4}(4-α) compounds with a layered TlInSiS{sub 4} structure have tetrahedral [InM′S{sub 4}]{sup −} frameworks. On the other hand, LiInSnS{sub 4}(5) with spinel structure and NaInSnS{sub 4}(6), KInSnS{sub 4}(7), RbInSnS{sub 4}(8-α) and TlInSnS{sub 4}(10) compounds with layered structure have octahedral [InM′S{sub 4}]{sup −} frameworks. NaInSnS{sub 4}(6) and KInSnS{sub 4}(7) compounds undergo facile topotactic ion-exchange, at room temperature, with various mono-, di- and tri-valent cations in aqueous medium to give rise to metastable layered phases. - Graphical abstract: NaInSnS{sub 4} and KInSnS{sub 4} compounds undergo, in aqueous medium at room temperature, facile topotactic ion-exchange with mono, di and trivalent cations. Display Omitted - Highlights: • Ten AInM′S{sub 4} compounds with diverse structure types were synthesized. • They are wide band gap semiconductors. • NaInSnS{sub 4} and KInSnS{sub 4} compounds undergo facile topotactic ion-exchange at room temperature.

  8. EFFETS D’UN ALIMENT EXTRUDE SUR LES PERFORMANCES DE CROISSANCE DE LA TRUITE ARC-EN-CIEL (ONCORHYNCHUS MYKISS WALBAUM, 1792 ET SUR LA QUALITE DE L’EAU DE L’OUED OUM ER-RBIA (STATION AIN AGHBAL, AZROU-MAROC

    Directory of Open Access Journals (Sweden)

    Khadija OUAISSA

    2017-05-01

    Full Text Available The objective of our study is to test the efficacy of an extruded food on the growth performance of rainbow trout (Oncorhynchus mykiss Walbaum, 1792 at the fish farm Ain Aghbal in Azrou (Morocco. Generally, only the biochemical composition (percentages of moisture, proteins, lipids and carbohydrates and the (digestible and crude energies of the food are previously known, which is insufficient for the choice of the food in terms of growth performance and quality/environment. The rainbow trout breeding tanks used for this test are 222 days (15 June 2015 - 28 February 2016 are fed with water directly taken from the water of the Oum Er-Rbia sources according to an open circuit with a Renewal of water every half hour. The flow rate is 11.04m3/h. The initial breeding conditions, the density (Kg per volume 1.58kg/m3 and the initial charge with respect to the flow rate is 1.05 m3 / h. Fish are fed by ratios two to three times per day depending on the rearing stage. The frequency of sampling is biweekly where we measured the zootechnical performances of the fish and taken water samples for physicochemical analyzes in order to assess the quality of the waters of exit of the basins before their rejection in the Oum-Er-Rbia river. The results show that the test food shows a better growth of the rainbow trout and a conversion index not exceeding 0.9 for a size of 1043 g of trout.

  9. Poliitiline areng / Vello Pettai, Daunis Auers, Aine Ramonaite

    Index Scriptorium Estoniae

    Pettai, Vello, 1968-

    2011-01-01

    Ülevaade demokraatlikust arengust Baltimaades - valitsuste stabiilsus, parlamendi usaldatavus, valimised, erakonnad, kodanikuühiskonna areng, poliitika läbipaistvus, huvi poliitika vastu ühiskonnas. Tabelid, joonised

  10. Political development / Vello Pettai, Daunis Auers, Aine Ramonaite

    Index Scriptorium Estoniae

    Pettai, Vello, 1968-

    2011-01-01

    Ülevaade demokraatlikust arengust Baltimaades - valitsuste stabiilsus, parlamendi usaldatavus, valimised, erakonnad, kodanikuühiskonna areng, poliitika läbipaistvus, huvi poliitika vastu ühiskonnas. Tabelid, joonised

  11. Kibuvits üllatab ja pakub leevendust / Ain Raal

    Index Scriptorium Estoniae

    Raal, Ain, 1961-

    2005-01-01

    Taani teadlased avastasid-eraldasid kibuvitsaseemnetest ja viljakestadest uue põletikuvastase toimeaine galaktolipiidi (GOPO). Seda lipiidi sisaldub kõige enam koer-kibuvitsa alamliigis Hyben Vital Litos. Nüüdseks on GOPO saamisviis ja nimi patenteeritud nii Euroopas kui ka USAs

  12. Natura 2000 sai tuule tiibadesse Raplamaal / Ain Aivela

    Index Scriptorium Estoniae

    Aivela, Ain

    2004-01-01

    Natura 2000 idee jõudis Eestisse 2000. aastal, mil pilootprojekti raames ning Taani riigi rahalisel toel alustati Natura-võrgustiku eelvalikualade mahamärkimist Lääne- ja Raplamaal. Kommenteerinud Aleksei Lotman

  13. Overexploitation and cumulative drought trend effect on Ras El Ain ...

    Indian Academy of Sciences (India)

    Boulos Abou Zakhem

    2017-10-06

    Oct 6, 2017 ... UNDP-FAO 1966 Etudes des Ressources en Eaux Souter- raines (République Arabe Syrienne); Rapport Final,. FAO/SF: 17/SYR, p. 267. UN-ESCWA and BGR 2013 (United Nations Economic and Social Commission for Western Asia; Bundesanstalt für Geowissenschaften und Rohstoffe) 2013 Inventory of.

  14. Saaremaa taotleb LIFE programmist 50 miljonit krooni / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2001-01-01

    Vilsandi Rahvuspark ja Pärandkoosluste Kaitse Ühing esitasid EL Komisjonile LIFE programmi raames projektitaotlused. Ajalehe küsimustele vastab Vilsandi rahvuspargi kaitsekorralduskava spetsialist Enn Kaljo

  15. Toodangu maht sõltub impordist / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2002-01-01

    Saematerjali tootjate TOP 30. Käibe TOP 10. Käibe kasvu TOP 10. Kasumi TOP 10. Kasumi kasvu TOP 10. Rentaabluse TOP 10. Varade tootlikkuse TOP 10. Kahjumi TOP 5. Saematerjali tootjate finantsnäitajad. Saematerjali tootjate üldandmed. Tabelid

  16. Tuuleenergia kasutamisvõimalused Eestis / Ain Kull, Valdur Tiit

    Index Scriptorium Estoniae

    Kull, Ain, 1973-

    2005-01-01

    Autorite hinnangul on seni Eestis ulatuslik tuulejõu kasutamine raskendatud nii finantsprobleemide, kodumaise tootmise puudumise, rannikupiirkondade elektriliinide väikese võimsuse kui ka Narva põlevkivijaamade alakoormatuse tõttu. Tabel

  17. Jõupaberi tootmine tagab Kehra vabriku kasumi / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2015-01-01

    Kehra paberivabrik on kodumaa metsaomaniku jaoks oluline okaspuu paberipuidu tarnija, kasutades umbes viiendiku sellise sortimendi aastasest raiemahust. Vabriku toodangust lõviosa moodustab pakendipaber. Selle tootmine tagab ka kasumi

  18. Lubatakse raha, higi ja hambaravi / Maris Jesse, Ain Aaviksoo

    Index Scriptorium Estoniae

    Jesse, Maris

    2007-01-01

    Ilmunud ka: Infopress 2. märts nr. 9 lk. 161. Autorid analüüsivad erakondade valimislubadusi tervishoiu valdkonnas. Nad jõuavad seisukohale, et kuna ükski partei terviknägemust ei paku, sõltub tervishoiu tulevik ennekõike ametnike tarkusest, tulevase sotsiaalministri poliitilisest kogemusest ja valitsusenamuse otsustustahtest

  19. Meie esimese luuletõlke-antoloogia puhul : [rets.] / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    1997-01-01

    Ilm.: Kirjandus kriitiku pilguga : artikleid, arvustusi ja aastaülevaateid 1975-1976. Tallinn : Eesti Raamat, 1978, lk. 25-31 ; Keel ja Kirjandus 1975, nr. 5, lk. 309-311 . Rets. rmt.: Sang, August. Laenatud laulud I: luuletõlkeid. Tallinn : Eesti Raamat, 1973. 336 lk.; Sang, August. Laenatud laulud II: luuletõlkeid. Tallinn : Eesti Raamat, 1974. 392 lk.

  20. Terve mõistusega ahnuse vastu / Ain Aaviksoo

    Index Scriptorium Estoniae

    Aaviksoo, Ain, 1974-

    2005-01-01

    Dokumentaalfilm "Ülisuur mina" ("Super Size Me") : režissöör Morgan Spurlock : Ameerika Ühendriigid 2004. Turumajandusest, dieedist ja toitumisest, filmi hoiatavast osast eelkõige teistmelistele ja nende kasvatajatele

  1. PEPTIC ULCER FREQUENCY DIFFERENCES RELATED TO H. PYLORI OR AINES

    Directory of Open Access Journals (Sweden)

    Diego Michelon de CARLI

    Full Text Available Background Peptic ulcer etiology has been changing because of H. pylori decline. Objectives To estimate peptic ulcer prevalence in 10 years-interval and compare the association with H. pylori and use of non-steroidal anti-inflammatory drugs. Methods Records assessment in two periods: A (1997-2000 and B (2007-2010, searching for peptic ulcer, H. pylori infection and non-steroidal anti-inflammatory drugs use. Results Peptic ulcer occurred in 30.35% in A and in 20.19% in B. H. pylori infection occurred in 73.3% cases in A and in 46.4% in B. Non-steroidal anti-inflammatory drugs use was 3.5% in A and 13.3% in B. Neither condition occurred in 10.4% and 20.5% in A and B respectively. Comparing both periods, we observed reduction of peptic ulcer associated to H. pylori (P=0.000, increase of peptic ulcer related to non-steroidal anti-inflammatory drugs (P=0.000 and idiopathic peptic ulcer (P=0.002. The concurrent association of H. pylori and non-steroidal anti-inflammatory drugs was also higher in B (P=0.002. Rates of gastric ulcer were higher and duodenal ulcer lower in the second period. Conclusions After 10 years, the prevalence of peptic ulcer decreased, as well as ulcers related to H. pylori whereas ulcers associated to non-steroidal anti-inflammatory drugs increased. There was an inversion in the pattern of gastric and duodenal ulcer and a rise of idiopathic peptic ulcer.

  2. Peptic ulcer frequency differences related to h. Pylori or aines.

    Science.gov (United States)

    Carli, Diego Michelon de; Pires, Rafael Cardoso; Rohde, Sofia Laura; Kavalco, Caroline Mayara; Fagundes, Renato Borges

    2015-01-01

    Peptic ulcer etiology has been changing because of H. pylori decline. To estimate peptic ulcer prevalence in 10 years-interval and compare the association with H. pylori and use of non-steroidal anti-inflammatory drugs. Methods Records assessment in two periods: A (1997-2000) and B (2007-2010), searching for peptic ulcer, H. pylori infection and non-steroidal anti-inflammatory drugs use. Peptic ulcer occurred in 30.35% in A and in 20.19% in B. H. pylori infection occurred in 73.3% cases in A and in 46.4% in B. Non-steroidal anti-inflammatory drugs use was 3.5% in A and 13.3% in B. Neither condition occurred in 10.4% and 20.5% in A and B respectively. Comparing both periods, we observed reduction of peptic ulcer associated to H. pylori (P=0.000), increase of peptic ulcer related to non-steroidal anti-inflammatory drugs (P=0.000) and idiopathic peptic ulcer (P=0.002). The concurrent association of H. pylori and non-steroidal anti-inflammatory drugs was also higher in B (P=0.002). Rates of gastric ulcer were higher and duodenal ulcer lower in the second period. After 10 years, the prevalence of peptic ulcer decreased, as well as ulcers related to H. pylori whereas ulcers associated to non-steroidal anti-inflammatory drugs increased. There was an inversion in the pattern of gastric and duodenal ulcer and a rise of idiopathic peptic ulcer.

  3. Võib ja saab ka nii / Ariane Ain, Luule Niinesalu

    Index Scriptorium Estoniae

    Ain, Ariane

    2002-01-01

    11.-14. veebr.̀2002 toimus Audentese Erakoolis aktiivõppenädal 1.-7. kl. õpilastele ja õpetajatele. Sel nädalal ei toimunud ainetunde. Erinevate tegevuste ja õppemeetodite kaudu pakuti õpilastele uusi teadmisi, kogemusi ja elamusi

  4. Advokaadi kutse-eetika reason d’etre / Ain Alvin

    Index Scriptorium Estoniae

    Alvin, Ain, 1959-

    2014-01-01

    Advokaadi kohustus on kutsetegevuses järgida lisaks seadusele kutse-eetika nõudeid, häid kombeid ja südametunnistust. Mida sellised kohustused sisuliselt tähendavad, millest tuleneb vajadus kutse-eetika kutseühendusesisese reguleerimise järele ja milline on kutse-eetika normide sisu?

  5. Bassilaulja Ain Anger lummas Viini publiku / Talvi Nurgamaa

    Index Scriptorium Estoniae

    Nurgamaa, Talvi

    2008-01-01

    1. aprillil Musikvereini klaassaalis Viinis toimunud laulja soolokontserdist sarjast "Lied. Bühne", klaveril Jendrik Springer. Samal ajal kudses saalis toimunud Tonkünstler Orchester kontserdist, dirigent Kristjan Järvi

  6. Department of Pediatrics, Faculty of Medicine, Ain Shams University ...

    African Journals Online (AJOL)

    Egyptian Journal of Pediatric Allergy and Immunology (The). Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 1, No 2 (2003) >. Log in or Register to get access to full text downloads.

  7. Kevadelaul : [luuletused] / Federico Garcia Lorca ; tlk. Ain Kaalep

    Index Scriptorium Estoniae

    García Lorca, Federico, 1898-1936

    2006-01-01

    Sisu: Kevadelaul ; Uued laulud ; Unenägu ; Uus süda ; Rõske siseõu ; Risttee : "Oh valu: mu värsid võtnud..." ; Ballaad mereveest ; Huile ; Vaikus ; Risttee : "Tuul puhub läänest..." ; Sevilla ; Kuus keelt ; Memento ; Kolm linna : Malaguena ; Cordoba agul ; Tants ; Kitarrimõistatus ; Poolkuu ; Neli kollast ballaadi ; Aadam ; Tasakaal ; Friis ; Maha raiuti kolm puud ; Teokarp ; Rumal laul ; Õhtu ; Ratsaniku laul ; Debussy ; Kuu tõuseb ; Kaks õhtust kuud ; Serenaad ; Laul lahkuvast päevast ; Kuuba neegrilaul ; Itk Ignacio Sanchez Mejiase surma puhul ; Madrigal Santiago linnale ; Hällilaul surnud Rosalia Castrole ; Kuu tants Santiagos ; Gaseel kohutavast lähedusest ; Gaseel tumedast surmast ; Gaseel põgenemisest ; Gaseel saja-aastasest armastusest ; Kassiida okstest ; Kassiida selili lebavast naisest ; Kassiida unenäost vabas õhus ; Kassiida tumedaist tuvidest ; Vee süit ; Herbaariumid ; Omega ; Ood Salvador Dalile ; "Ma kardan, kas su imet ma ei kaota..." . Eluloolisi andmeid autori kohta lk. 879

  8. Puti povõshenija effektivnosti proizvodstva / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2008-01-01

    Kulude kokkuhoid aitab saavutada kõrgemat tootlikkust. Vt. samas: Indeks rosta proizvoditelnosti za period 2000-2007gg., %. Kommenteerivad: Aleksandr Miina, Ants Pak, Kaul Aulasmägi, Veljo Haube ja Kuido Kuntro

  9. The cytometric future: it ain't necessarily flow!

    Science.gov (United States)

    Shapiro, Howard M

    2011-01-01

    Initial approaches to cytometry for classifying and characterizing cells were based on microscopy; it was necessary to collect relatively high-resolution images of cells because only a few specific reagents usable for cell identification were available. Although flow cytometry, now the dominant cytometric technology, typically utilizes lenses similar to microscope lenses for light collection, improved, more quantitative reagents allow the necessary information to be acquired in the form of whole-cell measurements of the intensities of light transmission, scattering, and/or fluorescence.Much of the cost and complexity of both automated microscopes and flow cytometers arises from the necessity for them to measure one cell at a time. Recent developments in digital camera technology now offer an alternative in which one or more low-magnification, low-resolution images are made of a wide field containing many cells, using inexpensive light-emitting diodes (LEDs) for illumination. Minimalist widefield imaging cytometers can provide a smaller, less complex, and substantially less expensive alternative to flow cytometry, critical in systems intended for in resource-poor areas. Minimalism is, likewise, a good philosophy in developing instrumentation and methodology for both clinical and large-scale research use; it simplifies quality assurance and compliance with regulatory requirements, as well as reduces capital outlays, material costs, and personnel training requirements. Also, importantly, it yields "greener" technology.

  10. Kaubandusettevõtetel madalad logistikakulud / Ain Kiisler, Tomi Solakivi

    Index Scriptorium Estoniae

    Kiisler, Ain, 1965-

    2007-01-01

    Ilmunud ka: Delovõje Vedomosti : Logistika i Transport 28. nov. lk. 8. Uuringu järgi on Eesti kaubandusettevõtted logistikakuludelt teiste Läänemere-äärsete regioonide kaubandusettevõtetega võrreldes kõige konkurentsivõimelisemad, kuid Eesti tootmisfirmade logistikakulud on aga suurimaid. Diagrammid: Logistikakulude uuring. Vt. sams: Uuring tõstab Läänemere regiooni logistikakompetentsi

  11. Euroopa Liit kasvatas transpordikulusid / Ain Kiisler, Tomi Solakivi

    Index Scriptorium Estoniae

    Kiisler, Ain, 1965-

    2007-01-01

    2007. aasta alguses rahvusvahelise uurimisprojekti raames Eesti firmade hulgas läbi viidud logistikauuringu tulemustest. Lisa: Mis on mis; Number. Tabel: Eesti ettevõtted suudavad kõige vähem täita perfektselt tellimusi

  12. Geniaalne aines, hämmastav film / Tarmo Teder

    Index Scriptorium Estoniae

    Teder, Tarmo, 1958-

    2006-01-01

    Oktoobri algul Kuressaares peetud Saaremaalt pärit ameerika arhitekti Louis Kahni konverentsi raames Kuressaare Linnateatris näidatud dokumentaalfilmist "Minu arhitekt" ("My Architect") : režissöör Nathaniel Kahn : Ameerika Ühendriigid 2003

  13. Saaremaa rahvaliitlased on liitumise osas ettevaatlikud / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2009-01-01

    Keskerakonna poolt Rahvaliidule tehtud ühinemisettepanekut arutanud ERL Saaremaa maakonnaühendus ei poolda liitumist seni väljapakutud tingimustel. SDE juhatus moodustas töörühma, kes hakkab pidama konsultatsioone ERL-i ja EER-iga võimaliku liitumise üle

  14. The Hollow Men: Ain't It Awful?

    Science.gov (United States)

    Kendall, Martha E.

    1991-01-01

    Charles Sykes' book "The Hollow Men: Politics and Corruption in Higher Education" is criticized as overreacting to trends in higher education and the college curriculum but also seen as potentially prompting educators to ask questions about the dominant politics on their campuses. (MSE)

  15. Gynaecologists and industry: ain't no sunshine.

    Science.gov (United States)

    Farquhar, Cynthia M; Vercellini, Paolo; Marjoribanks, Jane

    2017-08-01

    The field of reproductive medicine is known for its innovations, and where there is innovation there is marketing and engagement with the doctors who are potential prescribers and users of those innovations. Financial connections between drug and device manufacturers with doctors have been extensively debated over the past decade. On one hand, relationships between doctors and industry could be considered synergistic by allowing the development of improved treatments. On the other hand, payment (and other benefits) from industry to doctors may subtly shift the main objective of the collaboration from patients' health to mutual benefits for both doctors and industry. Fertility patients can be considered 'vulnerable' as they face the multiple challenges of seeking to be parents, understanding complex and expensive fertility treatments that are by no means universally successful, and at the same time are under pressure because of their ever-increasing age. They are entitled to receive the most cost-effective treatments. We suggest that specialists in the field of reproductive medicine should be transparent about the receipt of financial benefits, including funding from industry, as it may be influencing both research outcomes and treatments that patients are offered. We also recommend that payments arising from industry-sponsored research should be centralized in institutional funds and not paid directly to researchers. And there should be transparency about the source and the purpose of the payment. Industry sponsorship of medical societies and their educational events should be kept to a minimum and declared quantitatively in societies' websites and scientific programme brochures. Industry sponsorship of scientific meetings should not include the right to host educational symposia or speakers within the programme. All speakers should declare their conflicts of interest (COIs) at their meetings. Guideline groups should require all members to declare their financial COIs before meeting and exclude or limit those members with COI. Governmental authorities should not allow continuing medical education credits to those educational events not complying with the above policies. The crucial role of medical journals as 'gatekeepers' for identifying 'science' must be reaffirmed. © The Author 2017. Published by Oxford University Press on behalf of the European Society of Human Reproduction and Embryology. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.

  16. Soomlane propageerib Saaremaale ülikooli asutamist / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2007-01-01

    Saaremaa peaks tõsiselt mõtlema rahvusvahelise kõrgkooli asutamisele, leiab Turu Ülikooli täienduskoolituskeskuse projektijuht ja Sihtasutuse Ülikoolide Keskus Saaremaal juhatuse liige Antti Karlin

  17. AIN thin film unimorph piezoelectric actuators on polysilicon microbridges

    NARCIS (Netherlands)

    Saravanan, S.; Dijkstra, Mindert; Berenschot, Johan W.; Krijnen, Gijsbertus J.M.; Elwenspoek, Michael Curt

    We present a surface micromachining process to fabricate AlN piezoelectric microstructures. The fabrication process utilizes Si02 sacrificial layer etching with Polysilicon as a structural layer. The significance of the process is that the polysilicon layer is used as a structural as weIl as a

  18. What We Expect Ain't Always What We Get.

    Science.gov (United States)

    Gellen, M. I.; Hoffman, R. A.

    1984-01-01

    Discusses the use of the chi-square statistic in educational evaluation based on the assumption that the availability of calculators and computers does not absolve educators from the responsibility of understanding this statistically evaluative technique. Illustrates applicability to an action research study in a middle school setting. (NEC)

  19. Eestis käis ilmataadi maapealne asemik / Ain Kallis

    Index Scriptorium Estoniae

    Kallis, Ain, 1942-

    2005-01-01

    Tänavu täitub 200 aastat pidevate instrumentaalsete ilmamõõtmiste algusest Eestis. Keskkonnaminister Villu Reiljan ja Euroopa Keskpika Ilmaennustuse Keskuse (European Centre for Medium-Range Weather Forecasts, ECMWF) direktor Dominique Marbouty kirjutasid alla koostöölepingule

  20. Tootjad karastusid kriisis. Rahapaigutused siiski veel vaka all / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2011-01-01

    Majanduskriisi mõjude üle ettevõtetele arutlevad ASi Tallegg juhatuse esimees Teet Soorm, ASi Haapsalu Uksetehas juhataja Ago Soomre, ASi Fazer Eesti juhatuse esimees Kristjan Kongo. Arvamust avaldab AS-i E-Betoonelement juhataja Valdo Leosk

  1. On a new species of Lanistes

    NARCIS (Netherlands)

    Schepman, M.M.

    1891-01-01

    Testa sinistrorsa, anguste umbilicata, conico-globosa, aut flavido- aut viridi-olivacea, semper fasciis spiralibus purpureis angustis in anfr. ultimo picta; spira scalaris, magis minusve conica; apex obtusus. Anfr. 5½, superne vel acute angulati vel carinati, supra plani, carina interdum linea

  2. 18 octobre 2013 - Le Préfet de l’Ain L. Touvet signe le livre d'or avec le Directeur général du CERN R. Heuer et le Chef du Département Technologie F. Bordry. Photo de groupe, de gauche à droite: T. Kupisz, Secrétaire général de la sous préfecture de Gex; L. Miralles, Chef du Département Infrastructure et services généraux; F. Eder, Délégué aux Relations avec les Etats hôtes; S. Donnot, Sous-préfet de Gex; L. Touvet, Préfet de l'Ain; E. Sches, Sous-préfète de Nantua; E.Gröniger-Voss, Conseiller juridique du CERN; R. Heuer, Directeur général; F. Bordry, Chef du Département Technologie et P. Bloch, Chef du Département Physique.

    CERN Multimedia

    Anna Pantelia

    2013-01-01

    18 octobre 2013 - Le Préfet de l’Ain L. Touvet signe le livre d'or avec le Directeur général du CERN R. Heuer et le Chef du Département Technologie F. Bordry. Photo de groupe, de gauche à droite: T. Kupisz,\tSecrétaire général de la sous préfecture de Gex; L. Miralles, Chef du Département Infrastructure et services généraux; F. Eder, Délégué aux Relations avec les Etats hôtes; S. Donnot, Sous-préfet de Gex; L. Touvet, Préfet de l'Ain; E. Sches, Sous-préfète de Nantua; E.Gröniger-Voss, Conseiller juridique du CERN; R. Heuer, Directeur général; F. Bordry, Chef du Département Technologie et P. Bloch, Chef du Département Physique.

  3. Portreefotograafia Oscarid. Kuidas neid küll jagada? / Annika Haas ; kommenteerinud Birgit Püve

    Index Scriptorium Estoniae

    Haas, Annika, 1974-

    2016-01-01

    Londoni rahvusliku portreegalerii (National Portrait Gallery) poolt 2003. aastal algatatud portreefotokonkursist Taylor Wessing Photographic Portrait Prize (TWPPP). 2015. aasta võidutöö: David Stewart "Viis tüdrukut"

  4. Putin's security policy in the past, present and future / Marcel de Haas

    Index Scriptorium Estoniae

    Haas, Marcel de

    2004-01-01

    Venemaa julgeolekupoliitika analüüs. Analüüsi aluseks on 2000. aastal välja töötatud Venemaa riiklik julgeolekukontseptsioon, sõjaline doktriin ja Vene föderatsiooni välispoliitiline kontseptsioon ning 2003. a. avaldatud Venemaa Föderatsiooni sõjalise kaitsevõime arendamise peamised prioriteedid. Tabel

  5. Muutuvintressi arvestamine krediidilepingutes, kui baasintressimäär on muutunud negatiivseks / Anni Haas

    Index Scriptorium Estoniae

    Haas, Anni

    2016-01-01

    Krediidilepingutest, milles intressimäär moodustub baasintressimäära ja intressimarginaali summast. Intressimakse negatiivse väärtuse tähendusest laenuandja ja laenusaaja suhte jaoks. Intressiarvestusest lepingu tõlgendamisel

  6. Paris Photo 2015 / Kristel Schwede, Annika Haas, Laura Põld, Piret Frey

    Index Scriptorium Estoniae

    2015-01-01

    Rahvusvaheline fotomess "Paris Photo 2015" 12. kuni 15. novembrini Pariisi messihallis Grand Palais. Eestit esindasid messil oma loominguga Jaanus Samma, Sigrid Viir, Krista Mölder (Temnikova & Kasela galerii)

  7. Oma ninast kaugemal: Aasia ja Euroopa fotokunsti võrdlusi / Annika Haas

    Index Scriptorium Estoniae

    Haas, Annika, 1974-

    2016-01-01

    Rahvusvahelisest portreefotovõistlusest "Kuala Lumpur International Photo Awards 2016" (KLPA 2016). Saksa fotokunstnikest Kathrin Tschirnerist ja Heiko Tiemannist, Jaapani fotokunstnikust Mayumi Suzukist, Jeemeni-Bosnia-Ameerika päritolu fotokunstnikust Alia Alist, Malaisia fotokunstnikest Eiffel Chongist ja Nadirah Zakariyast

  8. Deposition and characterization of TaAIN thin films by reactive magnetron sputtering; Deposicao e caracterizacao de filmes finos de TaAIN depositados por magnetron sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, G.B.; Fernandez, D.R.; Fontes Junior, A.S.; Felix, L.C.; Tentardini, E.K. [Universidade Federal de Sergipe (UFS), Sao Cristovao, SE (Brazil). Departamento de Ciencia e Engenharia de Materiais; Hubler, R. [Pontificia Universidade Catolica do Rio Grande do Sul (PUC-RS), RS (Brazil); Silva Junior, A.H. da, E-mail: brito-g@hotmail.com [Universidade Federal do Rio Grande do Sul (UFRGS), RS (Brazil)

    2016-07-01

    Phase stability, oxidation resistance and great mechanical properties are the main objectives when synthesizing protective coatings. The tantalum nitride (TaN) has aroused interest because of its high temperature stability, chemical inertness and thermal conductivity. However, it has a low hardness value when compared to other coatings. Researches has shown that one way to improvements in the properties of a thin film is by adding other elements in the deposition process. Therefore, the objective of this study was to deposit thin films of TaAlN by magnetron sputtering, changing the aluminum concentration of 2, 5, 7, to 14%. Then the coatings were characterized by EDS, RBS, GIXRD and nanohardness. In this study was found that the aluminum deposited did not change the oxidation resistance of the coating, and the highest value of hardness was 28 GPa for the sample with 14 at.%. (author)

  9. Deposition and characterization of NbAIN thin films by reactive magnetron sputtering; Deposicao e caracterizacao de filmes finos de NbAIN por magnetron sputtering reativo

    Energy Technology Data Exchange (ETDEWEB)

    Carvalho, R.G.; Felix, L.C.; Fernandez, D.A.R.; Fontes Junior, A.S.; Oliveira, G.B.; Tentardini, E.K., E-mail: renatacarvalho.rc@gmail.com [Universidade Federal de Sergipe (UFS), SE (Brazil)

    2016-07-01

    The objective of this work was to study NbAlN thin films and the influence of variation in the concentration of aluminum in the crystal structure and oxidation resistance of these coatings. The thin films were deposited by reactive magnetron sputtering and characterized by Grazing Incidence X-ray Diffraction (GIXRD), Energy Dispersive Spectroscopy (EDS) and oxidation tests at high temperatures. NbAlN thin films were deposited and present at concentration of 10, 20 and 42 at% Al. The NbAlN crystalline phase obtained was the δ-NbN, however it was observed a shift of the peaks in the patterns obtained GIXRD of regions for larger angles for these samples, indicating the formation of a solid solution. The higher oxidation resistance temperature was 700° C for the sample with 42 in at% Al. From the SEM analysis it was possible to observe the surface of the film after oxidation, all films showed defects, however the amount of such defects was lower in samples with higher aluminum concentrations. (author)

  10. Marcel de Haas, Russia’s Foreign Security Policy in the 21st Century – Putin, Medvedev and Beyond.

    Directory of Open Access Journals (Sweden)

    Isabelle Facon

    2011-03-01

    Full Text Available Specialists of Russian military and defense policy are familiar with Marcel De Haas’s prolific and in-depth publications on sometimes fairly technical issues. This book, with its broader outlook aimed at providing an overall understanding of Russian security policy in the 2000s, is the product of Dr. De Haas’s years as a Senior Research Fellow at the Clingendael Institute (The Hague. In many ways, it constitutes a follow-on to the author’s previous book– Russian Security Policy and Air Power...

  11. Microduplications encompassing the Sonic Hedgehog Limb Enhancer ZRS are Associated with Haas Type Polysyndactyly and Laurin-Sandrow Syndrome

    DEFF Research Database (Denmark)

    Lohan, Silke; Spielmann, Malte; Doelken, Sandra C

    2014-01-01

    Laurin-Sandrow syndrome (LSS) is a rare autosomal dominant disorder characterized by polysyndactyly of hands and/or feet, mirror image duplication of the feet, nasal defects, and loss of identity between fibula and tibia. The genetic basis of LSS is currently unknown. LSS shows phenotypic overlap...... limb malformations ranging from syndactyly to mirror image polydactyly with duplications of the fibulae. We show that larger duplications of the ZRS region (> 80 kb) are associated with HTS, whereas smaller duplications (... distinguished from HTS by the presence of mirror image polysyndactyly of the feet with duplication of the fibula. Our results expand the clinical phenotype of the ZRS-associated syndromes and suggest that smaller duplications (associated with a more severe phenotype. In addition, we show...

  12. Pentazocine pain relief in adult patients with acute abdominal ain: A ...

    African Journals Online (AJOL)

    Background: Reported studies in the African population, on early pain relief in patients with acute abdominal pain are few. The objective of the study was to evaluate the effect of pentazocine (PZ) on pain relief, diagnostic accuracy and treatment decisions in patients with acute abdominal pain. Methods: This was a ...

  13. T his article is m ainly about using sim ple trigonom etric identities ...

    Indian Academy of Sciences (India)

    RESONANCE. June 2007. E quation (7) can be rew ritten as,for exam ple, cos. 2. (x ) = exp(¡. 1. X n = 1 n. X r= 0 n C r. (¡ 1) r n cos. 2 r. (x )); (8) and hence ln (cos2 x ) = ¡. 1. X n = 1 n. X r= 0 n C r. (¡ 1) r n cos. 2 r. (x ):. (9). Integrating both sides of equation (9) between 0 and. ¼ /2, w e get. Z ¼ = 2. 0 ln (cos2 x )dx = ¡. 1. X n = 1.

  14. Enha utiliz de anceme ation b erived f ent of by stra from s bioma ain ...

    African Journals Online (AJOL)

    SAM

    en-Han Ch y, No. 1018, S an (R.O.C.). 12 January, 2015 ays could be e derived stra how that an ization. Char tion were obs. CW)/L) and v. L and 1.61 x ces was sign al subcultur ilization or im us; hsp60 gen ealth benefit. gh fed-batch esses for cos esses for pro as medium tion rate, tem ten the via. 6215829. Fax: + he terms ...

  15. COxSwAIN COmpressive Sensing for Advanced Imaging and Navigation

    Data.gov (United States)

    National Aeronautics and Space Administration — A new imaging architecture that incorporates elements of compressive sensing and computational imaging in order to reevaluate the design space of imaging systems...

