WorldWideScience

Sample records for ahb compatible ddr

  1. Dicty_cDB: AHB126 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AH (Link to library) AHB126 (Link to dictyBase) - - - Contig-U16336-1 AHB126P (Link... to Original site) AHB126F 598 AHB126Z 500 AHB126P 1078 - - Show AHB126 Library AH (Link to library) Clone ID AHB126 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dict...RGIRNHKKNETKFINQCINEIKEELKGDMQKKTVAVQKLTYIQMLGFDI SWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQSEAYLAL NCLSNICT...KKNETKFINQCINEIKEELKGDMQKKTVAVQKLTYIQMLGFDI SWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQSEAYLAL NCLSNICT

  2. General Purpose AHB-DMA Controller

    Directory of Open Access Journals (Sweden)

    Chetan Sharma

    2011-03-01

    Full Text Available This paper reviewed the design of a general purpose AHB-DMA controller whichhas two channels to perform read/write operations between the memory and customizable interface (SPI, I2C, USB or SDIOetc.. Each DMA channel enables movement of data from a source AHB address to the IP or IP to the destination AHB address, for a given programmed count. When the programmed bytes (data are transferred to/from the system memory, an “End of transfer interrupt” is generated by the DMA for each channel.

  3. General Purpose AHB-DMA Controller

    OpenAIRE

    Chetan Sharma

    2011-01-01

    This paper reviewed the design of a general purpose AHB-DMA controller whichhas two channels to perform read/write operations between the memory and customizable interface (SPI, I2C, USB or SDIOetc.). Each DMA channel enables movement of data from a source AHB address to the IP or IP to the destination AHB address, for a given programmed count. When the programmed bytes (data) are transferred to/from the system memory, an “End of transfer interrupt” is generated by the DMA for each channe...

  4. Dicty_cDB: AHB319 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AH (Link to library) AHB319 (Link to dictyBase) - - - Contig-U11186-1 AHB319P (Link to Original ... tnstktttnstiksyisttinqid*tkihsks r*f*l*f*nkfr**ksr*ngs --- ---SNHVREEAVKSLIARAAPVITSEDRVFLTTKLHIPEIWIDEAKA ... tlln Homology vs CSM-cDNA Score E Sequences producing s ignificant alignments: (bits) Value AHB319 (AHB319 ... 004.12.25 Homology vs DNA Score E Sequences producing s ignificant alignments: (bits) Value N AE014016 |AE ... 2.26 Homology vs Protein Score E Sequences producing s ignificant alignments: (bits) Value (Q54EQ8) RecNa ...

  5. Dicty_cDB: AHB313 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AH (Link to library) AHB313 (Link to dictyBase) - - - Contig-U12643-1 | Contig-U15705-1 AHB313P ... ifh*tink*nllckmsnrfk*fsktkkrfirfllfml*ifn*rr*yycn**reis **mf *mfil*gsy*rk*f**rtndinfk*lll*ylftqw*s**mcllswc ...

  6. Dicty_cDB: AHB262 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AH (Link to library) AHB262 (Link to dictyBase) - - - Contig-U16405-1 AHB262P (Link to Original ... *ikyc*glyi*cfgfsilsksiqfei**ktkniw*ryshywlifkiiwws*fpy ... *fh*ck*tfc--- ---nihwssfrtkynidlyktndfrnsnh*k*n*kr ...

  7. Dicty_cDB: AHB119 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AH (Link to library) AHB119 (Link to dictyBase) - - - Contig-U16405-1 AHB119P (Link to Original ... ikyc*glyi*cfgfsilsksiqfei**ktkniw*ryshywlifkii wws*fpy *fh*ck*tfc--- ---iikipqyllkmkry**lemkvervhsllqhslef ...

  8. Dicty_cDB: AHB155 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AH (Link to library) AHB155 (Link to dictyBase) - - - Contig-U11277-1 - (Link to Original site) ... 1 1 AJ242743 |AJ242743.1 Schizosaccharomyces pombe tpp 1+ gene for trehalose-6P phosphatase, exon 1. 50 0. ... hizosaccharomyces pombe phosphatidate phosphatase (TPP ) mRNA, partial cds. 50 0.031 1 BM360566 |BM360566. ...

  9. 并符合DDR1/DDR2/DDR3标准要求

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    加利福尼亚州米尔皮塔斯(MILPITAS,CA)凌力尔特公司(Linear Technology Corporation)推出高效率双输出同步降压型DC/DC控制器LTC3876,该器件为DDR1/DDR2/DDR3以及未来的标准存储器应用产生VDDQ电源电压、VTT总线终端电压和VTTR基准电压。第一个通道的输出产生VDDQ,并可在电流高达25 A时,在2.5~1 V的范围内设定VDDQ。

  10. Dicty_cDB: AHB145 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available uolar 4.0 %: plasma membrane >> prediction for AHB145 is cyt 5' ...ATCAAAGAAGGTCAAACACCAAAGTCTGTTAAXXXXXXXXXX sequence update 2002.10.25 Translated Amino Acid sequence *k*ksch...nslated Amino Acid sequence (All Frames) Frame A: lkvkklplpvivsviillnhhldgn*i*pfgk*l...:none) Podospora anserina genomic DNA c... 149 2e-40 Y18574_4( Y18574 |pid:none) Streptomyces tendae stra...omplete... 49 9e-05 BC158505_1( BC158505 |pid:none) Xenopus tropicalis pipecolic acid

  11. Multi Resolution AHB Bus Tracer with Real Time Compression for SOC

    Directory of Open Access Journals (Sweden)

    J. Jagadish Reddy

    2013-01-01

    Full Text Available AMBA (Advanced Microcontroller based Bus Architecture consists of AHB, APB, ASB and AXI. In this project we are Tracing AHB (Advanced High performance Bus signals with Real time Compression and Multi-resolution Techniques. A simple transaction on the AHB consists of an address phase and a subsequent data phase. Access to the target device is controlled through a MUX , thereby admitting bus-access to one bus-master at a time. In AHB Tracer we have to Trace Address signals, Data signals and Control signals, we have to compress them depending on AHB protocols. A multi-resolution AHB on-chip bus tracer is named as SYS_HMRBT (AHB Multi-resolution Bus Tracer and is used for monitoring. The goal is to provide better compression quality and multiple resolution traces to meet the complex SoC debugging needs. Compressing all signals at cycle-accurate-level does not always meet the debugging needs. As SOCs become more complex, the transaction level debugging becomes increasingly important, since it helps designers focus on the functional behaviors, instead of interpreting complex signals. By using this SYS_HMRBT, we can achieve 79%-96% of compression depending on selected resolution mode. Tools Used for this Project are Modelsim for Simulation, and Xilinx ISE II for Synthesis

  12. Personalwirtschaftliche Probleme in DDR-Betrieben

    OpenAIRE

    1990-01-01

    Das Sonderheft enthält Beiträge von DDR-Autor/innen zu den Themenkreisen "Von der Kaderarbeit zum Personalmanagement", "Motivation", "Technik" und "Aus- und Weiterbildung", jeweils mit Kommentaren von westdeutschen Personalexperten. Im einzelnen werden behandelt: der Übergang von der Reproduktion des Arbeitsvermögens in Betrieben der DDR zum Personalmanagement in Unternehmen der Marktwirtschaft; bisherige und künftige Aufgaben der Personalabteilung in Unternehmen der DDR; Entwicklungsstand, a...

  13. Radiation hard Monolithic SDRAM to support DDR2 and DDR3 architectures Project

    Data.gov (United States)

    National Aeronautics and Space Administration — There is no rad hard SDRAM currently available to support DDR2 and DDR3 applications. Space Micro proposes to build a radiation hardened by design (RHBD) SDRAM...

  14. NEPP DDR Device Reliability FY13 Report

    Science.gov (United States)

    Guertin, Steven M.; Armbar, Mehran

    2014-01-01

    This document reports the status of the NEPP Double Data Rate (DDR) Device Reliability effort for FY2013. The task targeted general reliability of > 100 DDR2 devices from Hynix, Samsung, and Micron. Detailed characterization of some devices when stressed by several data storage patterns was studied, targeting ability of the data cells to store the different data patterns without refresh, highlighting the weakest bits. DDR2, Reliability, Data Retention, Temperature Stress, Test System Evaluation, General Reliability, IDD measurements, electronic parts, parts testing, microcircuits

  15. Radiation Hard Monolithic SDRAM to Support DDR2 and DDR3 Architectures Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Space Micro has developed the architecture for a radiation hardened memory subsystem that targets DDR3-and-beyond generations of DRAM. The architecture combines...

  16. Use of Commercial FPGA-Based Evaluation Boards for Single-Event Testing of DDR2 and DDR3 SDRAMs

    Science.gov (United States)

    Ladbury, R. L.; Berg, M. D.; Wilcox, E. P.; LaBel, K. A.; Kim, H. S.; Phan, A. M.; Seidleck, C. M.

    2013-01-01

    We investigate the use of commercial FPGA based evaluation boards for radiation testing DDR2 and DDR3 SDRAMs. We evaluate the resulting data quality and the tradeoffs involved in the use of these boards.

  17. Recruitment and DDR: The case of Liberia

    OpenAIRE

    Gilhooly, Crystal Elizabeth

    2010-01-01

    This paper argues that if Disarmament, Demobilisation, and Reintegration (DDR) programmes have evolved from conflict resolution mechanisms to conflict prevention mechanisms, then there must be a greater focus on the nature of the recruitment relationship between the faction and the individual. Based on the theoretical and empirical work of Pugel, Humphreys, and Weinstein, the project uses the case of Liberia and its ex-combatants to support the theory that factions with different social and ...

  18. Denkmalpflege in der DDR. Rückblicke

    OpenAIRE

    Haspel, Jörg; Staroste, Hubert

    2014-01-01

    Denkmalpflege in der DDR. Rückblicke (Beiträge zur Denkmalpflege in Berlin, Band 41), hg. vom Landesdenkmalamt Berlin (Jörg Haspel und Hubert Staroste), Berlin: nicolai 2014 // mit Beiträgen von Ludwig Deiters, Ernst Wipprecht, Horst Ende, Peter Goralczyk, Rainhard Rüger, Rainer Schöne, Rainer Koppe, Ernst Badstübner, Reinhard Schmitt, Gotthard Voß, Werner Heinrich, Hans-Hartmmut Schauer, Thomas Noky, Günther Timm, Wolfgang Hähle, Gerhard Glaser, Heinrich Schleiff, Dieter Zander, Hans-Joachi...

  19. Die amtliche Erwerbstätigenstatistik in der DDR

    OpenAIRE

    Fritz, Wolfgang

    1997-01-01

    "Der Autor behandelt in diesem Artikel folgende Fragen zur amtlichen Erwerbstätigenstatistik in der DDR: Datenbedarf und allgemeine Datenlage; Glaubwürdigkeit der statistischen Daten; Spezifika der Erwerbstätigenstatistik in der DDR und deren Periodisierung; Datengewinnung, -erfassung und -verarbeitung; Erhebungen und ihre Charakteristika (Berufstätigenerhebung, Arbeitskräfteberichterstattung, Beschäftigtengruppenerhebung, Schichtberichterstattung, Normenberichterstattung, Qualifikationsberic...

  20. Comparative-Analysis of Gene-Sequences Encoding Ammonia Monooxygenase of Nitrosospira Sp Ahb1 and Nitrosolobus- Multiformis C-71

    NARCIS (Netherlands)

    Rotthauwe, J.H.; De Boer, W.; Liesack, W.

    1995-01-01

    DNA encoding ammonia monooxygenase from two phylogenetically related autotrophic nitrifying bacteria, Nitrosospira sp. AHB1 and Nitrosolobus multiformis C-71, was amplified by PCR, The resulting products were cloned into the vector pCR-Script, A continuous region of DNA of about 1.5 kb for strain AH

  1. Offizielle Kontakte zwischen der DDR und Polen in der Grenzregion

    OpenAIRE

    Wojtaszyn, Dariusz

    2011-01-01

    Eine neue Ära in den gegenseitigen Beziehungen zwischen der Volksrepublik Polen und der DDR begann in den 1970er Jahren. Die beiden neuen Staatschefs Edward Gierek und Erich Honecker entschlossen sich am 25. November 1971, die Grenze zwischen der DDR und Polen für den pass- und visafreien Reiseverkehr zu öffnen. Es war ein Schritt, der in den Staaten des Ostblocks beispiellos war. Ab dem 1. Januar 1972 wurde die Grenze geöffnet und Jahr für Jahr überschritten sie Millionen von DDR-Bewohne...

  2. Discoidin domain receptor 1 (DDR1) kinase as target for structure-based drug discovery.

    Science.gov (United States)

    Kothiwale, Sandeepkumar; Borza, Corina M; Lowe, Edward W; Pozzi, Ambra; Meiler, Jens

    2015-02-01

    Discoidin domain receptor (DDR) 1 and 2 are transmembrane receptors that belong to the family of receptor tyrosine kinases (RTK). Upon collagen binding, DDRs transduce cellular signaling involved in various cell functions, including cell adhesion, proliferation, differentiation, migration, and matrix homeostasis. Altered DDR function resulting from either mutations or overexpression has been implicated in several types of disease, including atherosclerosis, inflammation, cancer, and tissue fibrosis. Several established inhibitors, such as imatinib, dasatinib, and nilotinib, originally developed as Abelson murine leukemia (Abl) kinase inhibitors, have been found to inhibit DDR kinase activity. As we review here, recent discoveries of novel inhibitors and their co-crystal structure with the DDR1 kinase domain have made structure-based drug discovery for DDR1 amenable. PMID:25284748

  3. Infiniband Performance Comparisons of SDR, DDR and Infinipath

    Energy Technology Data Exchange (ETDEWEB)

    Minich, M

    2006-05-30

    This technical report will be comparing the performance between the most common infiniband-related technologies currently available. Included will be TCP-based, MPI-based and low-level performance tests to see what performance can be expected from Mellanox's SDR and DDR as well as PathScale's Infinipath. Also, we will be performing comparisons of the Infinipath on both OpenIB as well as PathScale's ipath stack. Infiniband promises to bring high performance interconnects for I/O (filesystem and networking) to a new cost performance level. Thus, LLNL has been evaluating Infiniband for use as a cluster interconnect. Various issues impact the decision of which interconnect to use in a cluster. This technical report will be looking more closely at the actual performance of the major infiniband technologies present today. Performance testing will focus on latency, and bandwidth (both uni and bi-directional) using both TCP and MPI. In addition, we will be looking at an even lower-level (removing most of the upper-level protocols) and seeing what the connection can really do if the TCP or MPI layers were perfectly written.

  4. Die Entwicklung der Arbeitsgemeinschaft "Radiochemische Analysenmethoden" im Fachverband Analytik der Chemischen Gesellschaft der DDR

    OpenAIRE

    Niese, Siegfried

    2012-01-01

    Es wird die Geschichte der Arbeitsgemeinschaft Radiochemische Analysenmethoden in der Chemischen Gesellschaft der DDR beschrieben. The History of the working-pool Radioanalytical Chemistry of the Chemical Society of the GDR is described.

  5. Der Stellenwert von Personalmanagement und Mitarbeitermotivation in der DDR-Wirtschaft

    OpenAIRE

    Münch, Reinhard

    1990-01-01

    "Welchen Stellenwert die Personalarbeit in der Industrie der DDR hatte bzw. konnte, versucht die Analyse über vergleichende Aussagen zum Personalmanagement in Theorie und Praxis zu beantworten. Einen Ansatzpunkt bieten die Rahmenbedingungen der Organisation der Arbeit in der Wirtschaft der DDR, die eine Grundlage des Selbstverständnisses von Führungskräften bildet. Dazu gehören das tayloristisch geprägte Menschenbild, die Sichtweise auf die Rolle als Führungskraft im sozialen System des Betri...

  6. Compatible solutes

    Science.gov (United States)

    Hill, Colin

    2010-01-01

    Recently we reported a role for compatible solute uptake in mediating bile tolerance and increased gastrointestinal persistence in the foodborne pathogen Listeria monocytogenes.1 Herein, we review the evolution in our understanding of how these low molecular weight molecules contribute to growth and survival of the pathogen both inside and outside the body, and how this stress survival mechanism may ultimately be used to target and kill the pathogen. PMID:21326913

  7. FY12 End of Year Report for NEPP DDR2 Reliability

    Science.gov (United States)

    Guertin, Steven M.

    2013-01-01

    This document reports the status of the NEPP Double Data Rate 2 (DDR2) Reliability effort for FY2012. The task expanded the focus of evaluating reliability effects targeted for device examination. FY11 work highlighted the need to test many more parts and to examine more operating conditions, in order to provide useful recommendations for NASA users of these devices. In order to develop these approaches, it is necessary to develop test capability that can identify reliability outliers. To do this we must test many devices to ensure outliers are in the sample, and we must develop characterization capability to measure many different parameters. For FY12 we increased capability for reliability characterization and sample size. We increased sample size by moving from loose devices to DIMMs with an approximate reduction of 20 to 50 times in terms of per DUT cost. By increasing sample size we have improved our ability to characterize devices that may be considered reliability outliers. This report provides an update on the effort to improve DDR2 testing capability. Although focused on DDR2, the methods being used can be extended to DDR and DDR3 with relative ease.

  8. Mechanism for accurate, protein-assisted DNA annealing by Deinococcus radiodurans DdrB.

    Science.gov (United States)

    Sugiman-Marangos, Seiji N; Weiss, Yoni M; Junop, Murray S

    2016-04-19

    Accurate pairing of DNA strands is essential for repair of DNA double-strand breaks (DSBs). How cells achieve accurate annealing when large regions of single-strand DNA are unpaired has remained unclear despite many efforts focused on understanding proteins, which mediate this process. Here we report the crystal structure of a single-strand annealing protein [DdrB (DNA damage response B)] in complex with a partially annealed DNA intermediate to 2.2 Å. This structure and supporting biochemical data reveal a mechanism for accurate annealing involving DdrB-mediated proofreading of strand complementarity. DdrB promotes high-fidelity annealing by constraining specific bases from unauthorized association and only releases annealed duplex when bound strands are fully complementary. To our knowledge, this mechanism provides the first understanding for how cells achieve accurate, protein-assisted strand annealing under biological conditions that would otherwise favor misannealing. PMID:27044084

  9. Wandlungen in der Steuerung des DDR-Hochleistungssports in den 1960er und 1970er Jahren

    OpenAIRE

    Ritter, Andreas

    2005-01-01

    Die intensive Auswertung unterschiedlicher schriftlicher und mündlicher Quellen sowie die Erschließung von damals "geheimer" Literatur für die Forschung heute ermöglicht eine differenzierte Rekonstruktion historischer Abläufe. Die vorliegende Arbeit nutzt diesen Zugang zur Darstellung von kleineren und größeren DDR-internen sportpolitischen Strukturwandlungen der 1960er und 1970er Jahre, die ihren Höhepunkt in einer dramatischen Umsteuerung des DDR-Hochleistungssports fanden. Es wird gezeigt,...

  10. 3D PLUS HI-REL DDR2 Termination Regulator Module- A Building Block Function for High Reliability SDRAM DDR2 System Architecture

    Science.gov (United States)

    Perrot, Nicolas; Dubus, Patrick; Garcia-Sanchez, Esther

    2015-09-01

    Memory system architectures using DDR2 technology need to be compliant with JEDEC JESD8-15A standard [1]. Therefore a bus termination regulator able to sink and source current while regulating VTT voltage is used for this purpose. Such module has been developed by 3D PLUS and is the first space qualified DDR Termination Regulator (DDR2-TR) available on the market. It is based on an innovative Bang-Bang regulation principle, chosen for its speed performance and to guarantee an output voltage that remains within the predefined limits regardless of any output current transients. The output filter type is selected to make the module rugged to any overload condition without complex protection circuits. The module has been specifically designed for low input voltage, low noise and high reliability systems where space is a key consideration. The module uses the 3D PLUS SIP (System-In-Package) technology embedding 3 stacked PCBs. No external filters or decoupling capacitors are needed.

  11. Evaluation of discoidin domain receptor-2 (DDR2) expression level in normal, benign, and malignant human prostate tissues.

    Science.gov (United States)

    Azemikhah, Mitra; Ashtiani, Hamidreza Ahmadi; Aghaei, Mahmoud; Rastegar, Hosein

    2015-01-01

    Discoidin domain receptor (DDR) is a new member of the receptor tyrosine kinase family. There are two isoforms of discoidin domain receptor (DDR), DDR1 and DDR2. These receptors play a major role in the adhesion, motility and cell proliferation. Due to the important role of DDR2 in the development of tumor extension, this receptor is pivotal in the field of carcinogenesis. The aim of this study was to investigate the mRNA and protein expression of DDR2, in the malignant, benign prostatic hyperplasia (BPH) and normal tissues of patients with prostate cancer. In this study the gene and protein expression of DDR2 in adjacent normal (n=40), BPH (n=40), and malignant (n=40) prostate tissue were measured using real-time PCR and Western blotting. Then, the correlation of DDR2 gene and protein expression with prognostic factors such as age, tumor grade, tumor stage, lymph node involvement, and serum prostate-specific antigen (PSA) concentration were evaluated. The relative mRNA and protein expression level of DDR2 in malignant and benign prostate tissue was significantly higher than those of adjacent normal tissues (P<0.01). This expression was found to increase approximately 3.5 and 2.1 fold for mRNA and protein levels, respectively. Spearman test indicated a significant correlation between DDR2 mRNA and protein expression with prognostic factors such as tumor grade, stage, lymph node involvement, and serum PSA concentration. However, significant correlation with age was not observed. These findings suggest that DDR2 is a cancer-related gene associated with the aggressive progression of prostate cancer patients. PMID:26600862

  12. Evaluation of discoidin domain receptor-2 (DDR2) expression level in normal, benign, and malignant human prostate tissues

    Science.gov (United States)

    Azemikhah, Mitra; Ashtiani, Hamidreza Ahmadi; Aghaei, Mahmoud; Rastegar, Hosein

    2015-01-01

    Discoidin domain receptor (DDR) is a new member of the receptor tyrosine kinase family. There are two isoforms of discoidin domain receptor (DDR), DDR1 and DDR2. These receptors play a major role in the adhesion, motility and cell proliferation. Due to the important role of DDR2 in the development of tumor extension, this receptor is pivotal in the field of carcinogenesis. The aim of this study was to investigate the mRNA and protein expression of DDR2, in the malignant, benign prostatic hyperplasia (BPH) and normal tissues of patients with prostate cancer. In this study the gene and protein expression of DDR2 in adjacent normal (n=40), BPH (n=40), and malignant (n=40) prostate tissue were measured using real-time PCR and Western blotting. Then, the correlation of DDR2 gene and protein expression with prognostic factors such as age, tumor grade, tumor stage, lymph node involvement, and serum prostate-specific antigen (PSA) concentration were evaluated. The relative mRNA and protein expression level of DDR2 in malignant and benign prostate tissue was significantly higher than those of adjacent normal tissues (P<0.01). This expression was found to increase approximately 3.5 and 2.1 fold for mRNA and protein levels, respectively. Spearman test indicated a significant correlation between DDR2 mRNA and protein expression with prognostic factors such as tumor grade, stage, lymph node involvement, and serum PSA concentration. However, significant correlation with age was not observed. These findings suggest that DDR2 is a cancer-related gene associated with the aggressive progression of prostate cancer patients. PMID:26600862

  13. Kontakte zwischen ČSSR- und DDR- Bürgern 1968-1989

    Czech Academy of Sciences Publication Activity Database

    Vilímek, Tomáš

    2007-01-01

    Roč. 4, č. 2 (2007), s. 285-300. ISSN 1612-9008 R&D Projects: GA AV ČR KJB800630703 Institutional research plan: CEZ:AV0Z80630520 Keywords : opposition - DDR - Czechoslovakia Subject RIV: AB - History

  14. Heterojunction DDR THz IMPATT diodes based on AlxGa1−xN/GaN material system

    International Nuclear Information System (INIS)

    Simulation studies are made on the large-signal RF performance and avalanche noise properties of heterojunction double-drift region (DDR) impact avalanche transit time (IMPATT) diodes based on AlxGa1−xN/GaN material system designed to operate at 1.0 THz frequency. Two different heterojunction DDR structures such as n-Al0.4Ga0.6N/p-GaN and n-GaN/p-Al0.4Ga0.6N are proposed in this study. The large-signal output power, conversion efficiency and noise properties of the heterojunction DDR IMPATTs are compared with homojunction DDR IMPATT devices based on GaN and Al0.4Ga0.6N. The results show that the n-Al0.4Ga0.6N/p-GaN heterojunction DDR device not only surpasses the n-GaN/p-Al0.4Ga0.6N DDR device but also homojunction DDR IMPATTs based on GaN and Al0.4Ga0.6N as regards large-signal conversion efficiency, power output and avalanche noise performance at 1.0 THz. (paper)

  15. Crystallization of the DdrB–DNA complex from Deinococcus radiodurans

    International Nuclear Information System (INIS)

    DdrB from D. radiodurans has been crystallized in complex with ssDNA and diffraction data have been collected to 2.3 Å resolution. The remarkable ability of members of the Deinococcus family to recover from extreme DNA damage is in part owing to their robust DNA-repair mechanisms. Of particular interest is their ability to repair hundreds of double-strand DNA breakages through a rapid and efficient mechanism involving novel proteins that are uniquely found in Deinococcus spp. One such protein, DdrB, which is thought to play a role early in DSB repair, has been crystallized in complex with ssDNA and data have been collected to 2.3 Å resolution

  16. Kingmax笔记本专用DDR Ⅱ内存Venus美丽登场

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    继“Mars战神”DDRⅡ台式机内存系列赢得业界和消费者好评之后,内存厂商Kingmax再次以古罗马神话中的“美神Venus”为其DDRⅡ笔记本专用内存系列命名,同时全新包装的Venus系列DDR Ⅱ SO-DIMM翩然降临至我们身旁。

  17. Hobbypolizisten? Freiwillige Helfer der Polizei in der Tschechoslowakei und der DDR (1952–1989)

    Czech Academy of Sciences Publication Activity Database

    Šmidrkal, Václav

    Göttingen: Vandenhoeck & Ruprecht, 2014 - (Zimmermann, V.; Pullmann, M.), s. 111-148 ISBN 978-3-525-37308-8. [Ordnung und Sicherheit, Devianz und Kriminalität im Staatssozialismus. Tschechoslowakei und DDR 1948/49 – 1989. Bad Wiessee (DE), 03.11.2011-06.11.2011] Institutional support: RVO:67985921 Keywords : Czechoslovakia, 1948-1989 * German Democratic Republic, 1949-1989 * police Subject RIV: AB - History

  18. Mutations in DDR2 gene cause SMED with short limbs and abnormal calcifications.

    Science.gov (United States)

    Bargal, Ruth; Cormier-Daire, Valerie; Ben-Neriah, Ziva; Le Merrer, Martine; Sosna, Jacob; Melki, Judith; Zangen, David H; Smithson, Sarah F; Borochowitz, Zvi; Belostotsky, Ruth; Raas-Rothschild, Annick

    2009-01-01

    The spondylo-meta-epiphyseal dysplasia [SMED] short limb-hand type [SMED-SL] is a rare autosomal-recessive disease, first reported by Borochowitz et al. in 1993.(1) Since then, 14 affected patients have been reported.(2-5) We diagnosed 6 patients from 5 different consanguineous Arab Muslim families from the Jerusalem area with SMED-SL. Additionally, we studied two patients from Algerian and Pakistani ancestry and the parents of the first Jewish patients reported.(1) Using a homozygosity mapping strategy, we located a candidate region on chromosome 1q23 spanning 2.4 Mb. The position of the Discoidin Domain Receptor 2 (DDR2) gene within the candidate region and the similarity of the ddr2 knockout mouse to the SMED patients' phenotype prompted us to study this gene(6). We identified three missense mutations c.2254 C > T [R752C], c. 2177 T > G [I726R], c.2138C > T [T713I] and one splice site mutation [IVS17+1g > a] in the conserved sequence encoding the tyrosine kinase domain of the DDR2 gene. The results of this study will permit an accurate early prenatal diagnosis and carrier screening for families at risk. PMID:19110212

  19. 利用重新排序型控制器提升DDR SDRAM的效率

    Institute of Scientific and Technical Information of China (English)

    Leith Johnson

    2010-01-01

    @@ 高速双倍数据速率(DDR)SDRAM厂商一般均使用峰值数据传输速率来指定器件规格.比如,如果某厂商把产品命名为DDR3-1600,则意味着该厂商将规定该SDRAM器件的峰值传输速率定为1,600 MT/s.

  20. 利用重新排序型控制器提升DDR SDRAM的效率

    Institute of Scientific and Technical Information of China (English)

    Leith Johnson

    2010-01-01

    @@ 高速双倍数据速率(DDR)SDRAM厂商一般均使用峰值数据传输速率来制定器件规格.比如,如果某厂商把产品命名为DDR3-1600,则意味着该厂商将规定该SDRAM器件的峰值传输速率定为1,600 MT/s.

  1. Die Praxis der 'operativen Arbeitsgruppeneinsätze' der DDR-Volkskammer : Ergebnisse einer retrospektiven Befragung von Abgeordneten

    OpenAIRE

    Elsner, Steffen H.

    1999-01-01

    Die Volkskammer der DDR war eine recht reiselustige Organisation. Die Mitglieder der Volkskammer reisten aus allen Teilen der Republik zu Plenar- und Ausschusssitzungen an und Abgeordnetengruppen besuchten darüberhinaus mehr oder weniger häufig ausgewählte Orte in der gesamten DDR. Solche Reisen von Arbeitsgruppen waren eine beliebte Form, in der die Volkskammer und ihre Ausschüsse ihrer Arbeit nachgingen. Hier wird eine unvermutete Nähe der obersten sozialistischen Körperschaft mit Problemen...

  2. The Enhanced Workflow and Efficiency of the Wireless Local Area Network (WLAN)-Based Direct Digital Radiography (DDR) Portable Radiography.

    Science.gov (United States)

    Ngan, Tsz-Lung; Wong, Edward Ting-Hei; Ng, Kris Lap-Shun; Jeor, Patrick Kwok-Shing; Lo, Gladys Goh

    2015-06-01

    With the implementation of the PACS in the hospital, there is an increasing demand from the clinicians for immediate access and display of radiological images. Recently, our hospital has installed the first wireless local area network (WLAN)-based direct digital radiography (DDR) portable radiography system. The DDR portable radiography system allows wireless retrieval of modality worklist and wireless transmission of portable X-ray image on the console to the Picture Archiving and Communication System (PACS), via WLAN connection of wireless fidelity (Wi-Fi). The aim of this study was to analyze the workflow and performance between the WLAN-based DDR portable radiography system and the old practice using conventional portable X-ray machine with computed radiography (CR) system. A total of 190 portable chest X-ray examinations were evaluated and timed, using the conventional portable X-ray machine with CR from March to April of 2012 and using the new DDR portable radiography system on December of 2012 (n = 97 for old system and n = 93 for DDR portable system). The time interval of image becoming available to the PACS using the WLAN-based DDR portable radiography system was significantly shorter than that of the old practice using the conventional portable X-ray machine with CR (6.8 ± 2.6 min for DDR portable system; 23 ± 10.2 min for old system; p WLAN-based DDR portable radiography system can enhance the workflow of portable radiography by reduction of procedural steps. PMID:25561071

  3. Flüchtlinge als politisches Instrument : chilenische Emigranten in der DDR 1973-1989

    OpenAIRE

    Maurin, Jost

    2005-01-01

    Nach dem Militärputsch gegen die chilenische Linksregierung am 11. September 1973 flohen circa 2000 Chilenen in die DDR. Der Verfasser zeigt, dass die SED-Führung bei der Aufnahme der Flüchtlinge nicht von humanitären Motiven geleitet war. Honecker und seine Funktionäre wollten vielmehr die Position des Sozialismus in Chile und ihre eigene Machtstellung in Ostdeutschland stärken. Daher benutzten sie die Flüchtlinge für ihre Propaganda, manipulierten deren politische Parteien und halfen Revolu...

  4. Technical basis for the ITER detailed design report, cost review and safety analysis (DDR)

    International Nuclear Information System (INIS)

    The ITER Detailed Design Report (DDR), Cost Review and Safety Analysis is the 3rd major milestone representing the progress made in the ITER Engineering Design Activities. With the approval of the Interim Design Report (IDR), it has been possible to freeze the main concepts and system approaches for ITER and to develop the design in more detail for the individual components and sub-systems. This report, although designed to be fully understandable as a separate document, focusses particularly on the main changes since the IDR

  5. Komponieren als Beruf. Frankreich und die DDR im Vergleich (1950–1980

    Directory of Open Access Journals (Sweden)

    Dorothea Trebesius

    2011-12-01

    Full Text Available Die Dissertation interessiert sich in systematischer Hinsicht für die Frage „Wer ist ein Komponist?“ und untersucht am Beispiel von Komponisten die Konstruktion und Praxis von Künstlerschaft in der zweiten Hälfte des 20. Jahrhunderts. Sie geht von der These aus, dass sich die Komponisten in dieser Zeit zunehmend dem Modell der Profession annähern. Die Arbeit fragt, wie dieser Prozess der Professionalisierung in Frankreich und der DDR im Vergleich gestaltet wurde und welche Akteure sich daran ...

  6. Zur Geschichte der außerklinischen Geburtshilfe in der DDR

    OpenAIRE

    Major, Sabine

    2003-01-01

    Zu Beginn des 20.Jahrhunderts fanden noch nahezu alle Geburten im privaten Hause statt. In der ersten Hälfte des Jahrhunderts begann der Übergang von der traditionellen Hausgeburtshilfe zur klinischen Geburtshilfe. Nach dem 2. Weltkrieg setzte sich diese Entwicklung fort und es vollzog sich in der DDR der vollständige Übergang zur klinischen Geburtshilfe. 1970 betrug der Anteil der Klinikentbindungen 99,1 %. Von staatlicher Seite wurde die Klinikentbindung eindeutig gefördert. Im "Gesetz üb...

  7. Patch repair: compatibility issues

    OpenAIRE

    Garbacz, Andrzej; Courard, Luc; Bissonnette, Benoît; Głodkowska, W.

    2014-01-01

    Repair of any concrete structure results in formation of complex, at least two-component repair systems. Compatibility approach is treated as a basic requirement during selection of repair material. Recently, the understanding for compatibility requirements in repair systems approach is demonstrated in many papers. The aim of this paper is analyzing the compatibility between repair materials and concrete substrate in the case of patch repair. The compatibility issues were discussed in light o...

  8. Research on the area-interleaved deep storing technology of DSO based on DDR2%基于DDR2的DSO分区交替深存储技术研究

    Institute of Scientific and Technical Information of China (English)

    彭伟; 张沁川; 袁洲

    2013-01-01

    具有深存储功能的数字存储示波器(DSO),能够将大量的采集数据存储下来,大大提高了采集到的波形数据的信息含量,能够很好的再现波形细节,为工程师分析信号、解决问题提供了极大的便利.设计采用FPGA外挂DDR2 SDRAM颗粒的方式来存储采集数据,并利用FPGA内部的MCB IP核来控制其读写和刷新.以此为基础,研究了基于DDR2 SDRAM颗粒的基本深存储设计方案,提出了分区交替深存储技术,并分析了该技术对提升DSO深存储性能的作用及具体实现方法.该技术解决了示波器停止状态下读取DDR2 SDRAM颗粒数据与写DDR2SDRAM颗粒之间的矛盾,并在实际测试中取得了很好的效果.%DSO with the function of deep storage can save plenty of sampling data and get more information of the signal.This enables us to replay the detail of the wave and provides a very good tool for engineers to analyze signals and solve problems.The design uses the DDR2 SDRAM which is connected outside the FPGA to store the sampling data and uses FPGA's MCB IP core to control it during the reading,writing and refreshing process.Based on this,we studies the basic deep storage method which based on DDR2 SDRAM,raised the area-interleaved storing technology and analyzed how it can improve the deep storage function of the DSO and how to realize it.This technology solves the contradiction between reading DDR2 SDRAM data in DSO's stop status and writing data into DDR2 SDRAM,and a good result has got in testing.

  9. Dokumentation, Rekonstruktion, Transformation : Plädoyer für einen offenen Umgang mit der DDR-Kultur

    OpenAIRE

    Beutelschmidt, Thomas

    2010-01-01

    Die DDR »kommt nicht wieder, sowenig wie die Römer«, lautete bereits 1994 der ultimative Befund des Berliner Kulturredakteurs Harald Martenstein. Selbst der Name ist nicht geschützt, so dass die Suchmaschinen im Internet unter »DDR Memory« nicht nur die Geschichte der Deutschen Demokratischen Republik finden, sondern auch einen PC-Speicher mit Double- Data-Rate-Technik. Trotzdem oder gerade deshalb versuchen sich Betroffene wie Berufene auch nach mehr als zehn Jahren deutsch-deutscher Vereini...

  10. Weibliche Arbeitserfahrungen in der DDR Women’s Work experiences in the GDR

    Directory of Open Access Journals (Sweden)

    Albrecht Wiesener

    2001-11-01

    Full Text Available Annegret Schüle kommt in ihrer Untersuchung zu dem Ergebnis, dass die DDR-Diktatur das Leben von Frauen mehr veränderte als das der Männer. Ihre auf Interviews basierende Untersuchung fokussiert den (Berufs-Alltag von Frauen in der Leipziger Baumwollspinnerei. Anhand der drei Kategorien „Generation“, „Frauenarbeit“ und „Vergemeinschaftung im Betrieb“ diskutiert sie die geführten Interviews , die Förderung weiblicher Erwerbstätiger einerseits und das Negativimage des Textilbetriebs andererseits. Die Autorin legt eine überzeugende Studie zur Erfahrungsgeschichte weiblicher Industriearbeit vor und zeigt am konkreten Beispiel, wie die DDR-Gesellschaft in einer von Frauen getragenen familiarisierten Betriebskultur nicht aufgebrochen, sondern in einer eigentümlichen Verbindung von Geborgenheit und Unterordnung reproduziert wurde.Schüle argues that the Eastern German dictatorship had a greater impact on the lives of women than on those of their male counterparts. Her research, based on interviews with female workers in a in a cotton-spinning factory in Leipzig, portrays women’s everyday-life and work, and offers a convincing study of the experience of female industrial workers. Using the three categories “cohort,” “women’s work,” and a discourse of “factory-as-community,” Schüle discusses her interviews with respect to the promotion of female textile workers on the one hand and the negative stereotypes associated with working in the textile industry on the other hand. Using concrete examples, Schüle demonstrates how a factory organised by women did not undermine the patriarchal frame in which it was embedded but how existing power differentials were reproduced as part of a discourse of family, security, and subordination.

  11. Compatible spanning trees

    OpenAIRE

    Garcia Olaverri, Alfredo Martin; Huemer, Clemens; Hurtado Díaz, Fernando Alfredo; Tejel Altarriba, Francisco Javier

    2014-01-01

    Two plane geometric graphs are said to be compatible when their union is a plane geometric graph. Let S be a set of n points in the Euclidean plane in general position and let T be any given plane geometric spanning tree of S. In this work, we study the problem of finding a second plane geometric tree T' spanning S, such that is compatible with T and shares the minimum number of edges with T. We prove that there is always a compatible plane geometric tree T' having at most #n - 3#/4 edges in ...

  12. Identification of novel driver mutations of the discoidin domain receptor 2 (DDR2) gene in squamous cell lung cancer of Chinese patients

    International Nuclear Information System (INIS)

    Although many of the recently approved genomically targeted therapies have improved outcomes for patients in non–small-cell lung cancer (NSCLC) with lung adenocarcinoma, little is known about the genomic alterations that drive lung squamous cell cancer (SCC) and development of effective targeted therapies in lung SCC is a promising area to be further investigated. Discoidin domain receptor 2 (DDR2), is a novel receptor tyrosine kinases that respond to several collagens and involved in tissue repair, primary and metastatic cancer progression. Expression of DDR2 mRNA was analyzed in 54 lung SCC tissues by qRT-PCR. Over-expression approaches were used to investigate the biological functions of DDR2 and its’ mutations in lung SCC cells. Conventional Sanger sequencing was used to investigate the mutations of DDR2 gene in 86 samples. The effect of DDR2 and its’ mutations on proliferation was evaluated by MTT and colony formation assays; cell migration and invasion was evaluated by trasnwell assays. Lung SCC cells stably transfected with pEGFP-DDR2 WT, pEGFP-DDR2-S131C or empty vector were injection into nude mice to study the effect of DDR2 and its’ mutation on tumorigenesis in vivo. Protein and mRNA expression levels of E-cadherin and MMP2 were determined by qRT-PCR and western blot analysis. Differences between groups were tested for significance using Student’s t-test (two-tailed). In this study, we found that DDR2 mRNA levels were significantly decreased in 54 lung SCC tissues compared with normal lung tissues. Moreover, there were 3 novel DDR2 mutations (G531V, S131C, T681I) in 4 patients and provide the mutation rate of 4.6% in the 86 patients with lung SCC. The mutation of S131C in DDR2 could promote lung SCC cells proliferation, migration and invasion via inducing MMP-2, but reducing E-cadherin expression. These data indicated that the novel DDR2 mutation may contribute to the development and progression of lung SCC and this effect may be associated

  13. Methanol-to-olefins process over zeolite catalysts with DDR topology: effect of composition and structural defects on catalytic performance

    OpenAIRE

    Yarulina, I.; J. Goetze; Gücüyener, C; Thiel, L.; Dikhtiarenko, A.; Ruiz-Martinez, J.; Weckhuysen, B. M.; Gascon, J; Kapteijn, F.

    2016-01-01

    A systematic study of the effect of physicochemical properties affecting catalyst deactivation, overall olefin selectivity and ethylene/propylene ratio during the methanol-to-olefins (MTO) reaction is presented for two zeolites with the DDR topology, namely Sigma-1 and ZSM-58. Both catalysts show high selectivity towards light olefins and completely suppress the formation of hydrocarbons bigger than C4, with selectivity to ethane not exceeding 1% and some traces of propane. By applying seeded...

  14. Versorgungsmängel trotz Einkommenssteigerungen in der DDR : zur Entwicklung der Einkommenssituation privater Haushalte in beiden deutschen Staaten

    OpenAIRE

    Wiegand, Erich

    1992-01-01

    'Gegenstand des Beitrages ist die Gegenüberstellung der Einkommenssituation privater Haushalte in der Bundesrepublik Deutschland und der Deutschen Demokratischen Republik. Mit Hilfe von Zeitreihen sozialer Indikatoren wird die Entwicklung ausgewählter monetärer Aspekte der materiellen Versorgung privater Haushalte über einen möglichst langen Zeitraum verglichen. Soweit die dazu notwendigen Daten vorliegen, ist das besondere Interesse auf die Situation in der ehemaligen DDR unmittelbar vor und...

  15. Diamond Based DDR IMPATTs: Prospects and Potentiality as Millimeter-Wave Source at 94 GHz Atmospheric Window

    Directory of Open Access Journals (Sweden)

    A. Acharyya

    2013-06-01

    Full Text Available Large-signal simulation is carried out in this paper to investigate the prospects and potentiality of Double-Drift Region (DDR Impact Avalanche Transit Time (IMPATT device based on semiconducting type-IIb diamond as millimeter-wave source operating at 94 GHz atmospheric window frequency. Large-signal simulation method developed by the authors and presented in this paper is based on non-sinusoidal voltage excitation. The simulation is carried out to obtain the large-signal characteristics such as RF power output, DC to RF conversion efficiency etc. of DDR diamond IMPATT device designed to operate at 94 GHz. The results show that the device is capable of delivering a peak RF power output of 7.01 W with 10.18% DC to RF conversion efficiency for a bias current density of 6.0×10^8 A m^-2 and voltage modulation of 60% at 94 GHz; whereas for the same voltage modulation 94 GHz DDR Si IMPATT can deliver only 693.82 mW RF power with 8.74 efficiency for the bias current density of 3.4×10^8 A m^-2.

  16. Trafficking defects and loss of ligand binding are the underlying causes of all reported DDR2 missense mutations found in SMED-SL patients.

    Science.gov (United States)

    Ali, Bassam R; Xu, Huifang; Akawi, Nadia A; John, Anne; Karuvantevida, Noushad S; Langer, Ruth; Al-Gazali, Lihadh; Leitinger, Birgit

    2010-06-01

    Spondylo-meta-epiphyseal dysplasia (SMED) with short limbs and abnormal calcifications (SMED-SL) is a rare, autosomal recessive human growth disorder, characterized by disproportionate short stature, short limbs, short broad fingers, abnormal metaphyses and epiphyses, platyspondyly and premature calcifications. Recently, three missense mutations and one splice-site mutation in the DDR2 gene were identified as causative genetic defects for SMED-SL, but the underlying cellular and biochemical mechanisms were not explored. Here we report a novel DDR2 missense mutation, c.337G>A (p.E113K), that causes SMED-SL in two siblings in the United Arab Emirates. Another DDR2 missense mutation, c.2254C>T (p.R752C), matching one of the previously reported SMED-SL mutations, was found in a second affected family. DDR2 is a plasma membrane receptor tyrosine kinase that functions as a collagen receptor. We expressed DDR2 constructs with the identified point mutations in human cell lines and evaluated their localization and functional properties. We found that all SMED-SL missense mutants were defective in collagen-induced receptor activation and that the three previously reported mutants (p.T713I, p.I726R and p.R752C) were retained in the endoplasmic reticulum. The novel mutant (p.E113K), in contrast, trafficked normally, like wild-type DDR2, but failed to bind collagen. This finding is in agreement with our recent structural data identifying Glu113 as an important amino acid in the DDR2 ligand-binding site. Our data thus demonstrate that SMED-SL can result from at least two different loss-of-function mechanisms: namely defects in DDR2 targeting to the plasma membrane or the loss of its ligand-binding activity. PMID:20223752

  17. Electromagnetic compatibility engineering

    CERN Document Server

    Ott, Henry W

    2009-01-01

    Praise for Noise Reduction Techniques IN electronic systems ""Henry Ott has literally 'written the book' on the subject of EMC. . . . He not only knows the subject, but has the rare ability to communicate that knowledge to others.""-EE Times Electromagnetic Compatibility Engineering is a completely revised, expanded, and updated version of Henry Ott's popular book Noise Reduction Techniques in Electronic Systems. It reflects the most recent developments in the field of electromagnetic compatibility (EMC) and noise reduction¿and their practical applications t

  18. DUPIC fuel compatibility assessment

    International Nuclear Information System (INIS)

    The purpose of this study is to assess the compatibility of DUPIC (Direct Use of Spent PWR Fuel in CANDU Reactors) fuel with the current CANDU 6 reactor, which is one of the technology being developed to utilize the spent PWR fuel in CANDU reactors. The Phase II study of this project includes the analysis of impact on the reactor safety, the development of core design technology, the development of fuel supply technology of optimal composition, and feasibility analysis on localization and license of DUPIC fuel. From the reactor safety analysis results, it is known that DUPIC fuel satisfies the safety limit of reactor containment and public dose for single failure. But, the safety limit may be exceeded for dual failure. Therefore, more analysis is needed for the removal of excessive conservatism in accident analysis methodology and modification of transient fuel behavior analysis methodology. The results of the validation calculations of core design methodology have confirmed that the current core analysis system is acceptable for the feasibility study of the DUPIC fuel compatibility analysis. The results of compatibility and fuel fabrication have shown that DUPIC fuel is technically feasible. For practical use and licensing, however, more research items required in the practical use, fuel rod and bundle design and fuel loading are should be performed. When these items are performed and resolved, the compatibility of the DUPIC fuel is achieved, and, eventually, the possibility of DUPIC fuel licensing can be confirmed

  19. Socially compatible technology management

    International Nuclear Information System (INIS)

    The public has a critical eye on the impacts of technology, and there is a growing awareness of the social impacts in addition to health hazards and economic and ecologic impacts. 'Socially compatible technology management' is the magic formula frequently used which has emerged as a political demand in the course of the social controversy about the hazards of large-scale technology. It marks a position in the conflict between those who declare existing market and policy instruments to be sufficient regulatory tools, and those who understand the incidents ranging from inadequacy to desaster as a warning, and call for more precaution in decisions with an impact on the future. The concept of 'social compatibility' has to be given shape by elaborating criteria and methods for achieving this goal. The book shows that social compatibility cannot sufficiently be defined either as a quality of a technology and of a socio-technical system (acceptability), or as the willingness of the people concerned to accept a technology (acceptance). The investigation explains by means of empirical analysis and examples that participation is the only way to combine acceptability and acceptance into a socially compatibly designed technology. The leading theoretical and political formula developed for this purpose is 'acquisition'. To put it in a provocative way: Man has to learn to manage and master technical systems as if they were an integral part of themselves. Which means, man has to acquire the required knowledge and skill in the changing social structures, and the real power of disposal. Sociology of technology is a branch of research that can and should give support in the process of designing and managing technological systems in a way compatible with social needs. (orig./HP)

  20. Schriftstellerinnen der DDR und feministisches Bewußtsein im Staatssozialismus GDR Women Authors and Feminist Consciousness During State Socialism

    Directory of Open Access Journals (Sweden)

    Eva Kaufmann

    2001-11-01

    Full Text Available Seit den 1960er Jahren produzierten Schriftstellerinnen in der DDR wie Christa Wolf, Irmtraud Morgner, Sarah Kirsch, Brigitte Reimann, Charlotte Worgitzky, Lia Pirskawetz, und Maya Wiens eine vielfältige Literatur zu frauenrelevanten Themen. Den Obertitel „The Promised Land“ (das gelobte Land hat Lorna Martens Irmtraud Morgner entlehnt, der Autorin, die sie neben Christa Wolf als wichtigste Zeugin für „feminist writing“ in der DDR betrachtet. In Morgners Roman Leben und Abenteuer der Trobadora Beatriz steht der Begriff „gelobtes Land“ bezogen auf die DDR in einem ironischen Zusammenhang. Mit simplem Jaja oder Neinnein ist diesem „Ort des Wunderbaren“ (Morgner nicht beizukommen. Vergleichbares signalisiert auch das Fragezeichen, das Martens hinter den Begriff „Promised Land“ setzt. Der anspielungsreiche Verweis auf das Land erscheint auch insofern nützlich, als die Eigenart feministischen Schreibens genauer zu fassen ist, wenn über das Land selbst, namentlich seine Frauenpolitik, Auskünfte gegeben werden. Lorna Martens möchte herausfinden, wie Schriftstellerinnen in der DDR feministisches Bewusstsein artikuliert haben, d.h. feministisches Bewusstsein unter den vom Staatssozialismus geschaffenen Bedingungen.From the 1960s on, women writers in the German Democratic Republic (GDR, including Christa Wolf, Irmtraud Morgner, Sarah Kirsch, Brigitte Reimann, Charlotte Worgitzky, Lia Pirskawetz, and Maya Wiens, produced a large body of writing on women’s issues. Martens wants to investigate how these women authors in the GDR have articulated their feminist consciousness under the conditions of state socialism. Martens’ use of the title The Promised Land is an allusion to a book by Irmtraud Morgner, an author whom, along with Christa Wolf, Martens considers one of the most important witnesses of feminist writing in the GDR. In Morgner’s book The Life and Adventures of Troubadour Beatriz the term “promised land” is being

  1. Aircraft electromagnetic compatibility

    Science.gov (United States)

    Clarke, Clifton A.; Larsen, William E.

    1987-01-01

    Illustrated are aircraft architecture, electromagnetic interference environments, electromagnetic compatibility protection techniques, program specifications, tasks, and verification and validation procedures. The environment of 400 Hz power, electrical transients, and radio frequency fields are portrayed and related to thresholds of avionics electronics. Five layers of protection for avionics are defined. Recognition is given to some present day electromagnetic compatibility weaknesses and issues which serve to reemphasize the importance of EMC verification of equipment and parts, and their ultimate EMC validation on the aircraft. Proven standards of grounding, bonding, shielding, wiring, and packaging are laid out to help provide a foundation for a comprehensive approach to successful future aircraft design and an understanding of cost effective EMC in an aircraft setting.

  2. 用于DDR电源及终端的高效率、双通道、±3A同步降压型稳压器符合DDR/DDR2/DDR3标准

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    凌力尔特公司推出一款高效率、双通道、单片式、同步降压型开关稳压器LTC3618,该器件能够为DDR/DDR2/DDR3及未来需要供应和吸收电流的标准存储器应用产生电源电压和总线终端电压。第一个降压型稳压器的输出提供了一个高准确度的VDDQ电源,该电源能输送±3A输出。一个内部电阻分压器负责将VTT DDR终端电源和VTTR基准电压设定为等于施加至VDDQIN输入端之电压的一半,并在VTT和VTTR上分别提供了±3A(供应/吸收)和±10mA的输出电流能力。VTT输出可在低至0.5V的电压条件下运作,以支持所有DDR标准。

  3. Halveti-Şâbânî Şeyhi Mustafa Kemâleddîn Bekrî ve Hediyyetü’l-Ahbâb Adlı Eseri

    Directory of Open Access Journals (Sweden)

    Halim Gül

    2013-03-01

    Full Text Available AbstractThis article studies the life and woks of Kemaleddin Bekrî, who affiliated himself to Khalvati-Shabani Sheikh Abdullatîf b. Hüsameddîn el-Halebî, and who was growed up under Abd al-Ghani al-Nabulsi’s control. His work “Hadiyyat al-Ahbab fi ma li’l-Khalveti min al-Şuruti va’l-Adab”, which explains the conditions and rules of “khalvet” was also studied. The work consists of preface, eight parts and an epilogue and all parts examined in detail.ÖzetBu makalede, Abdülganî Nablusî’nin (ö.1143/1730 gözetiminde yetişen, halvetî-Şabânî şeyhi Abdullatîf b. Hüsameddîn el-Halebî’ye intisap eden Mustafa Kemaleddin Bekrî’nin hayatı ve eserleri incelenmiştir. Bu çerçevede onun tasavvufi bir kavram olan halvetin âdab ve şartlarını izah eden “Hediyyetü’l ahbâb fî mâ li’l-halveti mine’ş-şurûti ve’l-âdâb” adlı risalesinin incelenmesi ve değerlendirmesi üzerinde durulmuştur. Söz konusu eser, mukaddime sekiz bölüm ve bir hatimeden oluşmaktadır.Le Shaykh Khalwatî-Sha‘bânî Mustafâ Kamâl al-Dîn Bakrî et son Traité qui s’intitule Hadiyya al-ahbâbRésuméDans cet article, on va étudier d’abord la vie et les œuvres du Shaykh Khalwatî-Sha‘bânî Mustafâ Kamâl al-Dîn Bakrî qui a été éduqué par le célèbre soufi ‘Abd al-Ghanî Nablûsî (m. 1143/1730 et a été initié par ‘Abd al-Latîf b. Husâm al-Dîn al-Halabî. Puis, plus particulièrement, on va analyser son traité qui s’intitule ‘Hadiyya al-ahbâb fî mâ li’l-khalwatî min al-shurût wa’l-âdâb’. Ce traité – qui a été composé de dix-huit chapitres et d’une conclusion – étudie les convenances et les conditions de la retraite spirituelle, khalwa, une des notions soufies importantes

  4. DUPIC fuel compatibility assessment

    International Nuclear Information System (INIS)

    The purpose of this study is to assess the compatibility of DUPIC(Direct Use of Spent PWR Fuel in CANDU Reactors) fuel with the current CANDU 6 reactor, which is one of the technology being developed to utilize the spent PWR fuel in CANDU reactors. The phase 1 study of this project includes the feasibility analysis on applicability of the current core design method, the feasibility analysis on operation of the DUPIC fuel core, the compatibility analysis on individual reactor system, the sensitivity analysis on the fuel composition, and the economic analysis on DUPIC fuel cycle. The results of the validation calculations have confirmed that the current core analysis system is acceptable for the feasibility study of the DUPIC fuel compatibility analysis. The results of core simulations have shown that both natural uranium and DUPIC fuel cores are almost the same from the viewpoint of the operational performance. For individual reactor system including reactively devices, the functional requirements of each system are satisfied in general. However, because of the pronounced power flattening in the DUPIC core, the radiation damage on the critical components increases, which should be investigated more in the future. The DUPIC fuel composition heterogeneity dose not to impose any serious effect on the reactor operation if the fuel composition is adjusted. The economics analysis has been performed through conceptual design studies on the DUPIC fuel fabrication, fuel handling in a plant, and spent fuel disposal, which has shown that the DUPIC fuel cycle is comparable to the once-trough fuel cycle considering uncertainties associated with unit costs of the fuel cycle components. The results of Phase 1 study have shown that it is feasible to use the DUPIC fuel in CANDU reactors without major changes in hardware. However further studies are required to confirm the safety of the reactor under accident condition

  5. DUPIC fuel compatibility assessment

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Hang Bok; Rho, G. H.; Park, J. W. [and others

    2000-03-01

    The purpose of this study is to assess the compatibility of DUPIC(Direct Use of Spent PWR Fuel in CANDU Reactors) fuel with the current CANDU 6 reactor, which is one of the technology being developed to utilize the spent PWR fuel in CANDU reactors. The phase 1 study of this project includes the feasibility analysis on applicability of the current core design method, the feasibility analysis on operation of the DUPIC fuel core, the compatibility analysis on individual reactor system, the sensitivity analysis on the fuel composition, and the economic analysis on DUPIC fuel cycle. The results of the validation calculations have confirmed that the current core analysis system is acceptable for the feasibility study of the DUPIC fuel compatibility analysis. The results of core simulations have shown that both natural uranium and DUPIC fuel cores are almost the same from the viewpoint of the operational performance. For individual reactor system including reactively devices, the functional requirements of each system are satisfied in general. However, because of the pronounced power flattening in the DUPIC core, the radiation damage on the critical components increases, which should be investigated more in the future. The DUPIC fuel composition heterogeneity dose not to impose any serious effect on the reactor operation if the fuel composition is adjusted. The economics analysis has been performed through conceptual design studies on the DUPIC fuel fabrication, fuel handling in a plant, and spent fuel disposal, which has shown that the DUPIC fuel cycle is comparable to the once-trough fuel cycle considering uncertainties associated with unit costs of the fuel cycle components. The results of Phase 1 study have shown that it is feasible to use the DUPIC fuel in CANDU reactors without major changes in hardware. However further studies are required to confirm the safety of the reactor under accident condition.

  6. Bigness in compatible systems

    OpenAIRE

    Snowden, Andrew; Wiles, Andrew

    2009-01-01

    Clozel, Harris and Taylor have recently proved a modularity lifting theorem of the following general form: if rho is an l-adic representation of the absolute Galois group of a number field for which the residual representation rho-bar comes from a modular form then so does rho. This theorem has numerous hypotheses; a crucial one is that the image of rho-bar must be "big," a technical condition on subgroups of GL(n). In this paper we investigate this condition in compatible systems. Our main r...

  7. Compatible use issues

    International Nuclear Information System (INIS)

    As part of a general review of rights-of-way policies at British Columbia Hydro, a task team was charged with examining issues related to compatible use, defined as any use of rights-of-way which does not compromise safety requirements, the security of BC Hydro plant and property rights, the ability to serve customers, and the ability to upgrade, modify, and maintain electric plant. The following issues were examined: modification of transmission works; preload activity on and adjacent to rights-of-way; Canadian Standards Association and BC Hydro standards and rights-of-way use; proactive right-of-way management; right-of-way use and future planning; right-of-way use administration; and transmission right-of-way identity. The task team was concerned about whether BC Hydro policy unnecessarily restricts land use, whether right-of-way policies are efficient, if policies on compatible uses of rights-of-way are well-developed and well-known, and if standards relative to right-of-way use are adequate. Each issue is described and recommendations are provided on policies, procedures, and guidelines. Each recommendation is supported by a justification statement and information on current practices and issue backgrounds. Alternative options are analyzed, and attention is given to cost effectiveness, internal and external goodwill, public opinion, and the implications for the future

  8. Hydrazine Materials Compatibility Database

    Science.gov (United States)

    Schmidt, E. W.

    2004-10-01

    Anhydrous hydrazine and its methyl derivatives MMH and UDMH have been safely used as monopropellants and bipropellant fuels in thousands of satellites and space probes, hundreds of expendable launch vehicles and hundreds of piloted reusable launch vehicle flights. The term hydrazine(s) is used here to describe the three propellant hydrazines and their mixtures. Over the years, a significant amount of experience has accumulated in the selection of compatible materials of construction for these and other rocket propellants. Only a few materials incompatibility issues have arisen in the recent past. New materials of construction have become available during the past decades which have not yet been extensively tested for long-term compatibility with hydrazine(s). These new materials promise lightweight (i. e., lighter weight) propulsion system designs and increased payloads in launch vehicles and satellites. Other new materials offer reduced contamination caused by leached ingredients, e. g. less silica leaching from diaphragms in propellant management devices in propellant tanks. This translates into longer mission life.

  9. Uhv compatible chopper system

    International Nuclear Information System (INIS)

    A time-of-flight system utilizing a novel mechanical chopper has been developed to measure the energy spectrum of neutral deuterium atoms emitted from a tokamak plasma. The chopper system consists of a motor, a magnetically levitated shaft, and a chopper disc. The 20 g disc is rigidly attached to a 159 g shaft assembly and the set is supported against gravity in vacuum by permanent magnets and a stabilizing servo system. All components are uhv compatible to avoid contamination to the tokamak and to the detector. The 25.4 cm OD, .005 cm thick, 301 stainless steel chopper disc has 24 .025 cm wide slots photoetched at an 11.4 cm radius. An effective aperture time of .55 μs is achieved during typical steady state operation at 22,500 rpm with a vacuum pressure of 2 x 10-8 torr

  10. Uhv compatible chopper system

    Energy Technology Data Exchange (ETDEWEB)

    Voss, D.E.; Cohen, S.A.

    1979-11-01

    A time-of-flight system utilizing a novel mechanical chopper has been developed to measure the energy spectrum of neutral deuterium atoms emitted from a tokamak plasma. The chopper system consists of a motor, a magnetically levitated shaft, and a chopper disc. The 20 g disc is rigidly attached to a 159 g shaft assembly and the set is supported against gravity in vacuum by permanent magnets and a stabilizing servo system. All components are uhv compatible to avoid contamination to the tokamak and to the detector. The 25.4 cm OD, .005 cm thick, 301 stainless steel chopper disc has 24 .025 cm wide slots photoetched at an 11.4 cm radius. An effective aperture time of .55 ..mu..s is achieved during typical steady state operation at 22,500 rpm with a vacuum pressure of 2 x 10/sup -8/ torr.

  11. Chromium in river substrate pore water and adjacent groundwater: 100-D/DR area, Hanford site, Washington

    International Nuclear Information System (INIS)

    This report describes the field investigation of groundwater discharging from the 100-D/DR Reactor Area into the Hanford Reach of the Columbia River located in Richland, Washington. This section of the Reach is used by fall chinook salmon as spawning habitat. The field investigation focused on hexavalent chromium in river substrate pore water, river water, riverbank seepage, and the Hanford Site aquifer at the shoreline. These data are used to establish a baseline for chromium concentrations in river substrate pore water and in the aquifer. This baseline will help assess the potential for exposure of ecological receptors to contaminated groundwater discharges and support groundwater remediation services. This groundwater is contaminated with hexavalent chromium at concentrations that exceed the U.S. Environmental Protection Agency's chronic ambient water quality criterion

  12. The NAE inhibitor pevonedistat interacts with the HDAC inhibitor belinostat to target AML cells by disrupting the DDR.

    Science.gov (United States)

    Zhou, Liang; Chen, Shuang; Zhang, Yu; Kmieciak, Maciej; Leng, Yun; Li, Lihong; Lin, Hui; Rizzo, Kathryn A; Dumur, Catherine I; Ferreira-Gonzalez, Andrea; Rahmani, Mohamed; Povirk, Lawrence; Chalasani, Sri; Berger, Allison J; Dai, Yun; Grant, Steven

    2016-05-01

    Two classes of novel agents, NEDD8-activating enzyme (NAE) and histone deacetylase (HDAC) inhibitors, have shown single-agent activity in acute myelogenous leukemia (AML)/myelodysplastic syndrome (MDS). Here we examined mechanisms underlying interactions between the NAE inhibitor pevonedistat (MLN4924) and the approved HDAC inhibitor belinostat in AML/MDS cells. MLN4924/belinostat coadministration synergistically induced AML cell apoptosis with or without p53 deficiency or FLT3-internal tandem duplication (ITD), whereas p53 short hairpin RNA (shRNA) knockdown or enforced FLT3-ITD expression significantly sensitized cells to the regimen. MLN4924 blocked belinostat-induced antiapoptotic gene expression through nuclear factor-κB inactivation. Each agent upregulated Bim, and Bim knockdown significantly attenuated apoptosis. Microarrays revealed distinct DNA damage response (DDR) genetic profiles between individual vs combined MLN4924/belinostat exposure. Whereas belinostat abrogated the MLN4924-activated intra-S checkpoint through Chk1 and Wee1 inhibition/downregulation, cotreatment downregulated multiple homologous recombination and nonhomologous end-joining repair proteins, triggering robust double-stranded breaks, chromatin pulverization, and apoptosis. Consistently, Chk1 or Wee1 shRNA knockdown significantly sensitized AML cells to MLN4924. MLN4924/belinostat displayed activity against primary AML or MDS cells, including those carrying next-generation sequencing-defined poor-prognostic cancer hotspot mutations, and CD34(+)/CD38(-)/CD123(+) populations, but not normal CD34(+) progenitors. Finally, combined treatment markedly reduced tumor burden and significantly prolonged animal survival (P < .0001) in AML xenograft models with negligible toxicity, accompanied by pharmacodynamic effects observed in vitro. Collectively, these findings argue that MLN4924 and belinostat interact synergistically by reciprocally disabling the DDR in AML/MDS cells. This strategy

  13. Compatibility: drugs and parenteral nutrition.

    Science.gov (United States)

    Miranda, Talita Muniz Maloni; Ferraresi, Andressa de Abreu

    2016-03-01

    Objective Standardization and systematization of data to provide quick access to compatibility of leading injectable drugs used in hospitals for parenteral nutrition. Methods We selected 55 injectable drugs analyzed individually with two types of parenteral nutrition: 2-in-1 and 3-in-1. The following variables were considered: active ingredient, compatibility of drugs with the parenteral nutrition with or without lipids, and maximum drug concentration after dilution for the drugs compatible with parenteral nutrition. Drugs were classified as compatible, incompatible and untested. Results After analysis, relevant information to the product's compatibility with parental nutrition was summarized in a table. Conclusion Systematization of compatibility data provided quick and easy access, and enabled standardizing pharmacists work. PMID:27074235

  14. Description of work for fiscal years 1999 and 2000: Drilling within the chromium plume west of the 100-D/DR reactors

    International Nuclear Information System (INIS)

    This document describes the fiscal years 1999 and 2000 work scopes associated with installing groundwater wells in the vicinity of the 100-D Area chromium plume west of the 100-D/DR Reactors (100-HR-3 Operable Unit). This document was revised to include the requirements for the drilling of wells in FY00

  15. Identification of novel inhibitors of DDR1 against idiopathic pulmonary fibrosis by integrative transcriptome meta-analysis, computational and experimental screening.

    Science.gov (United States)

    Chen, Can; Deng, Jingjing; Yu, Xiaoping; Wu, Fengbo; Men, Ke; Yang, Qian; Zhu, Yanfeng; Liu, Xiaogang; Jiang, Qinglin

    2016-04-26

    Idiopathic pulmonary fibrosis (IPF) is a kind of a chronic and fatal lung disease leading to progressive lung function decline. Although several RNA microarray studies on IPF patients have been reported, their results were merely specific to each study with distinct platforms or sample types. In the current study, an integrative transcriptome meta-analysis of IPF was performed to explore regulated pathways, based on four independent expression profiling microarrays of IPF datasets, including 73 samples from IPF tissues or lung fibroblast cells. The results suggested the discoidin domain receptor 1 (DDR1) and downstream c-Jun N-terminal kinases (JNK) pathway may play important roles in the progression of IPF. To our knowledge, discoidin domain receptor 1 (DDR1) is a kind of receptor tyrosine kinase (RTK) with a unique ability to bind both fibrillar and non-fibrillar collagens. Based on the crystallographic structures of DDR1, the combination of molecular dynamics simulation and a hybrid protocol of a virtual screening method, comprised of PBVS (multicomplex-pharmacophore based virtual screening) and DBVS (docking based virtual screening) methods were used for retrieving novel DDR1 inhibitors from the SPECS database. Twelve hit compounds were selected from the hit compounds and shifted to experimental validations, and the most potent compound was evaluated for its anti-IPF capacity on murine IPF models. Thus, these results may provide valuable information for further discovery of potential lead compounds for IPF therapy. PMID:26956955

  16. Electro-magnetic compatibility

    Science.gov (United States)

    Maidment, H.

    1980-05-01

    The historical background to the growth in problems of electromagnetic compatibility (EMC) in UK Military aircraft is reviewed and the present approach for minimizing these problems during development is discussed. The importance of using representative aircraft for final EMC assessments is stressed, and the methods of approach in planning and executing such tests are also outlined. The present equipment qualification procedures are based on assumptions regarding the electromagnetic fields present within the airframe, and the nature of the coupling mechanisms. These cannot be measured with any certainty in representative aircraft. Thus EMC assessments rely on practical tests. Avionics systems critical to flight safety, and systems vital to mission effectiveness require test methods that provide a measure of the safety and performance margins available to account for variations that occur in production and service use. Some proven methods are available, notably for detonator circuits, but in most other areas further work is required. Encouraging process has been made in the use of current probes for the measurement of interfering signals on critical signal lines, in conjunction with complementary test house procedures, as a means for obtaining the safety margins required in flight and engine control systems. Performance margins for mission systems using digital techniques are difficult to determine, and there is a need for improved test techniques. The present EMC qualification tests for equipment in the laboratory do not guarantee freedom from interference when installed, and the results are limited in value for correlating with aircraft tests.

  17. Compatible quantum theory

    International Nuclear Information System (INIS)

    Formulations of quantum mechanics (QM) can be characterized as realistic, operationalist, or a combination of the two. In this paper a realistic theory is defined as describing a closed system entirely by means of entities and concepts pertaining to the system. An operationalist theory, on the other hand, requires in addition entities external to the system. A realistic formulation comprises an ontology, the set of (mathematical) entities that describe the system, and assertions, the set of correct statements (predictions) the theory makes about the objects in the ontology. Classical mechanics is the prime example of a realistic physical theory. A straightforward generalization of classical mechanics to QM is hampered by the inconsistency of quantum properties with classical logic, a circumstance that was noted many years ago by Birkhoff and von Neumann. The present realistic formulation of the histories approach originally introduced by Griffiths, which we call ‘compatible quantum theory (CQT)’, consists of a ‘microscopic’ part (MIQM), which applies to a closed quantum system of any size, and a ‘macroscopic’ part (MAQM), which requires the participation of a large (ideally, an infinite) system. The first (MIQM) can be fully formulated based solely on the assumption of a Hilbert space ontology and the noncontextuality of probability values, relying in an essential way on Gleason's theorem and on an application to dynamics due in large part to Nistico. Thus, the present formulation, in contrast to earlier ones, derives the Born probability formulas and the consistency (decoherence) conditions for frameworks. The microscopic theory does not, however, possess a unique corpus of assertions, but rather a multiplicity of contextual truths (‘c-truths’), each one associated with a different framework. This circumstance leads us to consider the microscopic theory to be physically indeterminate and therefore incomplete, though logically coherent. The

  18. Implementation of PCIe-SerDes-DDR3 communication in a multi-FPGA data acquisition system

    Science.gov (United States)

    Byszuk, Adrian; Kolasiński, Piotr; Poźniak, Krzysztof; Zabołotny, Wojciech M.; Kasprowicz, Grzegorz

    2013-10-01

    This paper describes the embedded system used to store and transfer large amounts of data in a multichannel data acquisition system for the GEM detector. The stored data is used for diagnostics purposes. System consists of an embedded mini ITX motherboard connected through the PCI Express (PCIe) link to a backplane FPGA. The backplane FPGA is connected through the SerDes/GTP links to (up to) 4 carrier boards. Each carrier board is connected to (up to) 4 FMC modules. System allows for a high speed data transfers between the ITX motherboard and the backplane or carrier modules. Due to high performance/reliability requirements, special care is taken for a proper data error correction/packet retransmission scenarios. There is also need for a proper communications diagnostics and a system addressing abstraction. Due to a distributed nature of described data acquisition system, data stored in DDR memory has to have a specific structure. This structure allows for a proper synchronisation of data between all the carrier boards.

  19. Well Completion Report for the Fiscal Year 1999 Drilling Within the Chromium Plume West of the 100-D/DR Reactors

    International Nuclear Information System (INIS)

    This report describes the fiscal year (FY) 1999 field activities associated with installing 12 groundwater monitoring wells in the vicinity of the 100-D Area chromium plume west of the 100-D/DR Reactors (100-HR-3 Operable Unit [OU]). The wells were installed to further investigate the extent of the hexavalent chromium hot spot west of the 100-D/DR Reactors and to support future remedial action decisions associated with the 100-HR-3 OU. These wells were designed for multi-purpose use (i.e., monitoring, extraction, and injection). In addition, one of the wells was installed to support the initial deployment of the In Situ Redox Manipulation (ISRM) technology to remediate the chromium plume

  20. Novel DDR2 mutation identified by whole exome sequencing in a Moroccan patient with spondylo-meta-epiphyseal dysplasia, short limb-abnormal calcification type.

    Science.gov (United States)

    Mansouri, Maria; Kayserili, Hülya; Elalaoui, Siham Chafai; Nishimura, Gen; Iida, Aritoshi; Lyahyai, Jaber; Miyake, Noriko; Matsumoto, Naomichi; Sefiani, Abdelaziz; Ikegawa, Shiro

    2016-02-01

    Spondylo-meta-epiphyseal dysplasia (SMED), short limb-abnormal calcification type (SMED, SL-AC), is a very rare autosomal recessive disorder with various skeletal changes characterized by premature calcification leading to severe disproportionate short stature. Twenty-two patients have been reported until now, but only five mutations (four missense and one splice-site) in the conserved sequence encoding the tyrosine kinase domain of the DDR2 gene has been identified. We report here a novel DDR2 missense mutation, c.370C > T (p.Arg124Trp) in a Moroccan girl with SMED, SL-AC, identified by whole exome sequencing. Our study has expanded the mutational spectrum of this rare disease and it has shown that exome sequencing is a powerful and cost-effective tool for the diagnosis of clinically heterogeneous disorders such as SMED. PMID:26463668

  1. Contribució del receptor domini discoidina 1 (ddr1) en el procés de mielinització. Aplicació de diferents models experimentals

    OpenAIRE

    Tomàs Roig, Jordi

    2010-01-01

    S'ha demostrat que la mielina està alterada en el cervell de pacients amb esquizofrènia. El gen domini discoidina 1 (DDR1), que s'expressa en mielina, s'ha trobat associat a esquizofrènia. Ambdues troballes fetes al grup de recerca on he desenvolupat el treball de tesi doctoral.· Contribucions i coneixements nous que aporta la tesiEn síntesi podem afirmar que DDR1 és clau en el procés de mielinització. Una regulació a la baixa d'aquest gen podria estar associat a malalties de mielina.Estudi1...

  2. Informationen über ausgewählte Ergebnisse der Studie "Politische Organisiertheit der Jugend der DDR" (1984) zu aktuellen Fragen der Tätigkeit des Jugendverbandes

    OpenAIRE

    Förster, Peter

    1984-01-01

    Die vorliegende Studie informiert über einige Ergebnisse einer Untersuchung zur politischen Organisiertheit der DDR-Jugend. Im Rahmen dieser Untersuchung wurden ca. 3.600 junge Arbeitnehmer befragt. Die dargestellten Daten geben einen Überblick über folgende Themen: 1. Teilnahme am Nationalen Jugendfestival Pfingsten 1984; 2. Beteiligung am "FDJ-Studienjahr" und an anderen Formen politischer Bildung; 3. Persönliche Aufträge; 4. Teilnahme an der Mitgliederversammlung zum Thema "Mein Beitrag zu...

  3. Trafficking defects and loss of ligand binding are the underlying causes of all reported DDR2 missense mutations found in SMED-SL patients

    OpenAIRE

    Ali, Bassam R; Xu, Huifang; Nadia A Akawi; John, Anne; Karuvantevida, Noushad S.; Langer, Ruth; Al-Gazali, Lihadh; Leitinger, Birgit

    2010-01-01

    Spondylo-meta-epiphyseal dysplasia (SMED) with short limbs and abnormal calcifications (SMED-SL) is a rare, autosomal recessive human growth disorder, characterized by disproportionate short stature, short limbs, short broad fingers, abnormal metaphyses and epiphyses, platyspondyly and premature calcifications. Recently, three missense mutations and one splice-site mutation in the DDR2 gene were identified as causative genetic defects for SMED-SL, but the underlying cellular and biochemical m...

  4. Novel DDR Processing of Corn Stover Achieves High Monomeric Sugar Concentrations from Enzymatic Hydrolysis (230 g/L) and High Ethanol Concentration (10% v/v) During Fermentation

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Xiaowen; Jennings, Ed; Shekiro, Joe; Kuhn, Erik M.; O' Brien, Marykate; Wang, Wei; Schell, Daniel J.; Himmel, Mike; Elander, Richard T.; Tucker, Melvin P.

    2015-04-03

    Distilling and purifying ethanol, butanol, and other products from second and later generation lignocellulosic biorefineries adds significant capital and operating cost for biofuels production. The energy costs associated with distillation affects plant gate and life cycle analysis costs. Lower titers in fermentation due to lower sugar concentrations from pretreatment increase both energy and production costs. In addition, higher titers decrease the volumes required for enzymatic hydrolysis and fermentation vessels. Therefore, increasing biofuels titers has been a research focus in renewable biofuels production for several decades. In this work, we achieved over 200 g/L of monomeric sugars after high solids enzymatic hydrolysis using the novel deacetylation and disc refining (DDR) process on corn stover. The high sugar concentrations and low chemical inhibitor concentrations from the DDR process allowed ethanol titers as high as 82 g/L in 22 hours, which translates into approximately 10 vol% ethanol. To our knowledge, this is the first time that 10 vol% ethanol in fermentation derived from corn stover without any sugar concentration or purification steps has been reported. Techno-economic analysis shows the higher titer ethanol achieved from the DDR process could significantly reduce the minimum ethanol selling price from cellulosic biomass.

  5. Advanced Microgravity Compatible, Integrated Laundry System Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The Advanced Microgravity Compatible, Integrated Laundry (AMCIL) is a microgravity compatible liquid / liquid vapor, two-phase laundry system with water jet...

  6. Allgemeinbildungstheorie anstatt Allgemeiner Pädagogik. Zum Verhältnis von bildungspolitisch-doktrinärer Selbstdisziplinierung und gesellschaftspolitischer Instrumentalisierung pädagogischer Wissenschaften in der SBZ und DDR

    OpenAIRE

    Wiegmann, Ulrich

    1997-01-01

    Die Tendenzen der bildungsgeschichtlichen Bearbeitung pädagogischer Wissenschaften in der DDR insbesondere seitens ihrer zeitgeschichtlich argumentierenden ehemaligen Repräsentanten konturieren mein thematisches Erkenntnisinteresse. Besondere Beachtung gewann daher die Frage nach der Beziehung von erziehungswissenschaftlicher Wissensproduktion und Bildungspolitik während der Konstituierungsphase der DDR-Pädagogik. Geleitet wurde die Nachforschung durch die bereits in Hinsicht auf spätere Peri...

  7. Entwicklungspolitik und Solidarität in der DDR, dargestellt an Beispielen der staatlichen Zusammenarbeit mit Mosambik und Äthiopien und der entwicklungsbezogenen Bildungsarbeit unabhängiger Gruppen

    OpenAIRE

    Döring, Hans-Joachim

    2008-01-01

    Die Dissertation enthält Abhandlungen des Autors zur Entwicklungspolitik und Solidarität in der DDR im Zeitraum von 1968 bis 1990 bzw. 1994. Im Rahmen analytischer Rekonstruktionen werden die entwicklungsbezogene Bildungsarbeit der unabhängigen Dritte-Welt-Gruppen und die staatliche Entwicklungszusammenarbeit untersucht. Wichtige Grundlagen für die Abhandlungen sind bisher zur wissenschaftlichen und theoretischen Fundierung des Verständnisses von Entwicklungspolitik und Solidarität in der DDR...

  8. Radiation exposure from nuclear medical procedures in the former GDR; Strahlenexposition durch nuklearmedizinische Untersuchungen in der ehemaligen DDR

    Energy Technology Data Exchange (ETDEWEB)

    Tautz, M. [Klinikum Berlin-Buch (Germany). Inst. fuer Medizinische Physik; Ertl, S. [Klinikum Berlin-Buch (Germany). Inst. fuer Medizinische Physik; Deckart, H. [Klinikum Berlin-Buch (Germany). Nuklearmedizinische Klinik

    1995-12-01

    From 1978-1988 central records were kept of nuclear medical in vivo and in citro examinations and of treatments with radiopharmaceuticals in the former GDR. On the basis of ICRP publications No 60 the effective dose, the collective effective dose, and the radiation risk were assessed. Twenty-six different nuclear medical examinations were used in the calculations. The most frequent examinations were thyroid scintigraphy with {sup 99m}Tc-pertechnetate and renography with {sup 131}I-hippurate. {sup 131}I thyroid examinations decreased by a factor of 4 in the GDR during the period considered. Though the number of patients increased from 1978-1988 by about 55%, a continuous reduction of collective effective dose from 607 to 377 manSv could be achieved. The average effective dose was reduced from about 5.5 to 2.2 mSv. The radiation risk decreased by a factor of 2.5. (orig.) [Deutsch] Auf der Grundlage der in der ehemaligen DDR gefuehrten Statistik ueber die Haeufigkeit der nuklearmedizinischen In-vivo-Verfahren wurden die effektive Dosis, die kollektive effektive Dosis und das Strahlenrisiko auf der Basis der ICRP-Publikation Nr. 60 abgeschaetzt. Insgesamt entfielen ca. 70% aller Untersuchungen auf die Schilddruesen- und die Nierendiagnostik. Die unter 26 Verfahren mit Abstand haeufigsten waren die Schilddruesen-Szintigraphie mit {sup 99m}Tc-Pertechnetat und die Funktionsuntersuchungen der Nieren mit {sup 131}I-Hippurat. Bemerkenswert ist der Rueckgang bei den Radiojod-Testen und bei der Schilddruesen-Szintigraphie mit {sup 131}I-Jodid um ca. den Faktor 4 landesweit im betrachteten Zeitraum von 1978-1988. Trotz steigender Patientenzahlen (ca. 55%) war eine kontinuierliche Abnahme der kollektiven effektiven Dosis von 607 auf 377 manSv zu verzeichnen. Das fuehrte zu einer Verringerung der durchschnittlichen effektiven Dosis von ca. 5,5 mSv auf 2,2 mSv. Das Strahlenrisiko wurde um den Faktor 2,5 reduziert. (orig.)