  16. Füüsikud maailma päästmas / Ain Ainsaar

    Index Scriptorium Estoniae

    Ainsaar, Ain

    2003-01-01

    9.-11. oktoobrini Tallinna Pedagoogikaülikoolis aset leidnud rahvusvahelisest seminarist "Tiheda plasma ja materjalide interaktsioon", kus käsitleti termotuumareaktorite mudelite ehitamisel ette tulnud tehnilisi raskusi

  17. Sõjageograafia aine ja Eestimaa sõjageograafia 1920. aastatel / Kersti Vennik

    Index Scriptorium Estoniae

    Vennik, Kersti, 1975-

    2003-01-01

    Autori arvates puudub praeguses ohvitseride väljaõppes kursus, kus selgitataks täpsemalt Eesti maastike omadusi, erinevate maastiku-komponentide omavahelist koosmõju ning maastiku mõju kaitsejõudude tegevusele. Polkovnik Nikolai Reegi (1890-1942) panusest Eesti geograafiateaduse ajalukku

  18. Everyday Engineering: Ain't She Sweet--Bats, Rackets, Golf Clubs, and All

    Science.gov (United States)

    Moyer, Richard; Everett, Susan

    2011-01-01

    The pitcher throws the ball and the batter takes a mighty swing. Crack! The ball is hit on the sweet spot and soars to the outfield. Or, you hear a thud! This time, the ball dribbles along the infield ground and the batter's hands sting. Everyone who has played baseball or softball has probably experienced both of these outcomes. This may not seem…

  19. If Momma Ain't Happy: Explaining Declines in Marital Satisfaction among New Mothers

    Science.gov (United States)

    Dew, Jeffrey; Wilcox, W. Bradford

    2011-01-01

    This study tests competing explanations for the link between the transition to motherhood and declines in wives' marital satisfaction. Using data from the first and second waves of the National Survey of Families and Households (N = 569), we found that new mothers' marital satisfaction declines could be attributed to reductions in wives' quality…

  20. Laevade erinevate soetamisviiside kommertstingimuste võrdlev analüüs / Ain Eidast, Allan Kivi

    Index Scriptorium Estoniae

    Eidast, Ain, 1939-2013

    2005-01-01

    Laevade erinevate soetamisviiside analüüs näitab, et ühtse, kõikidele osapooltele vastuvõetavate tingimuste väljatöötamine ja rakendamine ei ole tehniliselt võimalik ning majanduslikult õigustatud. Tabelid. Diagrammid

  1. Pattern of community acquired pneumonia in pregnant ladies in Ain Shams University hospitals

    Directory of Open Access Journals (Sweden)

    Aya M. Abdel Dayem

    2012-10-01

    Conclusion: Morbidity and mortality in pregnant patients with pneumonia continue to present a significant challenge. Early recognition of the diseases process and prompt treatment are required to ascertain an optimal outcome. The treatments in the gravid patients generally follow standard guide lines for the treatment of pneumonia in adults. Concern for fetal outcome should not delay treatment as improvement in maternal oxygenation and status is the best way to ensure fetal protection.

  2. Living with the Sermon of the Mount : an uncomfortable presence of transcendence / Ain Riistan

    Index Scriptorium Estoniae

    Riistan, Ain, 1965-

    2003-01-01

    Ettekanne sümpoosionilt: Gemeinsames Symposium der Evangelisch-Theologischen Fakultät der Universität Tartu, der Estnischen Studiengesellschaft für Morgenlandkunde und der Deutschen Religionsgeschichtlichen Studiengesellschaft. Tartu, 2001

  3. Otepää piiskoplinnuse hävimisdaatumist / Ain Mäesalu

    Index Scriptorium Estoniae

    Mäesalu, Ain, 1955-

    2010-01-01

    Ülevaade, miks autor hakkas 1980. aastate keskel toetama hüpoteesi Otepää keskaegse linnuse hävimisest 1396. aastal. Samas on kriitiliselt vaetud sama ajakirja numbris mõningaid Jaak Mälli seisukohti

  4. ... ain pild erheben, als das zu perln gehoret... - Relief- und Perlstickerei des Spätmittelalters

    Czech Academy of Sciences Publication Activity Database

    Wetter, Evelin

    -, č. 70 (2014), s. 112-125 ISSN 0231-5793 R&D Projects: GA ČR GA13-39192S Institutional support: RVO:68378033 Keywords : textile works of art from the treasuries * liturgical robes * embroidery * serial production * made-to-order production Subject RIV: AL - Art, Architecture, Cultural Heritage

  5. Metallifirmade prioriteediks sai tootearendus / Ain Alvela ; kommenteerinud Jüri Riives

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2010-01-01

    Metallitöötlemisega tegelevate firmade juhid on valdavalt arvamusel, et praegu pole aeg paigutada raha ettevõtte laienemise ja tootmismahu suurendamise hüvanguks, vaid tegelda tuleks tootearenduse ja kogu ettevõtte struktuuri korrastamisega. Sobiv on aeg ka mõne ettevõtte ülesostmiseks

  6. Teaduspargist võrsub eriti agar gasell / Ain Alvela ; kommenteerinud Seren Eilmann

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2010-01-01

    Tallinna tehnoloogiapargi Tehnopol ja Tartu teaduspargi ettevõtlusinkubaatorid pakuvad ettevõtluskeskkonda kiiret arengut taotlevatele ettevõtetele. Tehnopolis on gaselli staatuse saanud 22 firmat, Tartu teaduspargis 13 firmat. AS-ist Proekspert, OÜ-st Interfire. Tabel

  7. Pemberian Obat-Obatan Anti Inflamasi Non Steroid (AINS pada Anak

    Directory of Open Access Journals (Sweden)

    Fajriani Fajriani

    2012-10-01

    Full Text Available We know that non-steroid anti-inflammatory drugs (NSAIDs analgetic, antipirettan and anti-inflammatory effect. This drugs can decrease pain simptomaticly, the most widely prescribed drugs worldwide and being the drugs of first choice other inflammatory pain. There is many kind NSAIDs that we knaw, like aspirin, parasetamol, ibuprofen, mefenamic acid, endometasin, diklofenak, piroksikan and nemosulide. Every kind of NSAIDs has its advantage and dis advantage for that beneficial actions and side effects. That beneficial actions and harmful side effects of NSAID can be associated with its mechanism of action. Using NSAID for children must in attention. This article is expented to give information and to help the collegnes in the selecting drugs NSAID for child.DOI: 10.14693/jdi.v15i3.27

  8. Water Ser - areng läbi torude ja üle kraavide / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2007-01-01

    1992. aastal asutatud vee- ja kanalisatsioonitorustike paigaldamisele spetsialiseerunud perefirma AS Water Ser on kasvanud rahvusvaheliselt mainekaks kontserniks. Vt. samas: Perefirma arengu kronoloogia; Amet sai alguse teismelise eas kraavikaevamisest. Kommenteerivad Andrus Piir ja Toomas Kapp

  9. A successful chronic care program in Al Ain-United Arab Emirates.

    Science.gov (United States)

    Baynouna, Latifa M; Shamsan, Amal I; Ali, Tahira A; Al Mukini, Lolowa A; Al Kuwiti, Moza H; Al Ameri, Thuraya A; Nagelkerke, Nico J D; Abusamak, Ahmad M; Ahmed, Nader M; Al Deen, Sanaa M Zein; Jaber, Tariq M; Elkhalid, Abdulkarim M; Revel, Anthony D; Al Husaini, Alhusini I; Nour, Fouad A; Ahmad, Hayat O; Nazirudeen, Mohammad K; Al Dhahiri, Rowaya; Al Abdeen, Yahya O Zain; Omar, Aziza O

    2010-02-22

    The cost effective provision of quality care for chronic diseases is a major challenge for health care systems. We describe a project to improve the care of patients with the highly prevalent disorders of diabetes and hypertension, conducted in one of the major cities of the United Arab Emirates. The project, using the principles of quality assurance cycles, was conducted in 4 stages.The assessment stage consisted of a community survey and an audit of the health care system, with particular emphasis on chronic disease care. The information gleaned from this stage provided feedback to the staff of participating health centers. In the second stage, deficiencies in health care were identified and interventions were developed for improvements, including topics for continuing professional development.In the third stage, these strategies were piloted in a single health centre for one year and the outcomes evaluated. In the still ongoing fourth stage, the project was rolled out to all the health centers in the area, with continuing evaluation. The intervention consisted of changes to establish a structured care model based on the predicted needs of this group of patients utilizing dedicated chronic disease clinics inside the existing primary health care system. These clinics incorporated decision-making tools, including evidence-based guidelines, patient education and ongoing professional education. The intervention was successfully implemented in all the health centers. The health care quality indicators that showed the greatest improvement were the documentation of patient history (e.g. smoking status and physical activity); improvement in recording physical signs (e.g. body mass index (BMI)); and an improvement in the requesting of appropriate investigations, such as HbA1c and microalbuminurea. There was also improvement in those parameters reflecting outcomes of care, which included HbA1c, blood pressure and lipid profiles. Indicators related to lifestyle changes, such as smoking cessation and BMI, failed to improve. Chronic disease care is a joint commitment by health care providers and patients. This combined approach proved successful in most areas of the project, but the area of patient self management requires further improvement.

  10. Fabrication of surface micromachined ain piezoelectric microstructures and its potential apllication to rf resonators

    NARCIS (Netherlands)

    Saravanan, S.; Saravanan, S.; Berenschot, Johan W.; Krijnen, Gijsbertus J.M.; Elwenspoek, Michael Curt

    2005-01-01

    We report on a novel microfabrication method to fabricate aluminum nitride (AlN) piezoelectric microstructures down to 2 microns size by a surface micromachining process. Highly c-axis oriented AlN thin films are deposited between thin Cr electrodes on polysilicon structural layers by rf reactive

  11. Surface micromachined fabrication of piezoelectric ain unimorph suspension devices for rf resonator applications

    NARCIS (Netherlands)

    Saravanan, S.; Saravanan, S.; Berenschot, Johan W.; Krijnen, Gijsbertus J.M.; Elwenspoek, Michael Curt

    We report a surface micromachining process for aluminum nitride (AlN) thin films to fabricate piezoelectric unimorph suspension devices for actuator applications. Polysilicon is used as a structural layer. Highly c-axis oriented AlN thin films 1 /spl mu/m thick are deposited by rf reactive

  12. DiSC aitab käitumist parandada / Ain Kivesti

    Index Scriptorium Estoniae

    Kivesti, Ain

    2008-01-01

    DiSC testi abil on võimalik saada ülevaade personaalsetest käitumishoiakutest ning vastavalt olukorrale on võimalik harjumuspärast reageerimisstiili radikaalselt muuta. Kommenteerivad Jorma Sarv ja Paavo Pilv

  13. Kodumaine allhange jõuab ka siinsete tootjateni / Ain Alvela ; kommenteerinud Ardo Kalda

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2015-01-01

    Metallitööfirma OÜ Haapsalu Metal on Rootsi kapitalile kuuluv allhanketellimustele spetsialiseerunud ettevõte, mille tootevalikusse kuuluvad näiteks ka Eesti ettevõtete tellimusel valminud saetööstusseadmed, kalatööstuse automatiseeritud tootmisliinid, metsatraktorite keskliigendid, turbakaevandamiseks mõeldud masinate ümberseadistamine ning võistlusautode detailid

  14. Odnim blazhennõm dnjom : [luuletused] / Uku Masing ; lühibiograafia: A. K. [Ain Kaalep

    Index Scriptorium Estoniae

    Masing, Uku, 1909-1985

    1999-01-01

    Sisu: Odnim blazhennõm dnjom ; Veter tshelnok bõl ; Pesn soldat, otstupajushishih pod natiskom netshistoi silõ / tlk. Svetlan Semenenko ; "Tõ groznaja gora..." ; "Ne mozhet ditja bez ottsa naroditsja..." ; K predelam ; Vestnik iz "Magellanovõh oblakov" : katkend ; Postigaja i verja ; V kazhdom strannike - nadezhda / tlk. A. Zorin. Orig.: Ühel kaunil päeval ; Süstik on tuul ; Tontide eest taganejate sõdurite laul ; "Sa oled mägi, mida kardavad me karjad..." ; "Välja südamest visata..." ; Piiridele püüdes ; Saadik Magellani pilvest : katkend ; Mõistu saades ja uskudes ; Iga rändur on lootus

  15. Rannakalanduse tulevik sõltub varust / Ain Soome ; interv. Agnes Jürgens

    Index Scriptorium Estoniae

    Soome, Ain

    2008-01-01

    Kalapüügiseaduse muudatustest. Lisatud: kalastajad. Ilmunud ka Hiiu Leht 2. mai 2008, lk. 4 ; Oma Saar 6. mai 2008, lk. 4 ; Vooremaa 13. mai 2008, lk. 2 ; Lääne Elu 20. mai 2008, lk. 4, lisatud: taustainfo ; Harju Elu 3. juuni 2008, lk. 2 ; Peipsi Rannik = Tshudskoje Poberezhje mai 2008, lk.4, lisatud: taustinfo

  16. Saaremaa sadamate majanduslik-regionaalpoliitiline tähtsus ja arenguperspektiivid / Taavo Asuja, Ain Eidast

    Index Scriptorium Estoniae

    Asuja, Taavo

    2005-01-01

    Et puudub selgus püsiühenduse rajamise ning selle tegevuse suhtes, on raskendatud sadamate arengu pikaajaline prognoosimine ja suunamine. Autorite hinnangul oleks vaja koostada Saaremaa sadamate arengu kontseptsioon. Tabelid. Diagrammid

  17. Sulev Keedus : "Jonathan" on film esti indiaanlastest / Sulev Keedus ; interv. Ain Lember

    Index Scriptorium Estoniae

    Keedus, Sulev, 1957-

    2007-01-01

    Dokumentaalfilm "Jonathan Austraaliast" : režissöör ja operaator Sulev Keedus : F-Seitse 2007. Režissöör filmist, kaitstes end kohaliku rahva süüdistuste vastu filmis kujutatu ebaeetilisuse üle

  18. Maailmas süveneb nõudlus lehtmetallist toodete järele / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2007-01-01

    Ilmunud ka: Delovõje Vedomosti : Promõshlennost 2. mai lk. 13. AS Favor on oma 17 tegevusaasta vältel teostanud allhankeid, mis on kujunenud tulusaks ja perspektiivseks äriks. Vt. samas: Tooraine tuleb hajutatud kanaleid mööda; Favori neli ärisuunda

  19. Prise en charge des hernies etranglees de l'aine en milieu ...

    African Journals Online (AJOL)

    Le délai moyen de consultation était de 2,5 jours et la nécrose intestinale était notée dans 39 cas. Un pincement latéral était observé dans 8 cas et un étranglement rétrograde en «W» dans 1 cas. La résection intestinale a été pratiquée chez les 39 patients qui avaient une nécrose. Les hernies inguinales ont été traitées par ...

  20. It Don't Mean a Thing If It Ain't Got That Swing.

    Science.gov (United States)

    Stainburn, Samantha

    2002-01-01

    Trumpeter Wynton Marsalis created a curriculum that focuses on jazz music, which he asserts can cure what ails today's students, because its unique musical characteristics (collective improvisation, call and response, solos, and unexpected rhythms) demand respect and patience as musicians listen to one another and collaborate. The article suggests…

  1. New frameshift CF mutation 3729delAinsTCT in a Tunisian cystic ...

    Indian Academy of Sciences (India)

    More than 1800 CFTR (cystic fibrosis transmembrane con- ductance regulator gene) sequence variations have been identified in the cystic fibrosis (CF) mutation database. (http://www.genet.sickkids.on.ca/cftr/). For North African populations, however, the nature and frequency of the major. CFTR mutations remain unclear, ...

  2. Kadriorg pakkus suviti tsaaritaridele glamuuri : Vene impeeriumi esimene merekuurort rajati Kadriorgu / Tiit Kask, Ain Hinsberg

    Index Scriptorium Estoniae

    Kask, Tiit

    2013-01-01

    Esimesed kümblusasutused alustasid Tallinna ümbruses tegevust 18. sajandi lõpus. 1813. a avas Georg Witte Tallinna lähistel Kadriorus oma Wittenhofi (Wittenau) suvemõisas lõbustus- ja kümblusasutuse. 1830-ndad ja 1840-ndad kujunesid Tallinna kuurortide kuldajastuks

  3. Lindora 11.-12. sajandi kääbaskalmistuantropoloogiline aines / Leiu Heapost

    Index Scriptorium Estoniae

    Heapost, Leiu, 1936-

    2006-01-01

    Kagu-Eesti seni kõige varasem laibahaudadest saadud atropoloogiline materjal pärineb Lindora kääbaskalmetest. Lindora ümarkääbastesse maetud olid morfoloogiliselt võrdlemisi sarnased, kõrge ja kitsa koljuga, pikakasvulised ja graatsiliste jäsemeluudega

  4. Tõnu Virve: filmi aines puudutas mu enda mälestusi / Tõnu Virve ; intervjueerinud Andres Laasik

    Index Scriptorium Estoniae

    Virve, Tõnu, 1946-

    2009-01-01

    Intervjuu 22. septembril Kumu auditooriumis esilinastunud dokumentaalfilmi "Monument" (Freyja Film, 2009) režissööri Tõnu Virvega. Kesksel kohal on filmis Tallinna Tõnismäe monument (skulptor Enn Roos, arhitekt Arnold Alas)

  5. 500 tudengiga aines kontrollib eksamitöid õppejõu eest arvuti / Anu Mõistlik

    Index Scriptorium Estoniae

    Mõistlik, Anu

    2003-01-01

    Tartu Ülikooli selle semestri rahvarohkeima, 500 kuulajaga sotsiaalkultuurilise psühholoogia loengukursuse lõpus kirjutasid tudengid eksamitööks valikvastustega testi, mida hakkavad kontrollima arvutid

  6. Saaremaa maaelu ja põllumajandus said mullu ligi 140 miljonit toetust / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2005-01-01

    Saare maakond sai 2004. aastal enam kui 138 miljoni krooni eest maaelu- ja põllumajandustoetusi, mis teeb iga maal elava inimese kohta 6760 krooni. Tabelid: Toetussumma maakonna lõikes; Toetussumma iga maal elava inimese kohta (kroonides)

  7. 'If it ain't broke, don't fix it': Challenges facing institutional ...

    African Journals Online (AJOL)

    The paper is based on interviews with 18 black lecturers who entered the academic workforce through the university's ADP. Employing Pierre Bourdieu's theoretical framework of social and cultural reproduction, we discuss how difficult it is to interrupt the naturalised norms and values that form part of the existing institutional ...

  8. A successful chronic care program in Al Ain-United Arab Emirates

    Directory of Open Access Journals (Sweden)

    Al Husaini Alhusini I

    2010-02-01

    Full Text Available Abstract Background The cost effective provision of quality care for chronic diseases is a major challenge for health care systems. We describe a project to improve the care of patients with the highly prevalent disorders of diabetes and hypertension, conducted in one of the major cities of the United Arab Emirates. Settings and Methods The project, using the principles of quality assurance cycles, was conducted in 4 stages. The assessment stage consisted of a community survey and an audit of the health care system, with particular emphasis on chronic disease care. The information gleaned from this stage provided feedback to the staff of participating health centers. In the second stage, deficiencies in health care were identified and interventions were developed for improvements, including topics for continuing professional development. In the third stage, these strategies were piloted in a single health centre for one year and the outcomes evaluated. In the still ongoing fourth stage, the project was rolled out to all the health centers in the area, with continuing evaluation. The intervention consisted of changes to establish a structured care model based on the predicted needs of this group of patients utilizing dedicated chronic disease clinics inside the existing primary health care system. These clinics incorporated decision-making tools, including evidence-based guidelines, patient education and ongoing professional education. Results The intervention was successfully implemented in all the health centers. The health care quality indicators that showed the greatest improvement were the documentation of patient history (e.g. smoking status and physical activity; improvement in recording physical signs (e.g. body mass index (BMI; and an improvement in the requesting of appropriate investigations, such as HbA1c and microalbuminurea. There was also improvement in those parameters reflecting outcomes of care, which included HbA1c, blood pressure and lipid profiles. Indicators related to lifestyle changes, such as smoking cessation and BMI, failed to improve. Conclusion Chronic disease care is a joint commitment by health care providers and patients. This combined approach proved successful in most areas of the project, but the area of patient self management requires further improvement.

  9. Ain't no mountain high enough: plant invasions reaching new elevations

    Science.gov (United States)

    An& iacute Pauchard; bal; Christoph Kueffer; Hansj& ouml Dietz; rg; Curtis C. Daehler; Jake Alexander; Peter J. Edwards; Ar& eacute; Jos& eacute valo; Ram& oacute; n; Lohengrin A. Cavieres; Antoine Guisan; Sylvia Haider; Gabi Jakobs; Keith McDougall; Constance I. Millar; Bridgett J. Naylor; Catherine G. Parks; Lisa J. Rew; Tim Seipel

    2009-01-01

    Most studies of invasive species have been in highly modified, lowland environments, with comparatively little attention directed to less disturbed, high-elevation environments. However, increasing evidence indicates that plant invasions do occur in these environments, which often have high conservation value and provide important ecosystem services. Over a thousand...

  10. MTZ trügib maailma mõjukate traktoritootjate sekka : [Minski traktoritehas] / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2015-01-01

    2016. a oma asutamise 70. aastapäeva tähistav Minski traktoritehas (MTZ) panustab viimse kümnendi jooksul jõuliselt Euroopa tingimustele ja nõuetele vastavate traktorite välja töötamisele ning tootmisele

  11. Veiko Õunpuu pälvis Euroopa Talendi auhinna / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2008-01-01

    Cannes'i filmifestivali raames toimuval Euroopa päeval antakse filmirežissöör Veiko Õunpuule üle Euroopa Talendi auhind (European Talent Prize) mängufilmiprojekti "Püha Tõnu Kiusamine" eest (produtsent Katrin Kissa). MEDIA Desk Eesti juht Anu Ernits peab seda suureks võiduks kogu Eesti filmile

  12. Ühiskondliku Leppe Sihtasutus tahab GMO üle otsustamise anda elanikele / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2005-01-01

    Ühiskondliku Leppe Sihtasutus peab mõttekaks ühineda üle-euroopalise algatusega muuta EL seadusandlust selliselt, et GMO-vabade piirkondade kehtestamiseks õigus jääb maaomanike ja ametnike asemel elanikele

  13. Ester Tuiksoo : Saksamaa on Eestile biomassi ja GMO vallas eeskujuks / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2006-01-01

    Põllumajandusminister Ester Tuiksoo ja abiminister Rain Vändre kohtusid Kielis Schleswig-Holsteini liidumaa ministri dr. Christian von Boetticheriga, peateemadeks abi biomassi ja geneetiliselt muundatud kultuurtaimede kooseksisteerimise vallas

  14. 2018 : tööstust veavad keskkond ja tervis / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2008-01-01

    Arengufondi foorumil "Tööstusvedurid 2018" tõdeti, et kümne aasta pärast peab Eesti majandus olulises osas toetuma töötlevale tööstusele. Kommenteerivad: Arvo Kivikas, Heikki Mäki ja Jaanus Purga

  15. Applying of whole-tree harvesting method; Kokopuujuontomenetelmaen soveltaminen aines- ja energiapuun hankintaan

    Energy Technology Data Exchange (ETDEWEB)

    Vesisenaho, T. [VTT Energy, Jyvaeskylae (Finland); Liukkonen, S. [VTT Manufacturing Technology, Espoo (Finland)

    1997-12-01

    The objective of this project is to apply whole-tree harvesting method to Finnish timber harvesting conditions in order to lower the harvesting costs of energy wood and timber in spruce-dominant final cuttings. In Finnish conditions timber harvesting is normally based on the log-length method. Because of small landings and the high level of thinning cuttings, whole-tree skidding methods cannot be utilised extensively. The share of stands which could be harvested with whole-tree skidding method showed up to be about 10 % of the total harvesting amount of 50 mill. m{sup 3}. The corresponding harvesting potential of energy wood is 0,25 Mtoe. The aim of the structural measurements made in this project was to get information about the effect of different hauling methods into the structural response of the tractor, and thus reveal the possible special requirements that the new whole-tree skidding places forest tractor design. Altogether 7 strain gauge based sensors were mounted into the rear frame structures and drive shafts of the forest tractor. Five strain gauges measured local strains in some critical details and two sensors measured the torque moments of the front and rear bogie drive shafts. Also the revolution speed of the rear drive shaft was recorded. Signal time histories, maximum peaks, Time at Level distributions and Rainflow distributions were gathered in different hauling modes. From these, maximum values, average stress levels and fatigue life estimates were calculated for each mode, and a comparison of the different methods from the structural point of view was performed

  16. Sõjanuiad, võimusümbolid ja margapuud / Ain Mäesalu, Jüri Peets

    Index Scriptorium Estoniae

    Mäesalu, Ain, 1955-

    2010-01-01

    Artiklis käsitletakse muinas- ja keskaegsete sõjanuiade problemaatikat arheoloogiliste leidude, kirjalike allikate ja omaaegsete kunstiteoste põhjal. Eestist leitud sõjanuiapeadest, mida kasutati 12.-13. sajandil relvadena, kuid need võisid sümboliseerida ka selle omaniku kõrget staatust. 19.-20. sajandil kasutati samasuguseid metalltahukaid margapuu otsaraskusena

  17. Metsateede kasutamine eeldab naabri austamist / Ain Alvela, Ketlin Rauk ; kommenteerinud Uno Luht

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2015-01-01

    Oma seisukohti väljendavad RMK Metsaparandustalituse juhataja Margus Reimann, OÜ Iriscorp Transport juhataja Kaido Sikk, AS Karo Trans juhatuse liige Meelis Lippe, Kohila vallavanem Heiki Hepner, Hiiumaa metsaseltsi juht Aira Toss

  18. Konkurentide ees annab eelise disainiga tegelemine / Peter L. Phillips ; intervjueerinud Ain Alvela

    Index Scriptorium Estoniae

    Phillips, Peter L.

    2010-01-01

    Intervjuu rahvusvaheliselt tunnustatud disainieksperdiga tootmisettevõtete ja disainerite koostöö tähtsusest, disaineri rollist. Eksperdi sõnul on äärmiselt oluline kasutada toodete eristumiseks ja nende turustamiseks disaini, kui Eesti tootjatel on soov müüa tooteid Eestist välja

  19. "I Know There Ain't No Pigs with Wigs": Challenges of Tier 2 Intervention

    Science.gov (United States)

    Stephens, Diane; Cox, Robin; Downs, Anne; Goforth, Jennie; Jaeger, Lisa; Matheny, Ashley; Plyler, Kristi; Ray, Sandra; Riser, Lee; Sawyer, Beth; Thompson, Tara; Vickio, Kathy; Wilcox, Cindy

    2012-01-01

    As a part of Response to Intervention, for three years, ten reading interventionists provided supplemental support to readers. They formed a learning community, took an inquiry-based approach to assessment and developed a theory of what students needed to know and be able to do as readers. They addressed and learned from several other challenges:…

  20. prevalence of hepatitis B and C viruses among health care workers in Ain Shams university hospitals

    International Nuclear Information System (INIS)

    El-fouly, A.H.A.

    2005-01-01

    exposure to blood borne pathogens poses a serious risk to health care workers (HCW), since the transmission of viral hepatitis B and C to health care workers has became of worldwide concern. hepatitis B and C viruses are the most frequent occupational disease in health care service workers, HCW are defined as persons (doctors, nurses, employees, students, contractors, attending clinicians, public-safety workers, or volunteers) whose activities involve contact with patients or with blood or other body fluids from patients in a health - care, laboratory, or public-safety setting . the potential exists for blood and body fluid exposure to other workers, and the same principle of exposure management could be applied to other setting.in the united states, the prevalence of HBV and HCV among HCWs range between (6-30%) and (2.7-10%) respectively . in spain HBV prevalence is 11.6% and HCV is 28.8%. while in taiwan 16.7% of HCWs were seropositive to HBsAG and 12.7% were seropositive for HCV. In Egypt, screening of 1485 HCWs in the Ministry of health hospitals, 35% were exposed to needle sticks

  1. Detoxification Of Ochratoxin AIN Green Coffee Beans By Physical Methods With Studying Genotoxicity Of Treated Samples

    International Nuclear Information System (INIS)

    FARAG, S.A.; SHAMS EL DIEEN, N.M.M.; EL-SIDEEK, L

    2010-01-01

    Ochratoxin A (OTA) is potently nephrotoxic, teratogenic and carcinogenic, and the potency was varied markedly between species and sexes. Unfortunately, OTA are present due to mold contamination in different food stuffs such as coffee bean, therefore, the present study was carried out on collected imported coffee samples from super markets in Egypt. The isolation and identification proved presence of Penicilli sp. and Aspergillus sp. whereas the last one was dominant in two samples as A. niger and A. ochoruses. Determination of OTA by using HPLC analysis showed presence of high levels than the allowance levels in green coffee beans (more than 5 μg/kg; ppb). In addition, another group of collected samples as roasted coffee beans indicated the presence of high toxic concentrations of OTA. The study was then conducted on samples contain the highest OTA content by using some physical methods as gamma irradiation (5 and 10 kGy), charcoal (powder, granules), roasting (at 200 0 C for 7-10 min and 20 min). The results showed that proposed physical methods, mainly gamma irradiation and charcoal, could be efficient to decrease OTA in green beans coffee without produce toxic substance as well as non-significant changes in its properties. In addition, safety of resulted coffee beans after treatments were checked by ESR and genotoxicity test, which raise the preferability of gamma irradiation (10 kGy) treatment before using medium roasting to get coffee beans free from OTA

  2. Trial excavations of the northern part of the Lehmja settlement site / Ain Lavi

    Index Scriptorium Estoniae

    Lavi, Ain

    2004-01-01

    Hilisrauaajal on pinnaveetaseme tõus sundinud Lehmja asukaid ümber asuma Tuuleveskimäe lõuna- ja edelajalamile. 2003. aasta kaevamiste põhjal näib, et Tuuleveskimäe edelanõlvale tekkis asustus keskajal

  3. Recubrimientos protectores de TiN y AIN: comportamiento frente a temperatura

    Directory of Open Access Journals (Sweden)

    Auger, M. A.

    2006-04-01

    Full Text Available The use of ceramic materials like titanium and aluminium nitrides have experienced a great improvement in the last years due to the variety of applications they show. The use as protective coatings on industrial tools is one important application with very favorable results for the moment, as it is the use as coating molds used for different elements fabrication. One of the mostly often used techniques to deposit protective coatings is the sputtering technique, which has been used in this work. In the present study we have analysed structural and mechanical properties of TiN and AlN thin films, using X-Ray diffraction, scanning electron microscopy, nanoindentation and pin-on-disk techniques. Thermal treatments have been applied on the mentioned films, applying three different temperature values: 750oC, 850oC y 950oC. Changes in their properties before and after the treatments have been observed. TiN layers show a thermal resistance around 750oC. The thermal resistance for AlN layers is around 850oC, being also observed an improvement in their properties when applying 850ºC of thermal treatment.

    La utilización de materiales cerámicos como el nitruro de titanio o de aluminio ha experimentado una gran popularización en los últimos años gracias a su gran variedad de aplicaciones. Una importante aplicación que cuenta hasta el momento con resultados muy favorables es la de su uso como recubrimientos protectores de herramientas industriales, así como de moldes empleados en la fabricación de diferentes elementos. Una de las técnicas más utilizadas en la obtención de recubrimientos protectores es la técnica de sputtering, utilizada en este trabajo. En el presente estudio se han analizado las propiedades estructurales y mecánicas de láminas delgadas de TiN y AlN mediante las técnicas de difracción de rayos X, microscopía electrónica de barrido, nanoindentación y pin-on-disk. Dichas capas han sido sometidas a un tratamiento térmico en el que se han aplicado tres temperaturas: 750oC, 850oC y 950oC, y se han observado variaciones en sus propiedades antes y después del tratamiento. Las capas de TiN presentan una resistencia térmica en torno a 750oC. Las capas de AlN resisten hasta una temperatura en torno a 850oC, observándose además una mejoría en sus propiedades al ser sometidas a dicha temperatura de 850oC.

  4. 'If it ain't broke, don't fix it': Challenges facing institutional ...

    African Journals Online (AJOL)

    and women South Africans to develop the research skills and teaching qualifications .... of school etc. For instance, the networks established by families through social class are intergenerationally transmitted and when these children enter university, they ... In contrast, it is a 'social risk' to form social relations and networks.

  5. Katrin Pudersell kaitses farmaatsiadoktori väitekirja / Ain Raal, Elmar Arak

    Index Scriptorium Estoniae

    Raal, Ain, 1961-

    2006-01-01

    3. mail 2006 kaitses farmaatsiamagister Tartu Ülikooli arstiteaduskonna nõukogu ees doktoriväitekirja "Tropaanalkaloidide ja riboflaviini produktsioon koera-pöörirohu (Hyoscyamus niger L.) põllu- ja koekultuurides

  6. "If It Ain't Broke, Don't Fix It"

    DEFF Research Database (Denmark)

    Blasco, Maribel; Tackney, Charles

    2013-01-01

    embedded in the hidden curriculum, which made Danish higher education effective at producing graduates with analytical and personal abilities and dispositions, such as reflexivity, curiosity, collaboration and trust that are particularly suitable for today's globalised, knowledge–based economies. We...... illustrate this by drawing on examples of changes to an education programme at a Danish business school....

  7. A Completely New Type of Actuator -or- This Ain't Your Grandfather's Internal Combustion Engine

    Science.gov (United States)

    Gore, Brian W.; Hawkins, Gary F.; Hess, Peter A.; Moore, Teresa A.; Fournier, Eric W.

    2010-01-01

    A completely new type of actuator - one that is proposed for use in a variety of environments from sea to land to air to space - has been designed, patented, built, and tested. The actuator is loosely based on the principle of the internal combustion engine, except that it is a completely closed system, only requiring electrical input, and the working fuel is water. This paper outlines the theory behind the electrolysis- and ignition-based cycle upon which the actuator operates and describes the performance capability test apparatus and results for the actuator. A mechanism application that harnessed the unit s power to twist a scaled rotor blade is also highlighted.