  9. The electromagnetic and nuclear compatibility

    International Nuclear Information System (INIS)

    The extraordinary development of electronics has increased the research needs in electromagnetic compatibility and nuclear radiations hardening. The knowledge relative to both aspects has been brought together in this single book divided in two parts and 11 chapters. The first part is devoted to electromagnetic compatibility (EMC) and deals successively with: the definition and stakes of EMC, the architecture of an EMC simulator (topological approach), the faradization of systems (physical mechanisms, diffraction, diffusion, coupling, characterization), the interconnection of systems, and the specification of components. The second part concerns the nuclear compatibility (NC) and deals with: the definition and stakes of NC, the radiations and their interaction with matter, the radiative environments (nuclear explosions, space, atmosphere, nuclear facilities etc..), the different radiative effects (cumulated dose, dose rate, neutron fluence, heavy ions and protons) and the associated technological hardening, the protection of components, circuits and systems, and the hardening standards and quality assurance (nuclear and aerospace industry). (J.S.)

  10. Chemical compatibility of cartridge materials

    Science.gov (United States)

    Ambrose, Bryan; Wilcox, R. C.; Zee, R. H.

    1992-01-01

    The objectives were to determine the chemical compatibility of titanium-zirconium-molybdenum (TZM) with GaAs and CdZnTe, and Inconel with HgCdTe and HgZnTe. At the present time, no other studies regarding the compatibility of these crystal components and their respective cartridge materials have been performed. This study was to identify any possible problems between these materials to insure proper containment of possibly hazardous fumes during crystal growth experiments. In this study, the reaction zone between the materials was studied and the amount of degradation to the system was measured. Detailed results are presented.

  11. Born In The DDR

    OpenAIRE

    Myerson, J.

    2015-01-01

    A play about the ground-breaking concert played in East Berlin by Bruce Springsteen. Approved by the Stasi to forestall the people's desire for freedom, it hastened it. The concert remains the largest single audience attendance in Europe.

  12. Tierschutz in der DDR

    OpenAIRE

    Stock, Marianne

    2015-01-01

    The topic of the present study is to depict the role of animal welfare in the former German Democratic Republic (GDR). In addition to the study of the influencing ideological and political factors, the analysis of the then existing legal basis and an explanation of the importance of animal welfare in veterinary education are performed. Furthermore, the organisation of animal welfare in the GDR is picked out as a central theme. A major issue is the husbandry of the bovine and porcine species a...

  13. Socio-compatible energy policies

    International Nuclear Information System (INIS)

    The socio-compatibility project comprises three central analytical elements: 1) The arborescent value analysis: Eminent social groups (such as the trade-unions or the ecological institutes) were questioned on their values and criteria applied to evaluate different energy systems. 2) The energy system and scenario impact analysis: Indicators deduced from the arborescent value analysis serve to approximately cover the value dimensions affected by above criteria. 3) Impact analysis weighing executed by a group of arbitrarily chosen citizens. All reflections considered, it is evident that none of the energy policies discussed may claim the title 'socio-compatible'. The individual, i.e. neither scientist nor politician, cannot decide upon the socio-compatibility of one or the other concept. An altogether socially compatible solution accepted and classified as such by different social groups may only crystallize and be set against different options by the political formation of opinion. The studys' primary concern lies in furnishing information, i.e. aids for politicians having to decide on energy policies. Above all the study aimed at finding out about reactions, social protest, opposition or approval to be coped with by those who, having the say in political matters, want to speak up for one of the energy policies under public discussion. (orig./HSCH)

  14. Electromagnetic compatibility in power electronics

    CERN Document Server

    Costa , François; Revol , Bertrand

    2014-01-01

    Scientists largely attribute the recent deterioration of the electromagnetic environment to power electronics. This realization has spurred the study of methodical approaches to electromagnetic compatibility designs as explored in this text. The book addresses major challenges, such as handling numerous parameters vital to predicting electro magnetic effects and achieving compliance with line-harmonics norms, while proposing potential solutions.

  15. Rubber composition compatible with hydrazine

    Science.gov (United States)

    Repar, J.

    1973-01-01

    Formulation improves compatibility of butyl rubbers with hydrazine while reducing permeation to low levels necessary for prolonged storage in space. This is accomplished by replacing carbon-black filler with inert materials such as hydrated silica or clay. Pressure increases suggest that hydrazine is decomposed only slightly by new type of rubber.

  16. PD98059抑制Peroxynitrite诱导人脑血管平滑肌细胞DDR2的表达%PD98059 inhibits Peroxynitrite-induced discoidin domain receptor-2 expression in human brain vascular smooth muscle cells

    Institute of Scientific and Technical Information of China (English)

    万小娟; 黄凌燕; 张国栋; 李建峰

    2012-01-01

    目的 探讨过氧亚硝酸盐(ONOO-)诱导人脑血管平滑肌细胞(HBVSMCs)盘状结构域受体2(DDR2)表达的机制.方法 体外培养HBVSMCs,用倒置相差显微镜、吖啶橙染色法和MTT比色法对PD98059预处理的细胞进行细胞形态学及细胞生存率检测,采用Western blot及Real-time PCR技术,检测ONOO-作用下HBVSMCs中DDR2表达及施加ERK1/2抑制剂PD98059后DDR2/MMP-9表达的变化.结果 10 μmol/L ONOO-诱导DDR2在蛋白及mRNA水平上呈现高表达(P<0.05),随着ONOO-浓度的增加,DDR2逐渐呈现低表达(P<0.05).PD98059预处理后的HBVSMCs,无明显形态学变化,对其进行生存率检测亦无显著影响(P>0.05).PD98059显著抑制ONOO-诱导的DDR2/MMP-9表达(P<0.05).结论 ERK1/2信号转导途径抑制剂PD98059可以抑制ONOO-诱导的DDR2/MMP-9表达,ONOO-诱导HBVSMCsDDR2的表达机制与ERK1/2信号转导途径有关.%Objective To explore the possible mechanism underlying peroxynitrite (ONOO ) -induced discoidin domain receptor-2 (DDR2) expression in human brain vascular smooth muscle cells (HBVSMCs). Methods HBVSMCs were cultured in vitro in different concentrations of ONOO- , and PD98059, a specific inhibitor of ERK1/2. Morphology and viability of HBVSMCs pretreated with PD98059 were detected by an inverted phase contrast microscope, acri-dine orange staining and MTT assay. Western blot and Real-time PCR were employed to determine expressions of DDR2/ MMP-9. Results 10 μmol/L of ONOO- significantly induced expression of DDR2 at both protein and mRNA levels (P0.05). Pretreatment on HBVSMCs with PD98059 significantly inhibited expressions of DDR2/ MMP-9 in HBVSMCs induced by 10 μmol/L of ONOO- (P < 0.05). Conclusion PD98059 inhibits ONOO- -induced DDR2 expression. The ERK1/2 signal transduction pathway might involve in ONOO -induced DDR2 expression in HBVSMCs.

  17. Compatibility Determination : [Crescent Lake NWR 2003 hunting

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This Compatibility Determination states that hunting deer and upland birds at Crescent Lake National Wildlife Refuge is compatible with Refuge purposes.

  18. [Compatibility determinations Squaw Creek National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This document provides two compatibility determinations; one stated that the proposed agricultural practices (row crop farming) are compatible with Refuge...

  19. Electromagnetic compatibility principles and applications

    CERN Document Server

    Weston, David A

    2001-01-01

    This totally revised and expanded reference/text provides comprehensive, single-source coverage of the design, problem solving, and specifications of electromagnetic compatibility (EMC) into electrical equipment/systems-including new information on basic theories, applications, evaluations, prediction techniques, and practical diagnostic options for preventing EMI through cost-effective solutions. Offers the most recent guidelines, safety limits, and standards for human exposure to electromagnetic fields! Containing updated data on EMI diagnostic verification measurements, as well as over 900 drawings, photographs, tables, and equations-500 more than the previous edition

  20. Compatibility of desoximetasone and tacrolimus.

    Science.gov (United States)

    Levitt, Jacob; Feldman, Terry; Riss, Ildiko; Leung, On-Tai

    2003-12-01

    The physical and chemical compatibility of desoximetasone ointment 0.25% and tacrolimus ointment 0.1%, both widely used to treat atopic dermatitis, were determined. A 1:1 (w/w) mixture of desoximetasone ointment 0.25% (Topicort, Taro Pharmaceuticals USA, Inc.) and tacrolimus ointment 0.1% (Protopic, Fujisawa Healthcare, Inc.) were prepared and stored under three different temperature/relative humidity conditions: 25 degrees C/60% RH; 30 degrees C/60% RH; and 40 degrees C/75% RH. Unmixed ointments stored under the same temperature and humidity conditions as the mixture served as controls. Samples were evaluated at days 1, 2, 7, 14, and 28 for color, degree of physical separation, and chemical stability via reverse-phase high performance liquid chromatography. Ranges of relative recovery for each active ingredient for all storage conditions ((% Mixture/% Control) x 100) were 89.6-109.3% for tacrolimus and 99.0-103.4% for desoximetasone. No significant difference in physical appearance or chromatographic profile between the mixture and controls was observed. Therefore, we conclude that desoximetasone ointment 0.25% (Topicort) and tacrolimus ointment 0.1% (Protopic) are physically and chemically compatible up to four weeks when mixed in a ratio of 1:1 (w/w). PMID:14711143

  1. Estimation of Most Favorable Optical Window Position Subject to Achieve Finest Optical Control of Lateral DDR IMPATT Diode Designed to Operate at W-Band

    Directory of Open Access Journals (Sweden)

    A. Acharyya

    2014-06-01

    Full Text Available The optimum position of the optical window (OW of illuminated lateral double-drift region (DDR impact avalanche transit time (IMPATT device has been determined subject to achieve the finest optical control of both DC and RF properties of the device. The OW is a tiny hole that has to be created on the oxide layer through which the light energy of appropriate wavelength can be coupled to the space charge region of the device. A non-sinusoidal voltage is assumed to be applied across the diode and the corresponding terminal current response is obtained from a two-dimensional (2-D large-signal (L-S simulation technique developed by the authors for illuminated lateral DDR IMPATT diode. Both the DC and L-S properties of the illuminated device based on Si, designed to operate at W-band frequencies (75 – 110 GHz are obtained from the said L-S simulation. Simulation is carried out for different incident optical power levels of different wavelengths (600 – 1000 nm by varying the position of the fixed sized OW on the oxide layer along the direction of electrical conduction of the device. Results show that, the most favorable optical tuning can be achieved when the OW is entirely created over the p-type depletion layer, i.e. when the photocurrent is purely electron dominated. Also the 700 nm wavelength is found to be most suitable wavelength for obtaining the maximum optical modulation of both DC and RF properties of the device.

  2. Role of value compatibility in IT adoption

    DEFF Research Database (Denmark)

    Bunker, Deborah; Kautz, Karlheinz; Nguyen, Anne Luu Thanh

    2007-01-01

    Compatibility has been recognised as an important element in the adoption of IT innovations in organisations but as a concept it has been generally limited to technical or functional factors. Compatibility is also significant, however, with regard to value compatibility between the organisation......, and the adopted IT innovation. We propose a framework to determine value compatibility analysing the organisation's and information system's structure, practices and culture, and explore the value compatibility of an organisation with its adopted self-service computer-based information system. A case study...... was conducted to determine the congruence of an organisation's value and IT value compatibility. This study found that there was a high correspondence in the organisational structure and practice dimensions; however, there were organisational culture disparities. The cultural disparities reflected the self...

  3. INCENTIVE COMPATIBILITY AND PRICING UNDER MORAL HAZARD

    OpenAIRE

    Belen Jerez

    2003-01-01

    We study a simple insurance economy with moral hazard, in which random contracts overcome the non-convexities generated by the incentive-compatibility constraints. The novelty is that we use linear programming and duality theory to study the relation between incentive compatibility and pricing. Using linear programming has the advantage that we can impose the incentive-compatibility constraints on the agents that are uninformed (the insurance firms). In contrast, most of the general equilibri...

  4. Vacuum Compatible Percussive Dynamic Cone Penetrometer Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Honeybee Robotics proposes to develop a vacuum compatible percussive dynamic cone penetrometer (PDCP), for establishing soil bin characteristics, with the ultimate...

  5. Constitutional compatibility of energy systems

    International Nuclear Information System (INIS)

    The paper starts from the results of the Enquiry Commission on 'Future Nuclear Energy Policy' of the 8th Federal German Parliament outlining technically feasible energy futures in four 'pathways'. For the purpose of the project, which was to establish the comparative advantages and disadvantages of different energy systems, these four scenarios were reduced to two alternatives: cases K (= nuclear energy) and S (= solar energy). The question to Ge put is: Which changes within our legal system will be ushered in by certain technological developments and how do these changes relate to the legal condition intended so far. Proceeding in this manner will not lead to the result of a nuclear energy system or a solar energy system being in conformity or in contradiction with the constitutional law, but will provide a catalogue of implications orientated to the aims of legal standards: a person deciding in favour of a nuclear energy system or a solar energy system supports this or that development of constitutional policy, and a person purishing this or that aim of legal policy should be consistent and decide in favour of this or that energy system. The investigation of constitutional compatibility leads to the question what effects different energy systems will have on the forms of political intercourse laid down in the constitutional law, which are orientated to models of a liberal constitutional tradition of citizens. (orig./HSCH)

  6. 32 CFR 552.95 - Compatible use.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 3 2010-07-01 2010-07-01 true Compatible use. 552.95 Section 552.95 National... CEMETERIES REGULATIONS AFFECTING MILITARY RESERVATIONS Fort Lewis Land Use Policy § 552.95 Compatible use. (a... closed. (4) Motorized infantry operations that will use the majority of the road net in a training...

  7. 32 CFR 552.171 - Compatible use.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 3 2010-07-01 2010-07-01 true Compatible use. 552.171 Section 552.171 National... CEMETERIES REGULATIONS AFFECTING MILITARY RESERVATIONS Land Use Policy for Fort Lewis, Yakima Training Center, and Camp Bonneville § 552.171 Compatible use. (a) Military unit commanders may request during...

  8. Spectral averaging for trace compatible operators

    OpenAIRE

    Azamov, Nurulla; Sukochev, Fyodor

    2007-01-01

    In this note the notions of trace compatible operators and infinitesimal spectral flow are introduced. We define the spectral shift function as the integral of infinitesimal spectral flow. It is proved that the spectral shift function thus defined is absolutely continuous and Krein's formula is established. Some examples of trace compatible affine spaces of operators are given.

  9. Common Fixed Points for Weakly Compatible Maps

    Indian Academy of Sciences (India)

    Renu Chugh; Sanjay Kumar

    2001-05-01

    The purpose of this paper is to prove a common fixed point theorem, from the class of compatible continuous maps to a larger class of maps having weakly compatible maps without appeal to continuity, which generalized the results of Jungck [3], Fisher [1], Kang and Kim [8], Jachymski [2], and Rhoades [9].

  10. New Commitment Options: Compatibility with Emissions Trading

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2006-07-01

    This paper considers different options for quantitative greenhouse gas emission commitments from the standpoint of their technical compatibility with emissions trading. These are dynamic targets, binding targets with price caps, non-binding targets, sector-wide targets/mechanisms, action targets, allowances and endowments, and long-term permits. This paper considers these options from the standpoint of their compatibility with emissions trading.

  11. The evolution of polymorphic compatibility molecules

    NARCIS (Netherlands)

    Boer, R.J. de

    1995-01-01

    Several primitive colonial organisms distinguish self from nonself by means of polymorphic compatibility molecules bearing similarity to the major histocompatibility complex (MHC). The evolution of such polymorphisms is generally explained in terms of resistance to parasites. Ignoring parasites, I d

  12. Advanced Microgravity Compatible, Integrated Laundry System Project

    Data.gov (United States)

    National Aeronautics and Space Administration — An Advanced Microgravity Compatible, Integrated laundry System (AMCILS) is proposed that uses a two phase water / water vapor system to allow good agitation of...

  13. DOD Offshore Wind Mission Compatibility Assessments

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set represents the results of analyses conducted by the Department of Defense to assess the compatibility of offshore wind development with military...

  14. Compatibility of repair mortars in restoration projects

    OpenAIRE

    Schueremans, Luc; Van Balen, Koenraad; Cizer, Özlem; Janssens, Elke; Serré, Gerty; Elsen, Jan; Brosens, Kris; Ignoul, Sven

    2010-01-01

    Mortars used for restoration must be highly compatible with historic materials in terms of physical, chemical and mechanical properties in order to assure the durability of masonry on the long term. Compatibility criteria are defined based on the original mortar characteristics but the efficiency and the performance of the repair mortar after application on masonry are not generally evaluated. From this perspective, historic mortars and repair mortars from 3 historic masonry structures were a...

  15. Electromagnetic theory for electromagnetic compatibility engineers

    CERN Document Server

    Toh, Tze-Chuen

    2013-01-01

    Engineers and scientists who develop and install electronic devices and circuits need to have a solid understanding of electromagnetic theory and the electromagnetic behavior of devices and circuits. In particular, they must be well-versed in electromagnetic compatibility, which minimizes and controls the side effects of interconnected electric devices. Designed to entice the practical engineer to explore some worthwhile mathematical methods, and to reorient the theoretical scientist to industrial applications, Electromagnetic Theory for Electromagnetic Compatibility Engineers is based on the

  16. Psychological compatibility of women's handball team

    Directory of Open Access Journals (Sweden)

    Shalar O.G.

    2010-02-01

    Full Text Available The results of study of psychological compatibility of womanish handball commands are presented. The psychological climate of command is investigational. Certain and adapted methods of estimation of psychological compatibility in the command playing types of sport. Psychological tests allow to expose the strong and weak sides of psychology of sportsmen. These information can be used for more effective program of psychological preparation of sportsmen development. It is necessary to improve determination of separate individual qualities of personality of sportsmen.

  17. Informative Advertisement of Partial Compatible Products

    OpenAIRE

    Roig, Guillem

    2014-01-01

    Product design and advertisement strategy have been theoretically studied as separate firms decisions. In the present paper, we look at the link between advertisement and product design and we analyze how firms' advertising decisions influence the market effect of product design. We consider a model of informative advertisement where two firms produce a bundle of complementary products which are partially compatible. A product design with more compatible components is associated with a larger...

  18. Compatibility problems in tritium breeding blankets

    International Nuclear Information System (INIS)

    Compatibility between tritium breeding materials (liquid or solid), neutron multiplier and structural steels is a concern for the choice of a tritium breeding blanket for NET. For solid tritium breeding blanket, it seems that the more severe compatibility problem is due to the interaction of beryllium with steel. As for the water-cooled Pb17Li blanket, the first results obtained in experimental conditions closed to the concept have evidenced lower corrosion rates than those measured in thermal convection loops

  19. Compatibility and product design in software markets

    OpenAIRE

    Woeckener, Bernd

    1999-01-01

    This paper analyzes the interplay between compatibility and product design decisions in a symmetric software duopoly with network effects. We show that suppliers do not always offer differentiated product designs and compete within the market. Rather, when ever both the significance of the network effects and the costs of compatibility are high, they offer homogeneous and incompatible variants and compete for the market, although this leads to Bertrand competition with zero profits. Moreover,...

  20. Medical research on environment and public health in the German Democratic Republic (1949-1989). A critical analysis of the literature; Umweltmedizinische Arbeiten aus der DDR-Zeit (1949-1989). Eine kritische Literaturanalyse

    Energy Technology Data Exchange (ETDEWEB)

    Klemm, P.G.

    1995-12-31

    Research on environmental health and environmental epidemiology was in the former GDR restricted and only possible under difficult conditions. The DDR-Officials did not want to acknowledge any existing environmental problems, they put their emphasis on the domestic economy. The aim of environmental research was to analyze the strongest effects on human health so that the running production was not jeopardized. Despite these restrictions a considerable number of studies exists which were published in scientific journals, internal reports or as theses. Results of these studies were only made accessible to the public and scientistis after the political officials gave their approval. Unfavourable results were withheld. In 1989 before the German unification the former German-German Commission on questions of environmental health started to collect these documents as a basis for a systematic evaluation of the literature on enrironment and health in the GDR. This evaluation was never carried out. After the unification the Author. (orig./VHE) [Deutsch] Umweltmedizinische und umweltepidemiologische Forschung war in der DDR nur unter schwierigen Randbedingungen moeglich. Dies lag im Selbstverstaendnis der DDR-Fuehrung begruendet, die der Oekonomie absoluten Vorrang vor der Oekologie gab. Umweltmedizinische Forschung hatte dabei die Aufgabe, gravierende umweltbedingte Wirkungen auf die menschliche Gesundheit im Vorfeld zu analysieren, um die laufende Produktion nicht zu gefaehrden. Deswegen kommt eine ansehnliche Zahl von Untersuchungen zusammen, die als wissenschaftliche Arbeiten publiziert wurden sowie als Forschungsberichte und Dissertationen vorliegen. Allerdings wurden die nach Einschaetzung der politischen Fuehrung und der wissenschaftlichen Administration umweltpolitisch brisanten Ergebnisse per Ministerratsbeschluss sowohl der Oeffentlichkeit vorenthalten als auch dem interessierten Fachwissenschaftler. Der zunehmenden Umweltbelastung und dem steigenden oeffentlichen

  1. Ion implantation and bio-compatibility

    International Nuclear Information System (INIS)

    Surface modification of polymers by ion implantation has been carried out to control surface properties such as conductivity, wettability, blood and tissue compatibility. Ion implantation into silicone rubber, polystyrene and segmented polyurethane was performed at 150 keV with doses ranging from 1 x 1015 to 3 x 1017 ions/cm2 to improve bio-compatibility. The platelet accumulation on ion implanted silicone rubber decreased and non-thrombogenicity of ion implanted specimens were improved. The ion implanted polystyrene and segmented polyurethane have been found to exhibit remarkably higher adhesion and spreading of endothelial cells compared to the non-implanted case. It is concluded that ion implantation into polymers is effective in controlling their bio-compatibility. (author)

  2. Compatible Spatial Discretizations for Partial Differential Equations

    Energy Technology Data Exchange (ETDEWEB)

    Arnold, Douglas, N, ed.

    2004-11-25

    From May 11--15, 2004, the Institute for Mathematics and its Applications held a hot topics workshop on Compatible Spatial Discretizations for Partial Differential Equations. The numerical solution of partial differential equations (PDE) is a fundamental task in science and engineering. The goal of the workshop was to bring together a spectrum of scientists at the forefront of the research in the numerical solution of PDEs to discuss compatible spatial discretizations. We define compatible spatial discretizations as those that inherit or mimic fundamental properties of the PDE such as topology, conservation, symmetries, and positivity structures and maximum principles. A wide variety of discretization methods applied across a wide range of scientific and engineering applications have been designed to or found to inherit or mimic intrinsic spatial structure and reproduce fundamental properties of the solution of the continuous PDE model at the finite dimensional level. A profusion of such methods and concepts relevant to understanding them have been developed and explored: mixed finite element methods, mimetic finite differences, support operator methods, control volume methods, discrete differential forms, Whitney forms, conservative differencing, discrete Hodge operators, discrete Helmholtz decomposition, finite integration techniques, staggered grid and dual grid methods, etc. This workshop seeks to foster communication among the diverse groups of researchers designing, applying, and studying such methods as well as researchers involved in practical solution of large scale problems that may benefit from advancements in such discretizations; to help elucidate the relations between the different methods and concepts; and to generally advance our understanding in the area of compatible spatial discretization methods for PDE. Particular points of emphasis included: + Identification of intrinsic properties of PDE models that are critical for the fidelity of numerical

  3. Compatibility and testing of electronic components

    CERN Document Server

    Jowett, C E

    2013-01-01

    Compatibility and Testing of Electronic Components outlines the concepts of component part life according to thresholds of failure; the advantages that result from identifying such thresholds; their identification; and the various tests used in their detection. The book covers topics such as the interconnection of miniature passive components; the integrated circuit compatibility and its components; the semiconductor joining techniques; and the thin film hybrid approach in integrated circuits. Also covered are topics such as thick film resistors, conductors, and insulators; thin inlays for el

  4. 36 CFR 1193.51 - Compatibility.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false Compatibility. 1193.51 Section 1193.51 Parks, Forests, and Public Property ARCHITECTURAL AND TRANSPORTATION BARRIERS COMPLIANCE... functionality shall provide a standard non-acoustic connection point for TTYs. It shall also be possible for...

  5. Coal use in Italy and environmental compatibility

    International Nuclear Information System (INIS)

    Fossil fuels have in Italy great importance. In Italy, in terms of environmental protection and for social acceptance, coal has had a real opposition not verified in other countries. Environmental compatibility of coal cycle and related technologies are discussed also consequently at the Kyoto protocol

  6. Compatibility Between Electric Components in Wind Farms

    DEFF Research Database (Denmark)

    Holdyk, Andrzej; Holbøll, Joachim; Arana Aristi, Iván

    2011-01-01

    The paper describes a method for investigation of the compatibility between electric components in wind farms by identifying critical resonances at different points of an offshore wind farm (OWF), based on systematic variation of critical parameters. In this way, the design of future OWF can be...

  7. Choosing mates: complementary versus compatible genes

    Czech Academy of Sciences Publication Activity Database

    Piálek, Jaroslav; Albrecht, Tomáš

    2005-01-01

    Roč. 20, č. 2 (2005), s. 63. ISSN 0169-5347 R&D Projects: GA AV ČR(CZ) IAA6093201 Institutional research plan: CEZ:AV0Z6093917 Keywords : genetic compatibility Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 14.864, year: 2005

  8. fMRI-compatible rehabilitation hand device

    Directory of Open Access Journals (Sweden)

    Tzika Aria

    2006-10-01

    Full Text Available Abstract Background Functional magnetic resonance imaging (fMRI has been widely used in studying human brain functions and neurorehabilitation. In order to develop complex and well-controlled fMRI paradigms, interfaces that can precisely control and measure output force and kinematics of the movements in human subjects are needed. Optimized state-of-the-art fMRI methods, combined with magnetic resonance (MR compatible robotic devices for rehabilitation, can assist therapists to quantify, monitor, and improve physical rehabilitation. To achieve this goal, robotic or mechatronic devices with actuators and sensors need to be introduced into an MR environment. The common standard mechanical parts can not be used in MR environment and MR compatibility has been a tough hurdle for device developers. Methods This paper presents the design, fabrication and preliminary testing of a novel, one degree of freedom, MR compatible, computer controlled, variable resistance hand device that may be used in brain MR imaging during hand grip rehabilitation. We named the device MR_CHIROD (Magnetic Resonance Compatible Smart Hand Interfaced Rehabilitation Device. A novel feature of the device is the use of Electro-Rheological Fluids (ERFs to achieve tunable and controllable resistive force generation. ERFs are fluids that experience dramatic changes in rheological properties, such as viscosity or yield stress, in the presence of an electric field. The device consists of four major subsystems: a an ERF based resistive element; b a gearbox; c two handles and d two sensors, one optical encoder and one force sensor, to measure the patient induced motion and force. The smart hand device is designed to resist up to 50% of the maximum level of gripping force of a human hand and be controlled in real time. Results Laboratory tests of the device indicate that it was able to meet its design objective to resist up to approximately 50% of the maximum handgrip force. The detailed

  9. BASIS FOR DETERMINATION OF CHEMICAL STABILITY and COMPATIBILITY OF SOLID WASTE CHEMICAL COMPATIBILITY TECHNICAL BASIS

    International Nuclear Information System (INIS)

    Solid wastes must be managed to prevent inadvertent reactions, explosion and degradation of waste containers per the ''Washington State Department of Ecology Dangerous Waste Regulations'' (WAC 173-303). An understanding of chemical compatibility principles and a consistent approach for implementing compatibility requirements is essential for complying with the regulations. This document explains the technical basis for ensuring chemical compatibility for solid wastes that are stored on site at on-site TSD facilities and for solid waste that will go to off-site TSD facilities. The document applies directly to the following aspects of chemical compatibility: (1) Ensuring that hazardous waste is not chemically reactive or unstable such that it cannot be safely transported or stored; (2) Ensuring that lab packs (i.e., drums containing multiple inner containers of differing types of hazardous waste) are packaged such that incompatible chemicals are not placed into the same drum; (3) Selecting containers and liners that are compatible with the waste they contain. This document does not cover individual TSD requirements, or specific offsite TSD requirements. This document does not cover chemical compatibility and segregation requirements for shipping wastes on-site or off-site. This document does not cover radiological hazards associated with radioactive waste or mixed wastes. Evaluation of compatibility for comingling and treating solid waste is beyond the scope of this document. In addition, heat generation and gas generation as they apply to the Hanford waste acceptance criteria are not covered in this document

  10. Automation of electromagnetic compatability (EMC) test facilities

    Science.gov (United States)

    Harrison, C. A.

    1986-01-01

    Efforts to automate electromagnetic compatibility (EMC) test facilities at Marshall Space Flight Center are discussed. The present facility is used to accomplish a battery of nine standard tests (with limited variations) deigned to certify EMC of Shuttle payload equipment. Prior to this project, some EMC tests were partially automated, but others were performed manually. Software was developed to integrate all testing by means of a desk-top computer-controller. Near real-time data reduction and onboard graphics capabilities permit immediate assessment of test results. Provisions for disk storage of test data permit computer production of the test engineer's certification report. Software flexibility permits variation in the tests procedure, the ability to examine more closely those frequency bands which indicate compatibility problems, and the capability to incorporate additional test procedures.

  11. Compatibility of DLC coatings with formulated oils

    OpenAIRE

    Sedlaček, Marko; PODGORNIK, Bojan; Vižintin, Jože

    2015-01-01

    In the present study, the tribological performance and compatibility of hydrogenated amorphous carbon coating (a-C:H) and metal-doped diamond-like carbon (DLC) coating (Me-C:H) with formulated oils under the boundary lubrication regime was investigated. The investigation employed ball-on-flat contact geometry in reciprocating sliding motion and six formulated oils (manual gearbox oil, automatic gearbox oil, hydraulic oil, compressor oil, andnormal and high performance motor oil), with pure po...

  12. Automatic kelvin probe compatible with ultrahigh vacuum

    OpenAIRE

    Baikie, I.D.; Werf, van der, M.J.; Oerbekke, H.; Broeze, J.; Silfhout, van, A.

    1989-01-01

    This article describes a new type of in situ ultrahigh‐vacuum compatible kelvin probe based on a voice‐coil driving mechanism. This design exhibits several advantages over conventional mechanical feed‐through and (in situ) piezoelectric devices in regard to the possibility of multiple probe geometry, flexibility of probe geometry, amplitude of oscillation, and pure parallel vibration. Automatic setup and constant spacing features are achieved using a digital‐to‐analog converter (DAC) steered ...

  13. Component Compatibility in Component Based Development

    OpenAIRE

    Dr. Hardeep Singh; Anitpal Kaur

    2014-01-01

    This paper presents a research on component compatibility in component based development. Component-based software engineering is a process that emphasizes the design and construction of computer-based systems using reusable software components. Commercial components repositories contain hundred thousand components that make component selection an extremely difficult and time expensive task. Often component selected by functional features are incompatible or the integration effort...

  14. Is Sharia Compatible with Contemporary Russian Law?

    OpenAIRE

    Leonid Sykiainen

    2015-01-01

    The analysis of the interaction between Sharia and legislation in action along with the compatibility of Sharia with contemporary Russian law is important from both a scientific and a practical point of view. There are several reasons for the increasing interest in this issue: the renaissance of Islam, the activity of Muslim communities outside the regions where Islam has traditionally spread, the threat of Islamic extremism, and the increasing influence of Sharia upon the political and legal...

  15. Double Retort System for Materials Compatibility Testing

    Energy Technology Data Exchange (ETDEWEB)

    V. Munne; EV Carelli

    2006-02-23

    With Naval Reactors (NR) approval of the Naval Reactors Prime Contractor Team (NRPCT) recommendation to develop a gas cooled reactor directly coupled to a Brayton power conversion system as the Space Nuclear Power Plant (SNPP) for Project Prometheus (References a and b) there was a need to investigate compatibility between the various materials to be used throughout the SNPP. Of particular interest was the transport of interstitial impurities from the nickel-base superalloys, which were leading candidates for most of the piping and turbine components to the refractory metal alloys planned for use in the reactor core. This kind of contamination has the potential to affect the lifetime of the core materials. This letter provides technical information regarding the assembly and operation of a double retort materials compatibility testing system and initial experimental results. The use of a double retort system to test materials compatibility through the transfer of impurities from a source to a sink material is described here. The system has independent temperature control for both materials and is far less complex than closed loops. The system is described in detail and the results of three experiments are presented.

  16. Double Retort System for Materials Compatibility Testing

    International Nuclear Information System (INIS)

    With Naval Reactors (NR) approval of the Naval Reactors Prime Contractor Team (NRPCT) recommendation to develop a gas cooled reactor directly coupled to a Brayton power conversion system as the Space Nuclear Power Plant (SNPP) for Project Prometheus (References a and b) there was a need to investigate compatibility between the various materials to be used throughout the SNPP. Of particular interest was the transport of interstitial impurities from the nickel-base superalloys, which were leading candidates for most of the piping and turbine components to the refractory metal alloys planned for use in the reactor core. This kind of contamination has the potential to affect the lifetime of the core materials. This letter provides technical information regarding the assembly and operation of a double retort materials compatibility testing system and initial experimental results. The use of a double retort system to test materials compatibility through the transfer of impurities from a source to a sink material is described here. The system has independent temperature control for both materials and is far less complex than closed loops. The system is described in detail and the results of three experiments are presented

  17. Fully CMOS-compatible titanium nitride nanoantennas

    International Nuclear Information System (INIS)

    CMOS-compatible fabrication of plasmonic materials and devices will accelerate the development of integrated nanophotonics for information processing applications. Using low-temperature plasma-enhanced atomic layer deposition (PEALD), we develop a recipe for fully CMOS-compatible titanium nitride (TiN) that is plasmonic in the visible and near infrared. Films are grown on silicon, silicon dioxide, and epitaxially on magnesium oxide substrates. By optimizing the plasma exposure per growth cycle during PEALD, carbon and oxygen contamination are reduced, lowering undesirable loss. We use electron beam lithography to pattern TiN nanopillars with varying diameters on silicon in large-area arrays. In the first reported single-particle measurements on plasmonic TiN, we demonstrate size-tunable darkfield scattering spectroscopy in the visible and near infrared regimes. The optical properties of this CMOS-compatible material, combined with its high melting temperature and mechanical durability, comprise a step towards fully CMOS-integrated nanophotonic information processing

  18. Fully CMOS-compatible titanium nitride nanoantennas

    Energy Technology Data Exchange (ETDEWEB)

    Briggs, Justin A., E-mail: jabriggs@stanford.edu [Department of Applied Physics, Stanford University, 348 Via Pueblo Mall, Stanford, California 94305 (United States); Department of Materials Science and Engineering, Stanford University, 496 Lomita Mall, Stanford, California 94305 (United States); Naik, Gururaj V.; Baum, Brian K.; Dionne, Jennifer A. [Department of Materials Science and Engineering, Stanford University, 496 Lomita Mall, Stanford, California 94305 (United States); Petach, Trevor A.; Goldhaber-Gordon, David [Department of Physics, Stanford University, 382 Via Pueblo Mall, Stanford, California 94305 (United States)

    2016-02-01

    CMOS-compatible fabrication of plasmonic materials and devices will accelerate the development of integrated nanophotonics for information processing applications. Using low-temperature plasma-enhanced atomic layer deposition (PEALD), we develop a recipe for fully CMOS-compatible titanium nitride (TiN) that is plasmonic in the visible and near infrared. Films are grown on silicon, silicon dioxide, and epitaxially on magnesium oxide substrates. By optimizing the plasma exposure per growth cycle during PEALD, carbon and oxygen contamination are reduced, lowering undesirable loss. We use electron beam lithography to pattern TiN nanopillars with varying diameters on silicon in large-area arrays. In the first reported single-particle measurements on plasmonic TiN, we demonstrate size-tunable darkfield scattering spectroscopy in the visible and near infrared regimes. The optical properties of this CMOS-compatible material, combined with its high melting temperature and mechanical durability, comprise a step towards fully CMOS-integrated nanophotonic information processing.

  19. The Effect of Birth Order on Roommate Compatibility

    Science.gov (United States)

    Schuh, John H.; Williams, Ondre J.

    1977-01-01

    A group of students were matched on the basis of compatible birth order; another was matched on the basis of conflicting birth order. After a month's experience in a residence hall their compatibility was examined. Students with conflicting birth order were more compatible than those with the same birth order. (Author)

  20. 46 CFR Figure 1 to Part 150 - Compatibility Chart

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 5 2010-10-01 2010-10-01 false Compatibility Chart 1 Figure 1 to Part 150 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) CERTAIN BULK DANGEROUS CARGOES COMPATIBILITY OF CARGOES Pt. 150, Fig. 1 Figure 1 to Part 150—Compatibility Chart EC02FE91.079...

  1. 77 FR 59702 - Promoting U.S. EC Regulatory Compatibility

    Science.gov (United States)

    2012-09-28

    ... greater transatlantic regulatory compatibility generally. Concrete ideas on how greater compatibility.... We also invite you to share your concrete ideas on how greater compatibility could be achieved in a... (.doc) or Adobe Acrobat (.pdf). If the submission is in an application other than those two,...

  2. Rust transformation/rust compatible primers

    Science.gov (United States)

    Emeric, Dario A.; Miller, Christopher E.

    1993-01-01

    Proper surface preparation has been the key to obtain good performance by a surface coating. The major obstacle in preparing a corroded or rusted surface is the complete removal of the contaminants and the corrosion products. Sandblasting has been traditionally used to remove the corrosion products before painting. However, sandblasting can be expensive, may be prohibited by local health regulations and is not applicable in every situation. To get around these obstacles, Industry developed rust converters/rust transformers and rust compatible primers (high solids epoxies). The potential use of these products for military equipment led personnel of the Belvoir Research, Development and Engineering Center (BRDEC) to evaluate the commercially available rust transformers and rust compatible primers. Prior laboratory experience with commercially available rust converters, as well as field studies in Hawaii and Puerto Rico, revealed poor performance, several inherent limitations, and lack of reliability. It was obvious from our studies that the performance of rust converting products was more dependent on the amount and type of rust present, as well as the degree of permeability of the coating, than on the product's ability to form an organometallic complex with the rust. Based on these results, it was decided that the Military should develop their own rust converter formulation and specification. The compound described in the specification is for use on a rusted surface before the application of an organic coating (bituminous compounds, primer or topcoat). These coatings should end the need for sandblasting or the removing of the adherent corrosion products. They also will prepare the surface for the application of the organic coating. Several commercially available rust compatible primers (RCP) were also tested using corroded surfaces. All of the evaluated RCP failed our laboratory tests for primers.

  3. Batch Processing of CMOS Compatible Feedthroughs

    DEFF Research Database (Denmark)

    Rasmussen, F.E.; Heschel, M.; Hansen, Ole

    2003-01-01

    process scheme allows for post processing of feedthroughs in any kind of fully processed CMOS wafer. The fabrication of the electrical feedthroughs is based on wet etching of through-holes, low temperature deposition of dielectric material, and electrodeposition of photoresist and feedthrough metal. The...... feedthrough technology employs a simple solution to the well-known CMOS compatibility issue of KOH by protecting the CMOS side of the wafer using sputter deposited TiW/Au. The fabricated feedthroughs exhibit excellent electrical performance having a serial resistance of 40 mOmega and a parasitic capacitance...

  4. Martensitic textures: Multiscale consequences of elastic compatibility

    International Nuclear Information System (INIS)

    We show that a free energy entirely in the order-parameter strain variable(s), rather than the displacement field, provides a unified understanding of martensitic textures. We use compatibility equations, linking the strain tensor components in the bulk and at interfaces, that induce anisotropic order-parameter strain interactions. These two long-range bulk/interface potentials, together with local compositional fluctuations, drive the formation of global elastic textures. Relaxational simulations show the spontaneous formation (and evolution under stress/temperature quenches) of equal width parallel twins, branched twins, and tweed, including characteristic scaling of twin width with twin length. (author)

  5. The Construal (In)compatibility Effect

    DEFF Research Database (Denmark)

    Yang, Xiaojing; Ringberg, Torsten; Mao, Huifang;

    2011-01-01

    This research examines how consumers with a creative mind-set are persuaded by advertising claims construed at different levels (i.e., abstract vs. concrete ad claims). Across four experiments, we show that consumers with a creative mindset are more persuaded by ad claims construed at a level...... incompatible with their mental construal, while ad claims construed at a level compatible with consumers' mental construal are more effective for those who possess a less creative mindset. We document that such differences in persuasion are driven by the fact that consumers with a creative (less creative) mind...

  6. Algebraic properties of compatible Poisson brackets

    Science.gov (United States)

    Zhang, Pumei

    2014-05-01

    We discuss algebraic properties of a pencil generated by two compatible Poisson tensors A( x) and B( x). From the algebraic viewpoint this amounts to studying the properties of a pair of skew-symmetric bilinear forms A and B defined on a finite-dimensional vector space. We describe the Lie group G P of linear automorphisms of the pencil P = { A + λB}. In particular, we obtain an explicit formula for the dimension of G P and discuss some other algebraic properties such as solvability and Levi-Malcev decomposition.

  7. Liquid-Oxygen-Compatible Cement for Gaskets

    Science.gov (United States)

    Elmore, N. L.; Neale, B. C.

    1984-01-01

    Fluorelastomer and metal bonded reliably by new procedure. To cure fluoroelastomer cement, metal plate/gasket assembly placed in vacuum bag evacuated to minimum vacuum of 27 inches (69 cm) of mercury. Vacuum maintained throughout heating process and until assembly returns to ambient room temperature. Used to seal gaskets and O-rings or used to splice layers of elastomer to form non-standard sized O-rings. Another possible use is to apply protective, liquid-oxygen-compatible coating to metal parts.

  8. Electromagnetic compatibility of nuclear power plants

    International Nuclear Information System (INIS)

    Lately, there has been a mounting concern about the electromagnetic compatibility of nuclear-power-plant systems mainly because of the effects due to the nuclear electromagnetic pulse, and also because of the introduction of more-sophisticated and, therefore, more-susceptible solid-state devices into the plants. Questions have been raised about the adequacy of solid-state-device protection against plant electromagnetic-interference sources and transients due to the nuclear electromagnetic pulse. In this paper, the author briefly reviews the environment, and the coupling, susceptibility, and vulnerability assessment issues of commercial nuclear power plants

  9. Study of Electromagnetism Compatibility of Bleeper Station

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    Transmitted power will decrease, cross-modulate distortion and inter-modulate distortion will be caused and antenna pattern will shift if transmitted antennas are fixed together. All these will lead to the alteration of area coverage. According to the basic theory of electromagnetism compatibility a computer model is established. We do some quantitative analysis of the problems above and give total number, arrangement mode and distance between antennas of bleeper station that operate at 150 MHz. The relation of these factors above are also given. All these are basis of the arrangement of antenna group of bleeper station.

  10. Plasmonic Modulator Using CMOS Compatible Material Platform

    DEFF Research Database (Denmark)

    Babicheva, Viktoriia; Kinsey, Nathaniel; Naik, Gururaj V.; Ferrera, Marcello; Lavrinenko, Andrei; Shalaev, Vladimir M.; Boltasseva, Alexandra

    In this work, a design of ultra-compact plasmonic modulator is proposed and numerically analyzed. The device l ayout utilizes alternative plas monic materials such as tr ansparent conducting oxides and titanium nitride which potentially can be applied for CMOS compatible process. The modulation is...... obtained by varying the ca rrier concentration of th e transparent conducting oxide layer and exciting plasmonic resonance in the structure. The analysis shows that an extinction ratio of 46 dB/μm can be achieved at the telecommunication wavelength. Proposed structure is particularly convenient for...... integration with existing insulator-metal-insu lator plasmonic waveguides as well as novel photonic/electronic hybrid circuits...

  11. Plasmonic Modulator Using CMOS Compatible Material Platform

    DEFF Research Database (Denmark)

    Babicheva, Viktoriia; Kinsey, Nathaniel; Naik, Gururaj V.;

    2014-01-01

    In this work, a design of ultra-compact plasmonic modulator is proposed and numerically analyzed. The device l ayout utilizes alternative plas monic materials such as tr ansparent conducting oxides and titanium nitride which potentially can be applied for CMOS compatible process. The modulation is...... obtained by varying the ca rrier concentration of th e transparent conducting oxide layer and exciting plasmonic resonance in the structure. The analysis shows that an extinction ratio of 46 dB/μm can be achieved at the telecommunication wavelength. Proposed structure is particularly convenient for...

  12. Mixed waste chemical compatibility with packaging components

    International Nuclear Information System (INIS)

    In this paper, a chemical compatibility testing program for packaging of mixed wastes at will be described. We will discuss the choice of four y-radiation doses, four time durations, four temperatures and four waste solutions to simulate the hazardous waste components of mixed wastes for testing materials compatibility of polymers. The selected simulant wastes are (1) an aqueous alkaline mixture of sodium nitrate and sodium nitrite; (2) a chlorinated hydrocarbon mixture; (3) a simulant liquid scintillation fluid; and (4) a mixture of ketones. A selection of 10 polymers with anticipated high resistance to one or more of these types of environments are proposed for testing as potential liner or seal materials. These polymers are butadiene acrylonitrile copolymer, cross-linked polyethylene, epichlorhyarin, ethylene-propylene rubber, fluorocarbon, glass-filled tetrafluoroethylene, high-density poly-ethylene, isobutylene-isoprene copolymer, polypropylene, and styrene-butadiene rubber. We will describe the elements of the testing plan along with a metric for establishing time resistance of the packaging materials to radiation and chemicals

  13. Electromagnetic Compatibility of Matrix Converter System

    Directory of Open Access Journals (Sweden)

    S. Fligl

    2006-12-01

    Full Text Available The presented paper deals with matrix converters pulse width modulation strategies design with emphasis on the electromagnetic compatibility. Matrix converters provide an all-silicon solution to the problem of converting AC power from one frequency to another, offering almost all the features required of an ideal static frequency changer. They possess many advantages compared to the conventional voltage or current source inverters. A matrix converter does not require energy storage components as a bulky capacitor or an inductance in the DC-link, and enables the bi-directional power flow between the power supply and load. The most of the contemporary modulation strategies are able to provide practically sinusoidal waveforms of the input and output currents with negligible low order harmonics, and to control the input displacement factor. The perspective of matrix converters regarding EMC in comparison with other types of converters is brightly evident because it is no need to use any equipment for power factor correction and current and voltage harmonics reduction. Such converter with proper control is properly compatible both with the supply mains and with the supplied load. A special digital control system was developed for the realized experimental test bed which makes it possible to achieve greater throughput of the digital control system and its variability.

  14. Backwards compatible high dynamic range video compression

    Science.gov (United States)

    Dolzhenko, Vladimir; Chesnokov, Vyacheslav; Edirisinghe, Eran A.

    2014-02-01

    This paper presents a two layer CODEC architecture for high dynamic range video compression. The base layer contains the tone mapped video stream encoded with 8 bits per component which can be decoded using conventional equipment. The base layer content is optimized for rendering on low dynamic range displays. The enhancement layer contains the image difference, in perceptually uniform color space, between the result of inverse tone mapped base layer content and the original video stream. Prediction of the high dynamic range content reduces the redundancy in the transmitted data while still preserves highlights and out-of-gamut colors. Perceptually uniform colorspace enables using standard ratedistortion optimization algorithms. We present techniques for efficient implementation and encoding of non-uniform tone mapping operators with low overhead in terms of bitstream size and number of operations. The transform representation is based on human vision system model and suitable for global and local tone mapping operators. The compression techniques include predicting the transform parameters from previously decoded frames and from already decoded data for current frame. Different video compression techniques are compared: backwards compatible and non-backwards compatible using AVC and HEVC codecs.

  15. Is religious education compatible with science education?

    Science.gov (United States)

    Mahner, Martin; Bunge, Mario

    1996-04-01

    This paper tackles a highly controversial issue: the problem of the compatibility of science and religion, and its bearing on science and religious education respectively. We challenge the popular view that science and religion are compatible or even complementary. In order to do so, we give a brief characterization of our conceptions of science and religion. Conspicuous differences at the doctrinal, metaphysical, methodological and attitudinal level are noted. Regarding these aspects, closer examination reveals that science and religion are not only different but in fact incompatible. Some consequences of our analysis for education as well as for education policy are explored. We submit that a religious education, particularly at an early age, is an obstacle to the development of a scientific mentality. For this and other reasons, religious education should be kept away from public schools and universities. Instead of promoting a religious world view, we should teach our children what science knows about religion, i.e., how science explains the existence of religion in historical, biological, psychological and sociological terms.

  16. Magma/metal compatibility study: compatibility of metals in molten degassed tholeiitic basalt

    International Nuclear Information System (INIS)

    The compatibility of ten commercially available alloys with molten (13000C) degassed tholeiitic basalt was studied. Results can be explained on the basis of (1) the relative free energies of formation of pertinent oxides and (2) shifts in the chemical equilibrium among iron species. (auth)

  17. Compatibility results of some diagnostic ionization chambers

    International Nuclear Information System (INIS)

    The most important task of the National Laboratory for Metrology of the Ionizing Radiations at the Institute for Radiation Protection and Dosimetry - LNMRI/IRD-CNEN/MCT is to realize and maintain the legal units in compliance with the International System of Units - Si and disseminate them, above all within the framework of legal and scientific metrology. The LNMRI/IRD thus is on top of the metrological hierarchy in Brazil. Calibration certificates issued is the document that was result of the calibrations, that is, the instrument was calibrated and now it is traceable to national standards. Groups of a similar model of the ion chambers design specific for using at conventional diagnostic dosimetric, attenuated and no attenuated and dental applications, are placed under similar calibration condition at the LNMRI/IRD. The main objective is to observe how is the compatibilities' measurements obtained through 10 equipment set dedicated for clinical dosimetry, and how are the dispersion conclusion for these. (author)

  18. An overview of electromagnetic compatibility (EMC)

    International Nuclear Information System (INIS)

    The world is becoming increasingly dependent upon the use of electrical and electronic equipment. In the recent years, introduction of semiconductor based devices, microprocessor and micro computer have brought about a technological revolution that has had far reaching effects in the home, in industry, in commerce and in defense. Electromagnetic Compatibility (EMC) is the discipline which attempts to over come or, at least, minimize the effects of mismatch between equipment and the operating environment in accordance with agreed specifications, standards and regulations. Increased electromagnetic pollution in the environment has caused tremendous concern in the electronic industry and among users. Designers of the electronic products and systems want to be sure that their products do not emit excessive, unintentional radiation to interfere with the operation of the other systems, nor should these products be susceptible to electromagnetic interference which may degrade their performance. (author)

  19. Engine Materials Compatibility with Alternate Fuels

    Energy Technology Data Exchange (ETDEWEB)

    Thomson, Jeffery K [ORNL; Pawel, Steven J [ORNL; Wilson, Dane F [ORNL

    2013-05-01

    The compatibility of aluminum and aluminum alloys with synthetic fuel blends comprised of ethanol and reference fuel C (a 50/50 mix of toluene and iso-octane) was examined as a function of water content and temperature. Commercially pure wrought aluminum and several cast aluminum alloys were observed to be similarly susceptible to substantial corrosion in dry (< 50 ppm water) ethanol. Corrosion rates of all the aluminum materials examined were accelerated by increased temperature and ethanol content in the fuel mixture, but inhibited by increased water content. Pretreatments designed to stabilize passive films on aluminum increased the incubation time for onset of corrosion, suggesting film stability is a significant factor in the mechanism of corrosion.

  20. Chemical compatibility of DWPF canistered waste forms

    International Nuclear Information System (INIS)

    The Waste Acceptance Preliminary Specifications (WAPS) require that the contents of the canistered waste form are compatible with one another and the stainless steel canister. The canistered waste form is a closed system comprised of a stainless steel vessel containing waste glass, air, and condensate. This system will experience a radiation field and an elevated temperature due to radionuclide decay. This report discusses possible chemical reactions, radiation interactions, and corrosive reactions within this system both under normal storage conditions and after exposure to temperatures up to the normal glass transition temperature, which for DWPF waste glass will be between 440 and 460 degrees C. Specific conclusions regarding reactions and corrosion are provided. This document is based on the assumption that the period of interim storage prior to packaging at the federal repository may be as long as 50 years

  1. Fuel System Compatibility Issues for Prometheus-1

    Energy Technology Data Exchange (ETDEWEB)

    DC Noe; KB Gibbard; MH Krohn

    2006-01-20

    Compatibility issues for the Prometheus-1 fuel system have been reviewed based upon the selection of UO{sub 2} as the reference fuel material. In particular, the potential for limiting effects due to fuel- or fission product-component (cladding, liner, spring, etc) chemical interactions and clad-liner interactions have been evaluated. For UO{sub 2}-based fuels, fuel-component interactions are not expected to significantly limit performance. However, based upon the selection of component materials, there is a potential for degradation due to fission products. In particular, a chemical liner may be necessary for niobium, tantalum, zirconium, or silicon carbide-based systems. Multiple choices exist for the configuration of a chemical liner within the cladding; there is no clear solution that eliminates all concerns over the mechanical performance of a clad/liner system. A series of tests to evaluate the performance of candidate materials in contact with real and simulated fission products is outlined.

  2. Catalytic nanoarchitectonics for environmentally compatible energy generation

    Directory of Open Access Journals (Sweden)

    Hideki Abe

    2016-01-01

    Full Text Available Environmentally compatible energy management is one of the biggest challenges of the 21st century. Low-temperature conversion of chemical to electrical energy is of particular importance to minimize the impact to the environment while sustaining the consumptive economy. In this review, we shed light on one of the most versatile energy-conversion technologies: heterogeneous catalysts. We establish the integrity of structural tailoring in heterogeneous catalysts at different scales in the context of an emerging paradigm in materials science: catalytic nanoarchitectonics. Fundamental backgrounds of energy-conversion catalysis are first provided together with a perspective through state-of-the-art energy-conversion catalysis including catalytic exhaust remediation, fuel-cell electrocatalysis and photosynthesis of solar fuels. Finally, the future evolution of catalytic nanoarchitectonics is overviewed: possible combinations of heterogeneous catalysts, organic molecules and even enzymes to realize reaction-selective, highly efficient and long-life energy conversion technologies which will meet the challenge we face.

  3. Engine Materials Compatability with Alternative Fuels

    Energy Technology Data Exchange (ETDEWEB)

    Pawel, Steve [Oak Ridge National Laboratory; Moore, D. [USCAR

    2013-04-05

    The compatibility of aluminum and aluminum alloys with synthetic fuel blends comprised of ethanol and reference fuel C (a 50/50 mix of toluene and iso-octane) was examined as a function of water content and temperature. Commercially pure wrought aluminum and several cast aluminum alloys were observed to be similarly susceptible to substantial corrosion in dry (< 50 ppm water) ethanol. Corrosion rates of all the aluminum materials examined were accelerated by increased temperature and ethanol content in the fuel mixture, but inhibited by increased water content. Pretreatments designed to stabilize passive films on aluminum increased the incubation time for onset of corrosion, suggesting film stability is a significant factor in the mechanism of corrosion.

  4. Compatibility problems with beryllium in ceramic blankets

    International Nuclear Information System (INIS)

    Compatibility of beryllium with structural materials (316L austenitic steel and 1.4914 martensitic steel) and with tritium breeding ceramics (lithium aluminate or silicate) has been studied in contact tests between 550 C and 700 C and for durations reaching 3000 hours. Beryllium-ceramic interaction is negligeable in all the temperature range with aluminate and up to 600 C with silicates. On the other hand, noticeable interaction is observed between beryllium and 316L steel at 580 C and above. Beryllium interaction with 1.4914 steel is visible only at 650 C and above and its amplitude is lower than 316L steel one. In these two cases, the superficial layer is brittle, and adherent to the steel. Comparison between beryllium - 0.4 wt% calcium alloy and beryllium at 700 C shows that interaction with steels or ceramics is qualitatively the same but slightly weaker. (author). 6 refs.; 6 figs.; 3 tabs

  5. fMRI-Compatible Electromagnetic Haptic Interface.

    Science.gov (United States)

    Riener, R; Villgrattner, T; Kleiser, R; Nef, T; Kollias, S

    2005-01-01

    A new haptic interface device is suggested, which can be used for functional magnetic resonance imaging (fMRI) studies. The basic component of this 1 DOF haptic device are two coils that produce a Lorentz force induced by the large static magnetic field of the MR scanner. A MR-compatible optical angular encoder and a optical force sensor enable the implementation of different control architectures for haptic interactions. The challenge was to provide a large torque, and not to affect image quality by the currents applied in the device. The haptic device was tested in a 3T MR scanner. With a current of up to 1A and a distance of 1m to the focal point of the MR-scanner it was possible to generate torques of up to 4 Nm. Within these boundaries image quality was not affected. PMID:17281892

  6. Fuel System Compatibility Issues for Prometheus-1

    International Nuclear Information System (INIS)

    Compatibility issues for the Prometheus-1 fuel system have been reviewed based upon the selection of UO2 as the reference fuel material. In particular, the potential for limiting effects due to fuel- or fission product-component (cladding, liner, spring, etc) chemical interactions and clad-liner interactions have been evaluated. For UO2-based fuels, fuel-component interactions are not expected to significantly limit performance. However, based upon the selection of component materials, there is a potential for degradation due to fission products. In particular, a chemical liner may be necessary for niobium, tantalum, zirconium, or silicon carbide-based systems. Multiple choices exist for the configuration of a chemical liner within the cladding; there is no clear solution that eliminates all concerns over the mechanical performance of a clad/liner system. A series of tests to evaluate the performance of candidate materials in contact with real and simulated fission products is outlined

  7. Hydrogen compatibility handbook for stainless steels

    Energy Technology Data Exchange (ETDEWEB)

    Caskey, G.R. Jr.

    1983-06-01

    This handbook compiles data on the effects of hydrogen on the mechanical properties of stainless steels and discusses this data within the context of current understanding of hydrogen compatibility of metals. All of the tabulated data derives from continuing studies of hydrogen effects on materials that have been conducted at the Savannah River Laboratory over the past fifteen years. Supplementary data from other sources are included in the discussion. Austenitic, ferritic, martensitic, and precipitation hardenable stainless steels have been studied. Damage caused by helium generated from decay of tritium is a distinctive effect that occurs in addition to the hydrogen isotopes protium and deuterium. The handbook defines the scope of our current knowledge of hydrogen effects in stainless steels and serves as a guide to selection of stainless steels for service in hydrogen.

  8. Automatic kelvin probe compatible with ultrahigh vacuum

    Science.gov (United States)

    Baikie, I. D.; van der Werf, K. O.; Oerbekke, H.; Broeze, J.; van Silfhout, A.

    1989-05-01

    This article describes a new type of in situ ultrahigh-vacuum compatible kelvin probe based on a voice-coil driving mechanism. This design exhibits several advantages over conventional mechanical feed-through and (in situ) piezoelectric devices in regard to the possibility of multiple probe geometry, flexibility of probe geometry, amplitude of oscillation, and pure parallel vibration. Automatic setup and constant spacing features are achieved using a digital-to-analog converter (DAC) steered offset potential. The combination of very low driver noise pick-up and data-acquisition system (DAS) signal processing techniques results in a work function (wf ) resolution, under optimal conditions, of analysis techniques this design has numerous applications in surface studies, e.g., adsorption kinetics, sample topography and homogeneity, sputter profiles, etc. For semiconductor specimens the high wf resolution makes it eminently suitable for surface photovoltage (SPV) spectroscopy.

  9. Electromagnetic compatibility in high-voltage engineering

    Science.gov (United States)

    Vanhouten, Marinus Albertus

    1990-09-01

    Electro Magnetic Compatibility (EMC) concepts for an efficient and consistant approach to practical interference problems are described. A critical analysis of 'grounding' is given. The design of a 'differentiated/integrated' system to measure fast voltage transients is described. Measurements of steep transient voltages across interruptions in a Gas Insulated Switchear (GIS) installation, due to switching actions, are presented. Available means to reduce the influence of this interference source on the measuring are discussed. General conclusions are that general, linear and basic design methods for the protection of electronics and (large) interconnected electrical systems against interference can be developed which can save production costs and research time. The design methods described concentrate on the reduction of dangerous voltages between critical points which can be achieved by correct layout choice.

  10. Incentive Compatible Privacy-Preserving Data Analysis

    Directory of Open Access Journals (Sweden)

    Shweta

    2014-08-01

    Full Text Available In many cases, competing parties who have private data may collaboratively conduct privacy-preserving distributed data analysis (PPDA tasks to learn beneficial data models or analysis results. Most often, the competing parties have different incentives. Although certain PPDA techniques guarantee that nothing other than the final analysis result is revealed, it is impossible to verify whether participating parties are truthful about their private input data. Unless proper incentives are set, current PPDA techniques cannot prevent participating parties from modifying their private inputs. This raises the question of how to design incentive compatible privacy-preserving data analysis techniques that motivate participating parties to provide truthful inputs. In this paper, we first develop key theorems, and then base on these theorems, we analyze certain important privacy-preserving data analysis tasks that could be conducted in a way that telling the truth is the best choice for any participating party.

  11. Propellant material compatibility program and results

    Science.gov (United States)

    Toth, L. R.; Cannon, W. A.; Coulbert, C. D.; Long, H. R.

    1976-01-01

    The effects of long-term (up to 10 years) contact of inert materials with earth-storable propellants were studied for the purpose of designing chemical propulsion system components that can be used for current as well as future planetary spacecraft. The primary experimental work, and results to date are reported. Investigations include the following propellants: hydrazine, hydrazine-hydrazine nitrate blends, monomethyl-hydrazine, and nitrogen tetroxide. Materials include: aluminum alloys, corrosion-resistant steels, and titanium alloys. More than 700 test specimen capsules were placed in long-term storage testing at 43 C in the special material compatibility facility. Material ratings relative to the 10-year requirement have been assigned.

  12. Is Christian Education Compatible With Science Education?

    Science.gov (United States)

    Martin, Michael

    Science education and Christian education are not compatible if by Christian education one means teaching someone to be a Christian. One goal of science education is to give students factual knowledge. Even when there is no actual conflict of this knowledge with the dogmas of Christianity, there exists the potential for conflict. Another goal of science education is to teach students to have the propensity to be sensitive to evidence: to hold beliefs tentatively in light of evidence and to reject these beliefs in the light of new evidence if rejection is warranted by this evidence. This propensity conflicts with one way in which beliefs are often taught in Christian education: namely as fundamental dogmas, rather than as subject to revision in the light of the evidence.

  13. Developing 2 C-compatible investment criteria

    International Nuclear Information System (INIS)

    This report studies the development of criteria for assessing the compatibility of financial investments with the international goal to limit global temperature increase to below 2 C above pre-industrial levels. The findings are intended as a starting point and a key input for a longer term process to develop consensus-based 2 C investing criteria. The focus here is placed on investments in projects and physical assets, in particular of development and climate finance organisations. In order to limit global temperature increase to 2 C, global greenhouse gas (GHG) emissions will have to be reduced significantly, eventually to zero, during the course of this century. This requires shifting capital from high to low carbon investments as well as significant capital mobilisation for investments in 2 C-compatible infrastructure. Given the long lifetime of physical assets, and the urgency of decarbonisation over the coming decades, this needs to begin today. Public financial institutions can play a prominent role in contributing to aligning investment flows with the 2 C limit, as well as in closing the current infrastructure investment gap, responding to their explicit or implicit climate mandates and leadership role in the finance sector. The majority of international financial institutions integrate climate considerations into their finance decisions to some degree, and are familiar with different types of criteria, including positive and negative lists, qualitative and quantitative benchmarks, and the use of shadow carbon pricing. However, current approaches do not link to the 2 C limit. 2 C investment criteria are therefore needed to guide investors in this regard. Such criteria may also support other purposes, including an understanding of climate risks and improved reporting and accountability.

  14. Developing 2 C-compatible investment criteria

    Energy Technology Data Exchange (ETDEWEB)

    Roeser, Frauke [NewClimate - Institute for Climate Policy and Global Sustainability gGmbH, Bonn (Germany); Weischer, Lutz [Germanwatch e.V., Koeln (Germany); Thomae, Jakob [2degrees Investing Initiative, New York, NY (United States); Hoehne, Niklas; Hagemann, Markus; El Alaoui, Alexander; Bals, Christoph; Eckstein, David; Kreft, Soenke; Rosse, Morten

    2015-11-30

    This report studies the development of criteria for assessing the compatibility of financial investments with the international goal to limit global temperature increase to below 2 C above pre-industrial levels. The findings are intended as a starting point and a key input for a longer term process to develop consensus-based 2 C investing criteria. The focus here is placed on investments in projects and physical assets, in particular of development and climate finance organisations. In order to limit global temperature increase to 2 C, global greenhouse gas (GHG) emissions will have to be reduced significantly, eventually to zero, during the course of this century. This requires shifting capital from high to low carbon investments as well as significant capital mobilisation for investments in 2 C-compatible infrastructure. Given the long lifetime of physical assets, and the urgency of decarbonisation over the coming decades, this needs to begin today. Public financial institutions can play a prominent role in contributing to aligning investment flows with the 2 C limit, as well as in closing the current infrastructure investment gap, responding to their explicit or implicit climate mandates and leadership role in the finance sector. The majority of international financial institutions integrate climate considerations into their finance decisions to some degree, and are familiar with different types of criteria, including positive and negative lists, qualitative and quantitative benchmarks, and the use of shadow carbon pricing. However, current approaches do not link to the 2 C limit. 2 C investment criteria are therefore needed to guide investors in this regard. Such criteria may also support other purposes, including an understanding of climate risks and improved reporting and accountability.

  15. Dicty_cDB: AHB160 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tica genomic, DNA sequence. 66 5e-10 2 BE325928 |BE325928.2 NF084H07ST1F1061 Developing stem Medicago trunca...tula cDNA clone NF084H07ST 5', mRNA sequence. 58 2e-09 3 AW692808 |AW692808.2 NF059H03ST1F1031 Developing st

  16. Dicty_cDB: AHB170 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Value N BI742991 |BI742991.1 kx37e02.y1 Parastrongyloides trichosuri IL pAMP1 v1 ...Chiapelli McCarter Parastrongyloides trichosuri cDNA 5' similar to TR:Q19070 Q19070 ELONGATION FACTOR 2-LIKE... ;, mRNA sequence. 70 5e-09 2 BI743756 |BI743756.1 kx52f02.y1 Parastrongyloides trichosuri PA pAMP1 v1 Chiap...elli McCarter Parastrongyloides trichosuri cDNA 5' similar to TR:O08810 O08810 U5-116KD. ;, mRNA sequence. 7...0 5e-09 2 BI501287 |BI501287.1 kx30d02.y1 Parastrongyloides trichosuri PA pAMP1 v

  17. Dicty_cDB: AHB194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available RISSIVIET--- ---vqlvnf*l*kkvqtlfqyhiwv*eqkf*sllihh*rvikvksc*hwvqh*mfslvvv qnhgiwkervis...---lfns*ifsykrrfkryfsiiygyesknfnlclstike*sk*nlvnigfnikcfl*ww srtmafgkkesfpincfkfnq*tkctfnrtr*w*fipchlsysyksfktnwyrinhw**s nhyqsis...nnnsnq lvkkqetkseekvksepqkhllpsqknklkkikek*vikrrgktgkxeilgsagskke Homology vs CSM-cDNA Score E Sequences pro...xnfrfsgf*kr Translated Amino Acid sequence (All Frames) Frame A: k*fnnqiiylfifyiykfyiyv*nlyiiiikeikdik*ikikrk****ik...s*sinynsillsspsfnsitscqftkrssnsrfftsstntttrttttttttai nlsrnkkpnlkkklnlnlkniyyqvkrin*krlkrnrssreeerqerxkf*vqrv

  18. Dicty_cDB: AHB309 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available qgiprattattttatttka kr*rvvitkeetiinaik*ketcrqrrf*nirdnhw*reeggci*s*tilfscnsssnhg gifnleyfllciscrlgne--- ---fssv*fl*wcyqesfni*fle...wfcwylyf imerrfrfnr*ts*s*kd*ss*vshveleerfrketssl*sfpsn*igq*k**csrikw* t*g*tifpyfkqri*yh*kfkt...KEVVFEVKPYFSHAILQATMA VFLIWNIFYFAYRAGWAMN--- ---srrydscngvtkshsiyds*sqetl*sr*ewsitlgrsy*sles*tnfl...prdxmkpvrvvhhfg*kllifgelnklslvllvlif hhgekvplqslnflklerlvvis*... N AF163835 |AF163835.1 Dictyostelium discoideum cellulose synthase (dcsA) mRNA, complete cds. 1287 0.0 3 AC

  19. Dicty_cDB: AHB375 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available prattattttatttkakr*rvvitkeetiinaik*ketcrqrrf*ni rdnhw*reeggci*s*tilfscnsssnhggifnleyfllciscrldne*nrlyhillfnp...fhsrrydscngvtkshsiyds*sqetl*sr*ewsitlgrsy* sles*tnflwfcwylyfimerrfrfnr*ts*s*kd*ss*vshveleerfrketssl*sfp sn*i...TFRTAISMDYPSENL--- ---l*vfglyqsl*kiqsfsfssv*fl*wcyqesfni*fleprdlmkpvrvvhhfg*kll i...shsliqsf ssl*slshfwvqhci*itlpihvllfww*hwnkslpreersiqpl*ctfvltknhhplyh vllelqslwiiqvktf--- ---yeyldctnrckrsnh...fgelnklslvllvlifhhgekvplqslnflklerlvvis*pcgigreis*rnq*fvkfs vklnwsmkmimlknqvvnirlnnlsvlqtknliplkiqdfsfqilssl

  20. Dicty_cDB: AHB122 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ot during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX14G21 5', mRNA sequence...e QHJ21N12, mRNA sequence. 54 1e-11 3 AI775579 |AI775579.1 EST256679 tomato resistant, Cornell...T311828 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX10C9 5

  1. Dicty_cDB: AHB208 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 312837 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX14G21 5...i aconitase mRNA, partial cds. 58 6e-11 3 AI775579 |AI775579.1 EST256679 tomato resistant, Cornell...1 EST311828 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX10

  2. Dicty_cDB: AHB301 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available yf**LHHYIYFNICIKKK--- ---YGNLEYYEDETXYSGLILRNQLICLLLL*nxls*xtitskstfxwrqfk*tlqxtsf wssnxiwlrs**skndl*tndsiig...tlssfyfylflvvtplyif*ymykkk--- ---YGNLEYYEDETXYSGLILRNQLICLLLL*nxls*xtitskstfxwrqf

  3. Dicty_cDB: AHB310 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available eneserftpwakdknrlllwhgsrltnfvsivsqglriappsapktgyrfgkgiyfadci sksfsycftssdcptalmllcevslgdmnelkhdtyme...rlnmqrvidqhvqpvkevlikkqfvlvikqnqntlmewmyhgii* nvnvhkyhhlqi*ftgntfvgktnyqlkqlifhlksmiqnqhqryker...n*tsqnqihlkslqxk*nkikffkiil kf Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Val...13 AC139644 |AC139644.1 Rattus norvegicus clone CH230-401P15, *** SEQUENCING IN PROGRESS ***, 30 unordered p...2 Homo sapiens clone RP11-657G2, WORKING DRAFT SEQUENCE, 15 unordered pieces. 50 0.083 1 AL139078 |AL139078.2 Campylobacter

  4. Dicty_cDB: AHB304 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 132494 |AC132494.1 Oryza sativa (japonica cultivar-group) chromosome 5 clone P0681F01, *** SEQUENCING IN PROGRESS ***, 4 ordere...32 0.099 8 AC132234 |AC132234.2 Mus musculus chromosome UNK clone RP24-496A9, WORKING DRAFT SEQUENCE, 5 unordere... 4e-08 ( P18493 ) RecName: Full=Poly [ADP-ribose] polymerase 1; ... 60 4e-08 T18600( T18600 )hypothetical...SIADNLKGPAIKNIIQYNKGYVDKVSPVHLLHTLSDWMLKGRPGRCPTCKNFDILFNGI EYQCKGWI--- Frame B: slliakekwqqkihllmrlnmqrvidq...4Q.Seq.d/ 1124 0.0 own update 2004.12.25 Homology vs DNA Score E Sequences producing significant alignme

  5. Studies on compatibility of energetic materials by thermal methods

    OpenAIRE

    Maria Alice Carvalho Mazzeu; Elizabeth da Costa Mattos; Koshun Iha

    2010-01-01

    The chemical compatibility of explosives, pyrotechnics and propellants with those materials is studied to evaluate potential hazards when in contact with other materials during production, storage and handling. Compatibility can be studied by several thermal methods as DSC (differential scanning calorimetry), TG (Thermogravimetry), VST (Vacuum stability test) and others. The test methods and well defined criteria are the most important elements when a compatibility study is being accomplished...

  6. Compatibility Heuristics for Modern Mobile Games : Mobile games, Game testing.

    OpenAIRE

    Gitau, Paul

    2010-01-01

    The purpose of this study was to demonstrate ways to perform a compatibility test for a modern mobile game. These tests were performed by running a tastephone midlet to the mobile handset to determine its characteristics and the equivalent implementation. Compatibility check test was also aimed to help a specified mobile game application to run successfully into a mobile phone. Compatibility heuristics for modern mobile games was also designed to study the factors that shoul...

  7. The Electromagnetic Compatibility Design of the Wireless Sensor Network Node

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    <正>This paper is concerned with the sensor nodes’ hardware design of the wireless sensor network.We focus on the electromagnetic compatibility design of the printed circuit board.In this paper,we will give a schematic diagram first,and then,according to the layout,wiring rules and the knowledge of electromagnetic compatibility, we will present the design of the printed circuit board which has a good characteristic of electromagnetic compatibility.

  8. MRI-compatible micromanipulator; design and implementation and MRI-compatibility tests.

    Science.gov (United States)

    Koseki, Yoshihiko; Tanikawa, Tamio; Chinzei, Kiyoyuki

    2007-01-01

    In this paper, we present a magnetic resonance imaging (MRI)-compatible micromanipulator, which can be employed to provide medical and biological scientists with the ability to concurrently manipulate and observe micron-scale objects inside an MRI gantry. The micromanipulator formed a two-finger micro hand, and it could handle a micron-scale object using a chopstick motion. For performing operations inside the MRI gantry in a manner such that the MRI is not disturbed, the system was designed to be nonmagnetic and electromagnetically compatible with the MRI. The micro-manipulator was implemented with piezoelectric transducers (PZT) as actuators for micro-motion, strain gauges as sensors for closed-loop control, and a flexure parallel mechanism made of acrylic plastic. Its compatibility with a 2-Tesla MRI was preliminarily tested by checking if the MRI obtained with the micromanipulator were similar to those obtained without the micromanipulator. The tests concluded that the micromanipulator caused no distortion but small artifacts on the MRI. The signal-to-noise ratio (SNR) of the MRI significantly deteriorated mainly due to the wiring of the micromanipulator. The MRI caused noise of the order of ones of volts in the strain amplifier. PMID:18001990

  9. Compatibility Determination [Public Use on Necedah National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Compatibility determinations for wildlife observation and photography, interpretation and environmental education, hunting, fishing, forest management (timber sales...

  10. EVA-Compatible Microbial Swab Tool

    Science.gov (United States)

    Rucker, Michelle A.

    2016-01-01

    When we send humans to search for life on Mars, we'll need to know what we brought with us versus what may already be there. To ensure our crewed spacecraft meet planetary protection requirements—and to protect our science from human contamination—we'll need to know whether micro-organisms are leaking/venting from our ships and spacesuits. This is easily done by swabbing external vents and suit surfaces for analysis, but requires a specialized tool for the job. Engineers at the National Aeronautics and Space Administration (NASA) recently developed an Extravehicular Activity (EVA)-compatible swab tool that can be used to sample current space suits and life support systems. Data collected now will influence Mars life support and EVA hardware early in the planning process, before design changes become difficult and expensive.NASA’s EVA swab tool pairs a Space Shuttle-era tool handle with a commercially available swab tip mounted into a custom-designed end effector. A glove-compatible release mechanism allows the handle to quickly switch between swab tips, much like a shaving razor handle can snap onto a disposable blade cartridge. Swab tips are stowed inside individual sterile containers, each fitted with a microbial filter that allows the container to equalize atmospheric pressure, but prevents cabin contaminants from rushing into the container when passing from the EVA environment into a pressurized cabin. A bank of containers arrayed inside a tool caddy allows up to six individual samples to be collected during a given spacewalk.NASA plans to use the tool in 2016 to collect samples from various spacesuits during ground testing to determine what (if any) human-borne microbial contamination leaks from the suit under simulated thermal vacuum conditions. Next, the tool will be used on board the International Space Station to assess the types of microbial contaminants found on external environmental control and life support system vents. Data will support

  11. Balance del proceso de Desmovilización, Desarme y Reinserción (DDR de los bloques Cacique Nutibara y Héroes de Granada en la ciudad de Medellín Overview of the Process of Demobilization, Disarmament and Re-integration (DDR in the Cacique Nutibara and Héroes de Granada Blocks in the City of Medellín

    Directory of Open Access Journals (Sweden)

    Manuel Alberto Alonso Espinal

    2008-07-01

    Full Text Available El artículo realiza una descripción general y un balance del proceso de Desmovilización, Desarme y Reinserción (DDR de los bloques Cacique Nutibara y Héroes de Granada en la ciudad de Medellín. El primero, desmovilizado el 9 de diciembre de 2003, con 868 excombatientes y 467 armas entregadas; el segundo, el 1 de agosto de 2005, con 2.033 excombatientes y 1.120 armas entregadas. El artículo describe y analiza el proceso local, con base en las variables propuestas por Gleichman y su grupo de trabajo en el año de 2004, y lo contrapone con el nacional, a la vez que construye una serie hipótesis que se deben tener presentes a la hora de caracterizar la naturaleza del paramilitarismo en la ciudad. El resultado es un programa con fortalezas y logros, pero también con vacíos y limitaciones.This article carries out a general description and an overview of the processes of De-mobilization, Disarmament and Re-insertion (DDR in the Cacique Nutibara y Héroes de Granada blocks in the city of Medellín. The first of these areas, was demobilized December 9, 2003, with 868 ex-combatants and 467 weapons delivered; the second, August 1, 2005, with 2,033 ex-combatants and 1,120 weapons delivered. The article describes and analyzes the local processes, based on the variables proposed by Gleichman and his working group in the year 2004, it and contrasts them with the national one, at the same time building a series of hypotheses that should be kept in mind at the moment of characterizing the nature of para-militarism in the city. The result is a program with strengths and achievements, but also with empty spaces and limitations.

  12. Radiochemical compatibility of EPDM/PP blends

    International Nuclear Information System (INIS)

    The capacity of ethylene-propylene-diene terpolymer to be cross-linked by its exposure to high energy radiation was considered in this work. γ-irradiation of EPDM/PP (ethylene-propylene-diene terpolymer/polypropylene) blends proved that free radicals provided by PP can be grafted on the EPDM backbone. Gel content measurements over all blending concentrations revealed a maximum level cross-linking at around 200 kGy. Simultaneity of cross-linking and oxidative degradation in irradiated polymers requires the choice of proper conditions to obtain high durability. IR spectroscopic measurements of carbonyl and hydroxyl indexes emphasize that low concentrations in radiolytic products is attained at short exposure (less than 200 kGy). This work presents the difference between raw and degraded polypropylene used for mixture preparation. The radiochemical behaviour of similar compositions of blends is proved. Thermal stability of non-irradiated EPDM/PP blend was checked by oxygen uptake method that confirms the higher probability of polypropylene to provide free radicals in a large extent. The high temperature used in the oxidation testing of present blends requires radiochemical compatibility of polymers. (authors)

  13. For a socially compatible power supply system

    International Nuclear Information System (INIS)

    The definition of social compatibility is an outcome of continuous analysis and assessment of impact on the society, also covering probable effects in future. In a democracy, this leads to political decisions of the government based on consideration of all relevant criteria. This is why in modern, highly industrialized societies with their complex structures, basis-democracy procedures which involve strong emotionalisation have been replaced by a system of decision-making powers given to authorities for a defined period of time. Applying these principles to the power industry, the author's analysis of the role of nuclear power in the electricity market, and later on in the heat market, is said to remain significant for many decades to come, at least for a time horizon not to be defined as yet. Nuclear power generation will increase. Should there be realistic chances in the power market one day for alternative energy sources, the process of nuclear power substitution will take many years, and will proceed in a way justifiable by responsible energy policy. (orig./HSCH)

  14. Oxygen Compatibility Assessment of Components and Systems

    Science.gov (United States)

    Stoltzfus, Joel; Sparks, Kyle

    2010-01-01

    Fire hazards are inherent in oxygen systems and a storied history of fires in rocket engine propulsion components exists. To detect and mitigate these fire hazards requires careful, detailed, and thorough analyses applied during the design process. The oxygen compatibility assessment (OCA) process designed by NASA Johnson Space Center (JSC) White Sands Test Facility (WSTF) can be used to determine the presence of fire hazards in oxygen systems and the likelihood of a fire. This process may be used as both a design guide and during the approval process to ensure proper design features and material selection. The procedure for performing an OCA is a structured step-by-step process to determine the most severe operating conditions; assess the flammability of the system materials at the use conditions; evaluate the presence and efficacy of ignition mechanisms; assess the potential for a fire to breach the system; and determine the reaction effect (the potential loss of life, mission, and system functionality as the result of a fire). This process should be performed for each component in a system. The results of each component assessment, and the overall system assessment, should be recorded in a report that can be used in the short term to communicate hazards and their mitigation and to aid in system/component development and, in the long term, to solve anomalies that occur during engine testing and operation.

  15. Studies of waste-canister compatibility

    International Nuclear Information System (INIS)

    Compatibility studies were conducted between 7 waste forms and 15 potential canister structural materials. The waste forms were Al-Si and Pb-Sn matrix alloys, FUETAP, glass, Synroc D, and waste particles coated with carbon or carbon plus silicon carbide. The canister materials included carbon steel (bare and with chromium or nickel coatings), copper, Monel, Cu-35% Ni, titanium (grades 2 and 12), several Inconels, aluminum alloy 5052, and two stainless steels. Tests of either 6888 or 8821 h were conducted at 100 and 3000C, which bracket the low and high limits expected during storage. Glass and FUETAP evolved sulfur, which reacted preferentially with copper, nickel, and alloys of these metals. The Pb-Sn matrix alloy stuck to all samples and the carbon-coated particles to most samples at 3000C, but the extent of chemical reaction was not determined. Testing for 0.5 h at 8000C was included because it is representative of a transportation accident and is required of casks containing nuclear materials. During these tests (1) glass and FUETAP evolved sulfur, (2) FUETAP evolved large amounts of gas, (3) Synroc stuck to titanium alloys, (4) glass was molten, and (5) both matrix alloys were molten with considerable chemical interactions with many of the canister samples. If this test condition were imposed on waste canisters, it would be design limiting in many waste storage concepts

  16. Electromagnetic Compatibility in Nuclear Power Plants

    International Nuclear Information System (INIS)

    Electromagnetic compatibility (EMC) has long been a key element of qualification for mission critical instrumentation and control (I ampersand C) systems used by the U.S. military. The potential for disruption of safety-related I ampersand C systems by electromagnetic interference (EMI), radio-frequency interference (RFI), or power surges is also an issue of concern for the nuclear industry. Experimental investigations of the potential vulnerability of advanced safety systems to EMI/RFI, coupled with studies of reported events at nuclear power plants (NPPs) that are attributed to EMI/RFI, confirm the safety significance of EMC for both analog and digital technology. As a result, Oak Ridge National Laboratory has been engaged in the development of the technical basis for guidance that addresses EMC for safety-related I ampersand C systems in NPPs. This research has involved the identification of engineering practices to minimize the potential impact of EMI/RFI and power surges and an evaluation of the ambient electromagnetic environment at NPPs to tailor those practices for use by the nuclear industry. Recommendations for EMC guidance have been derived from these research findings and are summarized in this paper

  17. A social compatibility analysis for technology policies

    International Nuclear Information System (INIS)

    The project reported on aimed at adding concrete helps in energy policy and energy economy decision making to the knowledge and information provided about the social aspects of energy supply. The KFA study proved to show that the two extreme energy paths 1 and 4 (Enquete commission) postulating drastic nuclear energy extensions or a radical nuclear phaseout, respectively, are not compatible with the given social conditions. While path 2 suggests a moderate but continuous extension of nuclear energy supplies and relies on the fast breeder at long date path 3 recommends the total resignation to nuclear energy to be starting in 2000. The scientific committee does not intend the book to be a 'vote' but rather aims at inciting the responsible decision makers to drawing conclusions on their own. The different contributions reveal different aspects of the research program. The program itself includes the following three central elements: tree analysis, impact analysis of energy systems and scenarios, planning cell-type evaluation. (orig./HSCH)

  18. 47 CFR 76.1621 - Equipment compatibility offer.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Equipment compatibility offer. 76.1621 Section... MULTICHANNEL VIDEO AND CABLE TELEVISION SERVICE Notices § 76.1621 Equipment compatibility offer. Cable system... offer to supply each subscriber with special equipment that will enable the simultaneous reception...