  8. "Ain't no one here but us social forces": constructing the professional responsibility of engineers.

    Science.gov (United States)

    Davis, Michael

    2012-03-01

    There are many ways to avoid responsibility, for example, explaining what happens as the work of the gods, fate, society, or the system. For engineers, "technology" or "the organization" will serve this purpose quite well. We may distinguish at least nine (related) senses of "responsibility", the most important of which are: (a) responsibility-as-causation (the storm is responsible for flooding), (b) responsibility-as-liability (he is the person responsible and will have to pay), (c) responsibility-as-competency (he's a responsible person, that is, he's rational), (d) responsibility-as-office (he's the responsible person, that is, the person in charge), and (e) a responsibility-as-domain-of-tasks (these are her responsibilities, that is, the things she is supposed to do). For all but the causal sense of responsibility, responsibility may be taken (in a relatively straightforward sense)-and generally is. Why then would anyone want to claim that certain technologies make it impossible to attribute responsibility to engineers (or anyone else)? In this paper, I identify seven arguments for that claim and explain why each is fallacious. The most important are: (1) the argument from "many hands", (2) the argument from individual ignorance, and (3) the argument from blind forces. Each of these arguments makes the same fundamental mistake, the assumption that a certain factual situation, being fixed, settles responsibility, that is, that individuals, either individually or by some group decision, cannot take responsibility. I conclude by pointing out the sort of decisions (and consequences) engineers have explicitly taken responsibility for and why taking responsibility for them is rational, all things considered. There is no technological bar to such responsibility. © Springer Science+Business Media B.V. 2010

  9. New frameshift CF mutation 3729delAinsTCT in a Tunisian cystic ...

    Indian Academy of Sciences (India)

    fibrosis patient. SONDESS HADJ FREDJ1, MONIA BOUDAYA1, SABRINE OUESLATI1, SAFA SAHNOUN1, CHAIMA SAHLI1,. HAJER SIALA1, KHEDIJA BOUSSETTA2, AMINA BIBI1 and TAIEB MESSAOUD1∗. 1Biochemistry Laboratory and 2Department of Pediatrics, Children's Hospital, Bab Saadoun Square 1007 Tunis, ...

  10. Kohtuotsus on õige : ['Siioni tarkade protokolli' eesti tõlke hävitamine] / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    1995-01-01

    Vastukaja : Tärni, Aulis. Tuleriit kohalikust punasest kütusest // Postimees. - 1995. - 24.nov. - Lk.6; Kalmre, Vahur. Raamatute kaitseks // Postimees. - 1995. - 27.nov. - Lk. 6; Langemets, Andres. Eesti ja juudi // Postimees. - 1995. - 30.nov. - Lk.8

  11. Eesti tootjad eiravad teadlikult CE-märgistust / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2005-01-01

    Ilmunud ka: Delovõje Vedomosti 2. nov. lk. 27. Euroopa Liit nõuab ehitusmaterjalide märgistamist CE-märgistusega, kuid kontrolli puudumise tõttu ei kiirusta tootjad nõude täitmisega. Kommenteerivad Urmas Leitmäe ja Hanno Egipt. Vt. samas: CE-märgistus annab tootele garantii; Märk teavitab klienti

  12. Preliminary investigations of the southeastern section of the settlement site of Lehmja / Ain Lavi

    Index Scriptorium Estoniae

    Lavi, Ain, 1951-

    2007-01-01

    Seoses Tallinn-Tartu maantee rekonstrueerimisega toimusid 1985.-1986. aastal Lehmja asula lõunapoolsel alal mahukad päästekaevamised. Selgus, et tegemist on I aastatuhandest pärit asulakohaga, milliseid teatakse Eestis vähe. 2006. aasta kaevamismetoodikast ja uurimistulemustest

  13. Summertime, and the Choosin' Ain't Easy: An Ice Cream Counting Problem.

    Science.gov (United States)

    Kreith, Kurt

    1992-01-01

    Utilizes the problem of determining the number of different ice cream cones and cups that can be made from a choice of 31 flavors to investigate the concepts of combinations and permutations. Provides a set of six related problems with their answers. (MDH)

  14. Ain't I Black Too: Counterstories of Black Atheists in College

    Science.gov (United States)

    Snipes, Jeremy T.

    2017-01-01

    Increasingly Black college students are identifying as atheist, however few empirical studies in higher education and student affairs are exploring the phenomenon. This dissertation examines the question, "How do Black atheist understand their identity in college?" Using Higginbotham's Politics of Respectability and tenants of Critical…

  15. Study of Shubnikov-de Haas Oscillations and Measurement of Hole Effective Mass in Compressively Strained InxGa1-xSb Quantum Wells

    Science.gov (United States)

    2011-05-04

    superlattice of AlAs and AlSb (Fig. 1) [5]. Details on the growth are available in Refs. [5,6]. Percentage of strain in the channel layers was calculated...quantum well heterostructure with (A) InXGa1XSb and (B) GaSb channel. The AlAsXSb1X layers are composed of AlSb /AlAs short-period superlattices. Also...In0.41Ga0.59Sb (75) AlSb 1.9 900 5000 0.94 1012 A3 In0.41Ga0.59Sb (125) Al0.7Ga0.3Sb 1.8a 621 2210 1.0 1012 B1 GaSb (75) AlAs0.219Sb0.781 1.06 880 4400 1.5

  16. Provenance studies of archaeological ceramics from Mar-Takla (Ain-Minin, Syria) using radioisotope X-ray fluorescence method

    International Nuclear Information System (INIS)

    Bakraji, E.H.; Othman, I.; Karajou, J.

    2001-01-01

    The radioisotope X-ray fluorescence method was applied to studies of the provenance of the ceramics fragments originated from the Mar-Takla site in Syria. The samples were irradiated 1000s by a 109 Cd radioisotope source and 13 elements (Ca, Ti, Mn, Fe, Zn, Ga, As, Rb, Sr, Y, Zr and Pb) were determined in 35 samples. The data were subjected to two multivariate statistical methods, cluster and principal components analysis (PCA). It was shown from the combination of the statistical techniques and the determination of elemental composition of the samples that 94% of the ceramic samples analyzed can be considered to be manufactured using two sources of raw materials

  17. Provenance studies of archaeological ceramics from Mar-Takla (Ain-Minin, Syria) using radioisotope x-ray fluorescence method

    International Nuclear Information System (INIS)

    Bakraji, E. H.; Karajou, J.; Othman, I.

    2002-01-01

    The radioisotope x-ray fluorescence method was applied to provenance studies of ceramics fragments originated from the Mar-Takla site in Syria. 35 samples were analyzed, where each sample was irradiated 1000 s by sup 1 sup 0 sup 9 Cd radioisotope source and the elements (As, Ca, fe, Ga, Nb, Mn, Pb, Rb, Sr, Ti, Y, Zn, and Zr) were determined. The data were subjected to two multivariate statistical methods, cluster and principal component analysis (PCA). The study show that 94% of the samples can be considered to be manufactured using two sources of raw materials. (Authors)

  18. Incidence, etiology, and patterns of maxillofacial fractures in ain-shams university, cairo, egypt: a 4-year retrospective study.

    Science.gov (United States)

    Mabrouk, Amr; Helal, Hesham; Mohamed, Abdel Rahman; Mahmoud, Nada

    2014-09-01

    Although there is a worldwide increase in maxillofacial trauma incidence; the pattern and etiology of these injuries varies from one country to another depending on socioeconomic, cultural, and environmental factors. This study aims to realize the epidemiological characteristics of maxillofacial fractures in our department. A retrospective cross-sectional study of all facial trauma patients admitted to our department during 2009 to 2012. Patients' data including gender, age, etiology of trauma, the pattern and demographic distribution of fractures of maxillofacial skeleton, and associated injuries were analyzed and compared with previously published data. The chi-square test was used with a p value of less than 0.05, which was considered statistically significant. There is a significant increase in maxillofacial fractures incidence in the past 2 years than former ones. There is a male predominance with highest incidence in the age group of 20 to 40 years. Road traffic accident is the most common etiological factor followed by violence. There is increase in mandibular fracture incidence compared with midface. The significant increased incidence of maxillofacial fracture due to motor car accidents and assaults in the past 2 years reflects a behavioral change within the community.

  19. "Sa, haavapuu, kesköösel valendad..." : [luuletused] / Paul Celan ; saksa k. tlk. [ja saatesõna]: Ain Kaalep

    Index Scriptorium Estoniae

    Celan, Paul, pseud., 1920-1970

    2001-01-01

    Autorist lk. 49-50. Sisu: "Sa, haavapuu, kesköösel valendad..." ; Mälestus Prantsusmaast ; Aastad sinust minuni ; Surmafuuga ; Aja silm ; Kõnevõre ; Silm, lahtine ; Zürich, "Toonekure" kohvik : Nelly Sachsile ; Psalm ; "Niitpäikesed..." ; "Maovankris, mööda..." ; "Maastik urnidega..." ; Prahas ; "Kõmin: see on..." ; "Üks hambajälg eikuskilpool..." ; "Kahinais, otsekui meie alguses..." ; Teine ; "Teie oma..." ; "See, mis meid..." ; "Lõika palvekäsi..." ; "Ma kuulen, et kirves lõi õitsema..." ; "Leht, mille puu küljest..."

  20. Tallinna Merepäevade turismikonverents käsitles mere ja linna kohtumispaiga arenguid ja arendamist / Ain Hinsberg

    Index Scriptorium Estoniae

    Hinsberg, Ain

    2013-01-01

    Tallinna Sadama, linnavalitsuse, Viking Line ja EHTE poolt 12. juulil Admiraliteedi basseiniääres Merepäevade paviljonis korraldatud konverentsist "Mere ja linna kohtumispaik kui linnaruum ja sihtkoht", kus esinesid Allan Kiil, Tiit Kask, Duncan Frazer Inglismaalt, Satu Lehtonen Soomest, Anu Hallik-Jürgenstein, Peeter Pere, Heikki Mäki, Evelyn Sepp ja Ahto Ader

  1. 115 Qualité de la source Ain Hamma et effet du déversement de ses ...

    African Journals Online (AJOL)

    AKA BOKO

    Revue des Énergies. RenouvelablesCER'07 Oujda (2007) 81-84. [22] - Y. ZARHLOULE, A. RIMI, M. BOUGHRIBA, M. VERDOYA, A. CORREIA, J. CARNEIRO et A. LAHRACH. La province géothermique du Maroc Nord Oriental. Revue des Énergies Renouvelables CER'07 Oujda. (2007) 89-94. [23] - A. FEKRAOUI.

  2. Formation, structure and magnetism of the metastable defect fluorite phases AVO3.5+x (A=In, Sc)

    International Nuclear Information System (INIS)

    Shafi, Shahid P.; Lundgren, Rylan J.; Cranswick, Lachlan M.D.; Bieringer, Mario

    2007-01-01

    We report the preparation and stability of ScVO 3.5+x and the novel phase InVO 3.5+x . AVO 3.5+x (A=Sc, In) defect fluorite structures are formed as metastable intermediates during the topotactic oxidation of AVO 3 bixbyites. The oxidation pathway has been studied in detail by means of thermogravimetric/differential thermal analysis and in-situ powder X-ray diffraction. The oxidation of the bixbyite phase follows a topotactic pathway at temperatures between 300 and 400 deg. C in air/carbon dioxide. The range of accessible oxygen stoichiometries for the AVO 3.5+x structures following this pathway are 0.00≤x≤0.22. Rietveld refinements against powder X-ray and neutron data revealed that InVO 3.54 and ScVO 3.70 crystallize in the defect fluorite structure in space group Fm-3 m (227) with a=4.9863(5) and 4.9697(3)A, respectively with A 3+ /V 4+ disorder on the (4a) cation site. Powder neutron diffraction experiments indicate clustering of oxide defects in all samples. Bulk magnetic measurements showed the presence of V 4+ and the absence of magnetic ordering at low temperatures. Powder neutron diffraction experiments confirmed the absence of a long range ordered magnetic ground state. - Graphical abstract: Topotactic oxidation of AVO 3 bixbyite to AVO 3.5 defect fluorite structure followed by in-situ powder X-ray diffraction. The upper structural diagram shows a six coordinated (A/V)-O 6 fragment in bixbyite, the lower structure illustrates the same seven-fold coordinated (A/V)-O 7 cubic environment in the defect fluorite structure

  3. Saaremaal anti täiskäik LEADER-programmi käivitamiseks / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2006-01-01

    Saaremaa Kodukandi korraldatud infopäeval sündis algatusrühm LEADER-tüüpi arendustegevuse ettevalmistamiseks maakonnas. Tabel: Saaremaa algatusrühma tegevuskava LEADER-tüüpi maapiirkondade arendustegevuse ettevalmistamiseks

  4. Effects of AIN457, a Fully Human Antibody to Interleukin-17A, on Psoriasis, Rheumatoid Arthritis, and Uveitis

    NARCIS (Netherlands)

    Hueber, Wolfgang; Patel, Dhavalkumar D.; Dryja, Thaddeus; Wright, Andrew M.; Koroleva, Irina; Bruin, Gerard; Antoni, Christian; Draelos, Zoe; Gold, Michael H.; Durez, Patrick; Tak, Paul P.; Gomez-Reino, Juan J.; Foster, C. Stephen; Kim, Rosa Y.; Samson, C. Michael; Falk, Naomi S.; Chu, David S.; Callanan, David; Nguyen, Quan Dong; Rose, Kristine; Haider, Asifa; Di Padova, Franco

    2010-01-01

    Interleukin-17A (IL-17A) is elaborated by the T helper 17 (T(H)17) subset of T-H cells and exhibits potent proinflammatory properties in animal models of autoimmunity, including collagen-induced arthritis, experimental autoimmune encephalomyelitis, and experimental autoimmune uveitis. To

  5. It "Ain't" Always So: Sixth Graders' Interpretations of Hispanic-American Stories with Universal Themes

    Science.gov (United States)

    Rice, Peggy S.

    2005-01-01

    This article examines the responses of eight sixth grade students discussing four realistic fiction Hispanic-American multicultural stories with universal themes by Gary Soto in peer-led literature discussion groups. The results indicate the importance of a reader's sociocultural frame--class, race, and gender, on their interpretation of…

  6. Merle Karusoo uue tüki aines pärineb lõpukirjandist / Garel Püüa

    Index Scriptorium Estoniae

    Püüa, Garel

    2006-01-01

    Merle Karusoo alustab proove eesti ja vene koolide õpilaste lõpukirjandite põhjal koostatud lavastusega. Septembris Draamateatris esietenduva Karusoo lavastuse tööpealkiri on "Küpsuskirjand 2005"

  7. Merle Karusoo uue tüki aines pärineb lõpukirjanditest / Garel Püüa

    Index Scriptorium Estoniae

    Püüa, Garel

    2006-01-01

    Lavastaja Merle Karusoo alustab peagi proove lavastusega, mis on koostatud õpilaste lõpukirjandite põhjal. Käsitletavad kirjanditeemad on venekeelsetelt lõpetajatelt ́ђجSeda maad nimetan ma kodumaakśђح ja eestlastelt ́ђجRahvussuhted 21. sajandiĺђح

  8. Hydride vapor phase epitaxy growth of GaN, InGaN, ScN, and ScAIN

    NARCIS (Netherlands)

    Bohnen, T.

    2010-01-01

    Chemical vapor deposition (CVD); hydride vapor phase epitaxy (HVPE); gallium nitride (GaN); indium gallium nitride (InGaN); scandium nitride (ScN); scandium aluminum nitride (ScAlN); semiconductors; thin films; nanowires; III nitrides; crystal growth - We studied the HVPE growth of different III

  9. Söötmisega disainitud piim tagab tervisliku toidukraami / Ene Tammsaar ; intervjueerinud Ain Alvela ; kommenteerinud Üllas Jaaska

    Index Scriptorium Estoniae

    Tammsaar, Ene, 1952-

    2014-01-01

    Et farmidest tööstusse minevast toorpiimast saaks toota maitsvaid ja tervislikke tooteid, peab toorpiim olema kõrgeima võimaliku kvaliteediga. Selle tagamiseks on piimatööstused koostöös teadlastega ette võtnud piima koostise disainimise

  10. Nahast küünarvarrekaitsmed keskaegsest Tartust / Ain Mäesalu, Jüri Peets, Elna Haiba

    Index Scriptorium Estoniae

    Mäesalu, Ain

    2008-01-01

    2000. aastal Tartust leitud 14. sajandi lõpukümnenditest või 15. sajandi algusest pärinevatest küünarvarrekaitsmetest. Keskaegsest kaitsevarustusest, Tartu küünarvarrekaitsmete valmistamistehnikast, nende kahjustustest ja konserveerimisest

  11. Küttimine võib septembris peatuda. Maaomanikud vs. jahimehed / Ain Alvela ; kommenteerinud Heiki Hepner, Val Rajasaar

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2011-01-01

    Maksumaksjad ja maaomanikud toetavad Eesti jahindust sisuliselt viie miljoni euroga aastas, kuigi keskkonnaspetsialistide hinnangul võiks asi olla vastupidi. Kehtiv jahiseadus ei aita kaasa metsa väärtuse parandamisele. Tabelid

  12. Kultuuriaasta väljapaistvaimaks sündmuseks osutus kirjandusfestival / Ly Brikkel, Ain Mäeots ; interv. Raimu Hanson

    Index Scriptorium Estoniae

    Brikkel, Ly

    2005-01-01

    Aasta parimaks harrastuslikuks koosluseks tunnistati näitemänguselts Vilde Teater (projektijuht L. Brikkel, lavastus "Tagahoov"), aasta looja nimetuse pälvis A. Mäeots ("Mullatoidu restoran)" jt. Tartu Kultuurkapitali nõukogu määras aastapreemia 50000 krooni H. Elvistele ja L. Eelmäele

  13. Twin City - past 1823-2013 : EHTE ja Haaga-Helia ühisprojekt / Tiit Kask, Ain Hinsberg

    Index Scriptorium Estoniae

    Kask, Tiit

    2012-01-01

    Turismikoolide ühisprojektist "Twin City - Empowering & Designing Twin-Capital Destination - Past, Present and Future of Tourism in Greater-Helsinki and Greater-Tallinn Area", mille eesmärgiks on Tallinna ja Helsingi kui ühtse turismisihtkoha käsitluse loomine ja 26. aprillil Tallinnas toimunud seminarist "TwinCity Helsinki-Tallinn / Tallinn & Estonian tourism 1813-2013", mis kutsus üles tähistama Tallinna (Kadrioru) merekuurordi ja "Eesti Turismimajandus 200" juubelit 2013. aastal

  14. Keskkonnakaitsjad pakuvad välja abinõud GMO saaste vältimiseks / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2006-01-01

    Eesti Keskkonnaühenduste Koda esitas ettepanekud tagamaks geneetiliselt muundatud põllumajanduskultuuride kasvatamise selliselt, et need ei tekitaks kahju tava- ja mahepõllumeestele. Vt. samas: Põllumajandusminister Ester Tuiksoo kommentaar EKO ettepanekutele. Vt. samas: Eesti ilmselt toetab geenmuundatud taimede lubamist Euroopa Liitu ja lühiinterv. põllumajandusministeeriumi taimetervise osakonna juhataja Tambet Sovaga. Vt. ka lk. 5: Nastja Pertsjonok. GMO keskkonnakaitsja pilgu läbi

  15. Method 445.0 In Vitro Determination of Chlorophyll a and Pheophytin ain Marine and Freshwater Algae by Fluorescence

    Science.gov (United States)

    This method provides a procedure for low level determination of chlorophyll a (chl a) and its magnesium free derivative, pheophytin a (pheo a), in marine and freshwater phytoplankton using fluorescence detection.(1,2) Phaeophorbides present in the sample are determined collective...

  16. Development of Production PVD-AIN Buffer Layer System and Processes to Reduce Epitaxy Costs and Increase LED Efficiency

    Energy Technology Data Exchange (ETDEWEB)

    Cerio, Frank

    2013-09-14

    The DOE has set aggressive goals for solid state lighting (SSL) adoption, which require manufacturing and quality improvements for virtually all process steps leading to an LED luminaire product. The goals pertinent to this proposed project are to reduce the cost and improve the quality of the epitaxial growth processes used to build LED structures. The objectives outlined in this proposal focus on achieving cost reduction and performance improvements over state-of-the-art, using technologies that are low in cost and amenable to high efficiency manufacturing. The objectives of the outlined proposal focus on cost reductions in epitaxial growth by reducing epitaxy layer thickness and hetero-epitaxial strain, and by enabling the use of larger, less expensive silicon substrates and would be accomplished through the introduction of a high productivity reactive sputtering system and an effective sputtered aluminum-nitride (AlN) buffer/nucleation layer process. Success of the proposed project could enable efficient adoption of GaN on-silicon (GaN/Si) epitaxial technology on 150mm silicon substrates. The reduction in epitaxy cost per cm{sup 2} using 150mm GaN-on-Si technology derives from (1) a reduction in cost of ownership and increase in throughput for the buffer deposition process via the elimination of MOCVD buffer layers and other throughput and CoO enhancements, (2) improvement in brightness through reductions in defect density, (3) reduction in substrate cost through the replacement of sapphire with silicon, and (4) reduction in non-ESD yield loss through reductions in wafer bow and temperature variation. The adoption of 150mm GaN/Si processing will also facilitate significant cost reductions in subsequent wafer fabrication manufacturing costs. There were three phases to this project. These three phases overlap in order to aggressively facilitate a commercially available production GaN/Si capability. In Phase I of the project, the repeatability of the performance was analyzed and improvements implemented to the Veeco PVD-AlN prototype system to establish a specification and baseline PVD-AlN films on sapphire and in parallel the evaluation of PVD AlN on silicon substrates began. In Phase II of the project a Beta tool based on a scaled-up process module capable of depositing uniform films on batches of 4”or 6” diameter substrates in a production worthy operation was developed and qualified. In Phase III, the means to increase the throughput of the PVD-AlN system was evaluated and focused primarily on minimizing the impact of the substrate heating and cooling times that dominated the overall cycle time.

  17. "It ain't all as bad as it may seem": young Black lesbians' responses to sexual prejudice.

    Science.gov (United States)

    Reed, Sarah J; Valenti, Maria T

    2012-01-01

    This article explores the ways in which young, Black lesbians manage their sexual minority identity when experiencing sexual prejudice. Fourteen Black lesbians between the ages of 16 and 24 participated in semistructured interviews. Instances of sexual prejudice and the young women's responses were thematically analyzed using open and axial qualitative coding techniques. Results indicated that participants experienced sexual prejudice frequently and even within the lesbian community. Responses to sexual prejudice included: cognitive reframing of heterosexist messages, passing, gaining support from self-created gay families, and fighting back (physically and verbally) in the event of isolated instances of sexual prejudice. Analysis focuses on how gender identity relates to experiences of sexual prejudice and identity management strategies. Findings suggest that there are parallels between the management strategies of these women and young, Black gay and bisexual males and between these women and Black women who are coping with sexism and racism.

  18. Lootus : [luuletused] / Friedrich Schiller ; tlk. Ain Kaalep, Rein Sepp, Paul Viiding, Eduard Roos, Jaan Kross, Jakob Tamm

    Index Scriptorium Estoniae

    Schiller, Friedrich, 1759-1805

    2006-01-01

    Sisu: Lootus ; Õhtu ; Brutus ja Caesar ; Laura klaveri ees ; Rousseau ; Grupp Tartarosest ; Rõõmule ; Palvekiri ; Hektori lahkumine ; Kunstnikud ; Laulu võim ; Metafüüsik ; Ideaal ja elu ; Maailma jaotamine ; Neiu võõrsilt ; Külvaja ; Odysseus ; Kolumbus ; Antiikkultuur rändurile Põhjast ; Zeus Heraklesele ; Kõrgeim ; Laps hällis ; Surematus ; Võti ; Astronoomilised teosed ; Parim riik ; Minu usk ; Sõber ja vaenlane ; Harv seos ; Nooruse lätted ; Naiste otsus ; Ootus ja täitumine ; Ühine saatus ; Looduseuurijad ja transtsendentaalfilosoofid ; Ohtlik tulemus ; Anonüümne jõgi ; Valgus ja soojus ; Neiu kaebus ; Ühele moralistile ; Goethele ; Pagulane ; Saksa muusa ; Uue sajandi saabumine ; Punshilaul ; Mäelaul ; Polykratese sõrmus ; Rüütel Toggenburg ; Kinnas ; Alpi kütt ; Sõpradele. Eluloolisi andmeid autori kohta lk. 239

  19. Tootest olulisemaks saab ärimudel. Kandiline arbuus tavalisest 30 korda kallim / Ain Alvela ; kommenteerinud Janek Kalvi

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2011-01-01

    Eesti Arengufondi juhatuse esimehe Ott Pärna, ASi Kalev Chocolate Factory juhataja Kaido Kaare ja ASi Balsnack International Holding juhatuse esimehe Elmar Rusingu ettekannetest toiduainetööstuse aastakonverentsil "Uue tõusu ootuses". Graafik

  20. In-situ metrology in multiwafer reactors during MOVPE of AIN-based UV-LEDs (Conference Presentation)

    Science.gov (United States)

    Knauer, Arne; Brunner, Frank; Kolbe, Tim; Hagedorn, Sylvia; Kueller, Viola; Weyers, Markus

    2017-02-01

    UV-LEDs are of great interest for applications like disinfection, gas sensing, and phototherapy. The cost sensitive LEDs are commonly grown by MOVPE on transparent AlN/sapphire templates. The large thermal and lattice mismatch between AlN and sapphire generates a very high dislocation density (DD) and causes big challenges in strain management. The threading dislocation density should be reduced to the order of low 108cm-2 for high internal efficiency of the AlGaN based UV-LED structures. The TDD will be reduced mainly by dislocation annihilation during the growth of thick Al(Ga)N layers, which is a challenge in terms of strain management. We present how in-situ reflectometry and curvature measurement (EpiCurveTT(at)LayTec) in commercial multiwafer growth reactors helps to optimize the growth processes concerning growth rates, surface roughening and avoidance of layer cracking on 2inch substrates and enhance the reproducibility of epitaxial growth. The growth of up to 3 μm thick planar AlN templates and up-to 10 μm thick AlN/sapphire templates by epitaxial lateral overgrowth of stripe patterned templates for UV-C LED structures will be highlighted. The implementation of different types of AlN/GaN superlattices for the subsequent growth of up to 5μm thick Al0.5Ga0.5N layer for UVB LED structures will be shown. Correlations to ex-situ measurements like X-ray diffraction and TEM analysis of defects in the LED structures will be shown. Some challenges of in-situ control through very narrow viewports as in Close Coupled Showerhead reactors will be discussed as well as the influence of silicon doping on curvature and dislocation density in Al(Ga)N layers.

  1. Päästetute koor : [luuletused] / Nelly Sachs ; saksa k. tlk. [ja järelsõna:] Ain Kaalep

    Index Scriptorium Estoniae

    Sachs, Nelly

    2003-01-01

    Sisu: Päästetute koor ; Kes aga tühjendas liivast teie kingad ; Et jälitatuist ei saaks jälitajad ; Sündmatute koor ; Liblikas ; Maailma rahvad ; Valmis on kõik maad ; Nii üksildane on inimene

  2. Õpilaste teadlikkus E-ainetest ja karastusjookides olevad E-ained / Dorel Donner ; juhendanud Karin Tuul

    Index Scriptorium Estoniae

    Donner, Dorel

    2014-01-01

    Räpina ühisgümnaasiumi 11. kl. õpilase uurimistööst, milles antakse ülevaade E-ainetest, nende kasutusaladest, eeldatavatest kõrvalmõjudest ning gümnaasiumiastme õpilaste karastusjookide tarbimise harjumustest ja üldisest E-ainetega seotud teadlikkusest

  3. Läti elanikud NSVL SARK filterlaagrites 1944-1948 (allikate ülevaade) / Ainārs Bambals

    Index Scriptorium Estoniae

    Bambals, Ainārs, 1964-

    2010-01-01

    Läti filtreerimise kontroll-koondamispunktid olid Riias, Daugavpilsis, Jelgavas, Kuldīga, Liepājas, Skrundas, Tukumsis, Vāiņodes, Ventspilsis, Ugāles. Pärast Teist maailmasõda allutati filtreerimisele 91 000 Läti elanikku

  4. Your tooth it ain't so purty but it's gen-u-ine: Cole Porter's comic song "Snagtooth Gertie".

    Science.gov (United States)

    Christen, Arden G; Christen, Joan A

    2010-01-01

    Cole Porter (1891-1964), an American musical icon, has been internationally acknowledged as one of the most cosmopolitan, sophisticated, elegant and influential composer-lyricists of the 20th century. Born in Indiana and raised in wealth and privilege, he attended both Yale and Harvard universities where he honed his song-writing skills. In his 800 tunes, many of which became smash hits, he blended fresh, witty, urbane and colloquial lyrics with catchy, singable melodies. He composed musical scores for both Broadway stage and Hollywood movies, but focused on the former. While Porter enjoyed penning comic songs, he rarely had them published. In 1946, Cole wrote the music and lyrics for a Broadway show entitled Around the World in Eighty Days. Deemed a failure, it closed after only 75 performances. One light-hearted ditty, "Snagtooth Gertie", which he composed for the show, was never used. The lyrics are presented for the first time in this paper.

  5. It ain't what you say, it's how you say it: linguistic and cultural diversity in the classroom.

    Science.gov (United States)

    Robinson, Cynthia Cole; Clardy, Pauline

    2011-01-01

    The disparity between the cultural and linguistic diversity of the teaching population and the student population continues to grow as teacher education programs enroll and graduate primarily white teacher candidates (83.7%). At the same time, the diversity of the K-12 student body has increased with 65% of public school students being from culturally and linguistically diverse backgrounds (National Center for Education Statistics, 2007). This chasm between the diversity of the teaching force and student population is of concern as many teachers report that they do not have the cultural knowledge and experience of working or living in diverse environments, yet will be faced with teaching a very diverse student population. Hence, the need for teacher candidates and current teachers to be explicitly taught the skills needed to successfully teach diverse student populations is urgent. In this article, we explore the following phenomena: how linguistic and cultural diversity is regarded in teacher education programs, as well as teacher candidates' and current K-12 teachers' dispositions towards students who do not share their cultural backgrounds or language (including those who vary in their dialects). Finally, we will present strategies that teacher educators can use to embrace and empower culturally and linguistically diverse (CLD) teacher candidates, as well as prepare teacher candidates to teach diverse student populations.

  6. Piimandus: laenukarid, ikaldused ja hinnaralli tõid kriisi / Ain Alvela ; kommenteerinud Tiit Tuuleveski, Urmas Põlluaas ja Tõnu Post

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2009-01-01

    Kuigi piimatootmisega tegelevad ettevõtted vajaksid tegevuse arendamiseks hädasti investeeringuid, jäävad enamiku rahastamisplaanid paremaid aegu ootama. Diagramm. Kommenteerivad Tiit Tuuleveski, Urmas Põlluaas ja Tõnu Post

  7. Antisymmetric entangled two-photon states generated in nonlinear GaN/AIN photonic-band-gap structures

    Czech Academy of Sciences Publication Activity Database

    Peřina ml., Jan; Centini, M.; Sibilia, C.; Bertolotti, M.; Scalora, M.

    2007-01-01

    Roč. 75, č. 1 (2007), 013805/1-013805/1 ISSN 1050-2947 R&D Projects: GA MŠk(CZ) 1M06002 Institutional research plan: CEZ:AV0Z10100522 Keywords : parametric down-conversion * quantum teleportation * interference * indistinguishability * dispersion Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.893, year: 2007

  8. 'If it ain't broke, don't fix it?': scandals, 'risk', and cosmetic surgery regulation in the UK and France.

    Science.gov (United States)

    Latham, Melanie

    2014-01-01

    The recent PIP scandal that affected patients worldwide, and received extensive media coverage, led to concerns being felt by patients about the 'risks' of cosmetic surgery. Theories about regulation and risk refer to societies such as those in the West becoming more risk averse. Regulation, in turn, has come to be seen as an instrument to solve a problem for a community seen to be or which perceives itself to be at risk. The political and electoral risk acknowledged by government if it ignores that concern, or at least media coverage of it, can lead to regulation, or the tightening up of regulation, as a response. This article looks at current proposals for legislation in the UK following the PIP silicone implant scandal as an example of the risk-regulation premise. Are cosmetic surgery patients in the UK now going to see stricter regulation of the cosmetic surgery industry? The article argues that the UK and France have both reacted to healthcare scandals and the ensuing societal conception of risk by drawing up more thorough legislation on cosmetic surgery than previously existed. France enacted the Kouchner law in 2002 and the UK government published the Keogh Report in April 2013. A comparison is made of these to establish whether the UK can learn from the French legislation when it comes to drafting actual regulation in the future, perhaps in 2014. Finally, some arguments are made about whether risk aversion may make better law. © The Author [2014]. Published by Oxford University Press; all rights reserved. For Permissions, please email: journals.permissions@oup.com.

  9. Õnnistus : [luuletused] / Charles Baudelaire ; tlk. Johannes Semper, Ants Oras, August Sang, Ilmar Laaban, Ain Kaalep, Indrek Hirv, Jaan Kross

    Index Scriptorium Estoniae

    Baudelaire, Charles, 1821-1867

    2006-01-01

    Sisu: Õnnistus ; Albatross ; Ülenemine ; Vastavusi ; Kutse teekonnale ; Muusika ; Elav tungal ; Vaenlane ; Ebaõnn ; Mees ja meri ; Ilu ; Hiigelnaine ; Hümn ilule ; Kalliskivid ; Eksootiline lõhn ; Raibe ; Vampiir ; Pihtimus ; Kass ; Mis ütled, vaene hing ; Lõhnapudel ; Sume laotus ; Kutse teele ; Sügissonett ; Öökullid ; Olematuse maitse ; Spliin : "Mu mälestuste last on nii painajalik..." ; Spliin : "Ma olen nii kui vürst, vürst sajulisel maal..." ; Mõrane kell ; "Nagu põhjatu taevas, öös tummuv ja mustav..." ; Kell ; Maastik ; Päike ; Punajuukselisele kerjustüdrukule ; Luik ; Hämarus ; Mäng ; Somp ja udud ; Pariisi unenägu ; Hommikuhämarik ; Üksildaste vein ; Üks märtritar ; Beatrice ; Aabel ja Kain ; Armastajate surm ; Vaeste surm ; Matk ; Lunahind ; Ühe pilgu lubadused. Eluloolisi andmeid autori kohta lk. 703

  10. Mass movement susceptibility mapping - A comparison of logistic regression and Weight of evidence methods in Taounate-Ain Aicha region (Central Rif, Morocco

    Directory of Open Access Journals (Sweden)

    JEMMAH A I

    2018-01-01

    Full Text Available Taounate region is known by a high density of mass movements which cause several human and economic losses. The goal of this paper is to assess the landslide susceptibility of Taounate using the Weight of Evidence method (WofE and the Logistic Regression method (LR. Seven conditioning factors were used in this study: lithology, fault, drainage, slope, elevation, exposure and land use. Over the years, this site and its surroundings have experienced repeated landslides. For this reason, landslide susceptibility mapping is mandatory for risk prevention and land-use management. In this study, we have focused on recent large-scale mass movements. Finally, the ROC curves were established to evaluate the degree of fit of the model and to choose the best landslide susceptibility zonation. A total mass movements location were detected; 50% were randomly selected as input data for the entire process using the Spatial Data Model (SDM and the remaining locations were used for validation purposes. The obtained WofE’s landslide susceptibility map shows that high to very high susceptibility zones contain 62% of the total of inventoried landslides, while the same zones contain only 47% of landslides in the map obtained by the LR method. This landslide susceptibility map obtained is a major contribution to various urban and regional development plans under the Taounate Region National Development Program.

  11. Mars ain't the kind of place to raise your kid: ethical implications of pregnancy on missions to colonize other planets.

    Science.gov (United States)

    Schuster, Haley; Peck, Steven L

    2016-12-01

    The colonization of a new planet will inevitably bring about new bioethical issues. One is the possibility of pregnancy during the mission. During the journey to the target planet or moon, and for the first couple of years before a colony has been established and the colony has been accommodated for children, a pregnancy would jeopardize the safety of the crew and the wellbeing of the child. The principal concern with a pregnancy during an interplanetary mission is that it could put the entire crew in danger. Resources such as air, food, and medical supplies will be limited and calculated to keep the crew members alive. We explore the bioethical concerns of near-future space travel.

  12. Perforated Peptic Ulcer: Different Ethnic, Climatic and Fasting Risk Factors for Morbidity in Al-Ain Medical District, United Arab Emirates

    Directory of Open Access Journals (Sweden)

    Fawaz Chikh Torab

    2009-04-01

    Conclusion: Patients with dyspeptic symptoms and a history of previous PUD should be considered for prophylactic treatment to prevent ulcer recurrence during prolonged daytime fasting in Ramadan, especially during the winter time.

  13. A nickel ain't worth a dime anymore: the illusion of money and the rapid encoding of its true value.

    Directory of Open Access Journals (Sweden)

    Rongjun Yu

    Full Text Available People often evaluate money based on its face value and overlook its real purchasing power, known as the money illusion. For example, the same 100 Chinese Yuan can buy many more goods in Tibet than in Beijing, but such difference in buying power is usually underestimated. Using event related potential combined with a gambling task, we sought to investigate the encoding of both the real value and the face value of money in the human brain. We found that the self-reported pleasantness of outcomes was modulated by both values. The feedback related negativity (FRN, which peaks around 250ms after feedback and is believed to be generated in the anterior cingulate cortex (ACC, was only modulated by the true value but not the face value of money. We conclude that the real value of money is rapidly encoded in the human brain even when participants exhibit the money illusion at the behavioral level.

  14. "That Ain't No Ninja Turtles": The Prevalence and Influence of Popular Culture in the Talk and Writing of Prekindergarten Children

    Science.gov (United States)

    Kissel, Brian T.

    2011-01-01

    This article describes how 2 classrooms of 4-year-old children incorporated popular media (cartoons, television shows, video games, movies, and music) into their conversations with peers during writing. The findings assert that (a) children naturally incorporate popular culture into their writing, (b) children include popular culture in their…

  15. Maastikusõiduk UTV aitab tööd teha ja lõõgastuda / Ain Alvela ; kommenteerinud Tanel Rütman

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2015-01-01

    Analoogselt ATVga (ingl k All Terrain Vehicle - iga maastiku sõiduk) võib ka UTVd (ingl k Utility Terrain Vehicle - vahend maastikul liikumiseks) käsitleda nii tarbesõidukina väiksemate maatööde tegemiseks või raskestiläbitaval maastikul liikumiseks kui ka lihtsalt adrenaliinilaksu pakkuva meelelahutajana

  16. Paneeldiskussioon (fonogrammilt lühendatult) / Ain Heinaru, Rein Vaikmäe, Rein Raud, Hardi Tullus, Urve Lippus, Andres Tali, Martin Zobel

    Index Scriptorium Estoniae

    2006-01-01

    Projekti "Eesti doktoriõppe kvaliteedi, tulemuslikkuse ja jätkusuutlikkuse tagamise süsteem" (2005-2008) II konverentsi "Doktorid Eesti tuleviku arengumootoriks" paneeldiskussioonist, millel arutleti doktoriõppe rahastamise ning doktoriõppe korralduse ja doktorandi juhendamise teemadel

  17. Kuidas on läinud vene koolide eestikeelsele aineõppele üleminek? / Natalja Lapikova, Vjatšeslav Gussarov, Irene Käosaar

    Index Scriptorium Estoniae

    Lapikova, Natalja

    2008-01-01

    Küsimusele vastavad Tallinna Haridusameti hariduskorralduse teenistuse üldhariduse osakonna vanemspetsialist Natalja Lapikova, Tallinna Kesklinna Vene Gümnaasiumi direktor Vjatšeslav Gussarov ja HTM-i rahvusvähemuste hariduse osakonna juhataja Irene Käosaar

  18. "A 28-Day Program Ain't Helping the Crack Smoker" -- Perceptions of Effective Drug Abuse Prevention Interventions by North Central Florida African Americans Who Use Cocaine

    Science.gov (United States)

    Brown, Emma J.; Hill, Mary Angelique; Giroux, Stacey A.

    2004-01-01

    Cocaine is a major problem in the rural South, but knowledge is limited regarding the impact on African American populations. Purpose: This study of 18-39-year-old black drug users assessed perceptions of contributing factors to drug use and possible interventions. The study design was qualitative-descriptive, utilizing 4 focus groups with 5 rural…

  19. Measurement of the spin rotation parameter Ain the elastic pion-proton scattering at 1.43 GeV/c

    Science.gov (United States)

    Alekseev, I. G.; Bazhanov, N. A.; Budkovsky, P. E.; Bunyatova, E. I.; Kanavets, V. P.; Kovalev, A. I.; Koroleva, L. I.; Kruglov, S. P.; Morozov, B. V.; Nesterov, V. M.; Novinsky, D. V.; Ryltsov, V. V.; Shchedrov, V. A.; Sulimov, A. D.; Sumachev, V. V.; Svirida, D. N.; Trautman, V. Yu; Zhurkin, V. V.

    2006-02-01

    The ITEP-PNPI collaboration presents new results of the measurements of the spin rotation parameter A in the elastic scattering of negative pions on protons at P beam = 1.43 GeV/c. The results are compared to the predictions of several partial wave analyses. The experiment was performed at the ITEP proton synchrotron, Moscow.

  20. "There Ain't No Accounting for What Folks See in Their Own Mirrors": Considering Colorism within a Sharon Flake Narrative

    Science.gov (United States)

    Brooks, Wanda; Browne, Susan; Hampton, Gregory

    2008-01-01

    This article describes a study of both textual and reader response analyses of "The Skin I'm In" by Sharon Flake. Because gender and race constitute central themes in the narrative, Black feminist thought and feminism undergirded the textual critique. Critics' reviews, scholarly articles, and published author interviews also supported the textual…

  1. "That Ain't Going to Get You a Professorship": Discourses of Writing and the Positioning of Academics' Work with Student Writers in UK Higher Education

    Science.gov (United States)

    Tuck, Jackie

    2016-01-01

    A growing body of academic literacies research has enhanced our understanding of university writing as contested, institutionally situated practice with important consequences, particularly for students as they learn to negotiate the writing demands of university study. Less empirical attention has been paid to the practices of subject academics…

  2. "It Ain't Much, but It's All I Got." The Rural Homelessness Project: A Study of Living Conditions in Two Rural West Virginia Counties.

    Science.gov (United States)

    Spence, Beth

    Many poor families in rural West Virginia live in unsafe, unsanitary structures that do not protect them from the elements, but these families are not considered officially homeless. Lincoln and Clay Counties are very rural, traditionally poor areas, with 45% of their populations receiving welfare and much larger proportions receiving food stamps.…

  3. It Don't Mean a Thing if It Ain't Got Musicality: A Music-First Method for Teaching Historically Rooted Jazz Dance

    Science.gov (United States)

    Liebhard, Erinn

    2015-01-01

    This article proposes a method for teaching jazz dance technique according to music concepts and prioritizing deep embodiment of music. This method addresses what can be seen as a disconnect between current practices and historical understanding in jazz dance today, a gap that can be bridged with education empowering students to make innovative…

  4. Koos Ain Mäeotsaga avasite Londonis The Ragged Schooli galeriis möödunud reedel näituse "Mullatoidu restoran" / Peeter Laurits ; interv. Eero Epner

    Index Scriptorium Estoniae

    Laurits, Peeter, 1962-

    2004-01-01

    The Ragged Schooli galerii näitusekorraldusest, nendepoolsest projekti tutvustamisest, näituse avamisest. Ajaleht "Sunday Times" noomis galeriste enne näituse avamist selle eest, et väljas on õudsed, surma käsitlevad pildid

  5. Kõrghoone "Tower" Tallinnas, Tartu mnt. ja Pääsukese tänava nurgal. Projekt, 1996. Arhitektid Vilen Künnapu ja Ain Padrik

    Index Scriptorium Estoniae

    1997-01-01

    32-korruselise torni neljal esimesel korrusel on kaubamaja, järgmisel viiel korrusel parkla, siis tehnilise korruse järel on 14 korrusel bürooruumid, seejärel viiel korrusel korterid, järgnevastel korrustel bürood, restoran, baar jm.

  6. Contribution à l'étude des techniques de multiplication arboricole dans la ferme de démonstration ITAFV. Ain Temouchent

    OpenAIRE

    BOURICHA, Rym

    2015-01-01

    L'utilisation des porte-greffes en viticulture est devenue indispensable depuis l'invasion phylloxérique de 1885 en Algérie. Les vignes de Vitis Vin jfera cultivées à l'époque « franc de pied » ont été décimées une à une par les dégâts importants occasionnés par l'insecte sur les racines, entrainant à plus ou moins brève échéance la mort des ceps. Le greffage sur des porte-greffes résistants d'origine américaine (Riparie, Rupestris, Bericindieri) est devenu ainsi indispensable et ...

  7. Justiitsminister Langi umbusaldamine kogub hoogu / Tuuli Koch; kommenteerinud Andrus Ansip, AIn Seppik, Valdur Lahtvee, Karel Rüütli, Andres Herkel, Sven Mikser

    Index Scriptorium Estoniae

    Koch, Tuuli

    2009-01-01

    Reformierakonna valitsuspartner IRL ja opositsioon ei mõista justiitsminister Rein Langi otsust ajutise siseministrina kustutada küberrünnakuga seotud Sergei Markovi nimi Schengeni mustast nimekirjast

  8. It ain't over when it's over: The adoption and sustainability of minority protection rules in new EU member states

    Directory of Open Access Journals (Sweden)

    Liudmila Mikalayeva

    2009-12-01

    Full Text Available This paper conducts a multi-value Qualitative Comparative Analysis (QCA of the formal adoption and sustainability of minority protection rules in four new EU member states (Poland, Romania, Estonia, Latvia over a twelve-year period including pre- and post-accession phases (1997-2008 and five minority protection related issue areas (non-discrimination, language use, education, citizenship, integration of Roma based on four conditions (external incentives, government position, veto players, size of minorities, in order to investigate under which external and domestic conditions minority protection and non-discrimination measures are adopted, maintained or revoked in new member states before and after accession to the EU.

  9. Mööbel vajab nišše ja ekspordiauke. Vallutamist ootab vana Euroopa / Ain Alvela ; kommenteerinud Ari Lustila, Heido Vitsur, Priit Tamm

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2011-01-01

    Olukorrast mööbliturul: edukamad on olnud korpusmööbliga tegelevad ettevõtted. Arvamust avaldavad ASi Suwem turundusjuht Mart Nilson ja OÜ Bellus Furnitur tootmisjuht Rolf Kristian Relander. Diagrammid

  10. It ain't what you do, it's the way that you do it: a qualitative study of advice for young cannabis users.

    Science.gov (United States)

    Faulkner, Nathan; McCambridge, Jim; Slym, Renee L; Rollnick, Stephen

    2009-03-01

    Advice is a widely recommended and practised intervention with young drug users. Study of precisely how advice is given and received in any setting has, however, been limited. We qualitatively analysed 106 audio-recordings of advice sessions on cannabis use for young people within a randomised trial. Inductive data analysis was guided by a focus on practitioner behaviour which served to engage the active participation of the young drug user in the session. A cluster of 'Information Management' activities was identified together with an 'Interactive Orientation' evident in a series of specific behaviours. Participants were most successfully engaged when both were combined, understood here as 'Personalised Advice-giving'. These components identified in this exploratory study might assist further research in rectifying the absence of a solid empirical basis for effective practice in advice giving with young drug users and more widely.

  11. The atomic world spooky? It ain't necessarily so! emergent quantum mechanics, how the classical laws of nature can conspire to cause quantum-like behaviour

    CERN Document Server

    van Holten, Theo

    2017-01-01

    The present book takes the discovery that quantum-like behaviour is not solely reserved to atomic particles one step further. If electrons are modelled as vibrating droplets instead of the usually assumed point objects, and if the classical laws of nature are applied, then exactly the same behaviour as in quantum theory is found, quantitatively correct! The world of atoms is strange and quantum mechanics, the theory of this world, is almost magic. Or is it? Tiny droplets of oil bouncing round on a fluid surface can also mimic the world of quantum mechanics. For the layman - for whom the main part of this book is written - this is good news. If the everyday laws of nature can conspire to show up quantum-like phenomena, there is hope to form mental pictures how the atomic world works. The book is almost formula-free, and explains everything by using many sketches and diagrams. The mathematical derivations underlying the main text are kept separate in a -peer reviewed - appendix. The author, a retired professor ...

  12. It Ain't the Heat, It's the Humanity: Evidence and Implications of a Knowledge-Based Consensus on Man-Made Global Warming

    Science.gov (United States)

    Jacobs, P.; Cook, J.; Nuccitelli, D. A.

    2013-12-01

    One of the most worrisome misconceptions among the general public about climate change is a belief that scientists disagree not only about the cause of the present climate change, but also whether or not the planet is currently warming. Recent surveys have demonstrated that an overwhelming consensus exists, both within the scientific literature and among scientists with climate expertise, that the planet is warming and humans are driving this climatic change. This disconnect, or 'consensus gap', between scientific agreement and public belief has significant consequences for public understanding of the reality and cause of climate change, as well as support for potential solutions. Ensuring that the consensus message is not simply broadcast but is also accepted as legitimate by the public appears to be a primary education and communications opportunity. While the existence of a consensus is not itself evidence of a position's truth, according to Miller (2013) scientific consensus can be taken as evidence that a position is true if it is 'knowledge-based', satisfying the conditions of social calibration, apparent consilience of evidence, and social diversity. We demonstrate that the scientific consensus on anthropogenic climate change is knowledge-based, satisfying Miller's criteria. In so doing, we hope to increase confidence in its use as an education and communications tool, and assure the public of its validity. We show the consensus is socially calibrated, based on common evidential standards, ontological schemes, and shared formalism. We establish that consilience of evidence points overwhelmingly to the reality of anthropogenic climate change by examining the evidence from several perspectives. We identify unique fingerprints expected as a result of increased greenhouse forcing, eliminate potential natural drivers of climate change as the cause of the present change, and demonstrate the consistency of the observed climate response with known changes in natural and manmade forcings across a wide variety of indices. Finally, we determine that the consensus is socially diverse, being geographically and disciplinarily varied, supported within public and private institutions, and endorsed by research organizations as well as groups with obvious financial incentives to deny it, such as fossil fuel companies. Additionally, we briefly discuss examples of purported incorrect consensus in climate research, and detail how they fail to satisfy one or more aspects of Miller's criteria. We conclude by discussing the key role that knowledge-based consensus can potentially play in education, influencing public beliefs about climate change, and increasing support for solutions.

  13. 'It ain't what you do it's the way that you do it': lessons for health care from decommissioning of older people's services.

    Science.gov (United States)

    Robinson, Suzanne; Glasby, Jon; Allen, Kerry

    2013-11-01

    Public sector organisations are facing one of the most difficult financial periods in history and local decision-makers are tasked with making tough rationing decisions. Withdrawing or limiting services is an emotive and complex task and something the National Health Service has always found difficult. Over time, local authorities have gained significant experience in the closure of care homes - an equally complex and controversial issue. Drawing on local knowledge and best practice examples, this article highlights lessons and themes identified by those decommissioning care home services. We believe that such lessons are relevant to those making disinvestment decisions across public sector services, including health-care. The study employed semi-structured interviews with 12 Directors of Adult Social Services who had been highlighted nationally as having extensive experience of home closures. Interviews were conducted over a 2-week period in March 2011. Results from the study found that having local policy guidance that is perceived as fair and reasonable was advocated by those involved in home closures. Many local policies had evolved over time and had often been developed following experiences of home closures (both good and bad). Decisions to close care home services require a combination of strong leadership, clear strategic goals, a fair decision-making process, strong evidence of the need for change and good communication, alongside wider stakeholder engagement and support. The current financial challenge means that public sector organisations need to make tough choices on investment and disinvestment decisions. Any such decisions need to be influenced by what we know constitutes best practice. Sharing lessons and experiences within and between sectors could well inform and develop decision-making practices. © 2013 John Wiley & Sons Ltd.

  14. Just watching the game ain't enough: striatal fMRI reward responses to successes and failures in a video game during active and vicarious playing.

    Science.gov (United States)

    Kätsyri, Jari; Hari, Riitta; Ravaja, Niklas; Nummenmaa, Lauri

    2013-01-01

    Although the multimodal stimulation provided by modern audiovisual video games is pleasing by itself, the rewarding nature of video game playing depends critically also on the players' active engagement in the gameplay. The extent to which active engagement influences dopaminergic brain reward circuit responses remains unsettled. Here we show that striatal reward circuit responses elicited by successes (wins) and failures (losses) in a video game are stronger during active than vicarious gameplay. Eleven healthy males both played a competitive first-person tank shooter game (active playing) and watched a pre-recorded gameplay video (vicarious playing) while their hemodynamic brain activation was measured with 3-tesla functional magnetic resonance imaging (fMRI). Wins and losses were paired with symmetrical monetary rewards and punishments during active and vicarious playing so that the external reward context remained identical during both conditions. Brain activation was stronger in the orbitomedial prefrontal cortex (omPFC) during winning than losing, both during active and vicarious playing. In contrast, both wins and losses suppressed activations in the midbrain and striatum during active playing; however, the striatal suppression, particularly in the anterior putamen, was more pronounced during loss than win events. Sensorimotor confounds related to joystick movements did not account for the results. Self-ratings indicated losing to be more unpleasant during active than vicarious playing. Our findings demonstrate striatum to be selectively sensitive to self-acquired rewards, in contrast to frontal components of the reward circuit that process both self-acquired and passively received rewards. We propose that the striatal responses to repeated acquisition of rewards that are contingent on game related successes contribute to the motivational pull of video-game playing.

  15. Multi-scale Fracture Patterns Associated with a Complex Anticline Structure: Insights from Field Outcrop Analogues of the Jebel Hafit Pericline, Al Ain-UAE

    Science.gov (United States)

    Kokkalas, S.; Jones, R. R.; Long, J. J.; Zampos, M.; Wilkinson, M. W.; Gilment, S.

    2017-12-01

    The formation of folds and their associated fracture patterns plays an important role in controlling the migration and concentration of fluids within the upper crust. Prediction of fracture patterns from various fold shapes and kinematics still remains poorly understood in terms of spatial and temporal distribution of fracture sets. Thus, a more detailed field-based multi scale approach is required to better constrain 3D models of fold-fracture relationships, which are critical for reservoir characterization studies. In order to generate reservoir-scale fracture models representative fracture properties across a wider range of scales are needed. For this reason we applied modern geospatial technologies, including terrestrial LiDAR, photogrammetry and satellite images in the asymmetric, east verging, four-way closure Jebel Hafit anticline, in the eastern part of the United Arab Emirates. The excellent surface outcrops allowed the rapid acquisition of extensive areas of fracture data from both limbs and fold hinge area of the anticline, even from large areas of steep exposure that are practically inaccessible on foot. The digital outcrops provide longer 1D transects, and 2D or 3D surface datasets and give more robust data, particularly for fracture heights, lengths, spacing, clustering, termination and connectivity. The fracture patterns across the folded structure are more complex than those predicted from conceptual models and geomechanical fracture modeling. Mechanical layering, pre-existing structures and sedimentation during fold growth seem to exert a critical influence in the development of fracture systems within Jebel Hafit anticline and directly affect fracture orientations, spacing/intensity, segmentation and connectivity. Seismic and borehole data provide additional constraints on the sub-surface fold geometry and existence of large-scale thrusting in the core of the anticline. The complexity of the relationship between fold geometry and fracture intensity is presented and the implications for prediction of fracture networks in naturally fractured reservoirs are discussed.

  16. Should providers of treatment be regarded as a random factor? If it ain't broke, don't "fix" it: a comment on Siemer and Joormann (2003).

    Science.gov (United States)

    Serlin, Ronald C; Wampold, Bruce E; Levin, Joel R

    2003-12-01

    In their criticism of B. E. Wampold and R. C. Serlin's analysis of treatment effects in nested designs, M. Siemer and J. Joormann argued that providers of services should be considered a fixed factor because typically providers are neither randomly selected from a population of providers nor randomly assigned to treatments, and statistical power to detect treatment effects is greater in the fixed than in the mixed model. The authors of the present article argue that if providers are considered fixed, conclusions about the treatment must be conditioned on the specific providers in the study, and they show that in this case generalizing beyond these providers incurs inflated Type I error rates.

  17. Protein (Cyanobacteria): 146367 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ain protein Halothece sp. PCC 7418 MSLVSFSELVTGAKEGKVVSFPTDTVPALAVRPDCAEAIFELKQREATKPLILMGASPEQLWDYVEGTPEEFQ...VWEQTAQQYFPGQLTLVLPSSSLVRPEVNPKTADTIGIRVPDCAIARQVFASTGVLATTSANRSGQPPLTTPEAINQAFPEVLVLADTEPIVSSGLPSTVAKWTGQDWEILRQGNIYLK ...

  18. Gene : CBRC-GGOR-01-1448 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ain Friedlin] 1e-79 49% MCLALGSAGTADDVKLHPVACADTARSTPGTSAPSTPGTSAPSTPGTSAPSTSGISAPSTSGTSAPSTLGTSAPSKPGTSAPSKPGISAPSTSGISAPSTSGTSAPS...TSGTSAPSTPGTSAPSKPGTSAPSKPGISAPYTPGTSAPSTLGTSAPSTPGTSAPSTPGTSAPSKPGTSAPSKPGTSAPS...TPGTSAPSTLGTSAPSTPGTTAPSTAGTSAPSTSGTSAPSTSGTSAPSKPTTSAPYTPGTSAPSIPGTSAPSTTGTSAPSTPGTSAPSTPGTSAPSKPGTSAPS...TPGTSAPSTLGTSAPSTPGTSAPSTPGTSAPSKPGTSAPSMSGTSAPSTPGTSVPSKAGTSAPVDPGVLWGLERPLTDTEGRWLPPYVLL

  19. Operation disturbance by wind turbines of fixed radars from civil aviation, national defense, Meteo-France, and maritime and fluvial harbors and navigation (PNM); Perturbations par les aerogenerateurs du fonctionnement des radars fixes de l'Aviation civile, de la Defense nationale, de Meteo-France et des ports et navigation maritime et fluviale (PNM)

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2008-07-01

    Wind turbines and the movement of their blades can have penalizing effects on the processing of radars data. These disturbances can have a strong impact on the air, maritime and fluvial safety, on the protection of the territory and on the prevention of natural hazards. Reports made by the national agency of frequencies (ANFR) have established recommendations for the definition of protection areas (5 km) and coordination areas (5 to 30 km) which have to be taken into consideration prior to any project of wind turbine. (J.S.)

  20. Operation disturbance by wind turbines of fixed radars from civil aviation, national defense, Meteo-France, and maritime and fluvial harbors and navigation (PNM)

    International Nuclear Information System (INIS)

    2008-01-01

    Wind turbines and the movement of their blades can have penalizing effects on the processing of radars data. These disturbances can have a strong impact on the air, maritime and fluvial safety, on the protection of the territory and on the prevention of natural hazards. Reports made by the national agency of frequencies (ANFR) have established recommendations for the definition of protection areas (5 km) and coordination areas (5 to 30 km) which have to be taken into consideration prior to any project of wind turbine. (J.S.)

  1. Fabrication and characterization of aluminum nitride/boron nitride nanocomposites by carbothermal reduction and nitridation of aluminum borate powders.

    Science.gov (United States)

    Kusunose, Takafumi; Sakayanagi, Nobuaki; Sekino, Tohru; Ando, Yoichi

    2008-11-01

    In order to fabricate aluminum nitride/boron nitride (AIN/BN) nanocomposites by pressureless sintering, the present study investigated the synthesis of AIN-BN nanocomposite powders by carbothermal reduction and nitridation of aluminum borate powders. Homogeneous mixtures of alumina (Al2O3), boric acid (H3BO3), and carbon powder were used to synthesize AIN/BN nanocomposite powders containing 10 and 20 vol% BN. Aluminum borate was produced by reacting Al2O3 and B2O3 above 800 degrees C, and AIN and turbostratic BN (t-BN) were produced by reacting aluminum borate with carbon powder and nitrogen gas at 1500 degrees C. Carbothermal reduction followed by nitridation yielded an AIN/BN nanocomposite powder composed of nanosized AIN and t-BN. By pressureless sintering nanocomposite AIN/BN powders containing 5 wt% Y22O3, AIN/BN nanocomposites were obtained without compromising the high thermal conductivity and high hardness.

  2. Kirjutaski endale elu pileti / Maarja Kangro

    Index Scriptorium Estoniae

    Kangro, Maarja, 1973-

    2010-01-01

    Arvustus: Pessoa, Fernando. Sõnum / tõlkinud Ain Kaalep, Maarja Kaplinski, Jüri Talvet ja Anneli Tuulik ; koost. Ain Kaalep ja Jüri Talvet. Tartu : Tartu Ülikooli Kirjastus, 2010. (Maailmakirjanduse tõlkevaramu)

  3. Valdmanni rahaseis peo peal / Peeter Raidla

    Index Scriptorium Estoniae

    Raidla, Peeter, 1955-

    2007-01-01

    Tallinna linnavalitsuse kommunaalameti juhataja Ain Valdmanni on mitmel korral tabanud korruptsioonisüüdistused. Vt. samas: Valdmanni ärid linna klientidega; Kronoloogia: Ain Valdmann on võtnud kaheksa aasta jooksul suuri laene

  4. Análise comparativa dos meios lubri-refrigerantes na furação do ferro fundido vermicular com brocas helicoidais de metal duro revestidas com TiAIN

    OpenAIRE

    Bossardi, Júlio Celso dos Santos

    2008-01-01

    Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro Tecnológico. Programa de Pós-Graduação em Engenharia Mecânica O aumento da eficiência térmica, aliado à redução do peso do motor, caracteriza o bloco de motor a diesel, em cuja fabricação é cada vez mais utilizado o ferro fundido vermicular (CGI). O emprego desse material viabiliza a construção de veículos com motores mais eficientes, no sentido de diminuir tanto o consumo de combustível quanto a emissão de poluentes, ...

  5. Análise da furação do ferro fundido vermicular com brocas de metal-duro com canais retos revestidas com TiN e TiAIN

    OpenAIRE

    Andrade, Cássio Luiz Francisco de

    2005-01-01

    Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro Tecnológico. Programa de Pós-Graduação em Engenharia Mecânica A furação, com o uso de brocas helicoidais ou de canais retos, é uma das maiores operações em tempo efetivo de corte na usinagem de um bloco de motor, possuindo assim grande influência sobre os custos de ferramentas de corte deste produto. Estes custos têm o seu valor dobrado se considerada a aplicação do ferro fundido vermicular como material alternativo ao...

  6. Producción de AIN por Nitruración Iónica y Deposición Física de Vapor en la Aleación de Aluminio 7022

    OpenAIRE

    Figueroa López, Ulises

    2005-01-01

    En este trabajo se presentan los resultados obtenidos del estudio de dos tecnologías propuestas para mejorar las propiedades tribológicas de una aleación de aluminio 7022-T6: mediante la producción de nitruro de aluminio por Nitruración Asistida con Plasmás o por Deposición Física de Vapor en modo reactivo con nitrógeno a partir de blancos de aluminio. Ambas tecnologías buscan generar un sistema consistente en una fase dura como el nitruro de aluminio, AlN, sobre el substrato blando de la ale...

  7. "It Don't Mean a Thing if It Ain't Got that Swing"- an Alternative Concept for Understanding the Evolution of Dance and Music in Human Beings.

    Science.gov (United States)

    Richter, Joachim; Ostovar, Roya

    2016-01-01

    The functions of dance and music in human evolution are a mystery. Current research on the evolution of music has mainly focused on its melodic attribute which would have evolved alongside (proto-)language. Instead, we propose an alternative conceptual framework which focuses on the co-evolution of rhythm and dance (R&D) as intertwined aspects of a multimodal phenomenon characterized by the unity of action and perception. Reviewing the current literature from this viewpoint we propose the hypothesis that R&D have co-evolved long before other musical attributes and (proto-)language. Our view is supported by increasing experimental evidence particularly in infants and children: beat is perceived and anticipated already by newborns and rhythm perception depends on body movement. Infants and toddlers spontaneously move to a rhythm irrespective of their cultural background. The impulse to dance may have been prepared by the susceptibility of infants to be soothed by rocking. Conceivable evolutionary functions of R&D include sexual attraction and transmission of mating signals. Social functions include bonding, synchronization of many individuals, appeasement of hostile individuals, and pre- and extra-verbal communication enabling embodied individual and collective memorizing. In many cultures R&D are used for entering trance, a base for shamanism and early religions. Individual benefits of R&D include improvement of body coordination, as well as painkilling, anti-depressive, and anti-boredom effects. Rhythm most likely paved the way for human speech as supported by studies confirming the overlaps between cognitive and neural resources recruited for language and rhythm. In addition, dance encompasses visual and gestural communication. In future studies attention should be paid to which attribute of music is focused on and that the close mutual relation between R&D is taken into account. The possible evolutionary functions of dance deserve more attention.

  8. "It don't mean a thing if it ain't got that swing"– an Alternative Concept for Understanding the Evolution of Dance and Music in Human Beings

    Directory of Open Access Journals (Sweden)

    Joachim Richter

    2016-10-01

    Full Text Available The functions of dance and music in human evolution are a mystery. Current research on the evolution of music has mainly focused on its melodic attribute which would have evolved alongside proto-language. Instead, we propose an alternative conceptual framework which focuses on the co-evolution of rhythm and dance (R&D as intertwined aspects of a multimodal phenomenon characterized by the unity of action and perception. Reviewing the current literature from this viewpoint we propose the hypothesis that R&D have co-evolved long before other musical attributes and (proto-language. Our view is supported by increasing experimental evidence particularly in infants and children: beat is perceived and anticipated already by newborns and rhythm perception depends on body movement. Infants and toddlers spontaneously move to a rhythm irrespective of their cultural background. If this behavior is universal, R&D must have an essential function in human evolution. Conceivable evolutionary functions of R&D include sexual attraction, transmission of mating signals, synchronization of many individuals, social bonding, appeasement of hostile individuals, pre- and extra-verbal communication, improvement of body coordination, as well as pain killing, anti-depressive, and anti-boredom functions. The impulse to dance may have been prepared by the susceptibility of infants to be soothed by rocking. Dance enables embodied individual and collective memorizing; in many cultures R&D are used for entering trance, a base for shamanism and early religions. Rhythm is necessary to codify human speech and dance encompasses gesture. In future studies attention should be paid to which attribute of music is focused and that the close mutual relation between R&D is taken into account. The possible evolutionary functions of dance deserve more attention.