  19. 47 CFR 76.630 - Compatibility with consumer electronics equipment.

    Science.gov (United States)

    2010-10-01

    ... the basic tier of service. 47 CFR 76.630(a). The request for waiver states (a brief summary of the... 47 Telecommunication 4 2010-10-01 2010-10-01 false Compatibility with consumer electronics... Compatibility with consumer electronics equipment. (a) Cable system operators shall not scramble or...

  20. Characterization of an Auto-Compatible Default Theory

    Institute of Scientific and Technical Information of China (English)

    XU DaoYun(许道云); DING DeCheng(丁德成); ZHANG MingYi(张明义)

    2003-01-01

    In this paper, an equivalence condition for deciding whether a default theory isan auto-compatible default one is presented. Under the condition, the existence of extension of anauto-compatible default theory is a natural result. By introducing a well-ordering over the set D ofdefault rules, the extensions of an auto-compatible default theory (D, W) can be computed directly.The condition represents clearly the characterization of an auto-compatible default theory, andsome properties about auto-compatible default theory, such as semi-monotonicity, become naturalcorollaries. Based on the characterization, the revision of default beliefs is discussed to ensure theexistence of extension of the default theory, and the method is applied to investigate stable modelsof a general logic program.

  1. The Electromagnetic Compatibility Research Group: research questions

    Directory of Open Access Journals (Sweden)

    Francisco José Román Campos

    2010-06-01

    Full Text Available This paper summarises the Universidad Nacional de Colombia’s Electrical and Electronic Engineering Department’s Electromag- netic Compatibility Research Group (EMC-UNC activities during the last 30 years. The group was involved in developing experimental tools during the early 1980s, such as constructing high-voltage apparatus, developing high-voltage practical work for students and observing electrical discharges. These tools enabled the group to spend a decade focused on resolving one of the Colombian electrical sector’s main EMC problems: distribution transformer’s failures caused by lightning. For almost a decade this investigation was focused on understanding the causes of the extremely high failure index in Colombian rural areas, especially in the Rionegro basin. The main result of this investigation was a reduction by one order of magnitude in mean 10% distribution transformer failure rate. During this research work a noticeable pattern was observed of several electrically-isolated me- tallic bodies immersed in an electric field (i.e. floating electrodes. This was led to initiating floating electrode studies and for mulating a new scientific question, “How do corona electrical discharges interact with floating electrodes?” This new research question was dealt with during the second half of the 1990s and the first decade of the 2000s. This investigation was related to using electrostatically-accumulated charge on a floating electrode. This question opened up four research areas: gas discharge physics, generating fast current impulses, harvesting energy from the electric field and the possibility of high impedance current sources. This paper has summarised the most relevant work done by the EMC-UNC group on these topics. This floating electrode research work started by formulating four patents. Fresh research questions for the 2010s were related to measuring lightning electromagnetic pulses (LEMP, intentional electromagnetic

  2. Investigation into the frequency of examinations and age distribution in nuclear medicine and the resulting collective dose in the GDR; Erhebungen zur Haeufigkeit und Altersverteilung sowie der kollektiven Dosis in der Nuklearmedizin in der DDR

    Energy Technology Data Exchange (ETDEWEB)

    Tautz, M. [Inst. fuer Medizinische Physik, Klinikum Berlin-Buch (Germany); Ertl, S. [Inst. fuer Medizinische Physik, Klinikum Berlin-Buch (Germany); Deckart, H.F. [Inst. fuer Medizinische Physik, Klinikum Berlin-Buch (Germany)

    1995-12-31

    In report nos. 26 and 60, the ICRP has outlined possible policies for the assessment of radiation exposures that provided a basis for the discussions in this contribution. For the period from 1978 until 1988 data were collected of patients undergoing any of the twelve nucleomedical in-vivo examinations that were most commonly performed in the GDR. The organ doses for the individual procedures were basically adopted from the relevant literature. The essential conclusions from the study can be summarized as follows: Despite the growing number of patients in this branch of medicine it was found that the mean equivalent dose (effective body dose), and hence the radiation risk, were systematically diminished by a factor of approx. three. This reduction is mainly attributable to the fact that radioiodine tests have been largely abondoned to the favour of Tc-99m compounds, which are now increasingly used. Nevertheless, the current understanding is that there still remains a remote possibility of resulting injuries. The radiation risk must therefore be carefully balanced agaisnt the overall benefits from any procedures using radioactive substances. The mean effective dose equivalent, which is expressed here on a per caput basis, is low in comparison with relevant values for other countries, which seems to be owing to the fact that physcians specializing in nuclear medicine in the GDR have been urging the use of standardized examination procedures over the past few decades. (orig./MG) [Deutsch] Die ICRP hat in ihren Reports Nr. 26 und 60 Konzepte zur Beurteilung der Strahlenexposition vorgeschlagen, auf deren Basis dieser Vortrag entstand. Fuer den Zeitraum von 1978-1988 wurden die Daten von Patienten erfasst, die sich den 12 haeufigsten nuklearmedizinischen in vivo Untersuchungsverfahren der DDR unterzogen. Die Organdosen fuer die einzelnen Verfahren wurden im wesentlichen der Literatur entnommen. Die wesentlichsten Ergebnisse der Studie koennen folgendermassen

  3. Compatibility of state assignments and pooling of information

    Science.gov (United States)

    Brun, Todd A.; Hsieh, Min-Hsiu; Perry, Christopher

    2015-07-01

    We say that two (or more) state assignments for one and the same quantum system are compatible if they could represent the assignments of observers with differing information about the system. A criterion for compatibility was proposed in [Phys. Rev. A 65, 032315 (2002), 10.1103/PhysRevA.65.032315]; however, this leaves unanswered the question of whether there are degrees of compatibility which could be represented by some quantitative measure, and whether there is a straightforward procedure whereby the observers can pool their information to arrive at a unique joint state assignment. We argue that such measures are only sensible given some assumption about what kind of information was used in making the state assignments in the first place, and that in general state assignments do not represent all of the information possessed by the observers. However, we examine one particular measure and show that it has a straightforward interpretation, assuming that the information was acquired from a particular type of measurement, and that in this case there is a natural rule for pooling information. We extend this measure to compatibility of states for k observers and show that the value is the solution to a semidefinite program. Similar compatibility measures can be defined for alternative notions of state compatibility, including post-Peierls and equal support compatibilities.

  4. Proteomics analysis of compatibility and incompatibility in grafted cucumber seedlings.

    Science.gov (United States)

    Xu, Qing; Guo, Shi-Rong; Li, Lin; An, Ya-Hong; Shu, Sheng; Sun, Jin

    2016-08-01

    Graft compatibility between rootstock and scion is the most important factor influencing the survival of grafted plants. In this study, we used two-dimensional gel electrophoresis (2-DE) and matrix-assisted laser desorption/ionization tandem time-of-flight mass spectrometry (MALDI-TOF/TOF MS) to investigate differences in leaf proteomes of graft-compatible and graft-incompatible cucumber (Cucumis sativus L.)/pumpkin (Cucurbita L.) combinations. Cucumber seedlings were used as the scions and two pumpkin cultivars with strongly contrasting grafting compatibilities were used as the rootstocks. Non-grafted and self-grafted cucumber seedlings served as control groups. An average of approximately 500 detectable spots were observed on each 2-DE gel. A total of 50 proteins were differentially expressed in response to self-grafting, compatible-rootstock grafting, and incompatible-rootstock grafting and were all successfully identified by MALDI-TOF/TOF MS. The regulation of Calvin cycle, photosynthetic apparatus, glycolytic pathway, energy metabolism, protein biosynthesis and degradation, and reactive oxygen metabolism will probably contribute to intensify the biomass and photosynthetic capacity in graft-compatible combinations. The improved physiological and growth characteristics of compatible-rootstock grafting plants are the result of the higher expressions of proteins involved in photosynthesis, carbohydrate and energy metabolism, and protein metabolism. At the same time, the compatible-rootstock grafting regulation of stress defense, amino acid metabolism, and other metabolic functions also plays important roles in improvement of plant growth. PMID:27070289

  5. Self-Compatibility Crosses of Several Cocoa Clones

    OpenAIRE

    Agung Wahyu Susilo

    2006-01-01

    Self compatibility cross in cocoa is a useful criterion in utilizing germplasm collection. Evaluation of self-compatibility crosses on cocoa clones has been carried out in Kaliwining Experimental Station of ICCRI by treating artificial self-pollination. The observed clones were TSH 858, ICS 60, ICS 13, UIT 1, KW 162, KW 165, KW 163, DR 1, DR 2, DRC 16, DRC 15, KKM 22, Na 32, Na 33 and DR 38. Self-compatibility crosses were identified by percentage of fruit set evaluated during 6 consecutive w...

  6. Materials compatibility and lubricants research on CFC-refrigerant substitutes

    Science.gov (United States)

    Szymurski, S. R.; Hawley, M.; Hourahan, G. C.; Godwin, D. S.

    1994-08-01

    The Materials Compatibility and Lubricants Research (MCLR) program supports critical research to accelerate the introduction of CFC and HCFC refrigerant substitutes. The MCLR program addresses refrigerant and lubricant properties and materials compatibility. The primary elements of the work include data collection and dissemination, materials compatibility testing, and methods development. The work is guided by an Advisory Committee consisting of technical experts from the refrigeration and air-conditioning industry and government agencies. The Air-Conditioning and Refrigeration Technology Institute, Inc., (ARTI) manages and contracts multiple research projects and a data collection and dissemination effort. Detailed results from these projects are reported in technical reports prepared by each subcontractor.

  7. Compatibility of Soybean Protein and Poly (vinyl alcohol)

    Institute of Scientific and Technical Information of China (English)

    沈婕; 肖茹; 顾利霞

    2004-01-01

    Bicomponent fibers were wet-spun from soybean protein and poly (vinyl alcohol). The fiber was brittle and showed a high frequency of breakage upon drawing and the bad compatibility between soybean protein and poly (vinyl alcohol) was thought to be the causes for the poor drawability. Our effort was then to study the soybean protein and poly (vinyl alcohol) solution, with the aim of trying to improve the components' compatibility and to determine the proper solution condition for dissolving them.The effects of alkali, sodium sulfite and urea on the compatibility of the solution were examined.

  8. Kinematical Compatibility Conditions for Vorticity Across Shock Waves

    Science.gov (United States)

    Baty, Roy

    2015-11-01

    This work develops the general kinematical compatibility conditions for vorticity across arbitrary shock waves in compressible, inviscid fluids. The vorticity compatibility conditions are derived from the curl of the momentum equation using singular distributions defined on two-dimensional shock wave surfaces embedded in three-dimensional flow fields. The singular distributions are represented as generalized differential operators concentrated on moving shock wave surfaces. The derivation of the compatibility conditions for vorticity requires the application of second-order generalized derivatives and elementary tensor algebra. The well-known vorticity jump conditions across a shock wave are then shown to follow from the general kinematical compatibility conditions for vorticity by expressing the flow field velocity in vectorial components normal and tangential to a shock surface.

  9. COMPATIBILITY OF PVC WITH POLYURETHANES OF DIFFERENT SOFT SEGMENTS

    Institute of Scientific and Technical Information of China (English)

    XIAO Fengfei; ZHANG Xian; HU Shiru; MA Dezhu; LUO Xiaolie; XU Mao

    1988-01-01

    Blends of PVC and polyurethanes with four different soft segments of molecular weight 1000 were prepared and studied by dynamic mechanical and DSC techniques. It was found that the compatibility of PVC with segmented polyurethanes was related to the mixing of PVC molecules and the soft segments of the polyurethanes. Polyester based polyurethanes are more compatible with PVC than polyether based polyurethanes. Solution cast blends of PVC with PCL-polyurethane (1/2/1) exhibit single and narrow glass transition, while the blends with PPO-polyurethane (1/2/1) are completely incompatible. The compatibility was found to decrease with increasing hard segment content for all the polyurethanes used. The methods of blend preparation may change the compatibility of PVC/PU blends through their influence on the mixing or demixing of the hard and soft segments.

  10. Metric Compatible or Noncompatible Finsler--Ricci Flows

    CERN Document Server

    Vacaru, Sergiu I

    2011-01-01

    There were elaborated different models of Finsler geometry using the Cartan (metric compatible), or Berwald and Chern (metric non-compatible) connections, the Ricci flag curvature etc. In a series of works, we studied (non)commutative metric compatible Finsler and nonholonomic generalizations of the Ricci flow theory [see S. Vacaru, J. Math. Phys. 49 (2008) 043504; 50 (2009) 073503 and references therein. The goal of this work is to prove that there are some models of Finsler gravity and geometric evolution theories with generalized Perelman's functionals, and correspondingly derived nonholonomic Hamilton evolution equations, when metric noncompatible Finsler connections are involved. Following such an approach, we have to consider distortion tensors, uniquely defined by the Finsler metric, from the Cartan and/or the canonical metric compatible connections. We conclude that, in general, it is not possible to elaborate self-consistent models of geometric evolution with arbitrary Finsler metric noncompatible co...

  11. Compatibility determination [for Walnut Creek National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This compatibility report for Neal Smith National Wildlife Refuge formerly Walnut Creek National Wildlife Refuge determines that the 1992 interim hunting plan is...

  12. An Evaluation of Blood Compatibility of Silver Nanoparticles

    OpenAIRE

    Huang, He; Lai, Wenjia; Cui, Menghua; Liang, Ling; Lin, Yuchen; Fang, Qiaojun; Liu, Ying; Xie, Liming

    2016-01-01

    Silver nanoparticles (AgNPs) have tremendous potentials in medical devices due to their excellent antimicrobial properties. Blood compatibility should be investigated for AgNPs due to the potential blood contact. However, so far, most studies are not systematic and have not provided insights into the mechanisms for blood compatibility of AgNPs. In this study, we have investigated the blood biological effects, including hemolysis, lymphocyte proliferation, platelet aggregation, coagulation and...

  13. Static Analysis for Checking Data Format Compatibility of Programs

    OpenAIRE

    Devaki, Pranavadatta; Kanade, Aditya

    2012-01-01

    Large software systems are developed by composing multiple programs. If the programs manipulate and exchange complex data, such as network packets or files, it is essential to establish that they follow compatible data formats. Most of the complexity of data formats is associated with the headers. In this paper, we address compatibility of programs operating over headers of network packets, files, images, etc. As format specifications are rarely available, we infer the format associated wi...

  14. Trade Liberalization in the Americas: are Regionalism and Globalization Compatible?

    OpenAIRE

    David Roland-Holst; Dominique van der Mensbrugghe

    2003-01-01

    Trade liberalization across the Americas holds the potential to substantially improve living standards and present a successful model of North-South regionalism. In this paper, we use a global CGE model to assess the effects of such an arrangement for both member and non-member economies. We also evaluate a number of other issues, including incentive compatibility of the regional agreement for individual members and its structural compatibility with the larger agenda of global trade liberaliz...

  15. Materials Compatibility of HVACR System Materials with Low GWP Refrigerants

    OpenAIRE

    Majurin, Julie A.; Gilles, William; Staats, Steven J.

    2014-01-01

    When assessing the suitability of next generation refrigerants for use with current HVACR system materials, two areas of concern need to be thoroughly investigated and understood: 1) chemical stability of the fluids when exposed to system materials under the anticipated conditions of use, and 2) compatibility of the system materials when in contact with the fluids. This paper will summarize materials compatibility evaluations of unsaturated hydrofluorocarbon (HFO) refrigerants, and HFO refrig...

  16. Optimization of Mass Spectrometry Compatible Surfactants for Shotgun Proteomics

    OpenAIRE

    Chen, Emily I.; Cociorva, Daniel; Norris, Jeremy L.; Yates, John R.

    2007-01-01

    An optimization and comparison of trypsin digestion strategies for peptide/protein identifications by μLC-MS/MS with or without MS compatible detergents in mixed organic-aqueous and aqueous systems was carried out in this study. We determine that adding MS compatible detergents to proteolytic digestion protocols dramatically increases peptide and protein identifications in complex protein mixtures by shotgun proteomics. Protein solubilization and proteolytic efficiency are increased by includ...

  17. Ambiguity aversion solves the conflict between efficiency and incentive compatibility

    OpenAIRE

    Castro, Luciano I.; Nicholas C. Yannelis

    2011-01-01

    The conflict between Pareto optimality and incentive compatibility, that is, the fact that some Pareto optimal (efficient) allocations are not incentive compatible is a fundamental fact in information economics, mechanism design and general equilibrium with asymmetric information. This important result was obtained assuming that the individuals are expected utility maximizers. Although this assumption is central to Harsanyi's approach to games with incomplete information, it is not the only o...

  18. Radiotracer experiments with biopolymers and bio-compatible polymers

    International Nuclear Information System (INIS)

    The applications of biopolymer and biocompatible polymer employing radiotracers have been reviewed. Two different aspects have been studied. Environmentally benign methodologies for the removal, immobilization, separation or speciation of heavy, toxic elements and clinically important radionuclides have been developed using biopolymer and bio-compatible polymer as well. The complex formation ability of a bio-compatible polymer, polyvinylpyrrolidone (PVP), with clinically important radionuclides have been tested which have tremendous importance in radiopharmaceutical sciences. (author)

  19. Secured Credit in Europe : From Conflicts to Compatibility

    OpenAIRE

    Juutilainen, Teemu

    2015-01-01

    This study seeks the optimal way to promote compatibility between systems of proprietary security rights in Europe. The focus is on security rights over tangible movables and receivables. Compatibility is understood as the absence of cross-border problems, notably uncertain enforceability and unexpected loss of proprietary security rights, or as the availability of workable solutions to them. Current cross-border problems mainly concern enforceability of proprietary security rights against th...

  20. Studies on compatibility of energetic materials by thermal methods

    Directory of Open Access Journals (Sweden)

    Maria Alice Carvalho Mazzeu

    2010-04-01

    Full Text Available The chemical compatibility of explosives, pyrotechnics and propellants with those materials is studied to evaluate potential hazards when in contact with other materials during production, storage and handling. Compatibility can be studied by several thermal methods as DSC (differential scanning calorimetry, TG (Thermogravimetry, VST (Vacuum stability test and others. The test methods and well defined criteria are the most important elements when a compatibility study is being accomplished. In this paper, the compatibility of two very important high explosives used in ammunition, RDX (Cyclo-1,3,5-trimethylene-2,4,6-trinitramine and HMX (Cyclotetramethylene tetranitramine was studied with the materials: fluoroelastomer (Viton and powdered aluminum (Al, using DSC and VST methods. The criteria to judge the compatibility between materials is based on a standardization agreement (STANAG 4147, 2001, and the final conclusion is that explosives and this materials are compatible, but in DSC it was observed that the peak of decomposition temperature of the admixture of RDX with Al decreased in 3º C and another peak appeared after the decomposition peak.

  1. Coproduction of detergent compatible bacterial enzymes and stain removal evaluation.

    Science.gov (United States)

    Niyonzima, Francois N; More, Sunil S

    2015-10-01

    Most of the detergents that are presently produced contain the detergent compatible enzymes to improve and accelerate the washing performance by removing tough stains. The process is environment friendly as the use of enzymes in the detergent formulation reduces the utilization of toxic detergent constituents. The current trend is to use the detergent compatible enzymes that are active at low and ambient temperature in order to save energy and maintain fabric quality. As the detergent compatible bacterial enzymes are used together in the detergent formulation, it is important to co-produce the detergent enzymes in a single fermentation medium as the enzyme stability is assured, and production cost gets reduced enormously. The review reports on the production, purification, characterization and application of detergent compatible amylases, lipases, and proteases are available. However, there is no specific review or minireview on the concomitant production of detergent compatible amylases, lipases, and proteases. In this minireview, the coproduction of detergent compatible enzymes by bacterial species, enzyme stability towards detergents and detergent components, and stain release analysis were discussed. PMID:26011283

  2. Chemical Compatibility Testing Final Report Including Test Plans and Procedures

    International Nuclear Information System (INIS)

    This report provides an independent assessment of information on mixed waste streams, chemical compatibility information on polymers, and standard test methods for polymer properties. It includes a technology review of mixed low-level waste (LLW) streams and material compatibilities, validation for the plan to test the compatibility of simulated mixed wastes with potential seal and liner materials, and the test plan itself. Potential packaging materials were reviewed and evaluated for compatibility with expected hazardous wastes. The chemical and physical property measurements required for testing container materials were determined. Test methodologies for evaluating compatibility were collected and reviewed for applicability. A test plan to meet US Department of Energy and Environmental Protection Agency requirements was developed. The expected wastes were compared with the chemical resistances of polymers, the top-ranking polymers were selected for testing, and the most applicable test methods for candidate seal and liner materials were determined. Five recommended solutions to simulate mixed LLW streams are described. The test plan includes descriptions of test materials, test procedures, data collection protocols, safety and environmental considerations, and quality assurance procedures. The recommended order of testing to be conducted is specified

  3. Image Theory's Compatibility Test and Evaluations of the Status Quo.

    Science.gov (United States)

    Richmond; Bissell; Beach

    1998-01-01

    The research on image theory's concept of progress decisions about either (1) the acceptability of the status quo vis a desired state or (2) the acceptability of movement toward a desired state has been limited to the laboratory. To demonstrate the feasibility of research on nonlaboratory, job-related progress decisions and to develop methods for doing it with minimal intrusion on participant work time, two experiments examined evaluations of the status quo vis a desired state in the context of three organizations: a controller's office, a pretrial services office, and a chain of fast food restaurants. Experiment 1 used fairly elaborate, time consuming methods in the controller's office and pretrial services office to measure the compatibility between participants' images of desirable supervision and their images of current supervision as well as their satisfaction with both supervision and with the organization. In both cases, as compatibility decreased, satisfaction decreased, but satisfaction with the organization appeared to derive from satisfaction with supervision rather than directly from compatibility. Experiment 2 measured the same concepts in the fast food chain using simple, single-item methods, obtaining roughly the same results as Experiment 1, except that it also demonstrated that hope for change can mitigate the effects of incompatibility on satisfaction. These results provide evidence for the role of compatibility in decision making and for the feasibility of using simple methods of measuring compatibility, acceptability, and hope in nonlaboratory research. Copyright 1998 Academic Press. PMID:9705793

  4. Waste compatibility assessments to support project W-320

    International Nuclear Information System (INIS)

    The intent of this internal memo is to provide a recommendation for the transfer of tank 241-C-106 waste, Attachment 2, to tank 241-AY-102. This internal memo also identifies additional requirements which have been deemed necessary for safely receiving and storing the waste documented in Attachment 2 from tank 241-C-106 in tank 241-AY-102. This waste transfer is planned in support of tank 241-C-106 solids sluicing activities. Approximately 200,000 gallons of waste and flush water are expected to be pumped from tank 241-C-106 into tank 241-AY-102. Several transfers will be necessary to complete the sluicing of tank 241-C-106 solids. To assure ourselves that this waste transfer will not create any compatibility concerns, a waste compatibility assessment adhering to current waste compatibility requirements has been performed

  5. Sexual compatibility in medfly (Diptera: Tephritidae) from different origins

    International Nuclear Information System (INIS)

    The use of the Sterile Insect Technique to control and/or eradicate insect pest populations has been extensively applied to medfly. However, patented differences in sexual compatibility between populations or strains from different origins has been a serious concern to a wider use of sterile flies, and in particular sterile males of genetic sexing strains (GSS). In the present experiments, the sexual compatibility and mating performance of flies from 9 countries representing 5 continents and 4 GSS were measured. It is demonstrated that, from a qualitative standpoint, wild medfly populations world-wide have not yet evolved specific sexual behaviors indicative of incipient pre-mating isolation mechanisms under local natural selection. Wild medfly populations are as sexually compatible with GSS as they are with other wild populations. On that basis, the same mass reared strain can now be used worldwide, as long as it fulfills the standard quality control requirements. (author)

  6. A compatible encapsulant for explosives. [Hexanitrostilbene and hexanitroazobenzene

    Energy Technology Data Exchange (ETDEWEB)

    Wischmann, K.B.

    1988-01-01

    Many epoxy resin encapsulants are amine cured; unfortunately, amine cured systems have long-term compatibility problems with certain explosives, i.e., HNS (hexanitrostilbene) and HNAB (hexanitroazobenzene). In response to this problem, an epoxy/anhydride encapsulant was developed that does not rely on amine catalysts. A new catalyst, an organochromium complex, was employed which was found to be compatible with the above explosives. This catalyst provided good cures at temperatures as low as 80)degrees)C; normally epoxy/anhydride systems require curing at temperatures well above 100)degrees)C. Our epoxy/anhydride formulation exhibits low exotherms, long pot life, and can be compounded with glass microballoons to attenuate shock and lower the encapsulant's coefficient of thermal expansion. This paper documents the formulation, physical property characterization, processing, and compatibility studies. 6 refs., 3 figs., 3 tabs.

  7. Compatibility grab sampling and analysis plan for fiscal year 1999

    International Nuclear Information System (INIS)

    This sampling and analysis plan (SAP) identifies characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for grab samples obtained to address waste compatibility. Analytical requirements are taken from two revisions of the Compatibility data quality objectives (DQOs). Revision 1 of the DQO (Fowler 1995) listed analyses to be performed to meet both safety and operational data needs for the Compatibility program. Revision 2A of the DQO (Mulkey and Miller 1998) addresses only the safety-related requirements; the operational requirements of Fowler (1995) have not been superseded by Mulkey and Miller (1998). Therefore, safety-related data needs are taken from Mulkey and Miller (1998) and operational-related data needs are taken from Fowler (1995). Ammonia and total alpha analyses are also performed in accordance with Fowler (1998a, 1998b)

  8. Almost compatible observables in quantum tests of contextuality

    Energy Technology Data Exchange (ETDEWEB)

    Guehne, Otfried [Institut fuer Quantenoptik und Quanteninformation, Oesterreichische Akademie der Wissenschaften, Innsbruck (Austria); Institut fuer Theoretische Physik, Universitaet Innsbruck (Austria); Kleinmann, Matthias [Institut fuer Quantenoptik und Quanteninformation, Oesterreichische Akademie der Wissenschaften, Innsbruck (Austria); Cabello, Adan [Departamento de Fisica Aplicada II, Universidad de Sevilla (Spain); Larsson, Jan-Ake [Institutionen foer Systemteknik och Matematiska Institutionen, Linkoepings Universitet (Sweden); Kirchmair, Gerhard; Zaehringer, Florian; Gerritsma, Rene; Blatt, Rainer; Roos, Christian [Institut fuer Quantenoptik und Quanteninformation, Oesterreichische Akademie der Wissenschaften, Innsbruck (Austria); Institut fuer Experimentalphysik, Universitaet Innsbruck (Austria)

    2010-07-01

    The Kochen-Specker-Theorem proves that in a hidden variable description of a quantum system, the value of a particular property (observable) depends on the context in which the value is to be revealed. The conflict here is between the hidden variable approach and the theory of quantum mechanics. In order to establish this conflict as the inability to employ a hidden variable description of an actual experiment, it has been suggested to extend the notion of non-contextuality to sequential measurements of compatible observables. However, in an experimental implementation the requirement of perfect compatibility cannot be reached. We show that this ''compatibility loophole'' can be addressed and that a recent experiment using trapped ions then excludes a large class of non-contextual hidden variable models.

  9. Material Compatibility with Space Storable Propellants. Design Guidebook

    Science.gov (United States)

    Uney, P. E.; Fester, D. A.

    1972-01-01

    An important consideration in the design of spacecraft for interplanetary missions is the compatibility of storage materials with the propellants. Serious problems can arise because many propellants are either extremely reactive or subject to catalytic decomposition, making the selection of proper materials of construction for propellant containment and control a critical requirement for the long-life applications. To aid in selecting materials and designing and evaluating various propulsion subsystems, available information on the compatibility of spacecraft materials with propellants of interest was compiled from literature searches and personal contacts. The compatibility of both metals and nonmetals with hydrazine, monomethyl hydrazine, nitrated hydrazine, and diborance fuels and nitrogen tetroxide, fluorine, oxygen difluoride, and Flox oxidizers was surveyed. These fuels and oxidizers encompass the wide variety of problems encountered in propellant storage. As such, they present worst case situations of the propellant affecting the material and the material affecting the propellant. This includes material attack, propellant decomposition, and the formation of clogging materials.

  10. Compatible finite element spaces for geophysical fluid dynamics

    CERN Document Server

    Natale, Andrea

    2016-01-01

    Compatible finite elements provide a framework for preserving important structures in equations of geophysical fluid dynamics, and are becoming important in their use for building atmosphere and ocean models. We survey the application of compatible finite element spaces to geophysical fluid dynamics, including the application to the nonlinear rotating shallow water equations, and the three-dimensional compressible Euler equations. We summarise analytic results about dispersion relations and conservation properties, and present new results on approximation properties in three dimensions on the sphere, and on hydrostatic balance properties.

  11. Elements of a compatible optimization theory for coupled systems

    International Nuclear Information System (INIS)

    The first theory deals with the compatible optimization in coupled systems. A game theory for two players and with a non-zero sum is first developed. The conclusions are then extended to the case of a game with any finite number of players. After this essentially static study, the dynamic aspect of the problem is applied to the case of games which evolve. By applying PONTRYAGIN maximum principle it is possible to derive a compatible optimisation theorem which constitutes a necessary condition. (author)

  12. Spectral measurement using IC-compatible linear variable optical filter

    OpenAIRE

    Emadi, A.; Grabarnik, S.; Wu, H; De Graaf, G.; Hedsten, K.; Enoksson, P.; Correia, J. H.; Wolffenbuttel, R.F.

    2010-01-01

    This paper reports on the functional and spectral characterization of a microspectrometer based on a CMOS detector array covered by an IC-Compatible Linear Variable Optical Filter (LVOF). The Fabry-Perot LVOF is composed of 15 dielectric layers with a tapered middle cavity layer, which has been fabricated in an IC-Compatible process using resist reflow. A pattern of trenches is made in a resist layer by lithography and followed by a reflow step result in a smooth tapered resist layer. The lit...

  13. Design of multichannel counting system for IBM PC and compatibles

    International Nuclear Information System (INIS)

    A Multichannel Counting System (MCCS), based on IBM-PC and compatible computer systems have been designed. The MCCS consists of a Multichannel Counting System plug-in interface card (MCCS-PC) for IBM PC and compatibles and a NIM-BIN module (MCCS-NB). The MCCS-PC provides simultaneous monitoring of upto seven independent SCA type inputs. An on board programmable timer provides elapsed time measurement. A menu-driven program for data acquisition and timer control has also been developed. (author) 8 figs

  14. Preparation of refractory cermet structures for lithium compatibility testing

    Science.gov (United States)

    Heestand, R. L.; Jones, R. A.; Wright, T. R.; Kizer, D. E.

    1973-01-01

    High-purity nitride and carbide cermets were synthesized for compatability testing in liquid lithium. A process was developed for the preparation of high-purity hafnium nitride powder, which was subsequently blended with tungsten powder or tantalum nitride and tungsten powders and fabricated into 3 in diameter billets by uniaxial hot pressing. Specimens were then cut from the billets for compatability testing. Similar processing techniques were applied to produce hafnium carbide and zirconium carbide cermets for use in the testing program. All billets produced were characterized with respect to chemistry, structure, density, and strength properties.

  15. Signal Groups of Compatible Graph in Traffic Control Problems

    Directory of Open Access Journals (Sweden)

    Arun Kumar Baruah

    2012-07-01

    Full Text Available Signal Groups of a compatibility graph is used to solve conflict between the traffic streams and hence can be used as a solution for traffic control problem at an intersection. In this paper we have considered cliques of the compatible graph as signal groups and the set of signal groups which can simultaneously move at an intersection is taken in a phase. Phasing of traffic lights is done by splitting the cycle time among these phases so that each set of signal group is allowed to move once in the cycle.

  16. Compatibility between Be12Ti and SS316LN

    International Nuclear Information System (INIS)

    Beryllides have good properties and are one of the candidate materials for the neutron multiplier of the DEMO reactor in which good performance is required at 600-800 deg. C. Therefore, a good compatibility with structural materials is expected for the beryllides. In this study, a compatibility test between Be12Ti and SS316LN was carried out as first step to evaluate the compatibility between beryllides and structural materials. The thickness of the reaction layer between Be12Ti and SS316LN at 800 deg. C after 1000 h was approximately 30 μm, whereas that of beryllium metal was 300 μm. At 600 deg. C after 1000 h, the thickness of the reaction layers as to Be12Ti and Be was less than 10 and 100 μm, respectively. The compatibility between Be12Ti and SS316LN was evaluated and Be12Ti was perfectly better than that between beryllium metal and SS316LN at high temperature (600-800 deg. C). The advantage of beryllides as a neutron multiplier in the Demo reactor was proved

  17. An open book decomposition compatible with rational contact surgery

    OpenAIRE

    Ozbagci, Burak

    2004-01-01

    We construct an open book decomposition compatible with a contact structure given by a rational contact surgery on a Legendrian link in the standard contact $S^3$. As an application we show that some rational contact surgeries on certain Legendrian knots induce overtwisted contact structures.

  18. Stiffness compatibility of coralline hydroxyapatite bone substitute under dynamic loading

    Institute of Scientific and Technical Information of China (English)

    REN ChaoFeng; HOU ZhenDe; ZHAO Wei

    2009-01-01

    When hydroxyapatite bone substitutes are implanted in human bodies, bone tissues will grow into their porous structure, which will reinforce their strength and stiffness. The concept of mechanical com-patibility of bone substitutes implies that their mechanical properties are similar to the bone tissues around, as if they were part of the bone. The mechanical compatibility of bone substitutes includes both static and dynamic behavior, due to the mechanical properties of bone depending on the strain rate. In this study, split Hopkinson pressure bar technique (SHPB) was employed to determine the dy-namic mechanical properties of coralline hydroxyapatite, bones with and bones without organic com-ponents, and their dynamic stress-strain curves of the three materials were obtained. The mechanical effects of collagens in bone were assessed, by comparing the difference between the Young's moduli of the three materials. As the implanted bone substitute becomes a part of bone, it can be regarded as an inclusion composite. The effective modulus of the composite was also evaluated in order to estimate its mechanical compatibility on stiffness. The evaluated result shows that the suitable porosity of HA is0.8, which is in favor of both static and dynamic stiffness compatibility.

  19. Stiffness compatibility of coralline hydroxyapatite bone substitute under dynamic loading

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    When hydroxyapatite bone substitutes are implanted in human bodies,bone tissues will grow into their porous structure,which will reinforce their strength and stiffness.The concept of mechanical com-patibility of bone substitutes implies that their mechanical properties are similar to the bone tissues around,as if they were part of the bone.The mechanical compatibility of bone substitutes includes both static and dynamic behavior,due to the mechanical properties of bone depending on the strain rate.In this study,split Hopkinson pressure bar technique(SHPB) was employed to determine the dy-namic mechanical properties of coralline hydroxyapatite,bones with and bones without organic com-ponents,and their dynamic stress-strain curves of the three materials were obtained.The mechanical effects of collagens in bone were assessed,by comparing the difference between the Young’s moduli of the three materials.As the implanted bone substitute becomes a part of bone,it can be regarded as an inclusion composite.The effective modulus of the composite was also evaluated in order to estimate its mechanical compatibility on stiffness.The evaluated result shows that the suitable porosity of HA is 0.8,which is in favor of both static and dynamic stiffness compatibility.

  20. Physicochemical compatibility of nebulizable drug admixtures containing colistimethate and tobramycin.

    Science.gov (United States)

    Wollstadt, A; Krämer, I; Kamin, W

    2013-09-01

    Inhalation therapy with nebulizable antibiotic drugs is a mainstay in treating Pseudomonas aeruginosa infections in cystic fibrosis patients. The combination of tobramycin and colistin was found to be superior to monotherapy in killing P. aeruginosa in biofilms. The simultaneous inhalation of tobramycin and colistin might be an option to increase the compliance of patients. The objective of this in-vitro study was to determine whether admixtures of inhalation solutions containing colistin methanesulfonate (CMS) and tobramycin are physicochemically compatible. Physical compatibility was determined by measuring pH and osmolality. Chemical compatibility was determined by testing the antibiotic activity of the mixtures by the pharmacopoeial microbiological assay and comparing the results to those of standard solutions. Samples were analyzed immediately after mixing and after 24 h. Values of pH and osmolality remained unchanged and in physiologically acceptable ranges. Neither for colistin methanesulfonate (CMS) nor for tobramycin losses of antibiotic potency were registered at any time. Admixtures of nebulizer solutions containing CMS and tobramycin were shown to be physicochemically compatible. Further investigations are needed to determine whether drug delivery is affected by mixing the nebulizer solutions to ensure that simultaneous inhalation is recommendable. PMID:24147342

  1. Leaders, Leadership and Democracy--Are They Compatible?

    Science.gov (United States)

    Schostak, John

    2016-01-01

    This article is taken from a talk given by John Schostak at the Co-Operative Head Office, Manchester on 25 September 2015. Question addressed in this paper include: (1) To what extent is leadership needed for a democratic life?; (2) What form of democratic organisation, if any, is compatible with leadership?; and (3) Is democracy undermined by…

  2. Developing Globally Compatible Institutional Infrastructures for Indian Higher Education

    Science.gov (United States)

    Chakrabarti, Raj; Bartning, Augustine; Sengupta, Shiladitya

    2010-01-01

    The authors profile developments in the globalization of Indian higher education, with an emphasis on emerging globally compatible institutional infrastructures. In recent decades, there has been an enormous amount of brain drain: the exodus of the brightest professionals and students to other countries. The article argues that the implementation…

  3. On a conjecture of compatibility of multi-states characters

    CERN Document Server

    Habib, Michel

    2011-01-01

    Perfect phylogeny consisting of determining the compatibility of a set of characters is known to be NP-complete. We propose in this article a conjecture on the necessary and sufficient conditions of compatibility: Given a set $\\mathcal{C}$ of $r$-states full characters, there exists a function $f(r)$ such that $\\mathcal{C}$ is compatible iff every set of $f(r)$ characters of $\\mathcal{C}$ is compatible. Some previous work showed that $f(2)=2$, $f(3)=3$ and $f(r) \\ge r-1$. Gusfield et al. 09 conjectured that $f(r) = r$ for any $r \\ge 2$. In this paper, we present an example showing that $f(4) \\ge 5$ and then a closure operation for chordal sandwich graphs. The later problem is a common approach of perfect phylogeny. This operation can be the first step to simplify the problem before solving some particular cases $f(4), f(5), ... $, and determining the function $f(r)$.

  4. Compatibility of Canadian Snowfall and Snow Cover Data

    Science.gov (United States)

    Goodison, B. E.

    1981-08-01

    The accuracy and compatibility of Canadian snowfall and snow survey data were investigated in the Cold Creek research basin in southern Ontario. Problems in obtaining compatible point measurements of snowfall precipitation from gauge and ruler measurements are discussed. However, it is shown that correction of gauge measurements (MSC Nipher, Universal, Fischer and Porter) of snowfall water equivalent for catch variations caused by environmental factors, notably wind speed, results in compatible storm or seasonal totals. Accurate statistics of basin snow cover were determined from snow courses specifically sited in relation to basin land use. At the time of peak accumulation, which might occur at any time during the winter, there was a statistically significant difference in snow cover between land use categories. Mean basin snow cover was calculated by weighting the snow survey measurements in proportion to basin land use. The need to consider the effect of changing land use on snow course measurements is demonstrated. Results show that as an alternative to direct snow survey measurements, accumulated precipitation may be used to estimate snow cover up to peak accumulation. Net snow cover determined from accumulated corrected gauge data less short-term melt losses and snow evaporation was within the confidence limits of the basin mean snow cover measured during the winter. Compatible results are only achieved when precipitation measurements are corrected for gauge catch variations and snow survey data are representative of basin land use.

  5. Design and calibration of a vacuum compatible scanning tunneling microscope

    Science.gov (United States)

    Abel, Phillip B.

    1990-01-01

    A vacuum compatible scanning tunneling microscope was designed and built, capable of imaging solid surfaces with atomic resolution. The single piezoelectric tube design is compact, and makes use of sample mounting stubs standard to a commercially available surface analysis system. Image collection and display is computer controlled, allowing storage of images for further analysis. Calibration results from atomic scale images are presented.

  6. Development and Implementation of Environmentally Compatible Solid Film Lubricants

    Science.gov (United States)

    Novak, Howard L.; Hall, Phillip B.