  9. Stiiliharjutused / Raymond Queneau ; prantsuse k. tlk. Jana Porila, värsstekstid tlk. Ain Kaalep, Toim. Hasso Krull, Järelsõna: M. V. [Märt Väljataga

    Index Scriptorium Estoniae

    Queneau, Raymond

    1995-01-01

    Sisu: Märkmed; Kahekordselt; Litootes; Metafoorselt; Tagasivaateline; Üllatused; Unenägu; Prognoosid; Vikerkaar; Kõhklused; Täpsustused; Subjektiivne pool; Teistpidi isiklik; Jutustus; Liitsõnad; Eitus; Animism; Anagrammid; Ametlik kiri; Annotatsioon; Teadmatus; Aleksandriinid; Mina igatahes; Hüüatused; Ja siis; Ülev; Ülekuulamine; Komöödia; Vahelaused; Kummituslik; Kõnetlus; Sonett; Gustatiivne; Taktiilne; Telegraafiline; Tanka; Kirjeldus; Hüüdsõnad; Ootamatu

  10. If It Ain't Broke, Why Fix It? Framework and Processes for Engaging in Constructive Institutional Development and Renewal in the Context of Increasing Standards, Assessments, and Accountability for University-Based Teacher Preparation

    Science.gov (United States)

    Lit, Ira; Nager, Nancy; Snyder, Jon David

    2010-01-01

    In this article, the authors offer a descriptive essay outlining the framework and processes of a five-year institutional renewal effort at Bank Street College of Education. Extended the opportunity to participate in the "Teachers for a New Era" (TNE) initiative, a multi-year, multi-million dollar effort to enhance and "radically…

  11. T'ain't what you say, it's the way that you say it--left insula and inferior frontal cortex work in interaction with superior temporal regions to control the performance of vocal impersonations.

    Science.gov (United States)

    McGettigan, Carolyn; Eisner, Frank; Agnew, Zarinah K; Manly, Tom; Wisbey, Duncan; Scott, Sophie K

    2013-11-01

    Historically, the study of human identity perception has focused on faces, but the voice is also central to our expressions and experiences of identity [Belin, P., Fecteau, S., & Bedard, C. Thinking the voice: Neural correlates of voice perception. Trends in Cognitive Sciences, 8, 129-135, 2004]. Our voices are highly flexible and dynamic; talkers speak differently, depending on their health, emotional state, and the social setting, as well as extrinsic factors such as background noise. However, to date, there have been no studies of the neural correlates of identity modulation in speech production. In the current fMRI experiment, we measured the neural activity supporting controlled voice change in adult participants performing spoken impressions. We reveal that deliberate modulation of vocal identity recruits the left anterior insula and inferior frontal gyrus, supporting the planning of novel articulations. Bilateral sites in posterior superior temporal/inferior parietal cortex and a region in right middle/anterior STS showed greater responses during the emulation of specific vocal identities than for impressions of generic accents. Using functional connectivity analyses, we describe roles for these three sites in their interactions with the brain regions supporting speech planning and production. Our findings mark a significant step toward understanding the neural control of vocal identity, with wider implications for the cognitive control of voluntary motor acts.

  12. Cultural tourism 2011 - Projekt Central Baltic INTERREGIV A Project Cultural Tourism 2011 - Developing cultural tourism as a joint network in Capitals of Culture 2011 võtab kokku ja plaanib jätku / Maritta Hiltunen, Ain Hinsberg

    Index Scriptorium Estoniae

    Hinsberg, Ain

    2012-01-01

    Soome organisatsiooni Matkailun ja elämystuotannon osaamisklusteri (OSKE) algatatud koostööprojektist Tallinna ja Turu kultuuripealinna vahel, mille laiem eesmärk on edendada Läänemere regiooni kultuuriturismi alast koostööd ning luua Läänemere regiooni hõlmav kultuuriturismi bränd

  13. Uudised : Vello Pähn Savonlinnas. Eri Klas pärast juubelit. Ain Anger Mirjam Helini konkursil. Türnpu sünnipäevakontsert / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    1999-01-01

    V. Pähn dirigeeris Savonlinna ooperifestivalil Gounod" ooperit "Faust". E.Klas erinevate orkestrite ees juuni-september 1999. 8.-20. augustini Helsingis toimunud IV rahvusvahelisest M. Helini konkursist, kus osales A. Anger. 13.augustil tähistati K. Türnpu 134. sünniaastapäeva kontserdiga Tuulna külas Keila vallas

  14. Contribution of G.I.S. for the survey and the management of water ...

    African Journals Online (AJOL)

    Contribution of G.I.S. for the survey and the management of water resources in the basin “Benhandjir – Tirkount” (Ain Sefra) – mounts of Ksour - Saharian Atlas ... Journal of Fundamental and Applied Sciences ... Keywords: Ain Sefra – G.I.S. - water resources - lower cretaceous sandstone - fault “Ras Touil-Ain Sefra” ...

  15. Anterior interosseous nerve syndrome diagnosis and intraoperative findings: A case report

    Directory of Open Access Journals (Sweden)

    Abdulla Aljawder

    2016-01-01

    Conclusion: Clinical suspicion should arise in the presence of isolated paralysis of the AIN-supplied muscles. MRI and electrodiagnostic studies will confirm the diagnosis and identify the etiology. The optimal treatment of AIN syndrome has not been established. We recommend surgical intervention in confirmed AIN syndrome from compression neuropathy, refractive to conservative therapy.

  16. Download this PDF file

    African Journals Online (AJOL)

    Professor of Genetics (Cytogenetics), Faculty of Medicine, Ain Shams University, Cairo, Egypt. Hosam A Abdel-Ghany. Consultant of Medical Human Genetics, Medical Genetic Center, Ain Shams University, Cairo, Egypt. Nermin S Elsayed. Consultant of Medical Human Genetics, Medical Genetics Center, Ain Shams ...

  17. Presence or Absence of Significant HPVE4 Expression in High-grade Anal Intraepithelial Neoplasia With p16/Ki-67 Positivity Indicates Distinct Patterns of Neoplasia: A Study Combining Immunohistochemistry and Laser Capture Microdissection PCR.

    Science.gov (United States)

    Leeman, Annemiek; Pirog, Edyta C; Doorbar, John; van de Sandt, Miekel M; van Kemenade, Folkert J; Jenkins, David; Quint, Wim G V

    2018-04-01

    Progression of anal intraepithelial neoplasia (AIN) involves transition from productive to transforming human papillomavirus (HPV) infection. Grading aims to distinguish productive low-grade AIN from high-grade anal intraepithelial neoplasia (HGAIN) with risk of cancer. We describe immunohistochemical patterns in AIN adding a novel marker for initiation of the productive phase of the HPV life cycle (panHPVE4) to those for cell cycle activity (Ki-67) and transforming activity of HPVE7 gene (p16). We studied 67 anal biopsies for suspected anal neoplasia (17 normal, 15 AIN1, 20 AIN2, 15 AIN3) from 54 men who have sex with men at New York Presbyterian Hospital, USA. Two pathologists generated consensus AIN and immunogrades. Whole tissue and laser capture microdissection samples from multiple HPV-infected biopsies were tested for HPV with SPF10-PCR-DEIA-LiPA25, version 1. (Para)basal Ki-67 expression distinguished normal from AIN (≥lower-third Ki-67) with sensitivity 0.92 and specificity 1.0. Ki-67 did not distinguish grades of AIN. Null/patchy p16 versus diffuse ≥lower-third patterns discriminated HGAIN (sensitivity, 1.0; specificity, 0.84). There was marked heterogeneity in E4 expression within HGAIN. Most AIN2 (14/20) was E4 versus 0/15 AIN3 (sensitivity, 0.70; specificity 1.0). HPV was detected in 63 (94%) biopsies, with 49 (77.8%) high-risk HPV. HPV16 was the most frequent (13%). Multiple HPV genotypes were found in 15 (24%) biopsies and laser capture microdissection -polymerase chain reaction confirmed specific HPV types in E4 +/- AIN. Although Ki-67 discriminated AIN and p16 HGAIN, E4/p16 staining shows that most AIN2 is different from transformed AIN3 in showing both entry into productive HPV infection and transforming activity.

  18. Recovery from hospital-acquired anemia after acute myocardial infarction and effect on outcomes.

    Science.gov (United States)

    Salisbury, Adam C; Kosiborod, Mikhail; Amin, Amit P; Reid, Kimberly J; Alexander, Karen P; Spertus, John A; Masoudi, Frederick A

    2011-10-01

    New-onset, hospital-acquired anemia (HAA) during acute myocardial infarction (AMI) is independently associated with poor outcomes. The patterns of recovery from HAA after AMI and their association with mortality and health status are unknown. In the prospective 24-center Translational Research Investigating Underlying disparities in acute myocardial infarction Patients' Health Status (TRIUMPH) registry, we identified 530 patients with AMI and HAA (defined as normal hemoglobin at admission with the development of anemia by discharge) who had a repeat, protocol-driven hemoglobin measurement at 1 month after discharge. The 1-month measures were used to define persistent (persistent anemia) and transient (anemia resolved) HAA. The patients' health status was assessed at 1, 6, and 12 months after AMI using the Short-Form 12 Physical Component Summary, and the health status of patients with persistent and transient HAA was compared using multivariate repeated measures regression analysis. Mortality was compared using the log-rank test and proportional hazards regression analysis. Overall, 165 patients (31%) developed persistent HAA. The adjusted mean Short-Form 12 Physical Component Summary scores at the follow-up visit were significantly lower in those with persistent HAA than in those with transient HAA (-2.0 points, 95% confidence interval -3.6 to -0.3; p = 0.02). During a median follow-up of 36 months, the crude mortality (13% vs 5%, p = 0.002) and multivariate-adjusted mortality (hazard ratio 2.08, 95% confidence interval 1.02 to 4.21, p = 0.04) was greater in patients with persistent HAA. In conclusion, HAA persists 1 month after discharge in nearly 1 of 3 patients and is associated with worse health status and greater mortality. Additional investigation is needed to understand whether HAA prevention, recognition, and treatment, particularly among those with persistent HAA, will improve outcomes. Copyright © 2011 Elsevier Inc. All rights reserved.

  19. Recovery from Hospital-Acquired Anemia after Acute Myocardial Infarction and Effect on Outcomes

    OpenAIRE

    Salisbury, Adam C.; Kosiborod, Mikhail; Amin, Amit P.; Reid, Kimberly J.; Alexander, Karen P.; Spertus, John A.; Masoudi, Frederick A.

    2011-01-01

    New onset, hospital-acquired anemia (HAA) during acute myocardial infarction (AMI) is independently associated with poor outcomes. Patterns of recovery from HAA after AMI and their association with mortality and health status are unknown. In the prospective 24-center TRIUMPH registry, we identified 530 AMI patients with HAA (defined as normal hemoglobin at admission with development of anemia by discharge) who had repeat, protocol-driven hemoglobin measurement 1 month after discharge. The 1-m...

  20. Five Things You Should Know About Soldier - Robot Teaming

    Science.gov (United States)

    2008-12-01

    challenging applications such as moving vehicles. Haas, Stachowiak , White, Pillalamarri, Feng (2007) conducted a field study at the ARL to determine...Display Type M ea n W or kl oa d R at in g Figure 3: Mean workload rating as a function of display type Haas, Stachowiak , White, Pillalamarri...Navigation. Manuscript submitted for publication, U.S. Army Research Laboratory, Aberdeen Proving Ground, MD. Haas, E.C., Stachowiak , C., White, T

  1. Human-Robot Interaction Literature Review

    Science.gov (United States)

    2012-03-01

    consideration for some military applications is that the operator will be located in a mobile environment. Haas and Stachowiak (2007) discuss the...age groups. Participants in their 20s had significantly shorter response times than those in their 40s (Haas & Stachowiak , 2007). The results also...had higher response times when multimodal cueing was used, compared to both tactile and audio modal cueing (Haas & Stachowiak , 2007). Workload results

  2. Pressure-assisted electrokinetic injection for on-line enrichment in capillary electrophoresis-mass spectrometry: a sensitive method for measurement of ten haloacetic acids in drinking water.

    Science.gov (United States)

    Zhang, Huijuan; Zhu, Jiping; Aranda-Rodriguez, Rocio; Feng, Yong-Lai

    2011-11-07

    Haloacetic acids (HAAs) are by-products of the chlorination of drinking water containing natural organic matter and bromide. A simple and sensitive method has been developed for determination of ten HAAs in drinking water. The pressure-assisted electrokinetic injection (PAEKI), an on-line enrichment technique, was employed to introduce the sample into a capillary electrophoresis (CE)-electrospray ionization-tandem mass spectrometry system (ESI-MS/MS). HAAs were monitored in selected reaction monitoring mode. With 3 min of PAEKI time, the ten major HAAs (HAA10) in drinking water were enriched up to 20,000-fold into the capillary without compromising resolution. A simple solid phase clean-up method has been developed to eliminate the influence of ionic matrices from drinking water on PAEKI. Under conditions optimized for mass spectrometry, PAEKI and capillary electrophoresis, detection limits defined as three times ratio of signal to noise have been achieved in a range of 0.013-0.12 μg L(-1) for ten HAAs in water sample. The overall recoveries for all ten HAAs in drinking water samples were between 76 and 125%. Six HAAs including monochloro- (MCAA), dichloro- (DCAA), trichloro- (TCAA), monobromo- (MBAA), bromochloro- (BCAA), and bromodichloroacetic acids (BDCAA) were found in tap water samples collected. Crown Copyright © 2011. Published by Elsevier B.V. All rights reserved.

  3. Table 1. Real-time qRT-PCR verification of eight DEGs. Gene ...

    Indian Academy of Sciences (India)

    (TCA)8. GGGTCCGAGTGCCTTAATTT. TGTGGGATGTGTTGTGTGTG 60.32 59.88. HAAS VR 415 BMK.5319. (T)13. GATTCACGTGTGCCATCATC TGGACAATTCATTCAAAAAGAAAA 59.93 59.87 372. HAAS_VR_417 BMK.5329. (AG)6. ATCCCGGGGTGAAAAATAAA AGAAATGGTGCAATGGGTTC 60.36 59.80 157. (GAC)5 ...

  4. NCBI nr-aa BLAST: CBRC-ETEL-01-1481 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ETEL-01-1481 ref|YP_484687.1| Chromosome segregation protein SMC [Rhodopseudomonas... palustris HaA2] gb|ABD05776.1| Chromosome segregation protein SMC [Rhodopseudomonas palustris HaA2] YP_484687.1 4.8 29% ...

  5. NCBI nr-aa BLAST: CBRC-TSYR-01-1170 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-1170 ref|YP_483908.1| hypothetical protein RPB_0286 [Rhodopseudomonas ...palustris HaA2] gb|ABD04997.1| Protein of unknown function DUF214 [Rhodopseudomonas palustris HaA2] YP_483908.1 0.18 26% ...

  6. NCBI nr-aa BLAST: CBRC-DDIS-04-0046 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DDIS-04-0046 ref|YP_487907.1| hypothetical protein RPB_4309 [Rhodopseudomonas ...palustris HaA2] gb|ABD08996.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2] YP_487907.1 2e-24 36% ...

  7. NCBI nr-aa BLAST: CBRC-OANA-01-2190 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-2190 ref|YP_484804.1| diguanylate phosphodiesterase [Rhodopseudomonas ...palustris HaA2] gb|ABD05893.1| diguanylate phosphodiesterase [Rhodopseudomonas palustris HaA2] YP_484804.1 3.2 32% ...

  8. Resonance Fluorescence of Many Interacting Adatoms at a Metal Surface.

    Science.gov (United States)

    1983-06-01

    of the system, one can write a total Hamiltonian as HA + B + AB + HAA HABA + HAR HBB + HAF (7) HA and H are the unperturbed Hamiltonians for the...adatom-plasmon interaction may be further broadened via HAA and HABA in which the collisional effects may be significant for a high-coverage system and/or

  9. International Conference on Deformation, Yield and Fracture of Polymers (9th) Held in Cambridge, UK on 11-14 April, 1994. Conference Papers

    Science.gov (United States)

    1994-01-01

    and (b) Rohm & Haas Paraloid BTA 753, a rubber-based modifier in which the particles consist of a polybutadiene core and a PMMA shell. The modifier was...core/shell latex particles comprised of a methacrylated butadiene-styrene copolymer with acid functionality from Rohm & Haas Co [ Paraloid EXL-261 I

  10. Audio Cues to Assist Visual Search in Robotic System Operator Control Unit Displays

    Science.gov (United States)

    2005-12-01

    Christopher C. Stachowiak , and Michael A. Lattin ARL-TR-3632 December 2005 Approved for...Assist Visual Search in Robotic System Operator Control Unit Displays Ellen C. Haas, Ramakrishna S. Pillalamarri, Christopher C. Stachowiak , and...5e. TASK NUMBER 6. AUTHOR(S) Ellen C. Haas, Ramakrishna S. Pillalamarri, Christopher C. Stachowiak , and Michael A. Lattin (all of ARL

  11. Effects of Tactile, Visual, and Auditory Cues About Threat Location on Target Acquisition and Attention to Visual and Auditory Communications

    Science.gov (United States)

    2006-08-01

    When Haas, Pillalamarri, Stachowiak , and Lattin (2005) presented target location information in plus and minus degrees (e.g., “Target minus 15 degrees...Aberdeen Proving Ground, MD, 2005. Haas, E. C.; Pillalamarri, R. S.; Stachowiak , C. C.; Lattin, M. A. Audio Cues to Assist Visual Search in

  12. Extreme Scalability: Designing Interfaces and Algorithms for Soldier-Robotic Swarm Interaction, Year 2

    Science.gov (United States)

    2010-06-01

    Christopher Stachowiak , Susan Hill, and Krishna Pillalamarri ARL-TR-5222 June 2010 Approved for...Interfaces and Algorithms for Soldier-Robotic Swarm Interaction, Year 2 Ellen C. Haas, Christopher Stachowiak , Susan Hill, and Krishna Pillalamarri Human...Haas, Susan Hill, Christopher Stachowiak , Krishna Pillalamarri, and MaryAnne Fields 5d. PROJECT NUMBER 5e. TASK NUMBER 5f. WORK UNIT NUMBER

  13. "Kurja lillede" kuus ärakeelatud luuletust / Charles Baudelaire ; saatesõna: Marek Tamm

    Index Scriptorium Estoniae

    Baudelaire, Charles

    2000-01-01

    Sisu: Kalliskivid / tlk. Ain Kaalep ; Lethe / tlk. Märt Väljataga ; Temale, kes on liiga rõõmus / tlk. Ain Kaalep ; Lesbos / tlk. Ilmar Laaban ; Äraneetud naised (Delphine ja Hyppolyte) / tlk. Ain Kaalep ; Vampiiri metamorfoosid / tlk. August Sang. Orig.: Les Bijoux ; Le Léthé ; A celle qui est trop gaie ; Lesbos ; Femmes damnées. Delphine et Hippolyte ; Les Métamorphoses du vampire

  14. Aluminium nitrate ceramics: A potential UV dosemeter material

    DEFF Research Database (Denmark)

    Trinkler, L.; Bøtter-Jensen, L.; Berzina, B.

    2002-01-01

    The ceramic material AIN-Y2O3 is proposed as a potential ultraviolet radiation (UVR) dosemeter using optically stimulated luminescence (OSL) and thermally stimulated luminescence (TL). Experimental studies have shown that AIN ceramics exhibit attractive characteristics suitable for practical UV...... of Al2O3:C; and (4) a large dynamic range TL signal (5 orders of magnitude). Although there is relatively high fading, it is demonstrated that AIN is a feasible material for UVR dosimetry using short integration times....

  15. Flip Chip on Organic Substrates: A Feasibility Study for Space Applications

    Science.gov (United States)

    2017-03-01

    ain opens were 50 hours. The umption due to those observed erature storage high level of also consistent Underfill B. die each of the subjected...to for each of the performed in Condition B, c between hot ain continuity ed among the rfill materials erfill exhibited d Underfill B die size and...fast ramp rate p chip solder st ramp rate ain coarsening . of th expo phen close cyclin form Fig

  16. Análisis coste-efectividad del empleo de celecoxib en el tratamiento de la artrosis

    OpenAIRE

    Moreno A.; Vargas E.; Soto J.; Rejas J.

    2003-01-01

    Antecedentes: Los antiinflamatorios no esteroideos (AINE), utilizados en el tratamiento de la artrosis, pueden producir reacciones adversas gastrointestinales (GI) graves. Celecoxib, un inhibidor específico de la ciclooxigenasa 2 (COX-2), ha demostrado una eficacia equivalente a los AINE convencionales con un mejor perfil de tolerabilidad y seguridad. Objetivo: La finalidad de este estudio ha sido realizar un análisis coste-efectividad sobre el uso de celecoxib frente a los AINE clásicos en e...

  17. Análisis coste-efectividad del empleo de celecoxib en el tratamiento de la artrosis Cost-effectiveness analysis of the use of celecoxib for the treatment of osteoarthritis

    OpenAIRE

    A. Moreno; E. Vargas; J. Soto; J. Rejas

    2003-01-01

    Antecedentes: Los antiinflamatorios no esteroideos (AINE), utilizados en el tratamiento de la artrosis, pueden producir reacciones adversas gastrointestinales (GI) graves. Celecoxib, un inhibidor específico de la ciclooxigenasa 2 (COX-2), ha demostrado una eficacia equivalente a los AINE convencionales con un mejor perfil de tolerabilidad y seguridad. Objetivo: La finalidad de este estudio ha sido realizar un análisis coste-efectividad sobre el uso de celecoxib frente a los AINE clásicos en e...

  18. ORF Alignment: NC_000868 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ain Orsay) ... Length = 133 ... Query: 7 ... MSQYLDEFLADARDRIDSLSNAILTLEKIVKEGG...SEEEKAELINQIFRDAHTLKGTAATM 66 ... MSQYLDEFLADARDRIDSLSNAILTLEKIVKEGGSEEEKAELINQIFRDAHTLKGTAATM Sbjct:... 1 ... MSQYLDEFLADARDRIDSLSNAILTLEKIVKEGGSEEEKAELINQIFRDAHTLKGTAATM 60 ... Query: 127 DLFRRADEFLQ 137 ... DLFRRADEFLQ Sbjct: 121 DLFRRADEFLQ 131

  19. Kihutav politseijuht Antropov testis Saaremaal Hummerit / Risto Berendson, Tuuli Koch

    Index Scriptorium Estoniae

    Berendson, Risto, 1975-

    2003-01-01

    Politsei pressishefi sõnul testis politseijuht Robert Antropov Saaremaal julgestuspolitsei tarbeks maastikuautot Hummer. Endise politseijuhi Ain Seppiku kommentaare. Tabel: Tavaline politseimaastur võrreldes Hummeriga

  20. Simple Comb Generator Design for SWaP Constrained Applications

    Science.gov (United States)

    2016-01-26

    coefficients ck x = −j Ain πk [1− (−1)k], (1) where Ain is the maximum output voltage and k is the frequency number. Since the function exhibits even...y(t) = ∞∑ n=−∞ Aoute −α(t−nT0)u(t− nT0), (3) where Aout is a scaled version of the input voltage Ain , α is the decay rate that controls the pulse...of crystal oscillators by Fox Electronics and was housed in a small surface mount package. This part provided an amplitude, Ain , of 1.0 V, with an

  1. Revizorõ sherstjat tshinovnikov / Jüri Kütt

    Index Scriptorium Estoniae

    Kütt, Jüri

    2001-01-01

    Tallinna linnavolikogu revisjonikomisjoni esimees Jaana Padrik, komisjoni liige Ain Seppik ja volikogu esimees Rein Voog vastasid ajakirjanike küsimustele turvalisuse ja integratsiooniameti tegevuse kohta

  2. Kaks debüüti / Lilian Vellerand

    Index Scriptorium Estoniae

    Vellerand, Lilian, 1932-

    1997-01-01

    "Shakespeare'i kogutud teosed" ("The Complete Works of William Shakespeare") Rakvere Teatris, lavastaja Ain Prosa ja Friedebert Tuglase - Ingomar Vihmari "Hei, Luciani!" Ugalas, lavastaja Ingomar Vihmar

  3. ORF Alignment: NC_002977 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ain ... protein [Methylococcus capsulatus str. Bath] ... Length = 147 ... Query: 1 ... MNLEMARLFRTITHGVYVVGVADAEGPNAFTA...AWVMQTSFDPPMLALSINPYCLSYRKLM 60 ... MNLEMARLFRTITHGVYVVGVADAEGPNAFTA...AWVMQTSFDPPMLALSINPYCLSYRKLM Sbjct: 1 ... MNLEMARLFRTITHGVYVVGVADAEGPNAFTAAWVMQTSFDPPMLALSINPYCL

  4. Trimethoprim-sulfamethoxazole induced acute interstitial nephritis in renal allografts; clinical course and outcome.

    LENUS (Irish Health Repository)

    Garvey, J P

    2009-11-01

    Acute interstitial nephritis (AIN) secondary to trimethoprim-sulfamethoxazole (TMP-SMX) is well documented as a cause of acute renal failure in native kidneys. TMP-SMX is the standard prophylactic agent against pneumocystis carinii (PCP) used in the early post-transplant period, however, it has to date only been indirectly associated with AIN in renal allografts. DESIGN, SETTING, PARTICIPANTS AND MEASUREMENTS: We describe eleven renal transplant patients with acute allograft dysfunction in whom a transplant biopsy demonstrated primary histopathologic features of allergic AIN, all of whom were receiving TMP-SMX in addition to other medications known to cause AIN.

  5. Human Factors Interface with Systems Engineering for NASA Human Spaceflights

    Science.gov (United States)

    Wong, Douglas T.

    2009-01-01

    This paper summarizes the past and present successes of the Habitability and Human Factors Branch (HHFB) at NASA Johnson Space Center s Space Life Sciences Directorate (SLSD) in including the Human-As-A-System (HAAS) model in many NASA programs and what steps to be taken to integrate the Human-Centered Design Philosophy (HCDP) into NASA s Systems Engineering (SE) process. The HAAS model stresses systems are ultimately designed for the humans; the humans should therefore be considered as a system within the systems. Therefore, the model places strong emphasis on human factors engineering. Since 1987, the HHFB has been engaging with many major NASA programs with much success. The HHFB helped create the NASA Standard 3000 (a human factors engineering practice guide) and the Human Systems Integration Requirements document. These efforts resulted in the HAAS model being included in many NASA programs. As an example, the HAAS model has been successfully introduced into the programmatic and systems engineering structures of the International Space Station Program (ISSP). Success in the ISSP caused other NASA programs to recognize the importance of the HAAS concept. Also due to this success, the HHFB helped update NASA s Systems Engineering Handbook in December 2007 to include HAAS as a recommended practice. Nonetheless, the HAAS model has yet to become an integral part of the NASA SE process. Besides continuing in integrating HAAS into current and future NASA programs, the HHFB will investigate incorporating the Human-Centered Design Philosophy (HCDP) into the NASA SE Handbook. The HCDP goes further than the HAAS model by emphasizing a holistic and iterative human-centered systems design concept.

  6. Identification and evaluation of resistance to powdery mildew and yellow rust in a wheat mapping population

    Science.gov (United States)

    Zhang, Xu; Wang, Jirui; Luo, Mingcheng; Yang, Mujun; Wang, Hua; Xiang, Libo; Zeng, Fansong; Yu, Dazhao; Fu, Daolin

    2017-01-01

    Deployment of cultivars with genetic resistance is an effective approach to control the diseases of powdery mildew (PM) and yellow rust (YR). Chinese wheat cultivar XK0106 exhibits high levels of resistance to both diseases, while cultivar E07901 has partial, adult plant resistance (APR). The aim of this study was to map resistance loci derived from the two cultivars and analyze their effects against PM and YR in a range of environments. A doubled haploid population (388 lines) was used to develop a framework map consisting of 117 SSR markers, while a much higher density map using the 90K Illumina iSelect SNP array was produced with a subset of 80 randomly selected lines. Seedling resistance was characterized against a range of PM and YR isolates, while field scores in multiple environments were used to characterize APR. Composite interval mapping (CIM) of seedling PM scores identified two QTLs (QPm.haas-6A and QPm.haas-2A), the former being located at the Pm21 locus. These QTLs were also significant in field scores, as were Qpm.haas-3A and QPm.haas-5A. QYr.haas-1B-1 and QYr.haas-2A were identified in field scores of YR and were located at the Yr24/26 and Yr17 chromosomal regions respectively. A second 1B QTL, QYr.haas-1B-2 was also identified. QPm.haas-2A and QYr.haas-1B-2 are likely to be new QTLs that have not been previously identified. Effects of the QTLs were further investigated in multiple environments through the testing of selected lines predicted to contain various QTL combinations. Significant additive interactions between the PM QTLs highlighted the ability to pyramid these loci to provide higher level of resistance. Interactions between the YR QTLs gave insights into the pathogen populations in the different locations as well as showing genetic interactions between these loci. PMID:28542459

  7. Evaluation of thirteen haloacetic acids and ten trihalomethanes formation by peracetic acid and chlorine drinking water disinfection.

    Science.gov (United States)

    Xue, Runmiao; Shi, Honglan; Ma, Yinfa; Yang, John; Hua, Bin; Inniss, Enos C; Adams, Craig D; Eichholz, Todd

    2017-12-01

    Free chlorine is a commonly used disinfectant in drinking water treatment. However, disinfection by-products (DBPs) are formed during water disinfection. Haloacetic acids (HAAs) and trihalomethanes (THMs) are two major groups of DBPs. Iodo-HAAs and iodo-THMs (I-HAAs and I-THMs) are formed during the disinfection of the water containing high levels of iodide and are much more toxic than their chlorinated and brominated analogs. Peracetic acid (PAA) is a strong antimicrobial disinfectant that is expected to reduce the formation of HAAs and THMs during disinfection. In this study, the formations of thirteen HAAs and ten THMs, including the iodinated forms, have been investigated during PAA disinfection and chlorination as the comparison. The DBP formations under different iodide concentrations, pHs, and contact times were systematically investigated. Two types of commercial PAAs containing different concentrations of PAA and hydrogen peroxide (H 2 O 2 ) were studied. A solid-phase microextraction gas chromatography-mass spectrometry method was upgraded for THM analysis including I-THMs. HAAs were analyzed by following a recently developed high performance ion chromatography-tandem mass spectrometry method. Results show that the ratio of PAA and H 2 O 2 concentration significantly affect the formation of I-THMs and I-HAAs. During PAA disinfection with lower PAA than H 2 O 2 , no detectable levels of THMs and HAAs were observed. During PAA disinfection with higher PAA than H 2 O 2 , low levels of monoiodoacetic acid, diiodoacetic acid, and iodoform were formed, and these levels were enhanced with the increase of iodide concentration. No significant quantities of chloro- or bromo-THMs and HAAs were formed during PAA disinfection treatment. Copyright © 2017 Elsevier Ltd. All rights reserved.

  8. Metabolism and Biomarkers of Heterocyclic Aromatic Amines in Molecular Epidemiology Studies: Lessons Learned from Aromatic Amines

    Science.gov (United States)

    2011-01-01

    Aromatic amines and heterocyclic aromatic amines (HAAs) are structurally related classes of carcinogens that are formed during the combustion of tobacco or during the high-temperature cooking of meats. Both classes of procarcinogens undergo metabolic activation by N-hydroxylation of the exocyclic amine group, to produce a common proposed intermediate, the arylnitrenium ion, which is the critical metabolite implicated in toxicity and DNA damage. However, the biochemistry and chemical properties of these compounds are distinct and different biomarkers of aromatic amines and HAAs have been developed for human biomonitoring studies. Hemoglobin adducts have been extensively used as biomarkers to monitor occupational and environmental exposures to a number of aromatic amines; however, HAAs do not form hemoglobin adducts at appreciable levels and other biomarkers have been sought. A number of epidemiologic studies that have investigated dietary consumption of well-done meat in relation to various tumor sites reported a positive association between cancer risk and well-done meat consumption, although some studies have shown no associations between well-done meat and cancer risk. A major limiting factor in most epidemiological studies is the uncertainty in quantitative estimates of chronic exposure to HAAs and, thus, the association of HAAs formed in cooked meat and cancer risk has been difficult to establish. There is a critical need to establish long-term biomarkers of HAAs that can be implemented in molecular epidemioIogy studies. In this review article, we highlight and contrast the biochemistry of several prototypical carcinogenic aromatic amines and HAAs to which humans are chronically exposed. The biochemical properties and the impact of polymorphisms of the major xenobiotic-metabolizing enzymes on the biological effects of these chemicals are examined. Lastly, the analytical approaches that have been successfully employed to biomonitor aromatic amines and HAAs, and

  9. Identification and evaluation of resistance to powdery mildew and yellow rust in a wheat mapping population.

    Directory of Open Access Journals (Sweden)

    Lijun Yang

    Full Text Available Deployment of cultivars with genetic resistance is an effective approach to control the diseases of powdery mildew (PM and yellow rust (YR. Chinese wheat cultivar XK0106 exhibits high levels of resistance to both diseases, while cultivar E07901 has partial, adult plant resistance (APR. The aim of this study was to map resistance loci derived from the two cultivars and analyze their effects against PM and YR in a range of environments. A doubled haploid population (388 lines was used to develop a framework map consisting of 117 SSR markers, while a much higher density map using the 90K Illumina iSelect SNP array was produced with a subset of 80 randomly selected lines. Seedling resistance was characterized against a range of PM and YR isolates, while field scores in multiple environments were used to characterize APR. Composite interval mapping (CIM of seedling PM scores identified two QTLs (QPm.haas-6A and QPm.haas-2A, the former being located at the Pm21 locus. These QTLs were also significant in field scores, as were Qpm.haas-3A and QPm.haas-5A. QYr.haas-1B-1 and QYr.haas-2A were identified in field scores of YR and were located at the Yr24/26 and Yr17 chromosomal regions respectively. A second 1B QTL, QYr.haas-1B-2 was also identified. QPm.haas-2A and QYr.haas-1B-2 are likely to be new QTLs that have not been previously identified. Effects of the QTLs were further investigated in multiple environments through the testing of selected lines predicted to contain various QTL combinations. Significant additive interactions between the PM QTLs highlighted the ability to pyramid these loci to provide higher level of resistance. Interactions between the YR QTLs gave insights into the pathogen populations in the different locations as well as showing genetic interactions between these loci.