    1999-01-01

    Multi-body launch vehicles require the use of Solid Film Lubricants (SFLs) to allow for unrestricted relative motion between structural assemblies and components during lift-off and ascent into orbit. The Space Shuttle Solid Rocket Booster (SRB), uses a dual coat, ceramic-bonded high temperature SFL in several locations such as restraint hardware between the SRB aft skirt and the Mobile Launch Platform (MLP), the aft SRB/External Tank (ET) attach struts, and the forward skirt SRB/ET attach ball assembly. Future launch systems may require similar applications of SFLs for attachment and restraint hardware. A family of environmentally compatible non-lead/antimony bearing alternative SFLs have been developed including a compatible repair material. In addition, commercial applications for SFLs on transportation equipment, all types of lubricated fasteners, and energy related equipment allow for wide usage's of these new lubricants. The new SFLs trade named BOOSTERLUBE is a family of single layer thin film (0.001 inch maximum) coatings that are a unique mixture of non-hazardous pigments in a compatible resin system that allows for low temperature curing (450 F). Significant savings in energy and processing time as well as elimination of hazardous material usage and disposal would result from the non-toxic one-step SFL application. Compatible air-dry field repair lubricants will help eliminate disassembly of launch vehicle restraint hardware during critical time sensitive assembly operations.

  7. Compatibility of sodium with ceramic oxides employed in nuclear reactors

    International Nuclear Information System (INIS)

    This work is a review of experiments carried out up to the present time on the corrosion and compatibility of ceramic oxides with liquid sodium at temperatures corresponding to those in fast breeder reactors. The review also includes the results of a thermo-dynamic/liquid sodium reactions. The exercise has been conducted with a view to effecting experimental studies in the future. (Author)

  8. Water structure and blood compatibility of poly(tetrahydrofurfuryl acrylate).

    Science.gov (United States)

    Mochizuki, Akira; Hatakeyama, Tatsuko; Tomono, Yuka; Tanaka, Masaru

    2009-01-01

    We previously reported that poly(2-methoxyethyl acrylate) (PMEA), which has excellent blood compatibility, contains a large amount of freezing bound water. In order to confirm the role of freezing bound water in determining blood compatibility, poly(tetrahydrofurfuryl acrylate) (PTHFA) was newly synthesized and the thermal properties of water in PTHFA were investigated by differential scanning calorimetry (DSC), as freezing bound water was observed as cold crystallization in DSC heating curves. In addition, the blood compatibility of PTHFA, including activations of platelets, the coagulation system and the complement system, was investigated. The temperature of cold crystallization of water in PTHFA was higher than that of water in PMEA; moreover, the amount of freezing bound water in PTHFA was smaller than that in PMEA. The effect of freezing bound water on blood compatibility was investigated by comparing PTHFA, PMEA, poly(2-hydroxyethyl methacrylate) (PHEMA) and poly(2-methoxyethyl methacrylate) (PMEMA). The latter two samples showed no cold crystallization. Activations of platelets, the coagulation system and the complement system were enhanced in the following order: PMEA < PHEMA < PTHFA < PMEMA, PMEA < PMEMA < PTHFA < PHEMA and PMEA < PTHFA < PMEMA < PHEMA, respectively. The above results were reasonably explained by the amount and/or the stability of freezing bound water. PMID:19323878

  9. Coincidence and fixed points for compatible and relatively nonexpansive maps

    Directory of Open Access Journals (Sweden)

    Gerald Jungck

    1993-03-01

    Full Text Available The concept of relatively nonexpansive maps is introduced. Fixed point and coincidence results for families of four self maps of metric spaces are obtained. Non-continuous compatible and relatively nonexpansive maps on star-shaped compact subsets of normed linear spaces are highlighted, and two theorems of Dotson are generalized.

  10. Coincidence and fixed points for compatible and relatively nonexpansive maps

    OpenAIRE

    Gerald Jungck

    1993-01-01

    The concept of relatively nonexpansive maps is introduced. Fixed point and coincidence results for families of four self maps of metric spaces are obtained. Non-continuous compatible and relatively nonexpansive maps on star-shaped compact subsets of normed linear spaces are highlighted, and two theorems of Dotson are generalized.

  11. 36 CFR 1193.21 - Accessibility, usability, and compatibility.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false Accessibility, usability, and... BARRIERS COMPLIANCE BOARD TELECOMMUNICATIONS ACT ACCESSIBILITY GUIDELINES General Requirements § 1193.21 Accessibility, usability, and compatibility. Where readily achievable, telecommunications equipment and...

  12. Compatibility of fixed orthodontic appliances with MR environment

    Czech Academy of Sciences Publication Activity Database

    Starčuk jr., Zenon; Hubálková, H.; Starčuková, Jana; Linetskiy, I.; Bartušek, Karel; Krupa, P.

    Warsaw: ESMRMB, 2006. s. 342-343. ISBN 10334-006-0043-1. [ESMRMB 2006 - 23rd Annual Scientific Meeting of the European Society for Magnetic Resonance in Medicine and Biology. 21.09.2006-23.09.2006, Warsaw] R&D Projects: GA MZd NR8110 Keywords : orthodontic appliance * magnetic resonance * compatibility * dentistry * artifact Subject RIV: FS - Medical Facilities ; Equipment

  13. Compatibility of fixed orthodontic appliances with MR environment

    Czech Academy of Sciences Publication Activity Database

    Starčuk jr., Zenon; Hubálková, H.; Starčuková, Jana; Linetskiy, I.; Bartušek, Karel; Krupa, P.

    2006-01-01

    Roč. 19, Suppl. 1 (2006), EPOS 726:1-7. E-ISSN 1352-8661 R&D Projects: GA MZd NR8110 Institutional research plan: CEZ:AV0Z20650511 Keywords : orthodontic appliance * magnetic resonance * compatibility * dentistry * artifact Subject RIV: FS - Medical Facilities ; Equipment Impact factor: 0.756, year: 2005 http://posters.webges.com/esmrmb/epos

  14. Compatibility of Muria NPP Development Planning with Conservation Area

    International Nuclear Information System (INIS)

    Compatibility of NPP development planning at Ujung Lemahabang (ULA) site located at Balong Village, Kembang District, Jepara Regency have been assessed of its compatibility with conservation area that are written down at National Spatial Development Planning (RT/RW National), Province RT/RW and Regency RT/RW. In the context of NPP development planning, conservation area should be considered as one of significant aspect in accordance with the regional spatial planning. The objective of the assessment is to analyze the compatibility of NPP site with area conservation located at surrounding the site, and also to provide safety guarantee to conservation area from radiation hazard both in the construction and operation stage including postulated accident. Based on the concept, NPP development planning should be refers to spatial development planning that will assure of the conservation existence therefore it will be support countermeasure if there is any accident. The method of the research used were identification of all conservation area, zoning of each conservation area surrounding the site, furthermore analyzing compatibility of the site to the conservation area. The result of the research showed that Muria NPP site was suitable with area conservation surrounding the NPP Site. (author)

  15. Assessment of MR compatibility of selected dental alloys

    Czech Academy of Sciences Publication Activity Database

    Starčuk jr., Zenon; Hubálková, H.; Krupa, P.; Bartušek, Karel; Starčuková, Jana; Linetskiy, I.

    Berkeley: ISMRM, 2005, s. 2276. ISSN 1545-4436. [International Society for Magnetic Resonance in Medicine /13./. Miami Beach (US), 07.05.2005-13.05.2005] R&D Projects: GA MZd(CZ) NR8110 Keywords : dental alloys * magnetic resonance compatibility Subject RIV: FS - Medical Facilities ; Equipment

  16. Compatibility of Fixed Dental Appliances with Magnetic Resonance Imaging

    Czech Academy of Sciences Publication Activity Database

    Hubálková, H.; Starčuk jr., Zenon; Linetskiy, I.; Starčuková, Jana; Mazánek, J.

    London: European Prosthodontic Association, 2006. O41. [EPA 2006. Annual Conference of the European Prosthodontic Association /30./. 02.11.2006-04.11.2006, London] R&D Projects: GA MZd NR8110 Keywords : fixed dental appliance * MRI * MR compatibility * image artefacts * radiofrequency heating Subject RIV: FS - Medical Facilities ; Equipment

  17. Compatibility of heat resistant alloys with boron carbide, 5

    International Nuclear Information System (INIS)

    This paper includes an experimental result of out-of-pile compatibility and capsule design for irradiation test in Japan Materials Testing Reactor (JMTR). The compatibility between sheath material and neutron absorber materials for control rod devices (CRD) was examined for potential use in a very high temperature reactor (VHTR) which is under development at JAERI. The purpose of the compatibility tests are preliminary evaluation of safety prior to irradiation tests. Preliminary compatibility evaluation was concerned with three items as follows : 1) Lithium effects on the penetrating reaction of Incoloy 800H alloy in contact with a mixture of boronated graphite and lithium hydroxide powders, 2) Short term tensile properties of Incoloy 800H and Hastelloy XR alloy reacted with boronated graphite and fracture mode analysis, 3) Reaction behavior of both alloys under transient power conditions of a VHTR. It was clear that the reaction rate constant of the Incoloy 800H alloy was accelerated by doping lithium hydroxide into the boron carbide and graphite powder. The mechanical properties of Incoloy 800H and Hastelloy XR alloy reacted with boronated graphite were decreased. Ultimate tensile strength and tensile ductilities at temperatures over 850 deg C were reduced, but there was no change in the proof (yield) stress. Both alloys exhibited a brittle intergranular fracture mode during transient power conditions of a VHTR and also exhibited severe penetration. Irradiation capsules for compatibility test were designed to simulate three irradiation conditions of VHTR: 1) steady state for VHTR, 2) Transient power condition, 3) Service limited life of CRD. Capsule irradiation experiments have been carried out satisfactorily and thus confirm the validity of the capsule design procedure. (author)

  18. Compatibility of hyaluronic acid hydrogel and skeletal muscle myoblasts

    Energy Technology Data Exchange (ETDEWEB)

    Wang Wei; Zhang Li; Sun Liang; Wang Chengyue [Jinzhou Central Hospital, Jinzhou 121000 (China); Fan Ming; Liu Shuhong, E-mail: Weiwang_Ly@yahoo.com.c [Institute of Basic Medical Sciences, Academy of Military Medical Science, Beijing 100850 (China)

    2009-04-15

    Compatibility of hyaluronic acid hydrogel (HAH) and skeletal muscle myoblasts has been investigated for the first time in the present paper. Skeletal muscle myoblasts were separated from skeletons of rats and incubated with a HAH-containing culture medium. Cell morphology, hydrophilicity and cell adhesion of the HAH scaffold were investigated using optical microscopy, scanning electron microscopy, Hoechest33258 fluorescent staining, the immunocytochemistry method and water adsorption rate measurement. It was found that at a proper concentration (around 0.5%) of hyaluronic acid, the hydrogel possessed good compatibility with skeletal muscle myoblasts. The hydrogel can create a three-dimensional structure for the growth of skeletal muscle myoblasts and benefit cell attachment to provide a novel scaffold material for the tissue engineering of skeletal muscle.

  19. Compatibility of hyaluronic acid hydrogel and skeletal muscle myoblasts

    International Nuclear Information System (INIS)

    Compatibility of hyaluronic acid hydrogel (HAH) and skeletal muscle myoblasts has been investigated for the first time in the present paper. Skeletal muscle myoblasts were separated from skeletons of rats and incubated with a HAH-containing culture medium. Cell morphology, hydrophilicity and cell adhesion of the HAH scaffold were investigated using optical microscopy, scanning electron microscopy, Hoechest33258 fluorescent staining, the immunocytochemistry method and water adsorption rate measurement. It was found that at a proper concentration (around 0.5%) of hyaluronic acid, the hydrogel possessed good compatibility with skeletal muscle myoblasts. The hydrogel can create a three-dimensional structure for the growth of skeletal muscle myoblasts and benefit cell attachment to provide a novel scaffold material for the tissue engineering of skeletal muscle.

  20. Augmenting drug-carrier compatibility improves tumour nanotherapy efficacy

    Science.gov (United States)

    Zhao, Yiming; Fay, François; Hak, Sjoerd; Manuel Perez-Aguilar, Jose; Sanchez-Gaytan, Brenda L.; Goode, Brandon; Duivenvoorden, Raphaël; de Lange Davies, Catharina; Bjørkøy, Astrid; Weinstein, Harel; Fayad, Zahi A.; Pérez-Medina, Carlos; Mulder, Willem J. M.

    2016-04-01

    A major goal of cancer nanotherapy is to use nanoparticles as carriers for targeted delivery of anti-tumour agents. The drug-carrier association after intravenous administration is essential for efficient drug delivery to the tumour. However, a large number of currently available nanocarriers are self-assembled nanoparticles whose drug-loading stability is critically affected by the in vivo environment. Here we used in vivo FRET imaging to systematically investigate how drug-carrier compatibility affects drug release in a tumour mouse model. We found the drug's hydrophobicity and miscibility with the nanoparticles are two independent key parameters that determine its accumulation in the tumour. Next, we applied these findings to improve chemotherapeutic delivery by augmenting the parent drug's compatibility; as a result, we achieved better antitumour efficacy. Our results help elucidate nanomedicines' in vivo fate and provide guidelines for efficient drug delivery.

  1. COSIDERATIONS REGARDING THE COMPATIBILITY BETWEEN LEADERSHIP AND TEAMWORK SKILLS

    Directory of Open Access Journals (Sweden)

    Codruta Dana Duda Daianu

    2015-01-01

    Full Text Available The team leader is the author of vision, mentor, guide, motivator, source of encouragement and supportive team. The leader helps team members to focus on the big picture of the project, to give the best of them, to follow the right path and stay united. Leader qualities must necessarily include its ability to work together, to be folded on the processes that describe functional and structural developments in embedded team. The issue of the leader development includes the necessity to concurrently form the skills of tem working. The working paper underlines that these two formative desiderate are compatible, correlative and complementary. So, in the study that we undertake we proposed to determine the degree of compatibility between the two demands of education, as follows: the training of leader capable to exercise also the specific activities of teamwork

  2. On Rate-Compatible Punctured Turbo Codes Design

    Directory of Open Access Journals (Sweden)

    Montorsi Guido

    2005-01-01

    Full Text Available We propose and compare some design criteria for the search of good systematic rate-compatible punctured turbo code (RCPTC families. The considerations presented by S. Benedetto et al. (1998 to find the "best" component encoders for turbo code construction are extended to find good rate-compatible puncturing patterns for a given interleaver length . This approach is shown to lead to codes that improve over previous ones, both in the maximum-likelihood sense (using transfer function bounds and in the iterative decoding sense (through simulation results. To find simulation and analytical results, the coded bits are transmitted over an additive white Gaussian noise (AWGN channel using an antipodal binary modulation. The two main applications of this technique are its use in hybrid incremental ARQ/FEC schemes and its use to achieve unequal error protection of an information sequence.

  3. The Compatibility of Polycarboxylate-Type Superplasticizers with Cement

    Institute of Scientific and Technical Information of China (English)

    LI Chongzhi; WANG Dongmin; SONG Shaomin; CHEN Jialong

    2005-01-01

    Four polycarboxylate-type (PC) superplasticizers of different functional groups were used;their dispersing and retaining behaviors were analyzed through ZETA potential measurement, mini-slump test of cement paste and performance test of concrete. The experimental results show that the dispersing and flow-retaining ability of PC was determined by two factors of anionic groups and nonionic groups: the density of anionic groups - COO- or -SOf acted on the electronic repulsive force, and the length and proportion of nonionic graft groups of PEO in PC chemical structure affected the steric effect. The compatibility between PC superplasticizers and cement mainly depended on the type of PEO groups; furthermore, adding mineral powders is good to the compatibility for high performance concretes ( HPCs ).

  4. On Rate-Compatible Punctured Turbo Codes Design

    Science.gov (United States)

    Babich, Fulvio; Montorsi, Guido; Vatta, Francesca

    2005-12-01

    We propose and compare some design criteria for the search of good systematic rate-compatible punctured turbo code (RCPTC) families. The considerations presented by S. Benedetto et al. (1998) to find the "best" component encoders for turbo code construction are extended to find good rate-compatible puncturing patterns for a given interleaver length[InlineEquation not available: see fulltext.]. This approach is shown to lead to codes that improve over previous ones, both in the maximum-likelihood sense (using transfer function bounds) and in the iterative decoding sense (through simulation results). To find simulation and analytical results, the coded bits are transmitted over an additive white Gaussian noise (AWGN) channel using an antipodal binary modulation. The two main applications of this technique are its use in hybrid incremental ARQ/FEC schemes and its use to achieve unequal error protection of an information sequence.

  5. Compatibility of structural materials with liquid bismuth, lead, and mercury

    Energy Technology Data Exchange (ETDEWEB)

    Weeks, J.R. [Brookhaven National Lab., Upton, NY (United States)

    1996-06-01

    During the 1950s and 1960s, a substantial program existed at Brookhaven National Laboratory as part of the Liquid Metal Fuel reactor program on the compatibility of bismuth, lead, and their alloys with structural materials. Subsequently, compatibility investigations of mercury with structural materials were performed in support of development of Rankine cycle mercury turbines for nuclear applications. The present talk will review present understanding of the corrosion/mass-transfer reactions of structural materials with these liquid metal coolants. Topics to be discussed include the basic solubility relationships of iron, chromium, nickel, and refractory metals in these liquid metals, the results of inhibition studies, the role of oxygen on the corrosion processes, and specialized topics such as cavitation-corrosion and liquid metal embrittlement. Emphasis will be placed on utilizing the understanding gained in this earlier work on the development of heavy liquid metal targets in spallation neutron sources.

  6. Preparation of anionic polyurethane nanoparticles and blood compatible behaviors.

    Science.gov (United States)

    Zhu, Qinshu; Wang, Yan; Zhou, Min; Mao, Chun; Huang, Xiaohua; Bao, Jianchun; Shen, Jian

    2012-05-01

    The anionic polyurethane nanoparticles (APU-NPs) were obtained by an emulsion polymerization method. It was found that the average size of the prepared APU-NPs is about 84 nm, and the APU-NPs have zeta-potential of -38.9 mV. The bulk characterization of synthesized APU-NPs was investigated by FTIR. The blood compatibility of APU-NPs was characterized by in vitro for coagulation tests, complement activation, platelet activation, cytotoxicity experiments, and hemolysis assay. The results showed that the APU-NPs synthesized in this paper are blood compatible with low level of cell cytotoxicity, and the results were significant for their potential use in vivo. PMID:22852346

  7. Thermal compatibility studies of unirradiated uranium silicide dispersed in aluminum

    International Nuclear Information System (INIS)

    Powder metallurgy dispersions of uranium silicides in an aluminum matrix have been developed by the international Reduced Enrichment for Research and Test Reactors program as a new generation of proliferation-resistant fuels. A major issue of concern is the compatibility of the fuel with the matrix material and the dimensional stability of this fuel type. A total of 45 miniplate-type fuel plates were annealed at 4000C for up to 1981 hours. A data base for the thermal compatibility of unirradiated uranium silicide dispersed in aluminum was established. No modification tested of a standard fuel plate showed any significant reduction of the plate swelling. The cause of the thermal growth of silicide fuel plates was determined to be a two-step process: (1) the reaction of the uranium silicide with aluminum to form U(AlSi)3 and (2) the release of hydrogen and subsequent creep and pillowing of the fuel plate. 9 references, 4 figures, 6 tables

  8. Compatibility of refractory materials for nuclear reactor poison control systems

    Science.gov (United States)

    Sinclair, J. H.

    1974-01-01

    Metal-clad poison rods have been considered for the control system of an advanced space power reactor concept studied at the NASA Lewis Research Center. Such control rods may be required to operate at temperatures of about 140O C. Selected poison materials (including boron carbide and the diborides of zirconium, hafnium, and tantalum) were subjected to 1000-hour screening tests in contact with candidate refractory metal cladding materials (including tungsten and alloys of tantalum, niobium, and molybdenum) to assess the compatibility of these materials combinations at the temperatures of interest. Zirconium and hafnium diborides were compatible with refractory metals at 1400 C, but boron carbide and tantalum diboride reacted with the refractory metals at this temperature. Zirconium diboride also showed promise as a reaction barrier between boron carbide and tungsten.

  9. Compatibility and stability of valsartan in a solid pharmaceutical formulation

    Directory of Open Access Journals (Sweden)

    Tamíris Amanda Júlio

    2013-12-01

    Full Text Available Valsartan (VAL is a highly selective blocker of the angiotensin II receptor that has been widely used in the treatment of hypertension. Active pharmaceutical ingredient compatibility with excipients (crospovidone, hypromellose, magnesium stearate, microcrystalline cellulose and titanium dioxide is usually evaluated in solid pharmaceutical development. Compatibility and stability can be evaluated by liquid chromatography. Studies were performed using binary mixtures of 1:1 (w/w VAL/excipient; samples were stored under accelerated stability test conditions (40 ºC at 75% relative humidity. The results indicate that VAL is incompatible with crospovidone and hypromellose, which reduced the VAL content and gave rise to new peaks in the chromatogram due to degradation products.

  10. Study of IC Compatible On-Chip Thermoelectric Coolers

    Science.gov (United States)

    Kong, Seong-Ho; Wijngaards, Davey D. L.; Wolffenbuttel, Reinoud F.

    2005-07-01

    A thin-film-based thermoelectric micro-cooler has been studied and realized using the standard integrated circuit (IC) fabrication technology and bulk micromachining technology in sequence. The whole fabrication process is kept IC compatible by postponing potassium hydroxide (KOH) etching step to the last part of the fabrication sequence. Considering the fabrication compatibility, polycrystalline silicon germanium (polySiGe) is chosen as thermoelectric material even though bismuth telluride (Bi2Te3) is one of the most effective thermoelectric materials. The influence of non-idealities on device performance, such as Joule heating due to contact resistance and parasitic heat loss through supporting membrane, is analyzed. The characterized thermoelectric, thermal and electric properties of the fabricated polySiGe thermoelectric material correspond well to those from literatures. Measured cooling performance demonstrates that an on-chip micro-cooler can be applied for thermal stabilization near ambient temperature.

  11. Electromagnetic Compatibility Testing of Implantable Neurostimulators Exposed to Metal Detectors

    OpenAIRE

    Seidman, Seth J; Kainz, Wolfgang; Casamento, Jon; Witters, Donald

    2010-01-01

    This paper presents results of electromagnetic compatibility (EMC) testing of three implantable neurostimulators exposed to the magnetic fields emitted from several walk-through and hand-held metal detectors. The motivation behind this testing comes from numerous adverse event reports involving active implantable medical devices (AIMDs) and security systems that have been received by the Food and Drug Administration (FDA). EMC testing was performed using three neurostimulators exposed to the ...

  12. Preparation and Blood Compatibility of Oxidized-chitosan Films

    Institute of Scientific and Technical Information of China (English)

    Yue Dong YANG; Jiu Gao YU; Yong Guo ZHOU; Pei Guo LI

    2005-01-01

    Chitosan membrane was modified by the selective oxidization of chitosan molecules on its surface with NO2 gas. FTIR spectra indicated there were plenty of-COOH and -COO- groups on the modified membrane surface. The SEM study showed the modified membrane surface was rough rather than smooth as chitosan membrane. All antithrombosis test, hemolysis test and blood cell morphology observation with SEM revealed that modified chitosan membranes have superior blood compatibility to chitosan.

  13. MRI dynamic range and its compatibility with signal transmission media

    OpenAIRE

    Gabr, Refaat E.; Schär, Michael; Edelstein, Arthur D.; Kraitchman, Dara L.; Bottomley, Paul A.; Edelstein, William A.

    2009-01-01

    As the number of MRI phased array coil elements grows, interactions among cables connecting them to the system receiver become increasingly problematic. Fiber optic or wireless links would reduce electromagnetic interference, but their dynamic range (DR) is generally less than that of coaxial cables. Raw MRI signals, however, have a large DR because of the high signal amplitude near the center of k-space. Here, we study DR in MRI in order to determine the compatibility of MRI multicoil imagin...

  14. LabVIEW Interactive Simulations for Electromagnetic Compatibility

    OpenAIRE

    Eduard Lunca; Silviu Ursache; Alexandru Salceanu

    2012-01-01

    At university level, virtual instrumentation techniques are extensively used for both education and research in various fields of electrical engineering (EE). In this paper, we illustrate the possibility of using a virtual instrumentation approach focused on LabVIEW to create interactive simulations for Electromagnetic Compatibility (EMC). Firstly, the main reasons for adopting the LabVIEW graphical programming to develop such tools are given. Then, a number of specific modules are presented.

  15. Fundamental approach for the concept of concrete repair compatibility

    OpenAIRE

    Courard, Luc; Bissonnette, Benoît; Garbacz, Andrzej

    2015-01-01

    Before being translated in terms of physical, mechanical and chemical of materials, the initial step for evaluating compatibility is interface creation. The thermodynamic properties of the materials as well as transport mechanisms – diffusion, capillary succion – at the interface and roughness of the concrete substrate are acting from the beginning and influencing the durability of the bond strength. A review of the main parameters influencing bond development is presented on the base of the ...

  16. Interaction and compatibility studies of efavirenz with pharmaceutical excipients

    OpenAIRE

    Cinira Fandaruff; Andrea Mariela Araya-Sibaja; Rafael Nicolay Pereira; Silvia Lucia Cuffini; Carlos Eduardo Maduro de Campos; Cristiane Rodrigues Drago Hoffmeistere; Helvécio Vinícius Antunes Rochae; Marco Antônio Segatto Silvaa

    2014-01-01

    Although excipients have traditionally been thought of as being inert, experience has shown that there can be interactions between excipients and drugs. Thus, knowledge of potential physical and chemical interactions can be very useful. The compatibility of efavirenz with the excipients: sodium lauryl sulfate, spray dried lactose, hydroxypropylcellulose, magnesium stearate, microcrystalline cellulose and croscarmellose sodium was studied. X-ray powder diffraction (XRPD), Fourier Transform ...

  17. Undergraduate nursing students' compatibility with the nursing profession

    OpenAIRE

    Dianati Mansur; Adib-Hajbaghery Mohsen

    2005-01-01

    Abstract Background The high rate of attrition among nursing students has caused some nursing leaders to think about the necessity of considering students' personality during the process of admission into nursing schools. Due to the lack of studies on Iranian nursing students' personality traits, this study was designed to assess freshmen nursing students' personality characteristics and their compatibility with the demands of the nursing profession. Methods A descriptive study was conducted ...

  18. A compatibility study of FEFO with various containment materials

    Energy Technology Data Exchange (ETDEWEB)

    Shepodd, T.J.; Goods, S.H. [Sandia National Labs., Livermore, CA (United States); Foster, P. [Mason and Hanger-Silas Mason Co., Inc., Amarillo, TX (United States)

    1994-01-01

    Compatibility between FEFO (bis-(2-fluoro-2,2-dinitroethyl) formal) and a number of organic and metallic materials was evaluated at 22 and 74 C for up to 8 months. The metals included common structural alloys and elemental metals that the extrudable explosive might contact in its service life. The organic materials included flexible materials for use as collapsible extrusion membranes or permeation barriers, rigid engineering resins (matrices for composite vessels), and polymer viscosity modifiers.

  19. Three levels of the electromagnetic compatibility (emc) in automotive engineering

    OpenAIRE

    Sperling, D.; Körber, B.; Müller, N.

    2004-01-01

    An important quality factor for vehicles is the compliance of the Electromagnetic Compatibility (EMC). This compliance is given both through legal requirements and by voluntary defaults of the automotive manufacturers and suppliers. In this paper, some selected EMC measuring methods will be presented, whereas two of these were recently developed at the EMC research laboratory at the University of Applied Sciences Zwickau in close cooperation with Volkswagen and Audi.

  20. Compatible solutes of organisms that live in hot saline environments

    OpenAIRE

    Santos, Helena; Costa, Milton S. da

    2002-01-01

    The accumulation of organic solutes is a prerequisite for osmotic adjustment of all microorganisms. Thermophilic and hyperthermophilic organisms generally accumulate very unusual compatible solutes namely, di-myo-inositol-phosphate, di-mannosyl-di-myo-­inositol-phosphate, di-glycerol-phosphate, mannosylglycerate and mannosylglyceramide, which have not been identified in bacteria or archaea that grow at low and moderate temperatures. There is also a growing awareness that some of these compati...

  1. Conservation-Compatible Practices and Programs: Who Participates?

    OpenAIRE

    Lambert, Dayton M.; Sullivan, Patrick; Claassen, Roger; Foreman, Linda F.

    2006-01-01

    In recent years, the Federal Government has increased its emphasis on conservation programs that reward good stewardship on working farmland. This report examines the business, operator, and household characteristics of farms that have adopted certain conservation-compatible practices, with and without financial assistance from government conservation programs. The analysis finds that characteristics of the farm operator and household, in addition to the characteristics of the farm business, ...

  2. Compatibility Issues of IPSec and TCP in Wireless Networks

    Institute of Scientific and Technical Information of China (English)

    ZHAO Hai-yang; XIN Yang

    2004-01-01

    Due to the problems arising when the Transmission Control Protocol (TCP) is applied over wireless networks, many TCP performance enhancement mechanisms have been proposed. However, such mechanisms aren't compatible with IPSec protocol. The paper reviews the TCP performance enhancement mechanisms in wireless networks. Then the conflicts between them are analyzed. Several proposals for solving theconflicts are discussed, and their benefit and limitations are examined.

  3. Compatible Value Gradients for Reinforcement Learning of Continuous Deep Policies

    OpenAIRE

    Balduzzi, David; Ghifary, Muhammad

    2015-01-01

    This paper proposes GProp, a deep reinforcement learning algorithm for continuous policies with compatible function approximation. The algorithm is based on two innovations. Firstly, we present a temporal-difference based method for learning the gradient of the value-function. Secondly, we present the deviator-actor-critic (DAC) model, which comprises three neural networks that estimate the value function, its gradient, and determine the actor's policy respectively. We evaluate GProp on two c...

  4. 125I-labelled cobalamin derivative compatible with intrinsic factor

    International Nuclear Information System (INIS)

    A 125I-labelled derivative of cobalamin (vitamin B12) is described which is compatible with intrinsic factor in binding assays. The derivative, [125I]cyanocobalamin-d-iodohistamide, can be readily prepared with a specific activity of 1400 Ci/g. Used as a substitute for [57Co]cyanocobalamin in binding assays, the new derivative can reduce counting times and decrease costs in such assays. (Auth.)

  5. Compatibility of plasma sprayed tungsten based materials with graphite substrates

    Czech Academy of Sciences Publication Activity Database

    Brožek, Vlastimil; Ctibor, Pavel; Boldyryeva, Hanna; Cheong, D.-I.; Yang, S.-H.

    Bratislava: STU Bratislava, 2009 - (Koman, M.; Mikloš, D.), s. 18-19. (Joint Seminar). ISBN 978-80-89088-81-2. [Joint Seminar – Development of materials science in research and education/19th./. Závažná Poruba (SK), 31.08.2009] Institutional research plan: CEZ:AV0Z20430508 Keywords : Tungsten, zirconium carbide * plasma spraying * carbide interlayers * compatibility Subject RIV: BL - Plasma and Gas Discharge Physics

  6. On Optimizing Compatible Security Policies in Wireless Networks

    Directory of Open Access Journals (Sweden)

    Makki Kia

    2006-01-01

    Full Text Available This paper deals with finding the maximum number of security policies without conflicts. By doing so we can remove security loophole that causes security violation. We present the problem of maximum compatible security policy and its relationship to the problem of maximum acyclic subgraph, which is proved to be NP-hard. Then we present a polynomial-time approximation algorithm and show that our result has approximation ratio for any integer with complexity .

  7. Miniaturised Spotter-Compatible Multicapillary Stamping Tool for Microarray Printing

    CERN Document Server

    Drobyshev, A L; Zasedatelev, A S; Drobyshev, Alexei L; Verkhodanov, Nikolai N; Zasedatelev, Alexander S

    2007-01-01

    Novel microstamping tool for microarray printing is proposed. The tool is capable to spot up to 127 droplets of different solutions in single touch. It is easily compatible with commercially available microarray spotters. The tool is based on multichannel funnel with polypropylene capillaries inserted into its channels. Superior flexibility is achieved by ability to replace any printing capillary of the tool. As a practical implementation, hydrogel-based microarrays were stamped and successfully applied to identify the Mycobacterium tuberculosis drug resistance.

  8. Partnership Models for Climate Compatible Development: Experiences from Zambia

    OpenAIRE

    Dyer, Jen; Leventon, Julia; Stringer, Lindsay; Dougill, Andrew; Syampungani, Stephen; Nshimbi, Muleba; Chama, Francis; Kafwifwi, Ackson

    2013-01-01

    Partnership working is necessary to allow nations to harness the evolving opportunities presented by climate finance and to progress towards climate compatible development (CCD). However, the new multi-stakeholder partnerships being formed and the factors affecting their outcomes remain poorly understood. This paper aims to identify the characteristics of partnership models that can lead to successful delivery of CCD projects by analyzing case study data from two projects in Zambia. The proje...

  9. What Java Developers Know About Compatibility, And Why This Matters

    OpenAIRE

    Dietrich, Jens; Jezek, Kamil; Brada, Premek

    2014-01-01

    Real-world programs are neither monolithic nor static -- they are constructed using platform and third party libraries, and both programs and libraries continuously evolve in response to change pressure. In case of the Java language, rules defined in the Java Language and Java Virtual Machine Specifications define when library evolution is safe. These rules distinguish between three types of compatibility - binary, source and behavioural. We claim that some of these rules are counter intuitiv...

  10. Compatibility Studies on Elastomers and Polymers with Ethanol Blended Gasoline

    OpenAIRE

    J. S. Dhaliwal; M. S. Negi; G. S. Kapur; Kant, Shashi

    2014-01-01

    This paper reports the compatibility studies of 10% ethanol blended gasoline (E10) with four types of elastomer materials, namely, Neoprene rubber, Nitrile rubber, hydrogenated Nitrile butadiene rubber (HNBR), and Polyvinyl chloride/Nitrile butadiene rubber blend (PVC/NBR), and two types of plastic materials, namely, Nylon-66 and Polyoxymethylene (Delrin). These materials have applications in automotives as engine seals, gaskets, fuel system seals and hoses, and so forth. Two types of the eth...

  11. Still seeking for an explanation of the Sequential Compatibility Effect

    Directory of Open Access Journals (Sweden)

    Jesús Privado

    2015-05-01

    Full Text Available The modulation of the Compatibility Effect (CE according to the compatibility of the previous trial (Sequential Compatibility Effect, SCE in three types of attentional tasks is explored. The flankers and spatial Stroop tasks have different degrees of cognitive complexity. In all three tasks it is analyzed whether the SCE varies when the stimuli in consecutive trials are exactly the same (pure replicas or not. The data, collected from three independent samples (total N = 1.159, show the CE in the three tasks. However, SCE only shows up in the spatial Stroop task. The effect is smaller albeit still significant when the pure replica trials are removed, a result inconsistent with those of Mayr et al. (2003 and Hommel (1998 but consistent with the Conflict Theory (Botvinick et al., 2001. Furthermore, we also discuss the importance of cognitive complexity in relation to the perspective of Botvinick et al. (2004. From this point of view more complexity should be reflected in a greater presence of cognitive conflict, and therefore a higher SCE.

  12. Synthesis of artificial spectrum-compatible seismic accelerograms

    International Nuclear Information System (INIS)

    The Hilbert–Huang transform is used to generate artificial seismic signals compatible with the acceleration spectra of natural seismic records. Artificial spectrum-compatible accelerograms are utilized instead of natural earthquake records for the dynamic response analysis of many critical structures such as hospitals, bridges, and power plants. The realistic estimation of the seismic response of structures involves nonlinear dynamic analysis. Moreover, it requires seismic accelerograms representative of the actual ground acceleration time histories expected at the site of interest. Unfortunately, not many actual records of different seismic intensities are available for many regions. In addition, a large number of seismic accelerograms are required to perform a series of nonlinear dynamic analyses for a reliable statistical investigation of the structural behavior under earthquake excitation. These are the main motivations for generating artificial spectrum-compatible seismic accelerograms and could be useful in earthquake engineering for dynamic analysis and design of buildings. According to the proposed method, a single natural earthquake record is deconstructed into amplitude and frequency components using the Hilbert–Huang transform. The proposed method is illustrated by studying 20 natural seismic records with different characteristics such as different frequency content, amplitude, and duration. Experimental results reveal the efficiency of the proposed method in comparison with well-established and industrial methods in the literature. (paper)

  13. Eco-Anthropic Compatibility - a Multidisciplinary Model in Urban Ecology

    Directory of Open Access Journals (Sweden)

    MARIANO L. BIANCA

    2010-01-01

    Full Text Available In this paper I propose a multidisciplinary model of urban development which goes beyond the notion of ecological sustainability, by building on the concept of eco-anthropic compatibility. First of all I will sketch the historical development of human aggregations and I will underline the difference between ancient and modern aggregations. On the basis of this analysis, I will take into consideration the notion of sustainability and its possible application to present conurbations. I will underline several limits of the notion of sustainable development and I will propose a multidisciplinary model grounded on a broader and new notion: the eco-anthropic compatibility. Using this notion, which includes the idea of sustainability, it is possible to handle, within the model, the human factors and human living conditions inside an urban aggregation. Finally, I will state that the actual urban model is decaying and therefore, sooner or later, we will have to face the end of urban civilization; for this reason we can start imagining new future ways for human aggregations on the planet based on the notion of eco-anthropic compatibility.

  14. Materials compatibility and corrosion issues for accelerator transmutation of waste

    International Nuclear Information System (INIS)

    The need to understand the materials issues in an accelerator transmutation of waste (ATW) system is essential. This report focuses on the spallation container material, as this material is exposed to some of the most crucial environmental conditions of simultaneous radiation and corrosion in the system. The most severe design being considered is that of liquid lead. In previous investigations of lead compatibility with materials, the chemistry of the system was derived solely from the corrosion products; however, in an ATW system, the chemistry of the lead changes not only with the derived corrosion products of the material being tested but also with the buildup of the daughter production with time. Daughter production builds up and introduces elements that may have a great effect on the corrosion activity of the liquid lead. Consequently, data on liquid lead compatibility can be regarded only as a guide and must be reevaluated when particular daughter products are added. This report is intended to be a response to specific materials issues and concerns expressed by the ATW design working group and addresses the compatibility/corrosion concerns

  15. 78 FR 30385 - Approval of Noise Compatibility Program for Tweed-New Haven Regional Airport

    Science.gov (United States)

    2013-05-22

    ... Federal Aviation Administration Approval of Noise Compatibility Program for Tweed-New Haven Regional... Administration (FAA) announces its findings on the noise compatibility program submitted by the Tweed-New Haven... FAA's approval of the Tweed-New Haven Regional Airport noise compatibility program is May 9, 2013....

  16. 47 CFR 68.415 - Hearing aid-compatibility and volume control informal complaints.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 3 2010-10-01 2010-10-01 false Hearing aid-compatibility and volume control... Procedures § 68.415 Hearing aid-compatibility and volume control informal complaints. Persons with complaints... complaints regarding rules in this part pertaining to hearing aid compatibility and volume control, may...

  17. Central Cross-Talk in Task Switching : Evidence from Manipulating Input-Output Modality Compatibility

    Science.gov (United States)

    Stephan, Denise Nadine; Koch, Iring

    2010-01-01

    Two experiments examined the role of compatibility of input and output (I-O) modality mappings in task switching. We define I-O modality compatibility in terms of similarity of stimulus modality and modality of response-related sensory consequences. Experiment 1 included switching between 2 compatible tasks (auditory-vocal vs. visual-manual) and…

  18. Compatibility with European law of opt-out legislation

    International Nuclear Information System (INIS)

    Should consensus with the utilities not be reached, Federal Minister for the Environment, Mr. Trittin, repeatedly announced to introduce opt-out legislation 'by dissent'. Both the constitutionality of such legislation and its compatibility with European law are topics of controversial debate in the literature. The decision taken by the Bavarian cabinet on February 8 in this year, to use all political and legal means against shutting down German nuclear power plants and, for this purpose, even to approach the European Commission on grounds of potential violation of European law, are reason enough to deal in more detail with the compatibility of an opt-out law with the Euratom Treaty and the EC Treaty. As the opt-out law does not yet exist, these considerations can only be of a theoretical nature. However, this is the working hypothesis assumed: Reprocessing is banned as of the entry into force of the opt-out law. This ban includes moving nuclear waste abroad for reprocessing. The peaceful use of nuclear power for electricity generation in power reactors operated for thirty years is forbidden. Older reactors may be run only for a transition period of another three years. (This includes abandoning the promotion purpose in the German Atomic Energy Act and a ban on building new power reactors). However, the operating life may be distributed in a flexible way. This contribution indicates that there are sound reasons and interesting approaches, respectively, in the literature for assuming that opting out by means of legislation, coupled with a ban on reprocessing, at least constitutes a violation of the freedom for goods and/or services. However, this cannot be derived unequivocally from either the Euratom Treaty or the EC Treaty or from rulings by the European Court of Justice. Ultimately, compatibility with European law of the ban on reprocessing can be decided only by the European Court of Justice. (orig.)