  10. Exegi monumentum ehk palee Tallinnas / Siim Sultson

    Index Scriptorium Estoniae

    Sultson, Siim

    2007-01-01

    Tallinnas Narva mnt. 7 endisest Tsentrosojuzprojektist ümber ehitatud Triumph Plazast (arhitektid Vilen Künnapu ja Ain Padrik). Maja kavandati 1981. a. büroohooneks (arhitektid Olga Bruns ja Mart Kalling). Kommenteerivad Mart Port, Dmitri Bruns, Kristiina Möldre ja Ain Padrik

  11. Reactive gas condensation synthesis of aluminum nitride nanoparticles.

    Science.gov (United States)

    Baker, Colin C; Ceylan, Abdullah; Shah, S Ismat

    2006-01-01

    Aluminum Nitride (AIN) nanoparticles were synthesized using a Reactive Gas Condensation (RGC) technique in which a mixture of ammonia (NH3) and nitrogen (N2) gases were used for the nitridation of aluminum. NH3 served as the reactive gas, while N2 served as both a carrier gas and the inert source for particle condensation. X-ray diffraction (XRD) and X-ray photoelectron spectroscopy (XPS) analyses revealed that at reactive gas compositions greater than 10% NH3 in N2, samples were composed entirely of hexagonal AIN nanoparticles. Electron diffraction patterns showed single crystal hexagonal AIN structure. The particle size was controlled by varying the pressure of the gas mixture. AIN nanoparticles were dispersed in a liquid matrix to enhance thermal conductivity. Results showed that a minimal addition of AIN increased the thermal conductivity of hydrocarbon pump oil by approximately 27%. The thermal conductivity became constant after reaching a maximum above 0.01 wt% AIN. Temporal stability of AIN was studied by XRD. Samples exposed to air for extended periods of time and analyzed by XRD show no degradation of crystalline AIN nanoparticles.

  12. Clinico-epidemiologic features of oculocutaneous albinism in ...

    African Journals Online (AJOL)

    Alaaeldin F. Mohamed

    Clinico-epidemiologic features of oculocutaneous albinism in northeast section of Cairo – Egypt. Alaaeldin F. Mohamed a. , Nermine S. El-Sayed a,. *, Neveen S. Seifeldin b a Medical Genetics Center, Ain Shams University, Egypt b Dermatology Department, Ain Shams University, Egypt. Received 30 January 2010; ...

  13. Study of plasma amino acid levels in children with autism: An ...

    African Journals Online (AJOL)

    Farida M. ElBaz

    2014-02-24

    Feb 24, 2014 ... ORIGINAL ARTICLE. Study of plasma amino acid levels in children with autism: An Egyptian sample. Farida M. ElBaz a. , Mona M. Zaki b. , Azza M. Youssef a,. *, Ghada F. ElDorry c. ,. Dina Y. Elalfy c a Pediatrics Department, Ain Shams University, Cairo, Egypt b Clinical Pathology Department, Ain Shams ...

  14. Detection of occult HBV infection by nested PCR assay among ...

    African Journals Online (AJOL)

    Shereen E. Taha

    2013-07-10

    Jul 10, 2013 ... Shereen E. Taha a,. *, Soha A. El-Hady a. , Tamer M. Ahmed b. , Iman Z. Ahmed b a Department of Medical Microbiology and Immunology, Faculty of Medicine, Ain Shams University, Cairo, Egypt b Department of Internal Medicine, Faculty of Medicine, Ain Shams University, Cairo, Egypt. Received 11 May ...

  15. Genotyping of mannose-binding lectin (MBL2) codon 54 and ...

    African Journals Online (AJOL)

    Rabah M. Shawky

    2013-11-17

    Nov 17, 2013 ... b Medical Genetics Research Centre and Genetics Unit Children's Hospital, Ain Shams University, Egypt c Ain Shams University .... lele) combined with a high expression promoter (YA/B) or a low-expression promoter .... and more severe post bronchiolitis wheezing in full term in- fants before the age of 6 ...

  16. Association of glutathione-S-transferase P1 (GSTP1)-313 A>G gene ...

    African Journals Online (AJOL)

    Afaf Elsaid

    2015-05-14

    May 14, 2015 ... Peer review under responsibility of Ain Shams University. The Egyptian Journal of Medical Human Genetics (2015) 16, 361–365. HOSTED BY. Ain Shams University. The Egyptian Journal of Medical Human Genetics www.ejmhg.eg.net www.sciencedirect.com · http://dx.doi.org/10.1016/j.ejmhg.2015.04.005.

  17. Multi-scale Computational Electromagnetics for Phenomenology and Saliency Characterization in Remote Sensing

    Science.gov (United States)

    2016-07-15

    Aine , and W.C. Chew, “Blackbox Macro- modeling of the Nonlinearity Based on Volterra Series Representation of X- Parameters,” IEEE EPEP, Portland...the Student Paper Competition) 2. X.Y. Xiong, L.J. Jiang, J. Shutt- Aine , and W.C. Chew, “Blackbox Macro- modeling of the Nonlinearity Based on

  18. SATCOM Supply Versus Demand and the Impact on Remotely Piloted Aircraft ISR

    Science.gov (United States)

    2016-03-01

    http://www.cnn.com/2009/US/12/17/drone.video.hacked/index.html (accessed 9 Dec 2015). 34 Pocock, Chris, AIN Online, “The Revolutionary but Thorny U.S...www.photonics.com/Article.aspx?AID=56998. Pocock, Chris, AIN Online, “The Revolutionary but Thorny U.S. Predator-Reaper Program,” 13 June 2015, http

  19. Pärast kõike / intervjueerinud Veiko Märka

    Index Scriptorium Estoniae

    1998-01-01

    Vestlusring: Ain Mäeots, Merle Jääger, Helena Merzin, Margus Jaanovits, Riho Kütsar. Madis Kõivu võrukeelse näidendi 'Omavahelisi jutuajamisi tädi Elliga' lavastamisest Vanemuise teatris, lavastaja Ain Mäeots. Ka Kauksi Ülle kommentaar

  20. Afican Health Sciences Vol 10 No 4.pmd

    African Journals Online (AJOL)

    Administrator

    Pathology department, Faculty of Medicine and health Sciences, United Arab Emirates University Al Ain,. UAE. 2. Pathology department, Tawam Hospital, Al Ain/ UAE. Key words: Soft tissue sarcoma; Epithelioid sarcoma; Paediatric; Submandibular. African Health Sciences 2010; 10(4): 400 - 404. *Corresponding author:.

  1. LALIGENS, Vol.4 (1), January 2015

    African Journals Online (AJOL)

    client

    2015-01-09

    Jan 9, 2015 ... Slavery required the creation of a particular kind ..... white supremacist view that the black man was created to be a slave, to serve the white man. ..... money to find them. She therefore concludes, “This old People Finding business is for the birds. He ain't never found nobody he ain't took away” (4). Whether ...

  2. Study of Cu-doping effects on magnetic properties of Fe-doped ZnO ...

    Indian Academy of Sciences (India)

    Laboratoire de Physique Fondamentale et Appliquée (LPFA), Faculté des Sciences Ain Chock, Université Hassan II, B.P. 5366 Mâarif, Casablanca, Morroco; Laboratoire de Physique des Matériaux, Micro-électronique, Automatique et Thermique (LPMMAT), Faculté des Sciences Ain Chock, Université Hassan II, B.P. 5366 ...

  3. Explanation of ferromagnetism origin in N-doped ZnO by first ...

    Indian Academy of Sciences (India)

    Laboratoire de Physique Fondamentale et Applique (LPFA), Faculté des Sciences Ain Chock, Université Hassan II, B.P. 5366 Mâarif, Casablanca, Maroc; Laboratoire de Physique des Matériaux, Micro-électronique, Automatique et Thermique (LPMMAT), Faculté des Sciences Ain Chock, Université Hassan II, B.P. 5366 ...

  4. Analysis of Aluminum-Nitride SOI for High-Temperature Electronics

    Science.gov (United States)

    Biegel, Bryan A.; Osman, Mohamed A.; Yu, Zhiping

    2000-01-01

    We use numerical simulation to investigate the high-temperature (up to 500K) operation of SOI MOSFETs with Aluminum-Nitride (AIN) buried insulators, rather than the conventional silicon-dioxide (SiO2). Because the thermal conductivity of AIN is about 100 times that of SiO2, AIN SOI should greatly reduce the often severe self-heating problem of conventional SOI, making SOI potentially suitable for high-temperature applications. A detailed electrothermal transport model is used in the simulations, and solved with a PDE solver called PROPHET In this work, we compare the performance of AIN-based SOI with that of SiO2-based SOI and conventional MOSFETs. We find that AIN SOI does indeed remove the self-heating penalty of SOL However, several device design trade-offs remain, which our simulations highlight.

  5. Efeitos das drogas antiinflamatórias não-estereoidais sobre o epitélio bucal e a capacidade de cicatrização

    OpenAIRE

    Cristiano Nakao

    2008-01-01

    Antiinflamatórios não-esteroidais (AINEs) são muito utilizados para o alívio da dor. Estudos indicam que 1 em 7 pacientes com doenças inflamatórias crônicas usam AINEs e que 1 em 5 pessoas usam AINEs para dores agudas. Os AINEs inibem a cicloxigenase (COX-1 e COX-2) ou seletivamente a COX-2, e apesar de sua excelente ação antiinflamatória e analgésica, muitos são os efeitos colaterais. Problemas gastrointestinais (GI) são a queixa mais comum para os AINEs convencionais, que também são as...

  6. Medical ethics educational improvement, is it needed or not?! Survey for the assessment of the needed form, methods and topics of medical ethics teaching course amongst the final years medical students Faculty of Medicine Ain Shams University (ASU), Cairo, Egypt 2010.

    Science.gov (United States)

    Fawzi, Marwa M

    2011-07-01

    In the process of our faculty gaining accreditation, the debate concerning the necessity for initiating an integrated course in which medical ethics course is implemented have arouse. Arguments concerning what should this course include, the best timing for this course to be applied, how it should be taught, planned for and mostly for what the students are interested to get out of it. The main purpose of this work is to identify the ethical needs and ethical dilemmas freshly graduated medical students face at the beginning of their training and their suggestions to seek better educational approaches that can be applied in teaching medical ethics proposed by the medical students themselves throughout the teaching process and after graduation. It seemed rather appropriate at this stage to carry out an evaluation survey assessing the needs for medical ethics teaching course through the exploration of the opinions of medical students and freshly graduated doctors on ethical issues through a simple survey by using an open ended question questionnaire designed to fulfil the study targeted requirements. 100 volunteers (n = 100) randomly chosen from the fifth year students of our faculty of medicine ASU who had recently studied ethics course in the fourth year (n = 20), interns both junior and senior residents in El Demerdash hospitals (n = 80). 25 questionnaires were excluded due to inappropriate or missing answers resulting in 75% response rate. 60% of the surveyed group favored an integrated ethics course taught throughout the whole academic years study. 56% chose the practical teaching method with problem solving strategies for the daily arising confusing ethical issues to be the best way to teach the course. While 53.4% thought that stuff specialized in medico legal issues were best to teach this course. As regards the highly confusing ethical dilemmas in which they were interested in getting updated feedback about: Confidentiality, doctor-patient relationship and informed consent came first by 69.3%. This study revealed the essential need for a model medical ethics curriculum that responds to students' concerns in addition to providing basic training in moral reasoning and ethical decision making to be applied both horizontally and vertically across the whole years of medical school. A Simple booklet containing recent version of the Egyptian code of ethics, common ethical dilemmas and recently evolving ethical issues should be available for all newly graduated health professionals. Copyright © 2011 Elsevier Ltd and Faculty of Forensic and Legal Medicine. All rights reserved.

  7. "É muito dificultoso!": etnografia dos cuidados a pacientes com hipertensão e/ou diabetes na atenção básica, em Manaus, Amazonas, Brasil "It sure ain't easy!": an ethnographic study of primary health care for patients with hypertension and/or diabetes in Manaus, Amazonas State, Brazil

    Directory of Open Access Journals (Sweden)

    Maximiliano Loiola Ponte de Souza

    2008-01-01

    Full Text Available O texto analisa os resultados de pesquisa avaliativa da Atenção Básica à Saúde do paciente com hipertensão e/ou diabetes em Manaus, Amazonas, Brasil. A abordagem etnográfica utilizou, como categorias analíticas centrais, o acesso aos serviços e a integralidade do cuidado, comparando-se as práticas sanitárias desenvolvidas em unidade do Programa Saúde da Família (PSF e em unidade básica de saúde não-PSF. A facilitação do acesso à unidade de saúde da família implantada em comunidade carente é limitada pela precariedade de infra-estrutura urbana do seu entorno. A unidade básica de saúde tem, nas grandes distâncias, a sua principal barreira de acesso. A inexistência de sistema de referência entre os distintos níveis de complexidade compromete o acesso dos pacientes a exames e especialistas. O cuidado oferecido nas duas unidades é restrito às queixas físicas passíveis de abordagem farmacológica, comprometendo a integralidade. Há baixa capacidade de escuta dos profissionais para problemas distintos do foco da ação programática. Destacam-se as potencialidades da utilização da etnografia na pesquisa avaliativa de sistemas e serviços de saúde.This paper analyzes the results of an evaluative study in the city of Manaus, Amazonas State, Brazil, on primary health care for patients with hypertension and/or diabetes. The ethnographic approach used access to services and comprehensiveness of health care as core analytical categories, comparing the health practices developed by Family Health Program (FHP units with traditional non-FHP primary care units. Access to family health care units in low-income communities is limited by the precarious surrounding urban infrastructure. The main barrier to access to primary care units is distance. The lack of a referral system between the various levels of complexity jeopardizes patients' access to tests and specialists. The care supplied by the two units is limited to patient conditions that can be treated pharmacologically, thus compromising the comprehensiveness of care. The health professionals display a limited capacity to hear problems outside the immediate focus of the program activity. The paper highlights the potential for using ethnography in evaluative research on health systems and services.

  8. Presidential Green Chemistry Challenge: 1998 Designing Greener Chemicals Award

    Science.gov (United States)

    Presidential Green Chemistry Challenge 1998 award winner, Rohm and Haas, developed CONFIRM, a highly selective, reduced risk insecticide that disrupts the molting process of caterpillar pests in turf and a variety of crops.

  9. Presidential Green Chemistry Challenge: 1996 Designing Greener Chemicals Award

    Science.gov (United States)

    Presidential Green Chemistry Challenge 1996 award winner, Rohm and Haas, developed Sea-Nine, a marine antifoulant to control plants and animals on ship hulls. Sea-Nine replaces persistent, toxic organotin antifoulants.

  10. Disease: H00998 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available ess Fatigue Bathing Hyperthermia/hypothermia Upper respiratory infection ... Flunarizine [DG:DG01006] Hemiplegic migraine...r H, Haan J, Haas JP, Terwindt GM, Ferrari MD ... TITLE ... CACNA1A mutation linking hemiplegic migraine and a

  11. Kolmekesi ühest Peipsi-äärsest asjast / Tiit Lepp

    Index Scriptorium Estoniae

    Lepp, Tiit

    2007-01-01

    Annika Haasi, Birgit Püve ja Age Petersoni fotonäitus "Prichudie, Revisited" Peipsiääre valla inimestest ja elust-olust kunstikeskuses AmbulARToorium Tartumaaal. Kommenteerinud Annika Haas, Birgit Püve, Age Peterson

  12. Creation of a Dynamical Stratospheric Turbulence Forecasting and Nowcasting Tool for High Altitude Airships and Other Aircraft

    National Research Council Canada - National Science Library

    Fritts, David C

    2008-01-01

    ... for which significant wave and turbulence activity may pose an operational or functional risk. The specific goal for MDA purposes was to create a forecasting methodology for turbulence activity at the expected High Altitude Airship (HAA...

  13. Power Budget Analysis for High Altitude Airships

    Science.gov (United States)

    Choi, Sang H.; Elliott, James R.; King, Glen C.

    2006-01-01

    The High Altitude Airship (HAA) has various potential applications and mission scenarios that require onboard energy harvesting and power distribution systems. The energy source considered for the HAA s power budget is solar photon energy that allows the use of either photovoltaic (PV) cells or advanced thermoelectric (ATE) converters. Both PV cells and an ATE system utilizing high performance thermoelectric materials were briefly compared to identify the advantages of ATE for HAA applications in this study. The ATE can generate a higher quantity of harvested energy than PV cells by utilizing the cascaded efficiency of a three-staged ATE in a tandem mode configuration. Assuming that each stage of ATE material has the figure of merit of 5, the cascaded efficiency of a three-staged ATE system approaches the overall conversion efficiency greater than 60%. Based on this estimated efficiency, the configuration of a HAA and the power utility modules are defined.

  14. Tryptophan-Derived 3-Hydroxyanthranilic Acid Contributes to Angiotensin II-Induced Abdominal Aortic Aneurysm Formation in Mice In Vivo.

    Science.gov (United States)

    Wang, Qiongxin; Ding, Ye; Song, Ping; Zhu, Huaiping; Okon, Imoh; Ding, Yang-Nan; Chen, Hou-Zao; Liu, De-Pei; Zou, Ming-Hui

    2017-12-05

    Abnormal amino acid metabolism is associated with vascular disease. However, the causative link between dysregulated tryptophan metabolism and abdominal aortic aneurysm (AAA) is unknown. Indoleamine 2,3-dioxygenase (IDO) is the first and rate-limiting enzyme in the kynurenine pathway of tryptophan metabolism. Mice with deficiencies in both apolipoprotein e (Apoe) and IDO (Apoe -/- /IDO -/- ) were generated by cross-breeding IDO -/- mice with Apoe -/- mice. The acute infusion of angiotensin II markedly increased the incidence of AAA in Apoe -/- mice, but not in Apoe -/- /IDO -/- mice, which presented decreased elastic lamina degradation and aortic expansion. These features were not altered by the reconstitution of bone marrow cells from IDO +/+ mice. Moreover, angiotensin II infusion instigated interferon-γ, which induced the expression of IDO and kynureninase and increased 3-hydroxyanthranilic acid (3-HAA) levels in the plasma and aortas of Apoe -/- mice, but not in IDO -/- mice. Both IDO and kynureninase controlled the production of 3-HAA in vascular smooth muscle cells. 3-HAA upregulated matrix metallopeptidase 2 via transcription factor nuclear factor-κB. Furthermore, kynureninase knockdown in mice restrained 3-HAA, matrix metallopeptidase 2, and resultant AAA formation by angiotensin II infusion. Intraperitoneal injections of 3-HAA into Apoe -/- and Apoe -/- /IDO -/- mice for 6 weeks increased the expression and activity of matrix metallopeptidase 2 in aortas without affecting metabolic parameters. Finally, human AAA samples had stronger staining with the antibodies against 3-HAA, IDO, and kynureninase than those in adjacent nonaneurysmal aortic sections of human AAA samples. These data define a previously undescribed causative role for 3-HAA, which is a product of tryptophan metabolism, in AAA formation. Furthermore, these findings suggest that 3-HAA reduction may be a new target for treating cardiovascular diseases. © 2017 American Heart Association, Inc.

  15. GRAPHICAL DETERMINATION OF DISSOCIATION CONSTANT ...

    African Journals Online (AJOL)

    DR. AMINU

    conform to the general equation of straight – line graph; y = mx + c, where y = pH, m = slope, x = log. [HA]/[A] and C = intercept = pKa. Thus the pKa is obtained as the intercept of the graph of pH versus – log [HA]/[A] as shown in Figures 1,2 and 3 for glycine, alanine and valine respectively. The values obtained were 9.87 ...

  16. Discovery, structural characterization and functional analysis of alpha-2-macroglobulin, a novel immune-related molecule from Holothuria atra.

    Science.gov (United States)

    Qian, Jing; Ren, Chunhua; Xia, Jianjun; Chen, Ting; Yu, Zonghe; Hu, Chaoqun

    2016-07-10

    The non-specific protease inhibitor alpha-2-macroglobulin (A2M) is a key macromolecular glycoprotein that involved in host immune defense against pathogens in vertebrates and invertebrates. However, no research regarding A2M has been developed in echinoderms to date. In this study, the full-length cDNA of A2M was cloned from the sea cucumber (Holothuria atra), which is a tropical species widely distributed along the coasts of the South China Sea and designated HaA2M. HaA2M possesses all three conserved functional domains of known A2M proteins, including the bait region domain, thioester domain and receptor-binding domain. Compared to fish and shrimp A2Ms, the histidine residue from the catalytical regions is well conserved in HaA2M. HaA2M mRNA was predominantly expressed in coelomocytes and, to a lesser extent, in the body wall, intestine and respiratory tree. A2M activity was detected in the coelomic fluids of H. atra. The mRNA expression and activity levels were investigated in the major immune tissues and coelomic fluids of H. atra after challenge with inactivated Vibrio alginolyticus or polyriboinosinic polyribocytidylic acid [Poly (I: C)]. RNA interference (RNAi)-mediated knockdown of HaA2M resulted in a significant reduction of HaA2M gene transcript level (86%). RNAi-mediated silencing of HaA2M gene significantly decreased the A2M activity (38%) and increased the number of viable bacteria (2.8-fold) in the coelomic fluids of H. atra infected by V. alginolyticus. Our study, as a whole, supplied the evidences for HaA2M as an immune-relevant molecule and it might have multiple functions in the innate immune system of H. atra. Copyright © 2016 Elsevier B.V. All rights reserved.

  17. Separation of beryllium and mercury from lithium chloride solution by gaseous extraction

    International Nuclear Information System (INIS)

    Sevast'yanov, A.I.; Chepovol, V.I.

    1989-01-01

    The possibility is shown of extracting beryllium and mercury by acetylacetone (HAA) from lithium chloride solution by passing argon through the solution and the optimum conditions have been determined. The dependence of the degree of extraction and the distribution coefficients on various parameters of the liquid phase are presented, viz. the initial pH value, the lithium chloride concentration, and the initial HAA content

  18. The role of genetic polymorphisms in metabolism of carcinogenic heterocyclic aromatic amines.

    Science.gov (United States)

    Turesky, R J

    2004-04-01

    More than twenty heterocyclic aromatic amines (HAAs) have been identified in grilled meats, fish, poultry, and tobacco smoke condensate. HAAs are carcinogens and induce tumors at multiple sites in experimental laboratory animals. Because of the widespread occurrence of HAAs in foods, these chemicals may contribute to the etiology of several common human cancers that are associated with frequent consumption of grilled meats including colon, rectum, prostate, and breast. HAAs require metabolism in order to exert their genotoxic effects. Metabolic activation occurs by N-hydroxylation, a reaction catalyzed by cytochromes p450 (CYP). Some N-hydroxy-HAA metabolites may directly react with DNA, but further metabolism by N-acetyltransferases (NATs) or sulfotransferases (SULTs) may occur to form highly reactive N-acetoxy or N-sulfonyloxy esters that readily react with DNA bases. The N-acetoxy ester of the HAA 2-amino-1-methyl-6-phenylimidazo[4,5-b]pyridine (PhIP) is detoxified by glutathione S-transferases (GSTs), which catalyze the reduction of the reactive intermediate back to the parent amine. Some HAAs also undergo detoxification through conjugation reactions with the phase II enzymes such as UDP-glucuronosyltransferases (UGTs) or SULTs to form stable, polar products that are readily eliminated. All of these xenobiotic metabolism enzyme systems (XMEs) display common genetic polymorphisms, which may affect protein expression, protein stability, catalytic activity, and thus, the biological potency of these procarcinogens. In this review, the roles of common genetic polymorphisms of XMEs involved in HAA metabolism and cancer risk are discussed.

  19. [Determination of 10 heterocyclic aromatic amines in beef jerky by high performance liquid chromatography].

    Science.gov (United States)

    Wan, Kehui; Peng, Zengqi; Shao, Bin; Yao, Yao; Shi, Jinming

    2012-03-01

    An analytical method was developed for the simultaneous determination of 10 heterocyclic aromatic amines (HAAs) in beef jerky by solid phase extraction-high performance liquid chromatography (SPE-HPLC). The HAAs were eluted from an Extrelut NT 20 SPE column with 60 mL dichlormethane (containing 5% toluene), and then the extract was purified with a propylsulfonic acid silica (PRS) column and a C18 SPE column, and finally, the HAAs were stored in a methanol-ammonia solution. The separation was achieved by using a TSK-gel ODS-80 column and a gradient elution with the mobile phases of acetonitrile and 0.05 mol/L acetic acid-ammonium acetate buffer (pH 3.5). The identification and quantitative analysis of the HAAs fraction were carried out using an HPLC system with ultraviolet-fluorescence detectors. The results showed that the correlation coefficients of the 10 HAAs were all above 0.999 and the limits of detection were in the range from 0.02 to 2.46 ng/g. The recoveries of the 10 HAAs spiked in beef samples were 61.69% - 101.81% with the relative standard deviations (RSDs) between 0.28% and 7.81%. 1-Methyl-9H-pyrido[4,3-b] indole (Harman) and 9H-pyrido [4,3-b]indole (Norharman) were detected in all beef jerky, and the total HAAs content of beef jerky were between 16.65 and 60.38 ng/g. This method is with wide linear range and high sensitivity, and is enough for the analysis of the HAAs in actual meat samples.

  20. Impact of different pan-frying conditions on the formation of heterocyclic aromatic amines and sensory quality in fried bacon.

    Science.gov (United States)

    Gibis, Monika; Kruwinnus, Miriam; Weiss, Jochen

    2015-02-01

    Heterocyclic aromatic amines (HAAs) are formed in the crust of cooked meat products. Most HAAs are carcinogenic in long-term animal studies. Besides precursors in raw materials, important factors are temperature and heating time. Bacon slices were investigated for concentrations of HAAs after pan-frying under different monitored heating conditions. Two HAAs, MeIQx (2-amino-3,8-dimethylimidazo [4,5-f]quinoxaline) (1.5-5.6ng/g) and PhIP (2-amino-1-methyl-6-phenylimidazo[4,5-b]pyridine) (0.1-2.6ng/g), were found in pan-fried bacon slices. The bacon clearly contained higher concentrations of HAAs both with longer frying times and at temperatures of 200-220°C rather than 150-170°C, respectively. A similar continuous increase of the concentrations was observed for norharman (5.0-19.9ng/g) and harman (0.3-1.7ng/g). The sensory evaluation, using a hedonic test design for colour and flavour, of the pan-fried bacon slices resulted in a preferred frying time of 5min at 150-170°C. However, some testers clearly preferred crispy and darker bacon slices containing higher HAA concentrations. Copyright © 2014 Elsevier Ltd. All rights reserved.

  1. Health Risk Assessment from Haloacetic Acids Exposure in Indoor and Outdoor Swimming Pool Water

    Directory of Open Access Journals (Sweden)

    Weerawat Ounsanaeha

    2017-07-01

    Full Text Available The concentrations of haloacetic acids (HAAs in both indoor and outdoor swimming pools were assessed for cancer and non-cancer health risks with water samples collected during the summer and rainy seasons from two sources. Results showed that average concentrations of HAA5 (MCAA, DCAA, TCAA, MBAA, and DBAA in both indoor and outdoor pools ranged from 74.28 to 163.05 µg/L which was higher than USEPA and WHO water quality standards. Cancer and non-cancer risk values of HAA5 exposure from both swimming pool types were acceptable risks based on USEPA recommendation (10 -6-10-4 and <1, respectively. The highest cancer and non-cancer risk values of HAAs exposure were females for indoor pool and children for outdoor pool, respectively. Cancer and non-cancer risk values of HAA5 exposure from outdoor pool were higher than indoor pool and during the rainy season, respectively. Results indicated that monitoring and control of water quality and accumulated organic substance in swimming pools should be followed to maximize health risk reduction from HAA exposure.

  2. Views and experiences of mental health nurses working with undergraduate assistants in nursing in an acute mental health setting.

    Science.gov (United States)

    Cleary, Michelle; Horsfall, Jan; O'Hara-Aarons, Maureen; Mannix, Judy; Jackson, Debra; Hunt, Glenn E

    2012-04-01

    Undergraduate nurses are employed as assistants in nursing (AIN) in inpatient mental health settings; however, there is a paucity of published research exploring registered nurses' (RN) views about the AIN role in these settings. This qualitative study documents the views and experiences of RN working with undergraduate AIN. Fifty structured face-to-face interviews were analysed, and the results are discussed in three sections. The first section outlines RN perceptions of qualities and skills required of AIN in mental health, and the responses primarily focus on communication skills, initiative, and willingness to learn. The second section targets factors in the workplace that might enhance the interest of AIN in a mental health nursing career; the responses emphasize their need to work with experienced staff. The last section outlines RN expectations of AIN, most of which are met and involve physical observations and technical tasks; less fulfilled activities primarily cluster around interactions with patients. Findings highlight the advantages and disadvantages of drawing on undergraduate nursing students as AIN in mental health settings. Communication skills, personal initiative, safety training to prevent violence, and education to increase knowledge and awareness about mental illness, diagnosis, and mental status-related skills were all important concerns articulated by RN. © 2011 The Authors. International Journal of Mental Health Nursing © 2011 Australian College of Mental Health Nurses Inc.

  3. Metal nitride coatings by physical vapor deposition (PVD) for a wear resistant aluminum extrusion die.

    Science.gov (United States)

    Lee, Su Young; Kim, Sang Ho

    2014-12-01

    The purpose of this study is to investigate the friction and wear behaviors of CrN, TiN, CrAlN, and TiAIN coated onto SKD61 for application to Al 7000 series extrusion dies. On the wear test, the experimental parameters are the load and the counter material's temperature. The results showed that the friction coefficient increased with load but decreased with the counter material's temperature, and the friction coefficients of CrN and CrAIN were lower than the friction coefficients of TiAIN and TIN, especially at a higher temperature. The wear track with different coatings identified different wear behaviors; the wear behavior of CrAIN was found to be abrasive, but the wear behavior of TiN, CrN, and TiAIN was adhesive. Therefore, CrAIN showed the least wear loss with a lower friction coefficient and less adhesion with counter materials at the highest range of wear load and temperature. This resulted in the easy formation of aluminum oxide in the wear track and less Al adhesion; moreover during the hard second phase, AIN dispersed in the film during deposition.

  4. Technology Research, Integration, and Demonstration (TRIAD) Program, Delivery Order 0013: High Strain Rate Tension Testing of Titanium 6-2-4-2S at Temperature

    Science.gov (United States)

    2016-06-01

    ain . R ate de ter mi ne d o ve r a st ra in ra ng e a fte r y iel d a nd up to U TS...str ain ) [% ] En gin ee rin g 0.2 % O ffs et Yie ld St re ss [M Pa ] Ma ch ine Ra te [m m/ s] Mo du lus [G Pa ] En gin ee rin g 0.2 % O ffs et...at Br ea k (G lob al str ain ) [% ] Sp ec im en si ze : 5 W fla t d og bo ne w ith a 5m m wi dth an d 1

  5. Trace Analysis of Mutagenic Heterocyclic Aromatic Amines in Cigarette Smoke Condensate and its Base Fractions via Silylation-GC-MS

    Directory of Open Access Journals (Sweden)

    Liu S

    2014-12-01

    Full Text Available Among the more than 5000 chemicals reported in cigarette smoke condensate (CSC, heterocyclic aromatic amines (HAAs are considered to be a contributor to observed biological activity. HAAs are non-volatile and are reported at ppb levels in CSC. A new method for HAA analysis at the trace level is reported here. N, O-Bis(trimethylsilyl trifluoroacetamide (BSTFA containing 1% trimethylchlorosilane was employed to derivatize amino groups by heating the reagent containing a sample of CSC at 80 °C for 30 min followed by analysis employing gas chromatography-mass spectroscopy (GC-MS in the selected-ion-monitoring (SIM mode. This derivatization method afforded symmetrical peak shapes on a ZB-50 stationary phase and achieved instrumental limits of quantification (LOQ at 10:1 S/N from -1 ng/mL for AαC to120 ng/mL for Glu-P-1. The chemical identity of each derivative was confirmed by comparison of retention time and mass spectra of standards. The latter were characterized by the following ions: M·+ or [M-1]+, [M-15]+, and m/z 73 (i.e., trimethylsilyl. CSC and its base sub-fractions were studied using the GC-MS method. Ten HAAs were screened and five were quantified in cigarette smoke condensate, while 2-5 HAAs were quantified in each of three base sub-fractions. Values obtained with the new procedure agree well with values reported in the literature and with results obtained from a commercial laboratory via a different analytical method. The potential contribution of each HAA to the overall mutagenic activity observed for CSC and its base fractions is discussed. When considered together, HAAs account for only a small portion (-7.8% of the observed mutagenicity of the CSC.

  6. Formation of heterocyclic amines in Chinese marinated meat: effects of animal species and ingredients (rock candy, soy sauce and rice wine).

    Science.gov (United States)

    Wang, Pan; Hong, Yanting; Ke, Weixin; Hu, Xiaosong; Chen, Fang

    2017-09-01

    Heterocyclic aromatic amines (HAAs) are one type of neo-formed contaminants in protein-rich foods during heat processing. Recently, accumulative studies have focused on the formation of HAs in Western foods. However, there is little knowledge about the occurrence of HAAs in traditional Chinese foods. The objective of this study was to determinate the contents of main HAs in traditional marinated meat products by UPLC-MS/MS, and to investigate the effects of animal species and the ingredients (soy sauce, rock candy, and rice wine) on the formation of HAAs in marinated meats. Five HAs - 2-amino-3-methylimidazo[4,5-f]-quinolone (IQ), 2-amino-3,8-dimethylimidazo[4,5-f]quinoxaline (MeIQx), 2-amino-3,4-dimethylimidazo[4,5-f]quinoxaline (MeIQ), 9H-pyrido[3,4-b]indole (Norharman) and l-methyl-9H-pyrido[3,4-b]indole (Harman) - were detected in 12 marinated meats, but 2-amino-1-methyl-6-phenylimidazo[4,5-b]pyridine (PhIP) was only found in three chicken marinates. The animal species and ingredients (soy sauce, rock candy and rice wine) have significant influence on the formation of HAAs in meat marinates. Beef had the highest content of total HAAs compared with pork, mutton and chicken. Meanwhile, soy sauce contributed to the formation of HAAs more greatly than rock candy, soy sauce, and rice wine. Choice of raw materials and optimisation of ingredients recipe should be become a critical point to control the HAAs formation in marinated meats. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  7. Intel Corporation osaleb Eesti koolitusprogrammis / Raivo Juurak

    Index Scriptorium Estoniae

    Juurak, Raivo, 1949-

    2001-01-01

    Haridusministeeriumis tutvustati infotehnoloogiaalast koolitusprogrammi, milles osaleb maailma suuremaid arvutifirmasid Intel Corporation. Koolituskursuse käigus õpetatakse aineõpetajaid oma ainetundides interneti võimalusi kasutama. 50-tunnised kursused viiakse läbi kõigis maakondades

  8. Pop / Erkki Luuk

    Index Scriptorium Estoniae

    Luuk, Erkki, 1971-

    2004-01-01

    Heliplaatidest: Current 909 "The price for existence is eternal warfare", Aapo Ilves "Pilpaküla kontsert", Yello "The Eye", Maian Kärmas, Ain Agan, Riho Sibul, Arvo Haasma "Tuigutuled", Manatark "Chaos Engine"

  9. Western Abandoned Uranium Mine Region Fact Sheets

    Science.gov (United States)

    Fact sheets related to Western Abandoned Uranium Mine (AUM) Region, more than 100 abandoned uranium mine claims located along the Little Colorado River and Highway 89, ain the Cameron, Coalmine Canyon, Bodaway/Gap, and Leupp Chapters in Northern Arizona.

  10. Valdek Murd: "Kuulake kannatlikult inimesi!" / Valdek Murd ; interv. Erik Gamzejev

    Index Scriptorium Estoniae

    Murd, Valdek

    2005-01-01

    Ilmunud ka: Severnoje Poberezhje : Subbota 17. september lk. 3. Sillamäe volikogu esimees põhjustest, miks ta kohalike valimistel ei kandideeri. Kommenteerivad Kohtla-Järve linnapea aastatel 1991-1996 Ain Kalmaru ja spordiaktivist Rene Kundla

  11. Disease: H00536 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available oencephalopathy (CADASIL) CADASIL is a chronic cerebrovascular disorder characterized by recurrent ischemic attacks and frequent migr...aines associated with diffuse white-matter abnormalities. CADASIL is caused by muta

  12. Spielpläne

    Index Scriptorium Estoniae

    2007-01-01

    Laulja Annely Peebo ooperis "Jenufa" 2., 4., 6., 9., 11., 13. ja 15. mail Mailandis. Eesti Filharmoonia Kammerkoor esinemas 27. ja 28. mail Bergenis. Laulja Ain Anger 19. mail Placido-Domingo Galal ja 31. mail ooperis "Othello" Viini Riigiooperis

  13. One dimensional aluminum nitride nanostructures: synthesis, structural, and luminescence properties.

    Science.gov (United States)

    Mousavi, S H; Gharavi, M A; Haratizadeh, H; Kitai, A; de Oliveira, P W

    2011-09-01

    Aluminum nitride (AIN) is a direct bandgap semiconductor with a bandgap about 6.1 eV at room temperature, the largest among semiconductors. This paper emphasizes experimental results of the growth and optical properties of AIN nanostructures by direct nitridation. The nitridation process was performed by chemical vapor deposition method with nitrogen (N2) gas flow. AIN nanostructures were analyzed by scanning electron microscope (SEM) equipped with energy-dispersive X-ray (EDX) spectroscope and photoluminescence (PL) spectroscopy. AIN nanowires with different widths from ultrathin to thick were synthesized with this method. All of the samples had high purity without presence of any other material in EDX spectrum. The PL spectra were obtained by a 325-nm helium-cadmium (He-Cd) laser as the excitation source showing high-intensity light emitting visible wavelengths for these structures at room temperature.

  14. Jälle põlved ja küünarnukid / Mihkel Mutt

    Index Scriptorium Estoniae

    Mutt, Mihkel

    1996-01-01

    Jess Borgesoni, Adam Longi ja Daniel Singeri 'Shakespeare'i kogutud teosed' Rakvere teatris (lav. Ain Prosa); Hermann Bahri 'Mees, naine ja kontsert' (lav. Eino Baskin) ning Tankred Dorsti 'Härra Paul' Eesti Draamateatris (lav. Mati Unt)

  15. Plaadid / Aivo Vahemets

    Index Scriptorium Estoniae

    Vahemets, Aivo

    2005-01-01

    Uutest heliplaatidest The All-American Rejects "Move Along", Devendra Banhart "Criple Crow", Rod Stewart "Thank For The Memory", Him "Dark Light", Status Quo "the Party Ain't Over Yet", Ricky Martin "Life", Barbara Streisand "Guilty Pleasures"

  16. BACTERIOLOGICAL ANALYSIS AND PUBLIC PERCEPTION ...

    African Journals Online (AJOL)

    Hamaidi-Chergui F, Brahim Errahmani M, Debib A, Hamaidi M.S

    2016-05-01

    . These results ... be free from organisms and chemical substances in concentration large enough to affect health. [8]. In Algeria, the two ... Location of Arib area in Ain Defla (Algeria) (Agence nationale de Développement de.

  17. Pap smears for men: a vision of the future?

    LENUS (Irish Health Repository)

    Oon, S F

    2012-02-01

    BACKGROUND: Anal intraepithelial neoplasia (AIN) rarely receives as much publicity as its neighbouring orifice, the cervix. As in the cervix, intraepithelial neoplasias are precursors to cancer in the anal canal. AIN and cervical interstitial neoplasia (CIN) undergo dysplasia as a consequence of human papillomavirus (HPV) infection. Since the advent of screening with the Pap smear in CIN, cervical cancer has plummeted to a fifth of its initial incidence. Anal cancer, however, has been rising, with a predilection for human immunodeficiency virus-infected men. HPV causes a squamous epithelial dysplasia and converts healthy tissue into AINs of increasing severity until anal cancer manifests. CLINICAL CASE: This article describes a clinical case of anogenital HPV infection refractory to medical and surgical therapy. It also describes an effective surgical excision technique associated with a good cosmetic outcome. CONCLUSIONS: The paper concludes by briefly discussing the implications of a national screening programme against AIN in the future.

  18. Quixotic coupling between irrigation system and maize-cowpea ...

    African Journals Online (AJOL)

    arid regions which suffer from water scarcity. A study was conducted at the Research and Experimental Station, Faculty of Agriculture, Ain Shams University at Shalakan, Kalubia Governorate, Egypt, to evaluate the effect of two irrigation ...

  19. Popmuusika / Valner Valme

    Index Scriptorium Estoniae

    Valme, Valner, 1970-

    2006-01-01

    Uutest heliplaatidest Graham Coxon "Love Travels At Illegal Speeds", Gabriel Rios "Ghostboy", "Sounds Of India", John Hughes "Wild Ocean", Ain Agan & Tallinn Chamber Orchestra/Toomas Vavilov, Ashanti "Collectables By Ashanti", Liv Kristine "Enter My Religion"

  20. Ühispanga omanikud : me ei pea olema liidrid / Marcus Wallenberg ; interv. Hindrek Riikoja

    Index Scriptorium Estoniae

    Wallenberg, Marcus

    2006-01-01

    Ühispanga omanik, SEB nõukogu esimees vastab küsimustele, mis puudutavad Ühispanga positsiooni Eesti turul, endise pangapresidendi Ain Hanschmidtiga seotud skandaali mõju pangale ning panga laienemist Venemaale

  1. Dgroup: DG01675 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available aine ... D01152 ... Oxethazaine (JP17/USAN); Oxetacaine (INN) ... D08311 ... Oxetacaine hydrochloride ... DG00801 ... Bupivacaine ... D07552 ... Bupiva...caine (USAN/INN) ... D01450 ... Bupivacaine hydrochloride (USP); Bupivacaine hydrochl

  2. Data of evolutionary structure change: 1YDVA-1AW2H [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1YDVA-1AW2H 1YDV 1AW2 A H RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVV...--- RHPVVMGNWKLNGSKEMVVDLLNGLNAELEGVTGVDVAVAPPALFVDLAERTLTEAGSAIILGA...nfEVID> 0 1YDV A 1YDVA...ain> 1YDV A 1YDVA

  3. ETV uus seriaal "Vistrik" kavatseb nime muuta / Anne Vetik

    Index Scriptorium Estoniae

    Vetik, Anne

    2006-01-01

    Toimuvad ETV uue krimisarja "Vistrik" võtted, stsenarist Mihkel Ulman, režissöör Ain Prosa, produtsent Raivo Suviste, kesksetes rollides Marko Matvere, Jaan Rekkor, Elisabet Tamm, tootjaks OÜ Balti Video

  4. Ohtlikud lennud / Simo Meinert

    Index Scriptorium Estoniae

    Meinert, Simo

    2006-01-01

    ETV uus algupärane krimisari "Ohtlik lend" : stsenarist Mihkel Ulman : lavastaja Ain Prosa : produtsent Raivo Suviste : peaosades Elisabet Tamm, Marko Matvere : Balti Video. Sama ka : Teleleht nr. 38, lk. 6-7 : ill

  5. Vek lovi - vek utshis / Hillar Jõõts ; interv. Kalju Hook

    Index Scriptorium Estoniae

    Jõõts, Hillar

    2005-01-01

    Keskkonnainspektsiooni Pärnumaa osakonna juhtivspetsialist Hillar Jõõts keskkonnaministeeriumi kalavarude osakonna juhataja Ain Soome, Eesti Kalurite Liidu juhatuse esimehe Andres Variku ja Eesti Mereinstituudi direktori Toomas Saati kohtumisest Pärnumaa kaluritega

  6. Kummitusmaja ja fusion-köök = Haunted House and Fusion Cuisine / Kai Lobjakas

    Index Scriptorium Estoniae

    Lobjakas, Kai, 1975-

    2003-01-01

    Tallinnas Rataskaevu 16 asuva jaapani toitu pakkuva restorani "Sushihouse" kujundus, ruumide restaureermine. Sisekujundajad Ain Nurmela ja Liina Link. Projekt 2001-2003, valmis 2003. Kõige muinsusteadlikumalt restaureeritud maja 2002. a. 3 ill

  7. AHHAA keskus Tartus = The Ahhaa Science Centre in Tartu / Triin Ojari

    Index Scriptorium Estoniae

    Ojari, Triin, 1974-

    2011-01-01

    2011. a. valminud AHHAA teaduskeskuse arhitektid on Ain Padrik ja Vilen Künnapu (AB Künnapu & Padrik), sisearhitektid Tea Tammelaan, Krista Lepland ja Malle Jürgenson (Laika, Belka & Strelka). Projekt: 2008

  8. Saare tantsupiigad pürgivad Eurovisiooni lauluvõistlusele / Janne Nurmik

    Index Scriptorium Estoniae

    Nurmik, Janne

    2009-01-01

    Lauri Pihlapi eurolaulu tiimis pürgivad Moskvas toimuvale Eurovisioonile Eestit esindama ka Kuressaare tantsukooli Semiir tantsijad Kristi Aksiim ja Triinu Tarus. Lauri Pihlapi ehk Lowry laulu "You Ain't What I Need" muusikavideost

  9. Technical Progress Report for "Optical and Electrical Properties of III-Nitrides and Related Materials"

    Energy Technology Data Exchange (ETDEWEB)

    Jiang, Hongxing

    2008-10-31

    Investigations have been conducted focused on the fundamental material properties of AIN and high AI-content AIGaN alloys and further developed MOCVD growth technologies for obtaining these materials with improved crystalline quality and conductivities.

  10. Klassitsheski ideal krasotõ v biznes-tsentre

    Index Scriptorium Estoniae

    2003-01-01

    Viru kaubanduskeskuse ette planeeritakse August Weizenbergi skulptuuri "Hämarik" pronkskoopiat. Idee on pärit projekteerijatelt Vilen Künnapult ja Ain Padrikult. Krista Kodres ei pea kohta klassikalisele skulptuurile sobivaks

  11. Kõnnivad köiel ja hoiavad kätt / Iir Hermeliin, Jaanus Vahtra ; intervju Sven Karja

    Index Scriptorium Estoniae

    Iir Hermeliin, pseud., 1973-

    2000-01-01

    Teatrikunstnikud Iir Hermeliin ja Jaanus Vahtra ning nende looming. Kunstnikud lavastajatest ja lavastajad Mati Unt ja Ain Mäeots koostööst kunstnikega lavastustes "Jacques ja tema isand"; "Laulatus"

  12. Алексий II 1929-2008

    Index Scriptorium Estoniae

    2008-01-01

    Aleksius II meenutavad: Kornelius, Tallinna ja kogu Eesti metropoliit ; Karin Jaani ; Marina Kaljurand ; Dmitri Medvedev, Venemaa president ; Helene Kamzol, Aleksius II sugulane ; Ain Seppik ; Vladimir Illjashevitsh ; Edgar Savisaar ; Jevgeni Tomberg ; Ene Ergma ; Toomas Hendrik Ilves, Eesti Vabariigi president

  13. Vene elu hõng Pilistvere rehealuses / Margot Visnap

    Index Scriptorium Estoniae

    Visnap, Margot, 1959-

    2008-01-01

    Pilistvere rehehoones etendunud Ain Saviaugu kirjutatud ja lavastatud suvetükist "Rasputin". Suvelavastuse tõi välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas Indrek Saar

  14. Päästev palsam / Karmen Tamme

    Index Scriptorium Estoniae

    Tamme, Karmen

    2016-01-01

    Mitmetoimelistest nahapalsamitest, mille põhikomponendiks on mesilasvaha, shea-või, oliiviõli või muu pehmendav aine, millele on juurde segatud niisutavaid/ravivaid taimeekstrakte, eeterlikke õlisid ja vitamiine

  15. Becketti Krapp on tagasi ja kuulab minevikku / Andres Laasik

    Index Scriptorium Estoniae

    Laasik, Andres, 1960-2016

    2010-01-01

    Eesti Draamateatri maalisaalis 7. novembril esietendunud Samuel Becketti kahest näidendist koosnevast lavastusest "Krappi viimane lint. Sammumisi". Lavastaja Rein Oja. Osades Ain Lutsepp, Kaie Mihkelson ja Ester Pajusoo

  16. Lugedes Pilve ja Pazi / Mathura

    Index Scriptorium Estoniae

    Mathura, pseud., 1973-

    2007-01-01

    Võrdlevalt Aare Pilve luulekogust "Näoline" (kirj. Tuum, 2007) ja Octavio Pazi luulekogust "Alati on olevik" (hispaania k. tlk. Ain Kaalep, Jaan Kaplinski, Asta Põldmäe ja Jüri Talvet, kirj. Perioodika, 1984)

  17. Partii Reform ne bezrazlitshna sudba russkogo obrazovanija / Sergei Ivanov

    Index Scriptorium Estoniae

    Ivanov, Sergei, 1958-

    2005-01-01

    Riigikogu liige vastab küsimustele, mis puudutavad Tallinna Pedagoogikaülikoolis algavat vene koolide jaoks aineõpetajate ettevalmistamist ja selleks ettenähtud rahasummat, vene akadeemilise keskuse loomiseks eraldatud raha kulutamist

  18. Low-dose corticosteroid and gallium-67 scintigraphy and acute interstitial nephritis

    Directory of Open Access Journals (Sweden)

    Tetsu Akimoto

    2014-01-01

    Full Text Available We describe a 19-year-old male who developed diclofenac-induced acute inters-titial nephritis (AIN. Diffuse mononuclear cell infiltration was confirmed by renal biopsy and a Gallium (Ga-67 scintigraphy revealed diffuse uptake of the isotope in both kidneys. His renal function had gradually and promptly recovered after initiation of low-dose prednisolone (0.5 mg/kg/day. There are no established criteria for the administration of corticosteroids in the treatment of drug-induced AIN. Moreover, no clear recommendations regarding the optimal dose and duration of steroid administration in the treatment for drug-induced AIN has been established. In addition, we discuss the clinical benefit of steroid treatment and the diagnostic impact of Ga scanning on the management of drug-induced AIN.

  19. Plaat

    Index Scriptorium Estoniae

    2008-01-01

    Laseringi kauplustes müügilolevatest heliplaatidest: Compromise Blue "Loomad on lahti", Mari Boine "Remixed vol. 2 - It Ain't Necessarily Evil", Me, Myself and I "Aastaajad", Whitesnake "Good To Be Bad", Estelle "Shine"

  20. Absence of HIV-Associated Nephropathy Among Antiretroviral Naive Adults With Persistent Albuminuria in Western Kenya

    Directory of Open Access Journals (Sweden)

    M.K. Koech

    2017-03-01

    Discussion: Among ART-naïve adults with persistent albuminuria at a referral center in Western Kenya, we observed no cases of HIVAN. AIN was the most common cause of persistent proteinuria in this setting.

  1. Mechanism of the Association between Na+ Binding and Conformations at the Intracellular Gate in Neurotransmitter:Sodium Symporters

    DEFF Research Database (Denmark)

    Stolzenberg, Sebastian; Quick, Matthias; Zhao, Chunfeng

    2015-01-01

    Neurotransmitter:sodium symporters (NSSs) terminate neurotransmission by Na+-dependent reuptake of released neurotransmitters. Previous studies suggested that Na+-binding reconfigures dynamically coupled structural elements in an allosteric interaction network (AIN) responsible for function...... in both LeuT and human dopamine transporter (hDAT), we apply the novel method to identify the composition and the dynamic properties of their conserved AIN. In LeuT, two different perturbations disrupting Na+ binding and transport (i.e. replacing Na+ with Li+ or the Y268A mutation at the intracellular...... gate) affect the AIN in strikingly similar ways. In contrast, other mutations that affect the intracellular gate (i.e. R5A and D369A) do not significantly impair Na+ cooperativity and transport. Our analysis shows these perturbations to have much lesser effects on the AIN, underscoring the sensitivity...

  2. Kas vangide ennetähtaegne vabastamine oli viga?

    Index Scriptorium Estoniae

    1998-01-01

    Eesti Päevalehe küsitlusele vastavad Viljandi politseiprefekt Ester Kallakas, Jaan Tõnissoni Instituudi direktor, Isamaaliit Agu Laius, vandeadvokaat, Reformierakond Märt Rask, endine politseiameti peadirektor Ain Seppik ja vandeadvokaat Simon Levin

  3. Melanoides tuberculata as intermediate host of Centrocestus ...

    African Journals Online (AJOL)

    Nishigori, 1924) in Tunisia. G Najet, D Sabah, H Hayet. Abstract. Melanoides tuberculata that naturally harbored trematode larvae were collected at the irrigation system in Ain Soltan's oasis (southwest of Tunisia), during malacological surveys ...

  4. Mis saab maaärist? / Ester Šank

    Index Scriptorium Estoniae

    Šank, Ester, 1956-

    2000-01-01

    Maaostu piirava seaduseelnõu Riigikogu menetlusest välja arvamist kommenteerib Vootele Hansen. Lisatud ka eelnõu autorite Jaanus Marrandi, Harri Õunapuu ja töörühma liikme Ain Kendra seisukohad

  5. On the limit distribution of lower extreme generalized order statistics

    Indian Academy of Sciences (India)

    Author Affiliations. H M Barakat1 Magdy E El-Adll2. Department of Mathematics, Faculty of Science, Zagazig University, Zagazig, Egypt; Department of Mathematics, Faculty of Science, Helwan University, Ain Helwan, Cairo, Egypt ...

  6. Kes kaitseks Eesti ohvitsere NKVD-KGB laimu eest? / Peep Varju

    Index Scriptorium Estoniae

    Varju, Peep

    2008-01-01

    Autor polemiseerib Eesti Ekspressis ilmunud artiklitega Eesti endiste ohvitseride kohta, kus käsitletakse nende väidetavat koostööd KGBga. Vaatluse all on ohvitserid Ain Mere, Harald Nugiseks, Alfons Rebane ja Harald Riipalu

  7. USA-s jagati kirjandusauhindu / Kaarel Kressa

    Index Scriptorium Estoniae

    Kressa, Kaarel, 1983-

    2007-01-01

    Ameerika Ühendriikide kirjandusauhinna National Book Award laureaadid 2007. a.: parim prosaist - Denis Johnson (romaan "Suitsupuu"), parim noorsookirjanik - Sherman Alexie ("Poole kohaga indiaanlase absoluutselt tõene päevik"), parim luuletaja - Robert Hass (luulekogu "Aeg ja ained")

  8. Vene õpetajad kardavad kakskeelset kooliõpet / Sirle Sommer- Kalda, Dagne Hanschmidt

    Index Scriptorium Estoniae

    Sommer-Kalda, Sirle, 1974-

    2005-01-01

    Vene õpetajate suhtumisest vene koolide üleminekusse osaliselt eestikeelsele õppele. TSN Emori uuringust, mille kohaselt on koolijuhtidel olnud seni eestikeelse aineõppe sisseviimisel mitmesuguseid ajendeid - seotuse tunnetamine Eestiga, aga ka hariduspoliitline surve ja kavandatav reform. Lisa: Kakskeelne õpe

  9. Case C-182/15, Proceedings Relating to the Extradition of Aleksei Petruhhin / Filippo Fontanelli

    Index Scriptorium Estoniae

    Fontanelli, Fillippo

    2017-01-01

    Euroopa Kohtu lahendist, mis puudutab Venemaa ametiasutuste poolt Läti ametiasutustele saadetud Eesti kodaniku Aleksei Petruhhini väljaandmise taotlust seoses narkootilise aine turustamise süüteoga

  10. Professional preparation of teachers - problems and possibilities. The Estonian case / Katrin Poom-Valickis, Ülle Saarits, Helle Sikka... [jt.

    Index Scriptorium Estoniae

    2008-01-01

    Artikkel kirjeldab õpetajakoolituse olukorda Eestis aastal 2003. Aineõpetajate, klassiõpetajate ja koolieelsete lasteasutuste õpetajate ettevalmistusest Tallinna Ülikoolis ning nende karjääriperspektiive tööturul

  11. Kuidas on teie kool varustatud õppevahenditega kakskeelsele õppele üleminekuks? Millest kõige rohkem puudust tunnete? / Andrei Aleksejev, Raissa Frei, Riho Kutsar, Jelena Laul...[jt.

    Index Scriptorium Estoniae

    2007-01-01

    Haridus-ja Teadusministeeriumi Tallinna esinduses tutvustati TNS Emori uuringut "Eestikeelne aineõpe vene õppekeelga koolides: hetkeolukord ja vajadused". Küsimusele vastavad viie üldhariduskooli juhid

  12. Krundi müük võiks EKA ehitusest viiendiku säästa / Ann-Marii Nergi ; kommenteerinud Jaak Aaviksoo

    Index Scriptorium Estoniae

    Nergi, Ann-Marii

    2011-01-01

    Eesti Kunstiakadeemia peab õigeks ehitada uus õppehoone ajaloolisele asukohale. Hoone ehituse ettevalmistamiseks on kulunud ligi viis miljonit eurot. EKA uue hoone mujale ehitamise osas avaldavad arvamust Metro Capital Management Eesti juht Ain Kivisaar ja riigihangete keskuse juhatuse liige Margus Lantin

  13. Tartu kaabel-TV monopolisurma ootel / Martin Pau

    Index Scriptorium Estoniae

    Pau, Martin, 1975-

    2001-01-01

    Riigikogus esimesele lugemisele minev uus kaabelleviseadus võib avada nii Tartu kui ka kogu Eesti turu vabale konkurentsile. Kommenteerivad Kalev Kallo, Peeter Kern, Peep Põltsam, Ain Mäeots. Parlamendisaadik (Kalev Kallo). Kaart: Tartu kaabel-TV operaatorid

  14. Lapi torn, Ameerika kotkas ja gooti kell / Vilen Künnapu ; intervjueerinud Margit Mutso

    Index Scriptorium Estoniae

    Künnapu, Vilen, 1948-

    2010-01-01

    Arhitekt Vilen Künnapu oma installatsioonist "Gooti kell", mis avati 2. novembril Lilleoru pargis, arhitekti rollist, osalemisest koos Ain Padriku, Lennart Meri ja Andres Siimuga rahvusvahelistel arhitektuurivõistlustel, valminud hoonetest, installatsioonidest, praegusest tegevusest jm.

  15. Politicians spin attacks against methadone, syringe replacement / Milda Seputyte

    Index Scriptorium Estoniae

    Seputyte, Milda

    2005-01-01

    Leedu parlamendiliikmed osalevad kampaanias, millega võideldakse narkomaanidele tasuta süstalde jagamise ja sõltuvuse vastase aine metadooni vastu, kuna nende arvates need meetmed pigem süvendavad narkomaaniat

  16. Õpetaja professionaalse rolli internaliseerimise hindamine õpetajakoolituse esmaõppe üliõpilaste hulgas / Äli Leijen, Katrin Kullasepp, Aivar Ots

    Index Scriptorium Estoniae

    Leijen, Äli, 1979-

    2013-01-01

    Aineõpetaja magistriõppe üliõpilaste seas läbi viidud uurimusest, milles vaadeldakse, kuidas üliõpilased koordineerivad personaalset ja professionaalset mina-positsiooni erialaste ambivalentsete olukordade kontekstis

  17. Märkmeid uusima Preisi tsensuuriinstruktsiooni kohta / Karl Marx

    Index Scriptorium Estoniae

    Marx, Karl

    2000-01-01

    Preisi uue (1841. aasta) tsensuuriinstruktsiooni tõusikliku vaimu vastuolust vana (1818. aasta) tsensuurimääruse ratsionalismiga. Moraali ja religiooni vastuolust. Vt. ka Ain Kaalepi artiklit "Veel Karl Marxist ja tsensuurist

  18. Esteet Hartshenko contra mehed punases / Heili Vaus-Tamm

    Index Scriptorium Estoniae

    Vaus-Tamm, Heili, 1961-

    2007-01-01

    Tantsuetendustest Kumu Kunstimuuseumis: "Red ain't dead", koreograaf - lavastajad Kaarel Väli, Kristjan Rohioja; tantsuteatri Zick esituses "Piaf", koreograaf - lavastaja Dmitri Harchenko. Dominiiklaste kloostri klausuuris "Reisijuht", koreograaf - lavastaja Dmitri Harchenko

  19. Kolhoosikeskus - oma ja võõras = Collective farm centre - familiar and alien / Liina Jänes ; tõlk. Liisi Ojamaa

    Index Scriptorium Estoniae

    Jänes, Liina, 1977-

    2000-01-01

    Eesti kolhoosikeskuste arhitektuurist. Vaadeldakse aastail 1957-1990 ehitatud 24 keskusehoonet. Arhitektid Nikolai Kusmin, Harri Kingo, Toomas Rein, Vilen Künnapu, Ain Padrik, Maara Metsal, Meeli Truu jt. 17 välisvaadet, 3 joon., kaart

  20. Meie igapäevane paanika / Ott Karulin

    Index Scriptorium Estoniae

    Karulin, Ott, 1980-

    2007-01-01

    Kahest Vanemuise teatri lavastusest Tartus - Saksa Kultuuri Instituudis etendunud Ingvar Ambjornseni-Axel Hellsteniuse "Elling" Ain Mäeotsa lavastuses ja Laura Cunninghami "Beautiful Bodies" Vanemuises, lavastaja Jüri Lumiste

  1. 9. II avati taas von Krahli Akna galerii

    Index Scriptorium Estoniae

    2004-01-01

    Näitusel "Mute - a Register of Dreams" on vaadata Aine Phillipsi (Iirimaa), Avangardi, Diane Dwyer & Tillamook Cheddari (USA), Evelin Urmi, Kiwa, Lee Adamsi (Inglismaa), Marcello Mercado (Saksamaa), Miguel Rodriguez Sepulveda (Mehhiko) ja Renato Meneghetti (Itaalia) töid

  2. In situ EELS and TEM observation of Al implanted with nitrogen ions

    International Nuclear Information System (INIS)

    Hojou, K.; Furuno, S.; Kushita, K.N.; Otsu, H.; Izui, K.

    1995-01-01

    Formation processes of Aluminum nitride (AIN) in Aluminum (AI) implanted with nitrogen were examined by in situ EELS and TEM observations during nitrogen ion implantation in an electron microscope at room temperature and 400 deg C. AIN phase was identified both by EDP and EELS after nitrogen ion implantation to 6 x 10 20 (N + )/m 2 . The observed peak (20.8 eV) in EELS spectra was identified as plasmon loss peak of AIN formed in AI. The binding energy of N ls in AI was found to shift by about 4 eV to the lower side with increasing nitrogen-ion fluence. Unreacted AI was also found to remain in the AIN films after high fluence implantation both at room temperature and 400 deg C. (authors). 11 refs., 5 figs., 2 tabs

  3. Materjalide jagamisest võidavad kõik / Maarja Soone

    Index Scriptorium Estoniae

    Soone, Maarja

    2011-01-01

    Koolitusest Colchesteris - Content and Language Integrated Learning, mis tähendab võõrkeelset aineõpet, kus vajadusel võetakse kasutusele ka emakeel, mistõttu viidatakse sellele tihti kui kakskeelsele õppele

  4. Browse Title Index

    African Journals Online (AJOL)

    . Kati Ain ... Vol 38, No 6 (2015), Connected domination stable graphs upon edge addition, Abstract ... Vol 29, No 4 (2006), Continued fractions and the geometric decomposition of modular transformations, Abstract.

  5. Tallinn pokupajet zemlju dlja prokladki shosse Põhjaväil

    Index Scriptorium Estoniae

    2007-01-01

    Seoses Russalkast Ahtri tänavani ulatuva tee-ehitusega seisab linnal ees 16 maaküsimuse lahendamine. Probleemidest seoses väila osaliselt merre ehitamisega. Kommenteerivad Alo Brandt ja Ain Valdmann

  6. Moroz i rozõ / Lev Livshits

    Index Scriptorium Estoniae

    Лившиц, Лев, 1924-2013

    2006-01-01

    Ain Järvega Kadrioru pargist. Kadrioru Lastepargi tekkimise ajaloost ja uue Lastepargi rajamisest. Ehitatakse uus Lastemuuseumi hoone kuhu kolib Kotzebue tänavalt Tallinna Nukumuuseum. Nukumuuseumist ja muuseumidest Kadriorus, ka KUMU hoonest

  7. Bez kota mõsham razdolje / Jevgeni Kapov

    Index Scriptorium Estoniae

    Kapov, Jevgeni

    2004-01-01

    Sillamäe linnapea Ain Kiviorgi ja Vaivara vallavanema Veiko Luhalaidi kohtumisest Politseiameti peadirektori Robert Antropovi ja Ida politseiprefekti Kalev Prillopiga, kus arutati seoses politseireformiga Sillamäe regioonis tekkinud korrakaitse probleeme

  8. Muusikalinn Viin / Kristina Kõrver

    Index Scriptorium Estoniae

    Kõrver, Kristina, 1979-

    2008-01-01

    Viini Kammerorkestri, Viini Filharmoonikute ja Viini Sümfoonikute kontsertidest, Straussi "Roosikavalerist" ja Wagneri "Lendavast Hollandlasest" Viini riigiooperis, Bizeti "Carmenist" Volksoperis, Leif Ove Anderseni kontserdist, Janacheki ooperist "Katja Kabanova" Theater an der Wienis, Ain Angeri kontserdist Musikvereini klaassaalis

  9. Plaadid / Aivo Vahemets

    Index Scriptorium Estoniae

    Vahemets, Aivo

    2006-01-01

    Uutest heliplaatidest Waltari "Blood Sample", Anthony Hamilton "Ain't Nobody Worrying", Kismabande "Polüpale", Siiri Sisask "Kuu lõhn", Les Diamants "Fortune Fools", "The Voice Clubbin", Nits "Les Nuits"

  10. [Kirjandusetendusest "Meri kümnele häälele"] / Kätlin Kaldmaa ; küsinud D. K. [Doris Kareva

    Index Scriptorium Estoniae

    Kaldmaa, Kätlin, 1970-

    2011-01-01

    Luulelavastus sisaldab Álvaro de Campose (Fernando Pessoa) "Mereoodi" ning Ain Kaalepi, Kalju Kruusa, fs-i jt. eesti luuletajate tekste. Lavastaja Anne Türnpu, etendused toimuvad kinos Sõprus. Vt. ka kuulutust lk. 30

  11. Understanding the impact of water distribution system conditions on the biodegradation of haloacetic acids and expression of bacterial dehalogenase genes.

    Science.gov (United States)

    Behbahani, Mohsen; Lin, Boren; Phares, Tamara L; Seo, Youngwoo

    2018-06-05

    The objective of this study is to evaluate the influence of water distribution system conditions (pH, total organic carbon, residual chlorine, and phosphate) on haloacetic acids (HAAs) biodegradation. A series of batch microcosm tests were conducted to determine biodegradation kinetics and collected biomass was used for real time quantitative reverse transcription polymerase chain reaction analyses to monitor how these drinking water distribution system conditions affect the relative expression of bacterial dehalogenase genes. It was observed that tested water distribution system conditions affected HAA biodegradation with different removal efficiencies (0-100%). HAA biodegradation was improved in tested samples with TOC (3 mg/L) and pH 8.5 compared to those of TOC (0 mg/L) and pH 7, respectively. However, slight improvement was observed with the increased PO 4 concentration (3.5 mg/L), and the presence of residual chlorine even at low concentration prohibited biodegradation of HAAs. The observed trend in the relative expression of dehII genes was compatible with the HAA biodegradation trend. Overall relative expression ratio of dehII genes was lower at pH 7, phosphate (0.5 mg/L), and TOC (0 mg/L) in comparison with pH 8.5, phosphate (3.5 mg/L), and TOC (3 mg/L) in the same experimental conditions. Copyright © 2018 Elsevier B.V. All rights reserved.