  19. Compatibility of AlN ceramics with molten lithium

    International Nuclear Information System (INIS)

    AlN ceramics were a candidate for electrically insulating materials and facing materials against molten breeder in a nuclear fusion reactor. In the nuclear fusion reactor, interactions of various structural materials with solid and liquid breeder materials as well as coolant materials are important. Therefore, corrosion tests of AlN ceramics with molten lithium were performed. AlN specimens of six kinds, different in sintering additives and manufacturing method, were used. AlN specimens were immersed into molten lithium at 823 K. Duration for the compatibility tests was about 2.8 Ms (32 days). Specimens with sintering additive of Y2O3 by about 5 mass% formed the network structure of oxide in the crystals of AlN. It was considered that the corrosion proceeded by reduction of the oxide network and the penetration of molten lithium through the reduced pass of this network. For specimens without sintering additive, Al2O3 containing by about 1.3% in raw material was converted to fine oxynitride particles on grain boundary or dissolved in AlN crystals. After immersion into lithium, these specimens were found to be sound in shape but reduced in electrical resistivity. These degradation of the two types specimens were considered to be caused by the reduction of oxygen components. On the other hand, a specimen sintered using CaO as sintering additive was finally became appreciably high purity. This specimen showed good compatibility for molten lithium at least up to 823 K. It was concluded that the reduction of oxygen concentration in AlN materials was essential in order to improve the compatibility for molten lithium. (author)

  20. Theories of Space and Time Compatible with the Inertia Principle

    CERN Document Server

    Caccese, E; Pace, A R

    1999-01-01

    A general formal definition of a theory of space and time compatible with the inertia principle is given. The formal definition of reference frame and inertial equivalence between reference frames are used to construct the class of inertial frames. Then, suitable cocycle relations among the coefficients of space-time transformations between inertial frames are established. The kinematical meaning of coefficients and their reciprocity properties are discussed in some detail. Finally, a rest frame map family is introduced as the most general constitutive assumption to obtain the coefficients and to define a theory of space and time. Four meaningful examples are then presented.

  1. A SPICE compatible model of permanent magnet DC motor drives

    OpenAIRE

    Chan, CC; Chau, KT

    1995-01-01

    A SPICE compatible model for the computer simulation of permanent magnet (PM) DC motor drives is presented. The key of the proposed model is to take into account the armature reaction and magnet demagnetization, hence the shift of operating point at load conditions can be considered. Making use of this model, the PSpice simulation of a typical PM DC motor drive is performed. Apart from the steady-state simulation, transient behaviours of the PM DC motor drive, including start-up, sudden load ...

  2. Thermogravimetric study of chemical compatibility of graphite with metal oxides

    International Nuclear Information System (INIS)

    Graphite and graphite mixtures with metal oxides are studied in conditions of nonisothermal heating to 1000 deg C using the methods of thermodynamic and gravimetric analyses. Chemical compatibility of graphite with Al2O3, CaO, SiO2, MgO, Fe2O3, TiO2, Na2O, K2O in the compositions considered is established. A decrease in the sample mass observed on the gravimetric curves in the presence of admixtures does not exceed the same value in pure graphite samples in specified conditions

  3. Chemical compatibility of structural materials in alkali metals

    International Nuclear Information System (INIS)

    The objectives of this task are to (a) evaluate the chemical compatibility of structural alloys such as V-5 wt.%Cr-5 wt.%Ti alloy and Type 316 stainless steel for application in liquid alkali metals such as lithium and sodium-78 wt.% potassium (NaK) at temperatures in the range that are of interest for International Thermonuclear Experimental Reactor (ITER); (b) evaluate the transfer of nonmetallic elements such as oxygen, nitrogen, carbon, and hydrogen between structural materials and liquid metals; and (c) evaluate the effects of such transfers on the mechanical and microstructural characteristics of the materials for long-term service in liquid-metal-environments

  4. Technical Basis for Electromagnetic Compatibility Regulatory Guidance Update

    Energy Technology Data Exchange (ETDEWEB)

    Ewing, Paul D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Korsah, Kofi [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Harrison, Thomas J. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Wood, Richard Thomas [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Mays, Gary T. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2016-03-01

    The objective of this report is to serve as the technical basis document for the next, planned revision of this RG that highlights and provides the rationale for the recommended changes. The structure of this document follows and summarizes the several assessment activities undertaken during the course of this project to evaluate new and updated electromagnetic compatibility (EMC) standards, testing methods and limits, and relevant technology developments being incorporated into plant activities that may have EMI/RFI implications, as well as other specific issues, including impacts of electrostatic discharge (ESD) on safety equipment and impacts on increased usage of wireless devices in nuclear power plants.

  5. Chemical compatibility of structural materials in alkali metals

    Energy Technology Data Exchange (ETDEWEB)

    Natesan, K.; Rink, D.L.; Haglund, R. [Argonne National Lab., Chicago, IL (United States)] [and others

    1995-04-01

    The objectives of this task are to (a) evaluate the chemical compatibility of structural alloys such as V-5 wt.%Cr-5 wt.%Ti alloy and Type 316 stainless steel for application in liquid alkali metals such as lithium and sodium-78 wt.% potassium (NaK) at temperatures in the range that are of interest for International Thermonuclear Experimental Reactor (ITER); (b) evaluate the transfer of nonmetallic elements such as oxygen, nitrogen, carbon, and hydrogen between structural materials and liquid metals; and (c) evaluate the effects of such transfers on the mechanical and microstructural characteristics of the materials for long-term service in liquid-metal-environments.

  6. Qualification of indigenously developed sodium compatible ultrasonic transducers for PFBR

    International Nuclear Information System (INIS)

    PFBR core is immersed in a pool of optically opaque liquid sodium at high temperature. Ultrasonic technique is utilized to view the components immersed in sodium. An under sodium ultrasonic scanner (USUSS) with indigenously developed sodium compatible transducers are used to scan the core plenum before every fuel handling operation, when the temperature of sodium is around 180℃. There are two different types of transducers, one for the measurement of bowing and the other is used for the protrusion measurement of any fuel sub assembly (FSA). (author)

  7. Liquid oxygen-compatible filament-winding matrix resin

    Science.gov (United States)

    Harrison, E. S.

    1973-01-01

    Polyurethanes derived from hydroxy terminated polyperfluoro propylene oxide prepolymers were evaluated as matrix resins for filament wound composites which would be exposed to liquid (and 100% gaseous) oxygen environments. A number of structural modifications were brought about by variations in prepolymer molecular weight, and alternative curing agents which allowed retention of the oxygen compatibility. Although satisfactory performance was achieved at sub-ambient temperatures, the derived composites suffered considerable property loss at ambient or slightly elevated temperatures. To attain overall effectiveness of the composite system, upgrading of the polymer thermomechanical properties must first be achieved.

  8. Compatibility and reactivity between chemical compounds and water

    International Nuclear Information System (INIS)

    Chemical product reactivity with water is often underestimated as water is incorrectly considered as an inert compound. The Fuels Experimental Station (SSC) compiled a complete research, funded by CNR National Group for Protection from Chemical Industry and Ecological Risks, about the reactivity and compatibility of several compounds with water. This article is an excerpt of the final report. Consulting databases, scientific literature, chemical industrial catalogues and material safety data sheets, more than 300 potential reactive substances have been identified. A thermodynamical evaluation has been carried out using suitable software for about half of the detected compounds (the ones for which heat of formation has been found or calculated).

  9. On Optimizing Compatible Security Policies in Wireless Networks

    Directory of Open Access Journals (Sweden)

    2006-01-01

    Full Text Available This paper deals with finding the maximum number of security policies without conflicts. By doing so we can remove security loophole that causes security violation. We present the problem of maximum compatible security policy and its relationship to the problem of maximum acyclic subgraph, which is proved to be NP-hard. Then we present a polynomial-time approximation algorithm and show that our result has approximation ratio 1+1 /k for any integer k with complexity O( N k+1 .

  10. CMOS-compatible plenoptic detector for LED lighting applications.

    Science.gov (United States)

    Neumann, Alexander; Ghasemi, Javad; Nezhadbadeh, Shima; Nie, Xiangyu; Zarkesh-Ha, Payman; Brueck, S R J

    2015-09-01

    LED lighting systems with large color gamuts, with multiple LEDs spanning the visible spectrum, offer the potential of increased lighting efficiency, improved human health and productivity, and visible light communications addressing the explosive growth in wireless communications. The control of this "smart lighting system" requires a silicon-integrated-circuit-compatible, visible, plenoptic (angle and wavelength) detector. A detector element, based on an offset-grating-coupled dielectric waveguide structure and a silicon photodetector, is demonstrated with an angular resolution of less than 1° and a wavelength resolution of less than 5 nm. PMID:26368423

  11. Design and validation of a MR-compatible pneumatic manipulandum.

    Science.gov (United States)

    Suminski, Aaron J; Zimbelman, Janice L; Scheidt, Robert A

    2007-07-30

    The combination of functional MR imaging and novel robotic tools may provide unique opportunities to probe the neural systems underlying motor control and learning. Here, we describe the design and validation of a MR-compatible, 1 degree-of-freedom pneumatic manipulandum along with experiments demonstrating its safety and efficacy. We first validated the robot's ability to apply computer-controlled loads about the wrist, demonstrating that it possesses sufficient bandwidth to simulate torsional spring-like loads during point-to-point flexion movements. Next, we verified the MR-compatibility of the device by imaging a head phantom during robot operation. We observed no systematic differences in two measures of MRI signal quality (signal/noise and field homogeneity) when the robot was introduced into the scanner environment. Likewise, measurements of joint angle and actuator pressure were not adversely affected by scanning. Finally, we verified device efficacy by scanning 20 healthy human subjects performing rapid wrist flexions against a wide range of spring-like loads. We observed a linear relationship between joint torque at peak movement extent and perturbation magnitude, thus demonstrating the robot's ability to simulate spring-like loads in situ. fMRI revealed task-related activation in regions known to contribute to the control of movement including the left primary sensorimotor cortex and right cerebellum. PMID:17498811

  12. A Highest Order Hypothesis Compatibility Test for Monocular SLAM

    Directory of Open Access Journals (Sweden)

    Edmundo Guerra

    2013-08-01

    Full Text Available Simultaneous Location and Mapping (SLAM is a key problem to solve in order to build truly autonomous mobile robots. SLAM with a unique camera, or monocular SLAM, is probably one of the most complex SLAM variants, based entirely on a bearing-only sensor working over six DOF. The monocular SLAM method developed in this work is based on the Delayed Inverse-Depth (DI-D Feature Initialization, with the contribution of a new data association batch validation technique, the Highest Order Hypothesis Compatibility Test, HOHCT. The Delayed Inverse-Depth technique is used to initialize new features in the system and defines a single hypothesis for the initial depth of features with the use of a stochastic technique of triangulation. The introduced HOHCT method is based on the evaluation of statistically compatible hypotheses and a search algorithm designed to exploit the strengths of the Delayed Inverse- Depth technique to achieve good performance results. This work presents the HOHCT with a detailed formulation of the monocular DI-D SLAM problem. The performance of the proposed HOHCT is validated with experimental results, in both indoor and outdoor environments, while its costs are compared with other popular approaches.

  13. Altruism and reward: motivational compatibility in deceased organ donation.

    Science.gov (United States)

    Voo, Teck Chuan

    2015-03-01

    Acts of helping others are often based on mixed motivations. Based on this claim, it has been argued that the use of a financial reward to incentivize organ donation is compatible with promoting altruism in organ donation. In its report Human Bodies: Donation for Medicine and Research, the Nuffield Council on Bioethics uses this argument to justify its suggestion to pilot a funeral payment scheme to incentivize people to register for deceased organ donation in the UK. In this article, I cast a sceptical eye on the above Nuffield report's argument that its proposed funeral payment scheme would prompt deceased organ donations that remain altruistic (as defined by and valued the report). Specifically, I illustrate how this scheme may prompt various forms of mixed motivations which would not satisfy the report's definition of altruism. Insofar as the scheme produces an expectation of the reward, it stands diametrical to promoting an 'altruistic perspective'. My minimal goal in this article is to argue that altruism is not motivationally compatible with reward as an incentive for donation. My broader goal is to argue that if a financial reward is used to incentivize organ donation, then we should recognize that the donation system is no longer aiming to promote altruism. Rewarded donation would not be altruistic but it may be ethical given a persistent organ shortage situation. PMID:24547770

  14. Compatibility of polymers and chemical oxidants for enhanced groundwater remediation.

    Science.gov (United States)

    Smith, Megan M; Silva, Jeff A K; Munakata-Marr, Junko; McCray, John E

    2008-12-15

    Polymer floods provide a promising method to more effectively deliver conventional groundwater treatment agents to organic contaminants distributed within heterogeneous aquifer systems. Combinations of nontoxic polymers (xanthan and hydrolyzed polyacrylamide) and common chemical oxidants (potassium permanganate and sodium persulfate) were investigated to determine the suitability of these mixtures for polymer-enhanced in situ chemical oxidation applications. Oxidant demand and solution viscosity were utilized as initial measures of chemical compatibility. After 72 h of reaction with both test oxidants, solution viscosities in mixtures containing hydrolyzed polyacrylamide were decreased by more than 90% (final viscosities approximately 2 cP), similar to the 95% viscosity loss (final viscosities approximately 1 cP, near that of water) observed in xanthan/persulfate experiments. In contrast, xanthan solutions exposed to potassium permanganate preserved 60-95% of initial viscosity after 72 h. Permanganate depletion in xanthan-containing experiments ranged from 2% to 24% over the same test period. Although oxidant consumption in xanthan/permanganate solutions appeared to be correlated with increasing xanthan concentrations, solutions of up to 2000 mg/L xanthan did not inhibit permanganate from oxidizing a dissolved-phase test contaminant (tetrachloroethene, PCE) in xanthan solution. These advantageous characteristics (high viscosity retention, moderate oxidant demand, and lack of competitive effects on PCE oxidation rate) render xanthan/permanganate the most compatible polymer/oxidant combination of those tested for remediation by polymer-enhanced chemical oxidation. PMID:19174907

  15. Material Compatibility of Medical Sterilizer Using Oxygen Plasma

    Science.gov (United States)

    Tanaka, Hiroshi; Ono, Reoto; Hayashi, Nobuya; Hanada, Yasushi; Noda, Minoru; Goto, Masaaki

    2015-09-01

    Material compatibility of oxygen plasma sterilizer is investigated comparing with hydrogen peroxide (H2O2) sterilizers and a gaseous H2O2 sterilizer. Organic materials such as ABS, PE, PP, and PET are used as sample materials, and are irradiated by active oxygen species produced in oxygen plasma. After plasma irradiation, surface of the sample materials is observed using a scanning electron microscope and FTIR spectroscopy. Strengths of the organic materials are evaluated by the tension test. Also, H2O2 plasma sterilizer and a gaseous H2O2 sterilizer those are commercially available are utilized to compare the material compatibility, especially organic compounds. The ABS resin becomes slightly soft after irradiation by both plasmas and gaseous H2O2. Also, PET material becomes soften by each sterilization treatment. Decrease of peak heights of CH around 1200 and 1730 cm-1 and increase of that of OH at 3300 cm-1 in FTIR spectra indicates the oxidation of ABS resin by both plasma and gaseous H2O2. In the case of PET material, treatment by the plasma has not modified chemical composition but changed the crystal structure. The gaseous H2O2 is completely friendly for the PET material.

  16. Why a Gunk World is Compatible with Nihilism about Objects

    Directory of Open Access Journals (Sweden)

    Baptiste Le Bihan

    2015-07-01

    Full Text Available Ted Sider argues that nihilism about objects is incompatible with the metaphysical possibility of gunk and takes this point to show that nihilism is flawed. I shall describe one kind of nihilism able to answer this objection. I believe that most of the things we usually encounter do not exist. That is, I take talk of macroscopic objects and macroscopic properties to refer to sets of fundamental properties, which are invoked as a matter of linguistic convention. This view is a kind of nihilism: it rules out the existence of objects; that is, from an ontological point of view, there are no objects. But unlike the moderate nihilism of Mark Heller, Peter van Inwagen and Trenton Merricks that claims that most objects do not exist, I endorse a radical nihilism according to which there are no objects in the world, but only properties instantiated in spacetime. As I will show, radical nihilism is perfectly compatible with the metaphysical possibility of gunk. It is also compatible with the epistemic possibility that we actually live in a gunk world. The objection raised by Ted Sider only applies to moderate nihilism that admits some objects in its ontology.

  17. An Evaluation of Blood Compatibility of Silver Nanoparticles.

    Science.gov (United States)

    Huang, He; Lai, Wenjia; Cui, Menghua; Liang, Ling; Lin, Yuchen; Fang, Qiaojun; Liu, Ying; Xie, Liming

    2016-01-01

    Silver nanoparticles (AgNPs) have tremendous potentials in medical devices due to their excellent antimicrobial properties. Blood compatibility should be investigated for AgNPs due to the potential blood contact. However, so far, most studies are not systematic and have not provided insights into the mechanisms for blood compatibility of AgNPs. In this study, we have investigated the blood biological effects, including hemolysis, lymphocyte proliferation, platelet aggregation, coagulation and complement activation, of 20 nm AgNPs with two different surface coatings (polyvinyl pyrrolidone and citrate). Our results have revealed AgNPs could elicit hemolysis and severely impact the proliferation and viability of lymphocytes at all investigated concentrations (10, 20, 40 μg/mL). Nevertheless, AgNPs didn't show any effect on platelet aggregation, coagulation process, or complement activation at up to ~40 μg/mL. Proteomic analysis on AgNPs plasma proteins corona has revealed that acidic and small molecular weight blood plasma proteins were preferentially adsorbed onto AgNPs, and these include some important proteins relevant to hemostasis, coagulation, platelet, complement activation and immune responses. The predicted biological effects of AgNPs by proteomic analysis are mostly consistent with our experimental data since there were few C3 components on AgNPs and more negative than positive factors involving platelet aggregation and thrombosis. PMID:27145858

  18. Aluminum nitride on titanium for CMOS compatible piezoelectric transducers

    International Nuclear Information System (INIS)

    Piezoelectric materials are widely used for microscale sensors and actuators but can pose material compatibility challenges. This paper reports a post-CMOS compatible fabrication process for piezoelectric sensors and actuators on silicon using only standard CMOS metals. The piezoelectric properties of aluminum nitride (AlN) deposited on titanium (Ti) by reactive sputtering are characterized and microcantilever actuators are demonstrated. The film texture of the polycrystalline Ti and AlN films is improved by removing the native oxide from the silicon substrate in situ and sequentially depositing the films under vacuum to provide a uniform growth surface. The piezoelectric properties for several AlN film thicknesses are measured using laser doppler vibrometry on unpatterned wafers and released cantilever beams. The film structure and properties are shown to vary with thickness, with values of d33f, d31 and d33 of up to 2.9, −1.9 and 6.5 pm V−1, respectively. These values are comparable with AlN deposited on a Pt metal electrode, but with the benefit of a fabrication process that uses only standard CMOS metals.

  19. Mating compatibility between Bactrocera invadens and Bactrocera dorsalis (Diptera: Tephritidae).

    Science.gov (United States)

    Bo, W; Ahmad, S; Dammalage, T; Tomas, U Sto; Wornoayporn, V; Ul Haq, I; Cáceres, C; Vreysen, M J B; Schutze, M K

    2014-04-01

    The invasive fruit fly, Bactrocera invadens Drew, Tsuruta & White, is a highly polyphagous fruit pest that occurs predominantly in Africa yet has its origins in the Indian subcontinent. It is extremely morphologically and genetically similar to the Oriental fruit fly, Bactrocera dorsalis (Hendel); as such the specific relationship between these two species is unresolved. We assessed prezygotic compatibility between B. dorsalis and B. invadens using standardized field cage mating tests, which have proven effectiveness in tephritid cryptic species studies. These tests were followed by an assessment of postzygotic compatibility by examining egg viability, larval and pupal survival, and sex ratios of offspring produced from parental and subsequent F1 crosses to examine for hybrid breakdown as predicted under a two-species hypothesis. B. dorsalis was sourced from two countries (Pakistan and China), and each population was compared with B. invadens from its type locality of Kenya. B. invadens mated randomly with B. dorsalis from both localities, and there were generally high levels of hybrid viability and survival resulting from parental and F1 crosses. Furthermore, all but one hybrid cross resulted in equal sex ratios, with the single deviation in favor of males and contrary to expectations under Haldane's rule. These data support the hypothesis that B. dorsalis and B. invadens represent the same biological species, an outcome that poses significant implications for pest management and international trade for sub-Saharan Africa. PMID:24772542

  20. High power compatible internally sensed optical phased array.

    Science.gov (United States)

    Roberts, Lyle E; Ward, Robert L; Francis, Samuel P; Sibley, Paul G; Fleddermann, Roland; Sutton, Andrew J; Smith, Craig; McClelland, David E; Shaddock, Daniel A

    2016-06-13

    The technical embodiment of the Huygens-Fresnel principle, an optical phased array (OPA) is an arrangement of optical emitters with relative phases controlled to create a desired beam profile after propagation. One important application of an OPA is coherent beam combining (CBC), which can be used to create beams of higher power than is possible with a single laser source, especially for narrow linewidth sources. Here we present an all-fiber architecture that stabilizes the relative output phase by inferring the relative path length differences between lasers using the small fraction of light that is back-reflected into the fiber at the OPA's glass-air interface, without the need for any external sampling optics. This architecture is compatible with high power continuous wave laser sources (e.g., fiber amplifiers) up to 100 W per channel. The high-power compatible internally sensed OPA was implemented experimentally using commercial 15 W fiber amplifiers, demonstrating an output RMS phase stability of λ/194, and the ability to steer the beam at up to 10 kHz. PMID:27410363

  1. FUNGIBLE AND COMPATIBLE BIOFUELS: LITERATURE SEARCH, SUMMARY, AND RECOMMENDATIONS

    Energy Technology Data Exchange (ETDEWEB)

    Bunting, Bruce G [ORNL; Bunce, Michael [ORNL; Barone, Teresa L [ORNL; Storey, John Morse [ORNL

    2011-04-01

    The purpose of the study described in this report is to summarize the various barriers to more widespread distribution of bio-fuels through our common carrier fuel distribution system, which includes pipelines, barges and rail, fuel tankage, and distribution terminals. Addressing these barriers is necessary to allow the more widespread utilization and distribution of bio-fuels, in support of a renewable fuels standard and possible future low-carbon fuel standards. These barriers can be classified into several categories, including operating practice, regulatory, technical, and acceptability barriers. Possible solutions to these issues are discussed; including compatibility evaluation, changes to bio-fuels, regulatory changes, and changes in the distribution system or distribution practices. No actual experimental research has been conducted in the writing of this report, but results are used to develop recommendations for future research and additional study as appropriate. This project addresses recognized barriers to the wider use of bio-fuels in the areas of development of codes and standards, industrial and consumer awareness, and materials compatibility issues.

  2. An MRI-compatible hand sensory vibrotactile system

    International Nuclear Information System (INIS)

    Recently, the application of vibrotactile noise to the wrist or back of the hand has been shown to enhance fingertip tactile sensory perception (Enders et al 2013), supporting the potential for an assistive device worn at the wrist, that generates minute vibrations to help the elderly or patients with sensory deficit. However, knowledge regarding the detailed physiological mechanism behind this sensory improvement in the central nervous system, especially in the human brain, is limited, hindering progress in development and use of such assistive devices. To enable investigation of the impact of vibrotactile noise on sensorimotor brain activity in humans, a magnetic resonance imaging (MRI)-compatible vibrotactile system was developed to provide vibrotactile noise during an MRI of the brain. The vibrotactile system utilizes a remote (outside the MR room) signal amplifier which provides a voltage from –40 to +40 V to drive a 12 mm diameter piezoelectric vibrator (inside the MR room). It is portable and is found to be MRI-compatible which enables its use for neurologic investigation with MRI. The system was also found to induce an improvement in fingertip tactile sensation, consistent with the previous study. (note)

  3. Pathogenicity and diversity of vegetative compatibility of Fusarium verticillioides

    Directory of Open Access Journals (Sweden)

    Krnjaja Vesna S.

    2007-01-01

    Full Text Available Pathogenicity of 10 Fusarium verticillioides isolates, originated from grain of wheat (five isolates and maize (five isolates, were studied under greenhouse conditions. Based on different parameters of the pathogenicity estimate (a scale for % of nonemerged plants, % of survived plants, plant vigour - the growth and dry weight of roots and epicotyls and disease severity it was determined that all F. verticillioides isolates expressed a different degree of pathogenicity. According to % of nonemerged plants six three and one F. verticillioides isolates expressed low, moderate and high degree of pathogenicity, respectively. All F. verticillioides isolates reduced the plant survival rate and vigour, while the disease severity ranged from 2.0 to 3.54. Two types of nit mutants, nit1 and NitM, were obtained by the use of the method of vegetative compatibility. The frequency of nit1 mutants was greater (58.79% than the frequency of NitM mutants (5.77%. A total of 10 vegetative compatibility groups (VCGs of F. verticillioides were established in the complementation tests. These results point out to a high genetic diversity of F. verticillioides population.

  4. Compatability of dispersion-strengthened platinum with resistojet propellants

    Science.gov (United States)

    Whalen, Margaret V.; Nathal, Michael V.

    1987-01-01

    Resistojets for the Space Station require long life and multipropellant capability. The choice of available materials to meet these requirements is limited. Dispersion-strengthened platinum was selected. Past results indicated that it should be suffieiently inert in candidate propellant environments and should be capable of operating at moderate temperatures for extended periods. A series of propellant compatibility tests was done with platinum strengthened with either yttria or zirconia. Data presented included the results of 1000-hr tests in CO2, H2, ammonia (NH3), N2, steam, hydrazine (N2H4), and methane (CH4); and 2000-hr tests in H2 and NH3. The platinum samples were tested at 1400 C in CO2, H2, NH3, N2, steam, and N2H4; at 500 C in CH4; and at 800 C in N2H4. The mass-loss results indicated material life, exptrapolated from experimental mass-loss data, in excess of 100 000 hr in all environments except steam and N2H4, where it was greater than or =45000 hr. Generally, on the basis of mass loss, there were no compatibility concerns in any of the environments considered. Optical and scanning electron microscopy were used to determine the effect of propellants on the material surface and to evaluate material stability.

  5. Compatibility experiments of facilities, materials, and propellants for electrothermal thrusters

    Science.gov (United States)

    Whalen, M. V.; Grisnik, S. P.; Sovey, J. S.

    1985-01-01

    Experiments were performed to determine the compatibility of materials and propellants for electro-thermal thrusters. Candidate propellants for resistojet propulsion include carbon dioxide, methane, hydrogen, ammonia, and hydrazine. The materials being examined are grain stabilized platinum for resistojets for space station and rhenium for high performance resistojets for satellites. Heater mass loss and deterioration of materials were evaluated. A coiled tube of platinum, with yttria dispersed throughout the base material to inhibit grain growth, was tested in carbon dioxide at 1300 C for 2000 hr. Post-test examination indicated the platinum-yttria heater would last over 100,000 hr with less than 10 percent mass loss. Short-term compatibility tests were conducted to test the integrity of the platinum-yttria in hydrogen, methane, carbon dioxide/methane mixtures and ammonia environments. In each of these 100 hr tests, the platinum-yttria mass change indicated a minimum coil life of 100,000 hr. Facility related effects were investigated in materials tests using rhenium heated to high temperatures. Vacuum facility water reduction was monitored using a mass spectrometer. In vacuum environments obtained using only diffusion pumping and those obtained with the assistance of cryogenic equipment there were mass gains in the rhenium heaters. These mass gains were the result of the high amount of oxygen and water contained in the gas. Propellant purity and preferred test facility environments are discussed.

  6. Development of hazard-compatible building fragility and vulnerability models

    Science.gov (United States)

    Karaca, E.; Luco, N.

    2008-01-01

    We present a methodology for transforming the structural and non-structural fragility functions in HAZUS into a format that is compatible with conventional seismic hazard analysis information. The methodology makes use of the building capacity (or pushover) curves and related building parameters provided in HAZUS. Instead of the capacity spectrum method applied in HAZUS, building response is estimated by inelastic response history analysis of corresponding single-degree-of-freedom systems under a large number of earthquake records. Statistics of the building response are used with the damage state definitions from HAZUS to derive fragility models conditioned on spectral acceleration values. Using the developed fragility models for structural and nonstructural building components, with corresponding damage state loss ratios from HAZUS, we also derive building vulnerability models relating spectral acceleration to repair costs. Whereas in HAZUS the structural and nonstructural damage states are treated as if they are independent, our vulnerability models are derived assuming "complete" nonstructural damage whenever the structural damage state is complete. We show the effects of considering this dependence on the final vulnerability models. The use of spectral acceleration (at selected vibration periods) as the ground motion intensity parameter, coupled with the careful treatment of uncertainty, makes the new fragility and vulnerability models compatible with conventional seismic hazard curves and hence useful for extensions to probabilistic damage and loss assessment.

  7. Highly efficient and compatible shampoo for use after hair transplant

    Directory of Open Access Journals (Sweden)

    Schweiger D

    2015-07-01

    Full Text Available Dorothea Schweiger,1 Andrea M Schoelermann,1 Alexander Filbry,1 Tina Hamann,1 Claudia Moser,2 Frank Rippke1 1Research and Development, Beiersdorf AG, Hamburg, Germany; 2Moser Medical, Clinics for Aesthetic Plastic Surgery, Vienna, Austria Background: Sensitive or hyperreactive skin is a common condition defined by prickling, burning, pain, and pruritus. Although this skin problem was initially described on the face, the scalp is often affected. A sensitive scalp can react with irritation to harsh surfactants or other additives which are often present in shampoos. For this reason, we developed a new rinse-off hypertolerant shampoo specifically designed for the hypersensitive and problematic scalp.Methods: The shampoo formulation is based on an extremely mild surfactant system and contains bisabolol, an anti-irritant and anti-inflammatory ingredient of chamomile. The shampoo is free of additives such as perfumes, silicones, colorants, parabens, paraffins, and betaine. Since skin can remain in a hyperreactive state after wounding, the status after hair transplantation was chosen as a model system to test the shampoo. Scalp condition and compatibility of each volunteer were analyzed by a plastic surgeon directly after hair transplant and after stitch removal. The plastic surgeons also rated whether they would recommend the further use of the test shampoo. Additionally, volunteers completed a self-assessment questionnaire.Results: Following hair transplantation, regular use of the shampoo resulted in a significant reduction in the extent of scabbing and erythema. This was confirmed by dermatological scalp examinations performed by the plastic surgeon as well as in volunteers' self-assessments. The plastic surgeon highly recommended the further use of the test shampoo after hair transplant to all study participants.Conclusion: Application of the test shampoo demonstrated excellent skin compatibility and product efficacy after hair transplant. The test

  8. Genetic differentiation among sexually compatible relatives of Brassica napus L.

    Directory of Open Access Journals (Sweden)

    Pipan Barbara

    2013-01-01

    Full Text Available Analysis of gene flow between Brassica napus L. and its sexually compatible relatives that could be found in the wild in Slovenia was performed by microsatellite analysis using fifteen selected primer pairs. Genotypes included in the study were obtained from the field survey of sexually compatible relatives of B. napus in natural habitats around Slovenia and from reference collections. Two different wild species of all the presented sexually compatible relatives of B. napus were found in Slovenia, B. rapa and Sinapis arvensis. The reference genotypes included varieties and wild forms from internal collections as marketable seeds or from gene banks. Reference genotypes were represented by the following species and subspecies: B. napus ssp. napobrassica, B. napus ssp. napus, B. nigra, B. oleracea, B. rapa ssp. oleifera, Diplotaxis muralis; D. tenuifolia, Raphanus raphanistrum, R. sativus, R. sativus var. oleiformis, Rapistrum rugosum, S. alba and S. arvensis. Estimation of gene flow described by average number of migrants was 0.72 followed by 0.20 migrants. Due to the observed gene migrations, genetic drift and selection, Hardy-Weinberg equilibrium was not met. The mean number of alleles over all loci was 16.9, the average polymorphic information content was 0.43. We found four highly divergent and polymorphic loci (Na12-C08, Na10-A08, Ni3-G04b and BRMS-050 at statistically significant level (p<0.05 of gene flow detected. Over all gene diversity intra-individual among populations (0.55 was lower than inter-individual among population (0.77. The results of genetic linkages based standard genetic distance and unweighted pair group method with arithmetic mean clustering method, generally divided the genotypes in three divergent groups. Similar results were obtained by principal coordinate analysis where three main groups were constructed according to three factors. A real number of genetic clusters demonstrated a clear separation between populations

  9. IVVS actuating system compatibility test to ITER gamma radiation conditions

    Energy Technology Data Exchange (ETDEWEB)

    Rossi, Paolo, E-mail: paolo.rossi@enea.it [Associazione EURATOM-ENEA sulla Fusione, 45 Via Enrico Fermi, 00044 Frascati, Rome (Italy); Collibus, M. Ferri de; Florean, M.; Monti, C.; Mugnaini, G.; Neri, C.; Pillon, M.; Pollastrone, F. [Associazione EURATOM-ENEA sulla Fusione, 45 Via Enrico Fermi, 00044 Frascati, Rome (Italy); Baccaro, S.; Piegari, A. [ENEA CR Casaccia, 301 Via Anguillarese, 00123 Santa Maria di Galeria, Rome (Italy); Damiani, C.; Dubus, G. [Fusion For Energy c/Josep Pla, n° 2 Torres Diagonal Litoral, 08019 Barcelona (Spain)

    2013-10-15

    Highlights: • ENEA developed and tested a prototype of a laser In Vessel Viewing and ranging System (IVVS) for ITER. • One piezo-motor prototype has been tested on the ENEA Calliope gamma irradiation facility to verify its compatibility to ITER gamma radiation conditions. • After a total dose of more than 4 MGy the piezo-motor maintained almost the same working parameters monitored before test without any evident and significant degradation of functionality. • After the full gamma irradiation test, the same piezo-motor assembly will be tested with 14 MeV neutrons irradiation using ENEA FNG facility. -- Abstract: The In Vessel Viewing System (IVVS) is a fundamental remote handling equipment, which will be used to make a survey of the status of the blanket first wall and divertor plasma facing components. A design and testing activity is ongoing, in the framework of a Fusion for Energy (F4E) grant agreement, to make the IVVS probe design compatible with ITER operating conditions and in particular, but not only, with attention to neutrons and gammas fluxes and both space constraints and interfaces. The paper describes the testing activity performed on the customized piezoelectric motors and the main components of the actuating system of the IVVS probe with reference to ITER gamma radiation conditions. In particular the test is performed on the piezoelectric motor, optical encoder and small scale optical samples .The test is carried out on the ENEA Calliope gamma irradiation facility at ITER relevant gamma fields at rate of about 2.5 kGy/h and doses of 4 MGy. The paper reports in detail the setup arrangement of the test campaign in order to verify significant working capability of the IVVS actuating components and the results are shown in terms of functional performances and parameters. The overall test campaign on IVVS actuating system will be completed on other ENEA testing facilities in order to verify compatibility to Magnetic field, neutrons and thermal

  10. RHETT2/EPDM Hall Thruster Propulsion System Electromagnetic Compatibility Evaluation

    Science.gov (United States)

    Sarmiento, Charles J.; Sankovic, John M.; Freitas, Joseph; Lynn, Peter R.

    1997-01-01

    Electromagnetic compatibility measurements were obtained as part of the Electric Propulsion Demonstration Module (EPDM) flight qualification program. Tests were conducted on a Hall thruster system operating at a nominal 66O W discharge power. Measurements of conducted and radiated susceptibility and emissions were obtained and referenced to MEL-STD-461 C. The power processor showed some conducted susceptibility below 4 kHz for the magnet current and discharge voltage. Radiated susceptibility testing yielded a null result. Conducted emissions showed slight violations of the specified limit for MIL-461C CE03. Radiated emissions exceeded the RE02 standard at low frequencies, below 300 MHz, by up to 40 dB RV/m/MHz.

  11. RSX system development under VAX/VMS compatibility mode

    International Nuclear Information System (INIS)

    The Control System for the Proton Storage Ring now being built at Los Alamos will use a VAX-11/750 as its main control computer with several LSI-11/23 microprocessors reading and controlling the hardware. The VMS Compatibility Mode makes it possible to use the VAX as a development system for the LSI-11/23 microprocessors running the RSX-11S (stand-alone) operating system. Digital Equipment Corporation (DEC)-supplied software is used to generate the RSX-11S operating system and DECNET-11S network software. We use the VMS editors to create source files, the Macro-11 assembler and the PDP-11 Fortran-77 compiler to generate object code, and the RSX Task Builder to link the executable RSX task image. The RSX task then can be tested to some extent on the VAX before it is down-line loaded to the LSI-11/23 for further testing

  12. Precision mirror mounting system for UHV compatible synchrotron radiation beamlines

    International Nuclear Information System (INIS)

    A ultra high vacuum compatible system for precision adjustment of the orientation and location of a mirror with respect to incident synchrotron radiation beam has been designed. This will be used for the upcoming photoelectron spectroscopy beamline to be installed on Indus-1. Our ray tracing calculations indicate that positioning of mirror with respect to synchrotron radiation beam direction and other beam line optical components is very critical for good resolution and photon flux. This requires the mirror to have various motions with a precision control over these motions of the order of millidegree for angular and five micron for linear motions. Based on these calculations, design of mirror mount system having various kinematic motions in ultra high vacuum has been worked out and incorporated in the mechanical design of the system. (author). 7 refs., 4 figs

  13. Is wave-particle objectivity compatible with determinism and locality?

    Science.gov (United States)

    Ionicioiu, Radu; Jennewein, Thomas; Mann, Robert B; Terno, Daniel R

    2014-01-01

    Wave-particle duality, superposition and entanglement are among the most counterintuitive features of quantum theory. Their clash with our classical expectations motivated hidden-variable (HV) theories. With the emergence of quantum technologies, we can test experimentally the predictions of quantum theory versus HV theories and put strong restrictions on their key assumptions. Here, we study an entanglement-assisted version of the quantum delayed-choice experiment and show that the extension of HV to the controlling devices only exacerbates the contradiction. We compare HV theories that satisfy the conditions of objectivity (a property of photons being either particles or waves, but not both), determinism and local independence of hidden variables with quantum mechanics. Any two of the above conditions are compatible with it. The conflict becomes manifest when all three conditions are imposed and persists for any non-zero value of entanglement. We propose an experiment to test our conclusions. PMID:25256419

  14. Fabric compatibility and cleaning effectiveness of drycleaning with carbon dioxide

    Energy Technology Data Exchange (ETDEWEB)

    Williams, S.B.; Laintz, K.E.; Spall, W.D.; bustos, L.; Taylor, C.

    1996-04-01

    Liquid carbon dioxide (CO{sub 2}) offers an environmentally sound replacement solvent to the currently used drycleaning solvent, perchloroethylene (PERC). In addition to the health and safety benefits of a CO{sub 2} based cleaning system, large savings in solvent costs provide an incentive for conversion to the new system. Lower operating costs for the new technology provide further incentive. Experimental studies were conducted using CO{sub 2} in both small scale and pilot scale test systems in order to address fabric compatibility with this alternative cleaning method. Results from these tests show that fabric shrinkage using CO{sub 2} is controlled to the same level as current drycleaning methods. In addition, tests to evaluate the cleaning performance of liquid CO{sub 2} drycleaning were also conducted. These results show the prototype liquid CO{sub 2} cleaning system to be better than PERC at soil removal, and worse than PERC at inorganic salt removal.

  15. Neutron irradiation and compatibility testing of Li2O

    International Nuclear Information System (INIS)

    A study was made of the neutron-irradiation behavior of 6Li-enriched Li2O material in EBR-II. In addition, a stress-corrosion study was performed ex-reactor to test compatibility of Li2O materials with a variety of stainless steels. Results of the irradiation testing showed that tritium and helium retention in the Li2O (approx. 89% dense) lessened with neutron exposure. Helium and tritium retention appear to approach steady-state after approx. 1% 6Li burnup. The stress-corrosion studies, using 316 stainless steel (Ti-modified) and a 35% Ni alloy, showed that stress does not enhance the corrosion, and that dry Li2O is not significantly corrosive, the LiOH content producing the corrosive effects. Corrosion, in general, was not severe as a passivation in sealed capsules seemed to occur after a time, greatly reducing corrosion rates

  16. Designing Cell-Compatible Hydrogels for Biomedical Applications

    Science.gov (United States)

    Seliktar, Dror

    2012-06-01

    Hydrogels are polymeric materials distinguished by high water content and diverse physical properties. They can be engineered to resemble the extracellular environment of the body’s tissues in ways that enable their use in medical implants, biosensors, and drug-delivery devices. Cell-compatible hydrogels are designed by using a strategy of coordinated control over physical properties and bioactivity to influence specific interactions with cellular systems, including spatial and temporal patterns of biochemical and biomechanical cues known to modulate cell behavior. Important new discoveries in stem cell research, cancer biology, and cellular morphogenesis have been realized with model hydrogel systems premised on these designs. Basic and clinical applications for hydrogels in cell therapy, tissue engineering, and biomedical research continue to drive design improvements using performance-based materials engineering paradigms.

  17. Electromagnetic compatibility. Transmission ways; Comptabilite electromagnetique. Modes de transmission

    Energy Technology Data Exchange (ETDEWEB)

    Champiot, G.G. [Electricite de France (EDF), 75 - Paris (France)

    2000-02-01

    This paper presents the different ways of coupling between a source of electromagnetic disturbance and its 'victim' taking into account the damping introduced by the different links between them. A particular emphasis is given to the electrical ground which represents a common connection between all electrical and/or electronic devices. Some recommendations concerning the grounding of different parts (electrical equipments, structures, frames, potential references, cable shields, power supplies) are given at the end of this paper: 1 - different types of electromagnetic disturbance signals; 2 - classification and analysis of the different types of coupling: common impedance, capacitive or electrical induction, inductive, and radiation coupling; 3 - difficulties encountered when solving electromagnetic compatibility problems: identification, non-ideal components, localization of fields, interaction between disturbance reduction techniques and grounds, problems of disturbance immunity and emission; 4 - grounds. (J.S.)