  12. Hazard assessment of three haloacetic acids, as byproducts of water disinfection, in human urothelial cells.

    Science.gov (United States)

    Marsà, Alicia; Cortés, Constanza; Hernández, Alba; Marcos, Ricard

    2018-04-07

    Disinfection by-products (DBPs) are compounds produced in the raw water disinfection processes. Although increased cancer incidence has been associated with exposure to this complex mixture, the carcinogenic potential of individual DBPs remains not well known; thus, further studies are required. Haloacetic acids (HAAs) constitute an important group among DBPs. In this study, we have assessed the in vitro carcinogenic potential of three HAAs namely chloro-, bromo-, and iodoacetic acids. Using a long-term (8 weeks) and sub-toxic doses exposure scenario, different in vitro transformation markers were evaluated using a human urothelial cell line (T24). Our results indicate that long-term exposure to low doses of HAAs did not reproduce the genotoxic effects observed in acute treatments, where oxidative DNA damage was induced. No changes in the transformation endpoints analyzed were observed, as implied by the absence of significant morphological, cell growth rate and anchorage-independent cell growth pattern modifications. Interestingly, HAA-long-term exposed cells developed resistance to oxidative stress damage, what would explain the observed differences between acute and long-term exposure conditions. Accordingly, data obtained under long-term exposure to sub-toxic doses of HAAs could be more accurate, in terms of risk assessment, than under acute exposure scenarios. Copyright © 2018. Published by Elsevier Inc.

  13. Formation of chlorination by-products in waters with low SUVA--correlations with SUVA and differential UV spectroscopy.

    Science.gov (United States)

    Ates, Nuray; Kitis, Mehmet; Yetis, Ulku

    2007-10-01

    The formation of THMs and HAAs after chlorination of bulk water fractions of low-SUVA (specific UV absorbance) surface waters was investigated, and the applicability of SUVA and differential UV spectroscopy for monitoring THMs and HAAs in such waters was evaluated. Samples from two reservoirs were fractionated employing XAD-8, XAD-4, MIEX resin and granular activated carbon adsorption. A total of 83 bulk water NOM fractions (i.e., the remaining solutions after contact with the adsorbent or resin at various doses) were obtained and chlorinated. The majority of NOM in both waters was found to have average molecular weights <2000 Da and SUVA values <2L/mg Cm, indicating that NOM in the tested waters contained dominantly lower molecular weight fractions and low aromaticity. SUVA did not correlate well with the formation and speciation of THMs and HAAs, suggesting that SUVA does not capture the reactive sites on NOM moieties responsible for DBP formation in low-SUVA waters. Similarly, no correlations were found among THMs/HAAs formations and differential UV spectroscopy, indicating the formation of DBPs independent of destruction in UV-absorbing sites. In all fractions, concentrations of THMs were higher than those of HAAs. Chlorinated DBP species were dominant over brominated ones due to low bromide concentrations. The results overall suggested that low- or non-UV-absorbing NOM moieties play important roles in the formation of DBPs in waters with low SUVA, low DOC and low bromide levels.

  14. Quantitative oral dosing of water soluble and lipophilic contaminants in the Japanese medaka (Oryzias latipes)

    Energy Technology Data Exchange (ETDEWEB)

    Schultz, Irv; Reed, Stacey M.; Pratt, Amanda V.; Skillman, Ann D.

    2007-02-01

    Quantitative oral dosing in fish can be challenging, particularly with water soluble contaminants, which can leach into the aquarium water prior to ingestion. We applied a method of bioencapsulation using newly hatched brine shrimp (Artemia franciscana) nauplii to study the toxicokinetics of five chlorinated and brominated halogenated acetic acids (HAAs), which are drinking water disinfection by-products. These results are compared to those obtained in a previous study using a polybrominated diphenyl ether (PBDE-47), a highly lipophilic chemical. The HAAs and PBDE-47 were bioencapsulated using freshly hatched A. franciscana nauplii after incubation in concentrated solutions of the study chemicals for 18 h. Aliquots of the brine shrimp were quantitatively removed for chemical analysis and fed to individual fish that were able to consume 400–500 nauplii in less than 5min. At select times after feeding, fish were euthanized and the HAA or PBDE-47 content determined. The absorption of HAAs was quantitatively similar to previous studies in rodents: rapid absorptionwith peak body levels occurringwithin 1–2 h, then rapidly declining with elimination half-life of 0.3–3 h depending on HAA. PBDE-47 was more slowly absorbed with peak levels occurring by 18 h and very slowly eliminated with an elimination half-life of 281 h.

  15. Küsitlus : Ilvest usaldan, Savisaart mitte / Gert D. Hankewitz

    Index Scriptorium Estoniae

    Hankewitz, Gert D.

    2006-01-01

    Äripäeva korraldatud küsitlusest selgub, et usaldusväärseimaks poliitikuks peavad Eesti elanikud Toomas Hendrik Ilvest, ebausaldusväärseimaks Edgar Savisaart; usaldusväärseim ärimees on vastanute arvates Urmas Sõõrumaa, ebausaldusväärseim Ain Hanschmidt. Kommenteerivad Andrus Saar, Toomas Hendrik Ilves, Urmas Sõõrumaa, Ain Hanschmidt ja Edgar Savisaar. Tabelid: Usaldan; Ei usalda

  16. Immune profile and Epstein-Barr virus infection in acute interstitial nephritis: an immunohistochemical study in 78 patients.

    LENUS (Irish Health Repository)

    Mansur, Abdurrezagh

    2011-01-01

    Acute interstitial nephritis (AIN) is a common cause of acute kidney injury and is characterised by a dense interstitial cellular infiltrate, which has not been well defined. Previous studies have demonstrated a correlation between Epstein-Barr virus (EBV) infection and AIN. The purpose of our study was to define the nature of the interstitial immune infiltrate and to investigate the possibility of renal infection with EBV.

  17. Colonic aberrant crypt formation accompanies an increase of opportunistic pathogenic bacteria in C57BL/6 mice fed a high-fat diet.

    Science.gov (United States)

    Zeng, Huawei; Ishaq, Suzanne L; Liu, Zhenhua; Bukowski, Michael R

    2018-04-01

    The increasing worldwide incidence of colon cancer has been linked to obesity and consumption of a high-fat Western diet. To test the hypothesis that a high-fat diet (HFD) promotes colonic aberrant crypt (AC) formation in a manner associated with gut bacterial dysbiosis, we examined the susceptibility to azoxymethane (AOM)-induced colonic AC and microbiome composition in C57/BL6 mice fed a modified AIN93G diet (AIN, 16% fat, energy) or an HFD (45% fat, energy) for 14 weeks. Mice receiving the HFD exhibited increased plasma leptin, body weight, body fat composition and inflammatory cell infiltration in the ileum compared with those in the AIN group. Consistent with the gut inflammatory phenotype, we observed an increase in colonic AC, plasma interleukin-6, tumor necrosis factor-α, monocyte chemoattractant protein-1 and inducible nitric oxide synthase in the ileum of the HFD-AOM group compared with the AIN-AOM group. Although the HFD and AIN groups did not differ in bacterial species number, the HFD and AIN diets resulted in different bacterial community structures in the colon. The abundance of certain short-chain fatty acid (SCFA) producing bacteria (e.g., Barnesiella) and fecal SCFA (e.g., acetic acid) content were lower in the HFD-AOM group compared with the AIN and AIN-AOM groups. Furthermore, we identified a high abundance of Anaeroplasma bacteria, an opportunistic pathogen in the HFD-AOM group. Collectively, we demonstrate that an HFD promotes AC formation concurrent with an increase of opportunistic pathogenic bacteria in the colon of C57BL/6 mice. Published by Elsevier Inc.

  18. Indrek Saar kehastub Pilistveres Rasputiniks / Aarne Mäe

    Index Scriptorium Estoniae

    Mäe, Aarne, 1967-

    2008-01-01

    7. aug. esietendub Pilistvere vanas rehehoones Ain Saviaugu kirjutatud ja lavastatud suvetükk "Rasputin". Suvelavastuse tõi välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas mängib näitlejast riigikogulane Indrek Saar. Lisaks lühike intervjuu lavastajaga "Lavastaja Ain Saviauk : "Ajalugu on karm" ja fakte Rasputinist - "Grigori Jefimovitsh Rasputin-Novõhh"

  19. Geochemistry of dark coastal heavy-mineral beaches sand (Annaba ...

    African Journals Online (AJOL)

    Mots clés : Minéraux lourds- élément majeur –élément trace – les terres rares- sable de plage. The study area (Ain Achir and Plage-Militaire beaches) is a part of the Edough Massif/Annaba /Algeria. Recent beach sediments of Ain Achir are characterized by light sand and dark reddish one. This latter appears mostly after a ...

  20. Tolerancia a inhibidores selectivos de la ciclooxigenasa 2 en casos de alergia o intolerancia a los antiinflamatorios no esteroideos convencionales: experiencia en un centro.

    OpenAIRE

    Echeverri Junca, Gabriel Jaime; Serrano Reyes, Carlos Daniel

    2012-01-01

    Antecedentes. La baja prevalencia de reacciones cruzadas con inhibidores selectivos de la ciclooxigenasa 2 (COX-2) en pacientes con alergia o intolerancia a los antiinflamatorios no esteroideos (AINE) convencionales, permite practicar una prueba de provocación con buen margen de seguridad para verificar la tolerancia a uno o varios de estos fármacos. Objetivo. Evaluar la tolerancia a inhibidores selectivos de la COX-2 en pacientes con intolerancia o alergia a los AINE convencionales en un cen...

  1. Relevancia clínica de las interacciones medicamentosas entre antiinflamatorios no esteroideos y antihipertensivos

    Directory of Open Access Journals (Sweden)

    Juan Villa

    2014-11-01

    Conclusiones: Algunos AINE pueden disminuir la efectividad del tratamiento antihipertensivo cuando se utilizan simultáneamente con antihipertensivos, en especial con inhibidores de la enzima conversora de angiotensina, diuréticos, bloqueadores beta y antagonistas de los receptores de angiotensina. No se encontró evidencia de la modificación del efecto de los antagonistas de los canales de calcio, especialmente dihidropiridínicos, por el uso simultáneo con AINE.

  2. Low-Energy Tunable Self-Modulated Nanolasers (1.1 SHORT-TERM INNOVATIVE RESEARCH (STIR) PROGRAM)

    Science.gov (United States)

    2016-09-28

    300 400 500 Th resh o ld G ain (cm -1) Q f ac to r SiO2 bot-layer thickness (nm) Varying SiO2 bot-layer thickness ONLY Q gth (a) 0 50 100...150 200 250 300 350 400 450 500 1300 1350 1400 1450 1500 1550 1600 0 50 100 150 200 250 300 350 Th resh o ld G ain (cm -1) Q f ac to r ITO

  3. Entanglement Rate for Gaussian Continuous Variable Beams

    Science.gov (United States)

    2016-08-24

    ain ,in ,in ,in ,in T( ˆ ˆ ˆ ˆ )† † . The quantumLangevin equations can be cast in the following compact form k= -A MA A , 30in˙ ( ) where...d w wá - ¢ ñ = + ¢¢ ¢a a 2q q qq,in ,inˆ ( ) ˆ ( ) ( ) † . For convenience, we define the vectors w w w w w= - -+ + - -A a a a ain out ,in out ,in out

  4. Pose de la première pierre du bâtiment SMA18 du Cern

    CERN Multimedia

    CERN Press Office. Geneva

    1999-01-01

    On 30 April 1999, Jean Pépin, Sénateur for the Department of the Ain and President of the Conseil Général, and Professor Luciano Maiani the Director-General of CERN will lay the foundation stone of Building SMA18, financed by the Department of the Ain in the framework of France's special contribution to CERN's Large Hadron Collider (LHC) project.

  5. Synthesis of TiCuAg thick film inks for glass frit free metallization of aluminium nitride

    International Nuclear Information System (INIS)

    Adlassnig, A.; Schuster, J. C.; Smetana, W.; Reicher, R.

    1997-01-01

    A glas frit free screen printing ink for metallization of AIN was developed. Bonding to the substrate is achieved by active metal additives. The metallic component consists of Cu and Ag powder synthesized from inorganic salts by the polyol process, and Cu-Ti powder synthesized by arc melting, milling and ultracentrifugation. This ternary powder mixture was introduced to a specifically developed organic vehicle and screen printed onto AIN. The detailed development process and the results will be presented. (author)

  6. Wireless intelligent network: infrastructure before services?

    Science.gov (United States)

    Chu, Narisa N.

    1996-01-01

    The Wireless Intelligent Network (WIN) intends to take advantage of the Advanced Intelligent Network (AIN) concepts and products developed from wireline communications. However, progress of the AIN deployment has been slow due to the many barriers that exist in the traditional wireline carriers' deployment procedures and infrastructure. The success of AIN has not been truly demonstrated. The AIN objectives and directions are applicable to the wireless industry although the plans and implementations could be significantly different. This paper points out WIN characteristics in architecture, flexibility, deployment, and value to customers. In order to succeed, the technology driven AIN concept has to be reinforced by the market driven WIN services. An infrastructure suitable for the WIN will contain elements that are foreign to the wireline network. The deployment process is expected to seed with the revenue generated services. Standardization will be achieved by simplifying and incorporating the IS-41C, AIN, and Intelligent Network CS-1 recommendations. Integration of the existing and future systems impose the biggest challenge of all. Service creation has to be complemented with service deployment process which heavily impact the carriers' infrastructure. WIN deployment will likely start from an Intelligent Peripheral, a Service Control Point and migrate to a Service Node when sufficient triggers are implemented in the mobile switch for distributed call control. The struggle to move forward will not be based on technology, but rather on the impact to existing infrastructure.

  7. Fractal dimension and image statistics of anal intraepithelial neoplasia

    Energy Technology Data Exchange (ETDEWEB)

    Ahammer, H., E-mail: helmut.ahammer@medunigraz.a [Institute of Biophysics, Center of Physiological Medicine, Medical University of Graz, Harrachgasse 21, A-8010 Graz (Austria); Kroepfl, J.M. [Human Performance Research Graz (HPR Graz), Karl-Franzens and Medical University of Graz, Max-Mell Allee 11, A-8010 Graz (Austria); Hackl, Ch. [Research Group of Applied Theoretical Pathology, Department of Pathology, Country Medical Centre St.Poelten, Propst Fuehrer Strasse 4, A-3100 St.Poelten (Austria); Sedivy, R. [Research Group of Applied Theoretical Pathology, Department of Pathology, Country Medical Centre St.Poelten, Propst Fuehrer Strasse 4, A-3100 St.Poelten (Austria); Department of Pathology, Country Medical Centre St.Poelten, Propst Fuehrer Strasse 4, A-3100 St.Poelten (Austria)

    2011-01-15

    Research Highlights: Human papillomaviruses cause anal intraepithelial neoplasia (AIN). Digital image processing was carried out to classify the grades of AIN quantitatively. The fractal dimension as well as grey value statistics was calculated. Higher grades of AIN yielded higher values of the fractal dimension. An automatic detection system is feasible. - Abstract: It is well known that human papillomaviruses (HPV) induce a variety of tumorous lesions of the skin. HPV-subtypes also cause premalignant lesions which are termed anal intraepithelial neoplasia (AIN). The clinical classification of AIN is of growing interest in clinical practice, due to increasing HPV infection rates throughout human population. The common classification approach is based on subjective inspections of histological slices of anal tissues with all the drawbacks of depending on the status and individual variances of the trained pathologists. Therefore, a nonlinear quantitative classification method including the calculation of the fractal dimension and first order as well as second order image statistical parameters was developed. The absolute values of these quantitative parameters reflected the distinct grades of AIN very well. The quantitative approach has the potential to decrease classification errors significantly and it could be used as a widely applied screening technique.

  8. Acute interstitial nephritis with acetaminophen and alcohol intoxication

    Directory of Open Access Journals (Sweden)

    Alexopoulou Iakovina

    2011-04-01

    Full Text Available Abstract Drug-induced acute interstitial nephritis (AIN represents a growing cause of renal failure in current medical practice. While antimicrobials and non-steroidal anti-inflammatory drugs are typically associated with drug-induced AIN, few reports have been made on the involvement of other analgesics. We report our experience in managing a 17-year-old female with AIN and subsequent renal injury following an acetaminophen overdose in conjunction with acute alcohol intoxication. It is well established that acetaminophen metabolism, particularly at high doses, produces reactive metabolites that may induce renal and hepatic toxicity. It is also plausible however, that such reactive species could instead alter renal peptide immunogenicity, thereby inducing AIN. In the following report, we review a possible mechanism for the acetaminophen-induced AIN observed in our patient and also discuss the potential involvement of acute alcohol ingestion in disease onset. The objective of our report is to increase awareness of healthcare professionals to the potential involvement of these commonly used agents in AIN pathogenesis.

  9. Method of analysis of populations exposure and radio coverage of GSM and UMTS mobile phone networks

    International Nuclear Information System (INIS)

    Gaudaire, Francois; Noe, Nicolas; Dufour, Jean Benoit; De Seze, Rene; Cagnon, Patrice; Selmaoui, Brahim; Mauger, Samuel; Thuroczy, Georges; Mazet, Paul

    2012-01-01

    We present a description and preliminary results of a large-scale project (COMOP) started in 2009 by the Ministry for Ecology, Sustainable Development and Energy and the National Agency of Frequencies (ANFR). This work is collaborative between the government, municipalities, associations, network operators and agencies. This project concerns GSM and UMTS mobile phone networks. Sixteen voluntary pilot communes were selected to carry out the experiments. This work is based on numerical modeling methods associated with various innovative measurement campaigns. It consists of: - determination of current status of exposure to radiofrequency electromagnetic fields emitted by base station antennas by modeling and measurements. - investigations on reducing this exposure while assessing the impact of parallel territorial coverage and quality of service of mobile networks. This study has established a comprehensive scientific realization of human exposure to radio-frequencies from base station antennas. These results constitute an innovative approach and are relevant in terms of dialogue in the current debate about positioning of base stations. (authors)

  10. 19. day devoted to electromagnetic waves organised by WHIST LAB, the joint laboratory of Institut Telecom and Orange Labs

    International Nuclear Information System (INIS)

    Debbah, Merouane; Matthes, Ruediger; Isabelle Deltour; Veyret, Bernard; Mann, Simon; Van Rongen, Eric; Laurent, L.; Celli, Bernard; Wiedemann, Peter; Ravazzani, P.; Rowley, Jack; Wiart, Joe

    2012-12-01

    This 2012 edition of the annual meeting devoted to the electromagnetic waves and to their interactions with the human being was the occasion to tackle the problem of RF waves under various aspects: technological, biological, epidemiological, societal, risk management. This document gathers the available presentations (slides) given during the meeting and dealing with: 1 - Green Small Cell Flexible Networks (Debbah, M.); 2 - Electromagnetic Fields - The ICNIRP View (Matthes, R.); 3 - IARC Research Actions on Radio-frequencies (Deltour, I.); 4 - Research activity worldwide on mobile telephony and health/Review of international research on RF bio-effects (Veyret, B.); 5 - HPA Research on RF Exposures (Mann, S.); 6 - The Dutch research programme 'Electromagnetic Fields and Health' (Van Rongen, E.); 7 - National Programme 'Occupational and environmental health and safety' of ANSES (Laurent, L.); 8 - ANFR and public exposure to radioelectric waves (Celli, B.); 9 - EMF exposure and risk perception: Challenges and needs of the next decade (Wiedemann, P.); 10 - The EFHRAN project: an European experience of EMF Health Risk Assessment (Ravazzani, P.); 11 - Mobile Networks: Exposure Levels (Rowley, J.); 12 - Lexnet, low EMF exposure future networks (Wiart, J.)

  11. High reactivity of nanosized niobium oxide cluster cations in methane activation: A comparison with vanadium oxides.

    Science.gov (United States)

    Ding, Xun-Lei; Wang, Dan; Wu, Xiao-Nan; Li, Zi-Yu; Zhao, Yan-Xia; He, Sheng-Gui

    2015-09-28

    The reactions between methane and niobium oxide cluster cations were studied and compared to those employing vanadium oxides. Hydrogen atom abstraction (HAA) reactions were identified over stoichiometric (Nb2O5)N(+) clusters for N as large as 14 with a time-of-flight mass spectrometer. The reactivity of (Nb2O5)N(+) clusters decreases as the N increases, and it is higher than that of (V 2O5)N(+) for N ≥ 4. Theoretical studies were conducted on (Nb2O5)N(+) (N = 2-6) by density functional calculations. HAA reactions on these clusters are all favorable thermodynamically and kinetically. The difference of the reactivity with respect to the cluster size and metal type (Nb vs V) was attributed to thermodynamics, kinetics, the electron capture ability, and the distribution of the unpaired spin density. Nanosized Nb oxide clusters show higher HAA reactivity than V oxides, indicating that niobia may serve as promising catalysts for practical methane conversion.

  12. Thermoelectric Energy Conversion Technology for High-Altitude Airships

    Science.gov (United States)

    Choi, Sang H.; Elliott, James R.; King, Glen C.; Park, Yeonjoon; Kim, Jae-Woo; Chu, Sang-Hyon

    2011-01-01

    The High Altitude Airship (HAA) has various application potential and mission scenarios that require onboard energy harvesting and power distribution systems. The power technology for HAA maneuverability and mission-oriented applications must come from its surroundings, e.g. solar power. The energy harvesting system considered for HAA is based on the advanced thermoelectric (ATE) materials being developed at NASA Langley Research Center. The materials selected for ATE are silicon germanium (SiGe) and bismuth telluride (Bi2Te3), in multiple layers. The layered structure of the advanced TE materials is specifically engineered to provide maximum efficiency for the corresponding range of operational temperatures. For three layers of the advanced TE materials that operate at high, medium, and low temperatures, correspondingly in a tandem mode, the cascaded efficiency is estimated to be greater than 60 percent.

  13. Haloacetic acids in the aquatic environment. Part II: ecological risk assessment

    International Nuclear Information System (INIS)

    Hanson, Mark L.; Solomon, Keith R.

    2004-01-01

    Haloacetic acids (HAAs) are environmental contaminants found in aquatic ecosystems throughout the world as a result of both anthropogenic and natural production. The ecological risk posed by these compounds to organisms in freshwater environments, with a specific focus on aquatic macrophytes, was characterized. The plants evaluated were Lemna gibba, Myriophyllum spicatum and M. sibiricum and the HAAs screened were monochloroacetic acid (MCA), dichloroacetic acid (DCA), trichloroacetic acid (TCA), trifluoroacetic acid (TFA) and chlorodifluoroacetic acid (CDFA). Laboratory toxicity data formed the basis of the risk assessment, but field studies were also utilized. The estimated risk was calculated using hazard quotients (HQ), as well as effect measure distributions (EMD) in a modified probabilistic ecological risk assessment. EMDs were used to estimate HAA thresholds of toxicity for use in HQ assessments. This threshold was found to be a more sensitive measure of low toxicity than the no observed effect concentrations (NOEC) or the effective concentration (EC 10 ). Using both deterministic and probabilistic methods, it was found that HAAs do not pose a significant risk to freshwater macrophytes at current environmental concentrations in Canada, Europe or Africa for both single compound and mixture exposures. Still, HAAs are generally found as mixtures and their potential interactions are not fully understood, rendering this phase of the assessment uncertain and justifying further effects characterization. TCA in some environments poses a slight risk to phytoplankton and future concentrations of TFA and CDFA are likely to increase due to their recalcitrant nature, warranting continued environmental surveillance of HAAs. - Current environmental concentrations of haloacetic acids do not pose a risk to aquatic macrophytes, but could impact plankton

  14. Antioxidant Properties of Kynurenines: Density Functional Theory Calculations

    Science.gov (United States)

    2016-01-01

    Kynurenines, the main products of tryptophan catabolism, possess both prooxidant and anioxidant effects. Having multiple neuroactive properties, kynurenines are implicated in the development of neurological and cognitive disorders, such as Alzheimer's, Parkinson's, and Huntington's diseases. Autoxidation of 3-hydroxykynurenine (3HOK) and its derivatives, 3-hydroxyanthranilic acid (3HAA) and xanthommatin (XAN), leads to the hyperproduction of reactive oxygen species (ROS) which damage cell structures. At the same time, 3HOK and 3HAA have been shown to be powerful ROS scavengers. Their ability to quench free radicals is believed to result from the presence of the aromatic hydroxyl group which is able to easily abstract an electron and H-atom. In this study, the redox properties for kynurenines and several natural and synthetic antioxidants have been calculated at different levels of density functional theory in the gas phase and water solution. Hydroxyl bond dissociation enthalpy (BDE) and ionization potential (IP) for 3HOK and 3HAA appear to be lower than for xanthurenic acid (XAA), several phenolic antioxidants, and ascorbic acid. BDE and IP for the compounds with aromatic hydroxyl group are lower than for their precursors without hydroxyl group. The reaction rate for H donation to *O-atom of phenoxyl radical (Ph-O*) and methyl peroxy radical (Met-OO*) decreases in the following rankings: 3HOK ~ 3HAA > XAAOXO > XAAENOL. The enthalpy absolute value for Met-OO* addition to the aromatic ring of the antioxidant radical increases in the following rankings: 3HAA* < 3HOK* < XAAOXO* < XAAENOL*. Thus, the high free radical scavenging activity of 3HAA and 3HOK can be explained by the easiness of H-atom abstraction and transfer to O-atom of the free radical, rather than by Met-OO* addition to the kynurenine radical. PMID:27861556

  15. Influence of pH and ozone dose on the content and structure of haloacetic acid precursors in groundwater.

    Science.gov (United States)

    Molnar, Jelena; Agbaba, Jasmina; Dalmacija, Božo; Rončević, Srđan; Prica, Miljana; Tubić, Aleksandra

    2012-09-01

    This study investigated the effects of pH (6-10) and ozone dose [0.4-3.0 mg O(3)/mg dissolved organic carbon (DOC)] on the content and structure of haloacetic acid (HAA) precursors in groundwater rich in natural organic matter (NOM; DOC 9.85 ± 0.18 mg/L) during drinking water treatment. The raw water was ozonated in a 2 L glass column. NOM fractionation was carried out using XAD resins. HAA formation potential (HAAFP) was determined according to standard EPA Method 552. NOM characterization revealed it is mostly hydrophobic (65 % fulvic and 14 % humic acids). Hydrophobic NOM significantly influences HAA formation, as confirmed by the high HAAFP (309 ± 15 μg/L). Ozonation at pH 6-10 led to changes in NOM structure, i.e. complete humic acid oxidation, and increased the hydrophilic NOM fraction content (65-90 % achieved using 3.0 mg O(3)/mg DOC). The highest degree of NOM oxidation and HAA precursor removal was achieved at pH 10 (up to 68 % HAAFP). Ozonation pH influenced the distribution of HAA precursor content, as increasing the pH from 6 to 10 increased the reactivity of the hydrophilic fraction, with the HAAFP increasing from 19.1 ± 6.0 μg/mg DOC in raw water to 152 ± 8 μg/mg DOC in ozonated water. The degree of HAA precursor removal depends on the dominant oxidation mechanism, which is related to the applied ozone dose and the pH of the oxidation process. Ozonation at pH 10 favours the mechanism of radical NOM oxidation and was the most effective for HAAFP reduction, with the efficacy of the process improving with increasing ozone dose.

  16. Quantitative evaluation of interstitial pneumonia using 3D-curved high-resolution CT imaging parallel to the chest wall: A pilot study.

    Directory of Open Access Journals (Sweden)

    Hiroyasu Umakoshi

    Full Text Available To quantify the imaging findings of patients with interstitial pneumonia (IP and emphysema using three-dimensional curved high-resolution computed tomography (3D-cHRCT at a constant depth from the chest wall, and compare the results to visual assessment of IP and each patient's diffusing capacity of the lungs for carbon monoxide (DLco.We retrospectively reviewed the axial CT findings and pulmonary function test results of 95 patients with lung cancer (72 men and 23 women, aged 45-84 years with or without IP, as follows: non-IP (n = 47, mild IP (n = 31, and moderate IP (n = 17. The 3D-cHRCT images of the lung at a 1-cm depth from the chest wall were reconstructed automatically using original software; total area (TA, high-attenuation area (HAA >-500 HU, and low-attenuation area (LAA <-950 HU were calculated on a workstation. The %HAA and %LAA were calculated as follows: [Formula: see text], and [Formula: see text].The %HAA and %LAA respective values were 3.2±0.9 and 27.7±8.2, 3.9±1.2 and 27.6±5.9, and 6.9±2.2 and 25.4±8.7 in non-IP, mild IP, and moderate IP patients, respectively. There were significant differences in %HAA between the 3 groups of patients (P<0.001, but no differences in %LAA (P = 0.558. Multiple linear regression analysis revealed that %HAA and %LAA were negatively correlated with predicted DLco (standard partial regression coefficient [b*] = -0.453, P<0.001; b* = -0.447, P<0.001, respectively.The %HAA and %LAA values computed using 3D-cHRCT were significantly correlated with DLco and may be important quantitative parameters for both IP and emphysema.

  17. Antioxidant Properties of Kynurenines: Density Functional Theory Calculations.

    Directory of Open Access Journals (Sweden)

    Aleksandr V Zhuravlev

    2016-11-01

    Full Text Available Kynurenines, the main products of tryptophan catabolism, possess both prooxidant and anioxidant effects. Having multiple neuroactive properties, kynurenines are implicated in the development of neurological and cognitive disorders, such as Alzheimer's, Parkinson's, and Huntington's diseases. Autoxidation of 3-hydroxykynurenine (3HOK and its derivatives, 3-hydroxyanthranilic acid (3HAA and xanthommatin (XAN, leads to the hyperproduction of reactive oxygen species (ROS which damage cell structures. At the same time, 3HOK and 3HAA have been shown to be powerful ROS scavengers. Their ability to quench free radicals is believed to result from the presence of the aromatic hydroxyl group which is able to easily abstract an electron and H-atom. In this study, the redox properties for kynurenines and several natural and synthetic antioxidants have been calculated at different levels of density functional theory in the gas phase and water solution. Hydroxyl bond dissociation enthalpy (BDE and ionization potential (IP for 3HOK and 3HAA appear to be lower than for xanthurenic acid (XAA, several phenolic antioxidants, and ascorbic acid. BDE and IP for the compounds with aromatic hydroxyl group are lower than for their precursors without hydroxyl group. The reaction rate for H donation to *O-atom of phenoxyl radical (Ph-O* and methyl peroxy radical (Met-OO* decreases in the following rankings: 3HOK ~ 3HAA > XAAOXO > XAAENOL. The enthalpy absolute value for Met-OO* addition to the aromatic ring of the antioxidant radical increases in the following rankings: 3HAA* < 3HOK* < XAAOXO* < XAAENOL*. Thus, the high free radical scavenging activity of 3HAA and 3HOK can be explained by the easiness of H-atom abstraction and transfer to O-atom of the free radical, rather than by Met-OO* addition to the kynurenine radical.

  18. Simultaneous determination of 9 heterocyclic aromatic amines in pork products by liquid chromatography coupled with triple quadrupole tandem mass spectrometry

    Science.gov (United States)

    Shen, X. C.; Zhang, Y. L.; Cui, Y. Q.; Xu, L. Y.; Li, X.; Qi, J. H.

    2017-07-01

    Heterocyclic aromatic amines (HAAs) are potent mutagens that formed at high temperature in cooked, protein-rich food. Owing to their frequent intake, an accurate method is essential to access human health risk of HAAs exposure through detecting these compounds in various heat-treated meat products. In this study, a liquid chromatography-electrospray tandem mass spectrometry (LC--ESI-MS/MS) method was developed to perform the determination of 9 mutagenic heterocyclic amines (HAAs) in meat samples with multiple reaction monitoring (MRM) mode. Ultrasound assisted extraction and diatomaceous earth was employed to extract HAAs from food samples, and the analytes were purified and enriched using tandem solid phase extraction, with propyl sulfonic acid coupled to a C18 cartridge. Two parameters, extraction time and eluent, were carefully optimized to improve the extraction and purification efficiency. The LC separation was carried out using a Zorbax SB-C18 (3.5 μm particle size, 2.1 × 150 mm i.d.) column and optimized some parameters, such as pH, concentration and volume. Under the optimal experimental conditions, recoveries ranged from 52.97% to 97.11% with good quality parameters: limit of detection values between 0.02 and 0.24 ng mL-1, linearity (R2>0.998), and run-to-run and day-to-day precisions lower than 9.81% achieved. To evaluate the performance of the method in high throughput analysis of complex meat samples, the LC-MS/MS method was applied to the analysis of HAAs in three food samples, and the results demonstrated that the method can be used for the trace determination of HAAs in pork samples.

  19. Análisis de mutaciones genéticas de alcohol deshidrogenasa, acetaldehído deshidrogenasa y citocromo P 450 en pacientes con hepatopatía alcohólica

    OpenAIRE

    Segado Soriano, Antonio

    2004-01-01

    Objetivos: Establecer la eficacia de los marcadores biológicos de etilismo y de HAA. Analizar las frecuencias de mutaciones genéticas en alcohol deshidrogenasa (ADH), aldehído deshidrogenasa (ALDH) y citocromo P450 2E1 (CYP2E1) y establecer su posible asociación con el desarrollo de hepatitis alcohólica aguda (HAA). Estudiamos un total de 120 pacientes Españoles clasificados en tres grupos en función de lesión histológica hepática y consumo de alcohol: grupo 1= abstemios; grupos 2 = bebedores...

  20. Laser Photochemistry.

    Science.gov (United States)

    1981-07-01

    HAB + HAA + HABA + HA, (18) where HA and HB are the unperturbed Hamiltonians of the active (A) mode and the bath (B) modes, respectively and HAB is...equations of motion for the average excitation of the active mode in which the many-body effects of the phonon bath modes (HAB and HABA ) and the active...relaxation rates induced by the many-body effects of the Hamiltonians HAA, HAB and HABA ; n is a Bose-Einstein function for the bath modes; and 2c <n> is the