  18. Multi-damping earthquake design spectra-compatible motion histories

    International Nuclear Information System (INIS)

    Two iterative methods of developing time histories compatible with multi-damping spectra are presented. The common method of forcing agreement among design and calculated spectral values at several frequencies and multiple damping values may give poor, even meaningless results. The two simple iterative techniques presented here use acceleration impulse functions for 'correcting' the time histories. In the first method the correction is calculated separately for each frequency and damping value and the maximum corresponding coefficient is used to correct the time history for the iteration. In the second method the solution is further improved by introducing a scale factor at each iteration. The effectiveness of the proposed techniques is illustrated by a comparison of a set of six multi-damping design spectra with spectral responses of a time history

  19. Laser welding of polymers, compatibility and mechanical properties

    DEFF Research Database (Denmark)

    Nielsen, Steen Erik; Strange, Marianne; Kristensen, Jens Klæstrup;

    2013-01-01

    Laser welding of polymers is today a commonly used industrial technology. It has shown obvious advantages compared to e.g. adhesive bonding in terms of higher productivity, better quality and easiness for automation. The ongoing development of lasers tailored for polymer welding in coordination...... with the development of related absorbers added to the polymer materials provide the possibility of joining transparent and non-transparent materials. The automotive industry, the medical device industry and the electronic industry are just some of the areas where the technology is widely implemented...... for research and development. This paper presents some research results related to laser welding of various polymer materials, including weld compatibility investigations related to the joining of different polymers. Theory for bonding mechanisms, strength development, mechanical properties testing and other...

  20. Compatibility between cellulose and hydrophobic polymer provided by microfibrillated lignocellulose.

    Science.gov (United States)

    Gindl-Altmutter, Wolfgang; Obersriebnig, Michael; Veigel, Stefan; Liebner, Falk

    2015-01-01

    Microfibrillated lignocellulose (MFLC) was produced from wood subjected to partial lignin extraction using an ethanol/water mixture. After homogenization, the average fibril diameter of MFLC was in the same range as conventional microfibrillated cellulose (MFC). Although MFLC exhibited higher wettability with water compared to MFC, AFM adhesion force measurements revealed high variability in surface polarity of MFLC compared to MFC. Specifically, domains of higher polarity than in MFC but also domains of lower polarity than in MFC were observed in MFLC. This tendency towards amphiphilic behavior of MFLC was used to provide enhanced compatibility with polycaprolactone and polystyrene matrices. With both polymers, a significantly more homogeneous distribution of fibrils was achieved using MFLC compared to MFC. In line with better dispersion of the fibrils, significantly more efficient mechanical reinforcement of polymers was obtained using MFLC compared to MFC. PMID:25348210

  1. Flight management concepts compatible with air traffic control

    Science.gov (United States)

    Morello, S. A.

    1986-01-01

    With the advent of airline deregulation and increased competition, the need for cost efficient airline operations is critical. This paper summarizes past research efforts and planned research thrusts toward the development of compatible flight management and air traffic control systems that promise increased operational effectiveness and efficiency. Potential capacity improvements resulting from a time-based ATC simulation (fast-time) are presented. Advanced display concepts with time guidance and velocity vector information to allow the flight crew to play an important role in the future ATC environment are discussed. Results of parametric sensitivity analyses are also presented that quantify the fuel/cost penalties for idle-thrust mismodeling and wind-modeling errors.

  2. Platforms for integrated nonlinear optics compatible with silicon integrated circuits

    CERN Document Server

    Moss, David J

    2014-01-01

    Nonlinear photonic chips are capable of generating and processing signals all-optically with performance far superior to that possible electronically - particularly with respect to speed. Although silicon has been the leading platform for nonlinear optics, its high two-photon absorption at telecommunications wavelengths poses a fundamental limitation. We review recent progress in CMOS-compatible platforms for nonlinear optics, focusing on Hydex glass and silicon nitride and briefly discuss the promising new platform of amorphous silicon. These material systems have opened up many new capabilities such as on-chip optical frequency comb generation, ultrafast optical pulse generation and measurement. We highlight their potential future impact as well as the challenges to achieving practical solutions for many key applications.

  3. New CMOS Compatible Platforms for Integrated Nonlinear Optical Signal Processing

    CERN Document Server

    Moss, D J

    2014-01-01

    Nonlinear photonic chips have succeeded in generating and processing signals all-optically with performance far superior to that possible electronically - particularly with respect to speed. Although silicon-on-insulator has been the leading platform for nonlinear optics, its high two-photon absorption at telecommunications wavelengths poses a fundamental limitation. This paper reviews some of the recent achievements in CMOS-compatible platforms for nonlinear optics, focusing on amorphous silicon and Hydex glass, highlighting their potential future impact as well as the challenges to achieving practical solutions for many key applications. These material systems have opened up many new capabilities such as on-chip optical frequency comb generation and ultrafast optical pulse generation and measurement.

  4. Compatibility of detached divertor operation with robust edge pedestal performance

    Energy Technology Data Exchange (ETDEWEB)

    Leonard, A.W., E-mail: leonard@fusion.gat.com [General Atomics, PO Box 85608, San Diego, CA 92186-5608 (United States); Makowski, M.A.; McLean, A.G. [Lawrence Livermore National Laboratory, Livermore, CA (United States); Osborne, T.H.; Snyder, P.B. [General Atomics, PO Box 85608, San Diego, CA 92186-5608 (United States)

    2015-08-15

    The compatibility of detached radiative divertor operation with a robust H-mode pedestal is examined in DIII-D. A density scan produced low temperature plasmas at the divertor target, T{sub e} ⩽ 2 eV, with high radiation leading to a factor of ⩾4 drop in peak divertor heat flux. The cold radiative plasma was confined to the divertor and did not extend across the separatrix in X-point region. A robust H-mode pedestal was maintained with a small degradation in pedestal pressure at the highest densities. The response of the pedestal pressure to increasing density is reproduced by the EPED pedestal model. However, agreement of the EPED model with experiment at high density requires an assumption of reduced diamagnetic stabilization of edge Peeling–Ballooning modes.

  5. Report on sodium compatibility of advanced structural materials.

    Energy Technology Data Exchange (ETDEWEB)

    Li, M.; Natesan, K.; Momozaki, Y.; Rink, D.L.; Soppet, W.K.; Listwan, J.T. (Nuclear Engineering Division)

    2012-07-09

    This report provides an update on the evaluation of sodium compatibility of advanced structural materials. The report is a deliverable (level 3) in FY11 (M3A11AN04030403), under the Work Package A-11AN040304, 'Sodium Compatibility of Advanced Structural Materials' performed by Argonne National Laboratory (ANL), as part of Advanced Structural Materials Program for the Advanced Reactor Concepts. This work package supports the advanced structural materials development by providing corrosion and tensile data from the standpoint of sodium compatibility of advanced structural alloys. The scope of work involves exposure of advanced structural alloys such as G92, mod.9Cr-1Mo (G91) ferritic-martensitic steels and HT-UPS austenitic stainless steels to a flowing sodium environment with controlled impurity concentrations. The exposed specimens are analyzed for their corrosion performance, microstructural changes, and tensile behavior. Previous reports examined the thermodynamic and kinetic factors involved in the purity of liquid sodium coolant for sodium reactor applications as well as the design, fabrication, and construction of a forced convection sodium loop for sodium compatibility studies of advanced materials. This report presents the results on corrosion performance, microstructure, and tensile properties of advanced ferritic-martensitic and austenitic alloys exposed to liquid sodium at 550 C for up to 2700 h and at 650 C for up to 5064 h in the forced convection sodium loop. The oxygen content of sodium was controlled by the cold-trapping method to achieve {approx}1 wppm oxygen level. Four alloys were examined, G92 in the normalized and tempered condition (H1 G92), G92 in the cold-rolled condition (H2 G92), G91 in the normalized and tempered condition, and hot-rolled HT-UPS. G91 was included as a reference to compare with advanced alloy, G92. It was found that all four alloys showed weight loss after sodium exposures at 550 and 650 C. The weight loss of the

  6. Energetics and Compatibility of Plasticizers in Composite Solid Propellants

    Directory of Open Access Journals (Sweden)

    Rm. Muthiah

    1989-04-01

    Full Text Available In this paper a comparative analysis on the energetics of ester type plasticizers such as dioctyl adipate (DOA, dioctyl phthalate (DOP,dibutyl sebacate (DBS, isodecyl pelargonate (IDP, trioctylphosphate (TOF, diethyl phthalate (DEP, tricresyl phosphate (TCPand dibutyl phthalate (DBP and hydrocarbon type plasticizers such as polybutene (PB, spindle oil, naphthenic oil, polymer extender oil(PEO and poly isobutylene (PIB and the impact of some of the plasticizers on the work ability, pot life and mechanical properties of propellants based on two selected polymeric binders namely polybutadiene-acrylic acid-acrylonitrile (PBAN ter polymer andhydroxyl terminated polybutadiene (HTPB have been reported. The compatibility of all the plasticizers on HTPB binder was also studied at different concentration levels and temperatures using Brookfield viscometer and reported. The mechanism of plasticization is also reviewed.

  7. Environmental compatibility of CRYOPLANE the cryogenic-fuel aircraft

    Energy Technology Data Exchange (ETDEWEB)

    Klug, H.G. [Daimler Benz Aerospace Airbus, Hamburg (Germany)

    1997-12-31

    `CRYOPLANE` is the project name for an aircraft powered by cryogenic fuel, either liquid natural gas (LNG, mainly consisting of methane) or liquid hydrogen (LH{sub 2}). Emission of CO{sub 2}, unburnt hydrocarbons, soot and sulfur will be completely avoided by hydrogen combustion: LH{sub 2} is an extremely pure liquid. Emission of water as a primary combustion product is increased by a factor of 2.6. Exhaust gases behind hydrogen engines contain more water than behind kerosene engines, and hence can form contrails under a wider range of atmospheric conditions. Liquid hydrogen fueled aircraft promise big advantages relative to kerosene aircraft in terms of environmental compatibility. (R.P.)

  8. Rate Compatible Protocol for Information Reconciliation: An application to QKD

    CERN Document Server

    Elkouss, David; Lancho, Daniel; Martin, Vicente

    2010-01-01

    Information Reconciliation is a mechanism that allows to weed out the discrepancies between two correlated variables. It is an essential component in every key agreement protocol where the key has to be transmitted through a noisy channel. The typical case is in the satellite scenario described by Maurer in the early 90's. Recently the need has arisen in relation with Quantum Key Distribution (QKD) protocols, where it is very important not to reveal unnecessary information in order to maximize the shared key length. In this paper we present an information reconciliation protocol based on a rate compatible construction of Low Density Parity Check codes. Our protocol improves the efficiency of the reconciliation for the whole range of error rates in the discrete variable QKD context. Its adaptability together with its low interactivity makes it specially well suited for QKD reconciliation.

  9. Compatibility of surface texturization and beam processing of solar cells

    International Nuclear Information System (INIS)

    The use of beam processing, especially pulsed-laser annealing, for junction formation in silicon with texturized surfaces was thought by many to be impossible, because the rapid melting and solidification of the surface cause a rounding of the pyramids, uneven junction formation, and even punch-through of the junction in some areas. Early work by Spire Corporation with e-beam annealing seemed to indicate that extensive rounding of the pyramids was unavoidable when melting occurred. More recently, early attempts at excimer laser annealing of ion-implanted texturized surfaces gave disappointing results. Nevertheless, the recent success of Spire in obtaining 18% AM1 solar cells on texturized surfaces convinced the authors that they should make a more careful study of the compatibility of texturization and beam processing. They report here on the present status of this study

  10. Compatibility of dielectric and heat shield material combinations during ablations

    International Nuclear Information System (INIS)

    The surface recession and mass-transfer rates of materials suitable for reentry thermal protection of microwave antennas have been examined. Experiments were performed with subsonic-turbulent flow of air in a confined channel. In supporting experiments, selected material combinations were subjected to ablative splash tests in the Sandia High Enthalpy Arc Tunnel. Microwave window materials were tested adjacent to ablative heat shield materials in combinations and configurations under consideration for reentry vehicle applications. Test results indicated that fused silica was compatible with quartz-phenolic and carbon-phenolic heat shield materials while the ablative characteristics of hot-pressed boron nitride were very similar to those of the STC-7 carbon composite developed by Sandia Laboratories. (U.S.)

  11. IGBT scaling principle toward CMOS compatible wafer processes

    Science.gov (United States)

    Tanaka, Masahiro; Omura, Ichiro

    2013-02-01

    A scaling principle for trench gate IGBT is proposed. CMOS technology on large diameter wafer enables to produce various digital circuits with higher performance and lower cost. The transistor cell structure becomes laterally smaller and smaller and vertically shallower and shallower. In contrast, latest IGBTs have rather deeper trench structure to obtain lower on-state voltage drop and turn-off loss. In the aspect of the process uniformity and wafer warpage, manufacturing such structure in the CMOS factory is difficult. In this paper, we show the scaling principle toward shallower structure and better performance. The principle is theoretically explained by our previously proposed "Structure Oriented" analytical model. The principle represents a possibility of technology direction and roadmap for future IGBT for improving the device performance consistent with lower cost and high volume productivity with CMOS compatible large diameter wafer technologies.

  12. Hydrophobic Modification of Layered Clays and Compatibility for Epoxy Nanocomposites

    Directory of Open Access Journals (Sweden)

    Jiang-Jen Lin

    2010-04-01

    Full Text Available Recent studies on the intercalation and exfoliation of layered clays with polymeric intercalating agents involving poly(oxypropylene-amines and the particular uses for epoxy nanocomposites are reviewed. For intercalation, counter-ionic exchange reactions of clays including cationic layered silicates and anionic Al-Mg layered double hydroxide (LDH with polymeric organic ions afforded organoclays led to spatial interlayer expansion from 12 to 92 Å (X-ray diffraction as well as hydrophobic property. The inorganic clays of layered structure could be modified by the poly(oxypropyleneamine-salts as the intercalating agents with molecular weights ranging from 230 to 5,000 g/mol. Furthermore, natural montmorillonite (MMT clay could be exfoliated into thin layer silicate platelets (ca. 1 nm thickness in one step by using polymeric types of exfoliating agents. Different lateral dimensions of MMT, synthetic fluorinated Mica and LDH clays had been cured into epoxy nanocomposites. The hydrophobic amine-salt modification resulting in high spacing of layered or exfoliation of individual clay platelets is the most important factor for gaining significant improvements of properties. In particular, these modified clays were reported to gain significant improvements such as reduced coefficient of thermal expansion (CTE, enhanced thermal stability, and hardness. The utilization of these layered clays for initiating the epoxy self-polymerization was also reported to have a unique compatibility between clay and organic resin matrix. However, the matrix domain lacks of covalently bonded crosslink and leads to the isolation of powder material. It is generally concluded that the hydrophobic expansion of the clay inter-gallery spacing is the crucial step for enhancing the compatibility and the ultimate preparation of the advanced epoxy materials.

  13. Chemical compatibility of rare earth cobaltite perovskites with YSZ

    International Nuclear Information System (INIS)

    Rare earth cobaltite perovskites are interesting cathode materials for the reduced temperature SOFC because of their high catalytic activity for oxygen reduction. The chemical compatibility of perovskites in Ln1-xSrxCoO3-δ(Ln=Sm, Dy), Ln0.4Sr0.6Co0.8Fe0.2O3-δ (Ln=La, Pr, Nd, Sm, Gd), Gd0.8Ca0.2Co1-xMnxO3-δ with 8 mol% yttria stabilized zirconia(8YSZ) has been investigated. Powder mixtures of these perovskites and 8YSZ have been annealed at different temperatures for 96 h in air. As the main reaction product, SrZrO3 has been found in 8YSZ/Ln, 1-xSrxCoO3-δ(Ln=Sm,Dy) with high Sr content and 8YSZ/Ln0.4Sr0.6Co0.8Fe0.2O3-δ (Ln=La,Pr,Nd,Sm,Gd) at 900 deg C. No reaction product has been detected in 8YSZ/Gd0.8Ca0.2Co1-6MnxO3-δ by XRD. However, significant diffusion of Co into 8YSZ has been found by EDX at the interface of 8YSZ/ Gd0.8Ca0.2Co0.6Mn0.4O3-δ after annealing at 1200 deg C for 24h. The bond-valence model has been used to discuss the chemical compatibility of the different perovskites with 8YSZ. Copyright (1999) Australasian Ceramic Society

  14. Condensate polishing plant compatibility study with ethanolamine and cyclohexylamine

    International Nuclear Information System (INIS)

    Use of ethanolamine (ETA) as all volatile treatment (AVT) reagent reduces 20-30 % Fe corrosion of over all steam-water circuit and 50% reduction in steam/water two phase flow areas. ETA - CPP (condensate polishing plant) compatibility study showed that cation resin can be loaded up to 75-80% capacity during H/OH cycle operation. With respect to sodium (Na) in steady state impurity ingress condition (130- 40 ppb Na) bed loading capacity of 16% was observed. The CPP-ETA combination is found to be one of the best in which ETA break-through, Na slip of 0-5 ppb and Cl slip of 0-20 ppb were observed. Cyclohexylamine (CHA) is a good AVT amine for pH control in steam-water circuit. In order to look for an alternative to morpholine for MAPS detailed CPP compatibility studies with cyclohexylamine (CHA) were performed. Due to its high selectivity on the cation resin. CHA can be loaded up to 85-90% capacity on the cation resin. In comparison with other amines. CHA break through slips for Na and Cl (chloride) were also of higher order (Na:100 ppb and Cl : 50 ppb). In H/OH cycle CHA-CPP combination can be used up to 10% cation bed loading by keeping effluent Na < 5 ppb. In case, influent Na ingress is less than 250 ppb and influent CHA concentration is kept below 1.5 ppm (to maintain pH 9-9.5) the CPP bed can also be loaded in CHA/OH cycle up to total of 10% Na provided that care is taken to maintain break through slip within plant technical specifications by using good quality regenerants. (author)

  15. Silicon photomultiplier modules for MRI-compatible PET

    Science.gov (United States)

    Sul, Woo-Suk; Kim, Hyoungtaek; Cho, Gyuseong

    2015-04-01

    Silicon photomultiplier (SiPM) modules were developed for use in positron emission tomography-magnetic resonance imaging (PET-MRI), which is a hybrid medical imaging technology. A PET-MRI is very efficient in the early diagnosis of representative senile diseases, including cancer, Alzheimer's disease, and Parkinson's disease. SiPMs comprise the core image sensor for MR-compatible PET applications since they have a low operational voltage, high gain, good timing resolution, ruggedness, insensitivity to magnetic fields, compactness, and low cost. In PET systems, SiPM microcells can be optimized by making a trade-off between photon detection efficiency (PDE) and dynamic range. The SiPM modules used in this study were fabricated at the National NanoFab Center (NNFC) of South Korea by using a customized CMOS processes. The SiPM modules were evaluated by first packaging them with a cost-effective PCB package instead of with a conventional ceramic package. Measurements on 1,400 SiPMs indicated a uniform breakdown voltage of 20.54 V with a standard deviation of 0.07 V. Moreover, the SiPM modules present a high and uniform energy resolution of 13.6% with a standard deviation of 0.5% at 511 keV with 3 × 3 × 20 mm3 cerium-doped lutetium-yttrium oxyorthosilicate (Lu2(1-x)Y2xSiO5:Ce, LYSO) crystal coupling. These results indicated that the proposed devices offer adequate performance to form the foundation of an image sensor technology for MRI-compatible PET.

  16. Compatibility of materials with liquid metal targets for SNS

    Energy Technology Data Exchange (ETDEWEB)

    DiStefano, J.R.; Pawel, S.J.; DeVan, J.H.

    1996-06-01

    Several heavy liquid metals are candidates as the target in a spallation neutron source: Hg, Pb, Bi, and Pb-Bi eutectic. Systems with these liquid metals have been used in the past and a data-base on compatibility already exists. Two major compatibility issues have been identified when selecting a container material for these liquid metals: temperature gradient mass transfer and liquid metal embrittlement or LME. Temperature gradient mass transfer refers to dissolution of material from the high temperature portions of a system and its deposition in the lower temperature areas. Solution and deposition rate constants along with temperature, {Delta}T, and velocity are usually the most important parameters. For most candidate materials mass transfer corrosion has been found to be proportionately worse in Bi compared with Hg and Pb. For temperatures to {approx}550{degrees}C, ferritic/martensitic steels have been satisfactory in Pb or Hg systems and the maximum temperature can be extended to {approx}650{degrees}C with additions of inhibitors to the liquid metal, e.g. Mg, Ti, Zr. Above {approx}600{degrees}C, austenitic stainless steels have been reported to be unsatisfactory, largely because of the mass transfer of nickel. Blockage of flow from deposition of material is usually the life-limiting effect of this type of corrosion. However, mass transfer corrosion at lower temperatures has not been studied. At low temperatures (usually < 150{degrees}C), LME has been reported for some liquid metal/container alloy combinations. Liquid metal embrittlement, like hydrogen embrittlement, results in brittle fracture of a normally ductile material.

  17. Integration of environmentally compatible soldering technologies for waste minimization

    International Nuclear Information System (INIS)

    There has been a concentrated effort throughout the international microelectronics industry to phase out chlorofluorocarbon (CFC) materials and alleviate the serious problem of ozone depletion created by the release of CFCS. The development of more environmentally compatible manufacturing technologies is the cornerstone of this effort. Alternative materials and processes for cleaning and soldering have received special attention. Electronic. soldering typically utilizes rosin-based fluxes to promote solder wettability. Flux residues must be removed from the soldered parts when high product reliability is essential. Halogenated or CFC solvents have been the principle chemicals used to clean the residues. With the accelerated push to eliminate CFCs in the US by 1995, CFC-free solvents, aqueous-based cleaning, water soluble or ''no clean'' fluxes, and fluxless soldering technologies are being developed and quickly integrated into manufacturing practice. Sandia's Center for Solder Science and Technology has been ch g a variety of fluxless and alternative soldering technologies for DOE's waste minimization program. The work has focused on controlled atmosphere, laser, and ultrasonic fluxless soldering, protective metallic and organic coatings, and fluxes which have water soluble or low solids-based chemistries. With the increasing concern that Pb will also be banned from electronic soldering, Sandia has been characterizing the wetting, aging, and mechanical properties of Pb-fire solder alloys. The progress of these integrated studies will be discussed. Their impact on environmentally compatible manufacturing will be emphasized. Since there is no universal solution to the various environmental, safety, and health issues which currently face industry, the proposed technologies offer several complementary materials and processing options from which one can choose

  18. Is compatible the idea of incommensurability with that of scientific progress? Some reasons in support of its compatibility [Spanish

    Directory of Open Access Journals (Sweden)

    Juan Manuel Jaramillo Uribe

    2006-01-01

    Full Text Available The problem of incommensurability and, particulary, the one of the scientific progress, is associated two names: Kuhn and Feyerabend, whose proposals caused than many put in doubt the apparent evidence of the call scientific progress, relativizing its validity to each school or paradigm. In this writing we will show that this type of epistemic relativism —just as convergentist theory of the truth— they lack of philosophical validity and historical and how the idea of scientific progress is compatible with the thesis of the incommensurability beyond the ontosemantics difficulties that it implies. This suppose to leave the the call statement view of the scientific theories and adopt a non-statement view where the intertheoretical relation of approach allows to subsink different non trivial incommensurability and to validate in them the notion oaf scientific progress.

  19. Compatibility of entomopathogenic nematodes (Nematoda: Rhabditida) with insecticides used in the tomato crop

    OpenAIRE

    Paulo Henrique de Siqueira Sabino; Fernanda Soares Sales; Elsa Judith Guevara; Alcides Moino Jr.; Camila Cramer Filgueiras

    2014-01-01

    Entomopathogenic nematodes (EPNs) are agents that can be used for the biological control of pests associated with insecticides in a tank mix. Compatibility studies need to be conducted to analyze which products are compatible with nematodes. The aim of this work was to evaluate the compatibility between EPNs and the insecticides that are most used on the tomato crop, and to correlate the toxicological classification of the chemical products with two species of EPNs that have the p...

  20. Assessment of the compatibility of wood and plastic with cement for their recycling in cement composites

    OpenAIRE

    Andrade, André De; Caldeira, Fernando

    2010-01-01

    The compatibility between maritime pine wood and cement, and between plastic (LDPE) and cement, was assessed for the recycling of wood and plastic in cement composites. Temperature vs. time profiles of cement setting were registered and compatibility indices were calculated. Results indicate that recycling of plastics in plastic-cement composites does not pose any questions regarding chemical compatibility. However, maritime pine hinders cement setting in some extent. So, in or...

  1. Compatibility Heuristics for Modern Mobile games. : Mobile games.Mobile Game testing

    OpenAIRE

    Gitau, Paul

    2010-01-01

    The purpose of this study was to demonstrate ways to perform a compatibility test for a modern mobile game. These tests were performed by running a tastephone midlet to the mobile handset to determine its characteristics and the equivalent implementation.Compatibility check test was also aimed to help a specified mobile game application to run successfully into a mobile phone. Compatibility heuristics for modern mobile games was also designed to study the factors that should be considered...

  2. Design of a New MR Compatible Haptic Interface with Six Actuated Degrees of Freedom

    DEFF Research Database (Denmark)

    Ergin, Mehmet Alper; Kühne, Markus; Thielscher, Axel;

    2014-01-01

    . Existing MR-compatible haptic interfaces are restricted to maximum three actuated degrees of freedom. We propose an MR-compatible haptic interface with six actuated degrees of freedom to be able to study human brain mechanisms of natural pick-and-place movements including arm transport. In this work, we......Functional magnetic resonance imaging is an often adopted tool to study human motor control mechanisms. Highly controlled experiments as required by this form of analysis can be realized with haptic interfaces. Their design is challenging because of strong safety and MR compatibility requirements...... noise is found and thus, bidirectional compatibility of the six DoF interface can be expected....

  3. 75 FR 39614 - Approval of Noise Compatibility Program for Modesto City-County Airport, Modesto, CA

    Science.gov (United States)

    2010-07-09

    ...-County Airport study contains a proposed noise compatibility program comprised of actions designed for... Ceres, and Stanislaus County General Plans; Consistently designate the area northwest of the...

  4. Carrier Analysis Lab (CAL) – Aircraft/Weapons/Ship Compatibility Lab

    Data.gov (United States)

    Federal Laboratory Consortium — Purpose: The Carrier Analysis Lab (CAL) - Aircraft/Weapons/Ship Compatibility Lab located at the Naval Air Warfare Center Aircraft Division, Lakehurst, NJ provides...

  5. Aqueous compatible boron nitride nanosheets for high-performance hydrogels

    Science.gov (United States)

    Hu, Xiaozhen; Liu, Jiahui; He, Qiuju; Meng, Yuan; Cao, Liu; Sun, Ya-Ping; Chen, Jijie; Lu, Fushen

    2016-02-01

    Hexagonal boron nitride nanosheets (BNNSs) possess ultimate thermal and chemical stabilities and mechanical strengths. However, the unmodified BNNSs are hydrophobic and insoluble in water, which hinders their use in many technological areas requiring aqueous compatibility. In this work, h-BN was treated with molten citric acid to produce aqueous dispersible boron nitride sheets (ca-BNNSs). The resultant ca-BNNSs were used to fabricate ca-BNNS/polyacrylamide (i.e., BNNS2.5/PAAm) nanocomposite hydrogels, targeting high water retentivity and flexibility. The BNNS2.5/PAAm hydrogel (initially swollen in water) largely remained swollen (water content ~94 wt%) even after one-year storage under ambient conditions. Importantly, the swollen BNNS2.5/PAAm hydrogel (water content ~95 wt%) was highly flexible. Its elongation and compressive strength exceeded 10 000% and 8 MPa at 97% strain, respectively. Moreover, the aforementioned hydrogel recovered upon the removal of compression force, without obvious damage. The substantially improved water retentivity and flexibility revealed that BNNSs can serve as a promising new platform in the development of high-performance hydrogels.Hexagonal boron nitride nanosheets (BNNSs) possess ultimate thermal and chemical stabilities and mechanical strengths. However, the unmodified BNNSs are hydrophobic and insoluble in water, which hinders their use in many technological areas requiring aqueous compatibility. In this work, h-BN was treated with molten citric acid to produce aqueous dispersible boron nitride sheets (ca-BNNSs). The resultant ca-BNNSs were used to fabricate ca-BNNS/polyacrylamide (i.e., BNNS2.5/PAAm) nanocomposite hydrogels, targeting high water retentivity and flexibility. The BNNS2.5/PAAm hydrogel (initially swollen in water) largely remained swollen (water content ~94 wt%) even after one-year storage under ambient conditions. Importantly, the swollen BNNS2.5/PAAm hydrogel (water content ~95 wt%) was highly flexible. Its

  6. Development of Recycling Compatible Pressure-Sensitive Adhesives and Coatings

    Energy Technology Data Exchange (ETDEWEB)

    Steven J. Severtson

    2010-02-15

    The objective of this project was the design of new water-based pressure-sensitive adhesive (PSA) products and coatings engineered for enhanced removal during the processing of recycled fiber. Research included the formulation, characterization, and performance measurements of new screenable coatings, testing of modified paper and board substrates and the design of test methods to characterize the inhibition of adhesive and coating fragmentation and relative removal efficiencies of developed formulations. This project was operated under the requirements that included commercially viable approaches be the focus, that findings be published in the open literature and that new strategies could not require changes in the methods and equipment used to produce PSA and PS labels or in the recycling process. The industrial partners benefited through the building of expertise in their company that they would not, and likely could not, have pursued if it had not been for the partnership. Results of research on water-based PSAs clearly identifies which PSA and paper facestock properties govern the fragmentation of the adhesive and provide multiple strategies for making (pressure-sensitive) PS labels for which the PSA is removed at very high efficiencies from recycling operations. The application of these results has led to the identification of several commercial products in Franklin International’s (industrial partner) product line that are recycling compatible. Several new formulations were also designed and are currently being scaled-up. Work on recycling compatible barrier coatings for corrugated containers examined the reinforcement of coatings using a small amount of exfoliated organically modified montmorillonite (OMMT). These OMMT/paraffin wax nanocomposites demonstrated significantly improved mechanical properties. Paraffin waxes containing clay were found to have significantly higher Young’s moduli and yield stress relative to the wax matrix, but the most

  7. Magnetic field compatibility of components for ITER electrical distribution systems

    International Nuclear Information System (INIS)

    The electrical distribution boards and control cubicles, installed inside the ITER Tokamak building, can be subject to a constant or slowly variable magnetic field up to 70 mT, 10 mT/s induced by ITER coils. This is a very unusual environmental condition and there are almost no data available on static magnetic field compatibility for the standard industrial electrical and electronic components that might be used inside standard low voltage distribution boards and standard control boards. CEA has especially taken in charge the test of electronic, control and signal conditioning units. For this purpose a test bed composed of a solenoid and a 30 V, 800 A power supply, has been developed at CEA Cadarache. Its characteristics are the following: - Magnetic field capability: 40 mT; - Variation of field: up to 10 mT/s. Useful dimensions for equipment under test: 500 x 500 x 500 mm. The list of the components to be tested has been identified trying to find common and recent components of different manufacturers. Test procedures have been written following the most relevant IEC standards and manufacturing recommendations and procedures. Magnetic compatibility tests on the basic components of standard low voltage control boards has been performed. All components tested are more or less sensitive to magnetic fields and the effect varies from the simple perturbation of the output signals to the partial destruction of some electronic card. The most sensitive are the ferromagnetic components like small power supplies transformers, relays, on inductors. For power supplies the most important consequence is the increase of the consumption (primary current). For most of the conditioning units the operational limits were found in the range of 30 mT (destruction of materials and overload of the supply) For PLC (Programme Logic Control) central units tested, the limit is in the order of 40 mT (components permanently out of service) Relays are limited to 15 mT (outputs oscillations, no

  8. Vehicle compatibility in car-to-car collisions : literature review in the framework of the European research project "Improvement of crash compatibility between cars", Workpackage 1.

    OpenAIRE

    van der Sluis, J.

    2000-01-01

    In this report, a literature review is given on the subject of crash compatibility and incompatibility between cars. The study is based on scientific publications on this subject published over the last 15 years. The compatibility problem is described from three points of view: statistical, mechanical and geometrical. From the statistical point of view, literature focusing on the influence of car mass (including mass ratio) and car size on the injury severity of occupants is reviewed; also se...

  9. Compatibility analysis of DUPIC fuel (part 3) - radiation physics analysis

    International Nuclear Information System (INIS)

    As a part of the compatibility analysis of DUPIC fuel in CANDU reactors, the radiation physics calculations have been performed for the CANDU primary shielding system, thermal shield, radiation damage, transportation cask and storage. At first, the primary shield system was assessed for the DUPIC fuel core, which has shown that the dose rates and heat deposition rates through the primary shield of the DUPIC fuel core are not much different from those of natural uranium core because the power levels on the core periphery are similar for both cores. Secondly, the radiation effects on the critical components and the themal shields were assessed when the DUPIC fuel is loaded in CANDU reactors. Compared with the displacement per atom (DPA) of the critical component for natural uranium core, that for the DUPIC fuel core was increased by -30% for the innermost groove and the weld points and by -10% for the corner of the calandria subshells and annular plates in the calandria, respectivdely. Finally, the feasibility study of the DUPIC fuel handling was performed, which has shown that all handling and inspection of the DUPIC fuel bundles be done remotely and behind a shielding wall. For the transportation of the DUPIC fuel, the preliminary study has shown that there shold be no technical problem th design a transportation cask for the fresh and spent DUPIC fuel bundles. For the storage of the fresh and spent DUPIC fuels, there is no the criticality safety problem unless the fuel bundle geometry is destroyed

  10. MRI dynamic range and its compatibility with signal transmission media

    Science.gov (United States)

    Gabr, Refaat E.; Schär, Michael; Edelstein, Arthur D.; Kraitchman, Dara L.; Bottomley, Paul A.; Edelstein, William A.

    2009-06-01

    As the number of MRI phased array coil elements grows, interactions among cables connecting them to the system receiver become increasingly problematic. Fiber optic or wireless links would reduce electromagnetic interference, but their dynamic range (DR) is generally less than that of coaxial cables. Raw MRI signals, however, have a large DR because of the high signal amplitude near the center of k-space. Here, we study DR in MRI in order to determine the compatibility of MRI multicoil imaging with non-coaxial cable signal transmission. Since raw signal data are routinely discarded, we have developed an improved method for estimating the DR of MRI signals from conventional magnitude images. Our results indicate that the DR of typical surface coil signals at 3 T for human subjects is less than 88 dB, even for three-dimensional acquisition protocols. Cardiac and spine coil arrays had a maximum DR of less than 75 dB and head coil arrays less than 88 dB. The DR derived from magnitude images is in good agreement with that measured from raw data. The results suggest that current analog fiber optic links, with a spurious-free DR of 60-70 dB at 500 kHz bandwidth, are not by themselves adequate for transmitting MRI data from volume or array coils with DR ˜90 dB. However, combining analog links with signal compression might make non-coaxial cable signal transmission viable.

  11. System Interconnect Bus (SIB) compatible multi crate CAMAC Controller (CC)

    International Nuclear Information System (INIS)

    This paper describes design of SIB compatible crate controller with PC interface. SIB is a general-purpose parallel 1/O interface bus used for connecting multi crate system with single PC-interface. The crate controller comprises of a dedicated PC-AT add-on SIB interface card and two width CAMAC module designed to work at station 24 and station 25 of CAMAC crate. PC Interface card (SIBINT) is used for communication between PC/AT host computer and CAMAC Crates. The controller module incorporates a set of registers, logic to generate CAMAC data way timing. Transmission protocol used is RS485 standard. This controller is used for multiple CAMAC crates system, interfaced to PC, using a 60 core twisted pair flat ribbon cable. The crate controller is developed for use in process control, general-purpose data acquisition and control system and laboratory automation. Sustained data transfer rate achieved by controller is 115 Kword/sec each word being 32 bits in length. (author)

  12. Shuttle Communications and Tracking, Avionics, and Electromagnetic Compatibility

    Science.gov (United States)

    deSilva, K.; Hwu, Shian; Kindt, Kaylene; Kroll, Quin; Nuss, Ray; Romero, Denise; Schuler, Diana; Sham, Catherine; Scully, Robert

    2011-01-01

    By definition, electromagnetic compatibility (EMC) is the capability of components, sub-systems, and systems, to operate in their intended electromagnetic environment, within an established margin of safety, and at design levels of performance. Practice of the discipline itself incorporates knowledge of various aspects of applied physics, materials science, and engineering across the board, and includes control and mitigation of undesirable electromagnetic interaction between intentional and unintentional emitters and receivers of radio frequency energy, both within and external to the vehicle; identification and control of the hazards of non-ionizing electromagnetic radiation to personnel, ordnance, and fuels and propellants; and vehicle and system protection from the direct and indirect effects of lightning and various other forms of electrostatic discharge (ESD) threats, such as triboelectrification and plasma charging. EMC is extremely complex and far-reaching, affecting in some degree every aspect of the vehicle s design and operation. The most successful efforts incorporate EMC design features and techniques throughout design and fabrication of the vehicle s structure and components, as well as appropriate operational considerations with regard to electromagnetic threats in the operational environment, from the beginning of the design effort to the end of the life cycle of the manufactured product. This approach yields the highest design performance with the lowest cost and schedule impact.

  13. Space hardware compatibility tests with hydrogen peroxide gas plasma sterilization

    Science.gov (United States)

    Faye, Delphine; Aguila, Alexandre; Debus, Andre; Remaury, Stephanie; Nabarra, Pascale; Darbord, Jacques C.; Soufflet, Caroline; Destrez, Philippe; Coll, Patrice; Coscia, David

    The exploration of the Solar System shall comply with planetary protection requirements handled presently by the Committee of Space Research (COSPAR). The goal of planetary protection is to protect celestial bodies from terrestrial contamination and also to protect the Earth environment from an eventual contamination carried by return samples or by space systems. For project teams, avoiding the biological contamination of other Solar System bodies such as Mars imposes to perform unusual tasks at technical and operational constraints point of view. The main are the reduction of bioburden on space hardware, the sterile integration of landers, the control of the biological cleanliness and the limitation of crash probability. In order to reduce the bioburden on spacecraft, the use of qualified sterilization processes may be envisaged. Since 1992 now, with the Mars96 mission, one of the most often used is the Sterrad(R) process working with hydrogen peroxide gas plasma. In the view of future Mars exploration programs, after tests performed in the frame of previous missions, a new test campaign has been performed on thermal coatings and miscellaneous materials coming from an experiment in order to assess the compatibility of space hardware and material with this sterilization process.

  14. Dibasic calcium phosphate dihydrate, USP material compatibility with gamma radiation

    Science.gov (United States)

    Betancourt Quiles, Maritza

    Gamma radiation is a commonly used method to reduce the microbial bioburden in compatible materials when it is applied at appropriate dose levels. Gamma irradiation kills bacteria and mold by breaking down the organism’s DNA and inhibiting cell division. The purpose of this study is to determine the radiation dosage to be used to treat Dibasic Calcium Phosphate Dihydrate, USP (DCPD) and to evaluate its physicochemical effects if any, on this material. This material will be submitted to various doses of gamma radiation that were selected based on literature review and existing regulations that demonstrate that this method is effective to reduce or eliminate microbial bioburden in natural source and synthetic materials. Analytical testing was conducted to the DCPD exposed material in order to demonstrate that gamma radiation does not alter the physicochemical properties and material still acceptable for use in the manufacture of pharmaceutical products. The results obtained through this study were satisfactory and demonstrated that the gamma irradiation dosages from 5 to 30 kGy can be applied to DCPD without altering its physicochemical properties. These are supported by the Assay test data evaluation of lots tested before and after gamma irradiation implementation that show no significant statistical difference between irradiated and non irradiated assay results. The results of this study represent an achievement for the industry since they provide as an alternative the use of Gamma irradiation technology to control the microbial growth in DCPD.

  15. Electromagnetic compatibility. General presentation; Comptabilite electromagnetique. Presentation generale

    Energy Technology Data Exchange (ETDEWEB)

    Champiot, G.G. [Electricite de France (EDF), 75 - Paris (France)

    2000-02-01

    The electromagnetic environment has become an important parameter to take into account in any industrial project involving electronic systems. Four factors can conjugate to increase the problems of electromagnetic disturbances: the instrumentation and control systems which use very low voltage electronic components, the development of fast high-power electronic switching systems (thyristors etc..), the more and more frequent association of disturbing apparatuses and sensible equipments in the same integrated devices, and the sensitiveness of data processing systems. This introductory paper aims at building a general philosophy for the mastery of these phenomena: 1 - the aim of electromagnetic compatibility: notion, analysis, reduction of the problem to essentials; 2 - sources of electromagnetic disturbances: lightning, aurora borealis, disturbances due to intentional emissions (radiofrequency radiation, conduction), disturbances due to non-intentional emissions (thermal noise, switching of inductive currents, arc welding, start-up of vehicles with internal combustion engines, power lines, driving systems, fluorescent lamps, voltage drops and short cuts, harmonics, voltage transients), electrostatic discharges, nuclear electromagnetic pulses. (J.S.)

  16. Wire-Compatible Unordered Delivery in TCP and TLS

    CERN Document Server

    Iyengar, Janardhan; Amin, Syed Obaid; Nowlan, Michael F; Tiwari, Nabin

    2011-01-01

    The performance of many common Internet applications can benefit from out-of-order delivery, a feature all IETF transports since TCP have included. Yet latency-sensitive applications still frequently build on in-order TCP despite its performance drawbacks, for reasons such as network compatibility and TCP's cultural inertia. We introduce uTCP, an API extension that adds out-of-order delivery support without changing TCP's wire protocol, by delivering received TCP segments to the application immediately on arrival along with sequence number metadata. To obtain robust out-of-order delivery across middleboxes that may re-segment TCP flows, the application employs a "record-marking" content encoding such as COBS, allowing the receiver to extract records from a byte stream with arbitrary holes. TLS can also serve as such an encoding, enabling applications to obtain out-of-order delivery in a stream indistinguishable in the network from conventional TLS over TCP. With uTCP, for example, voice/videoconferencing appl...

  17. MEMS compatible illumination and imaging micro-optical systems

    Science.gov (United States)

    Bräuer, A.; Dannberg, P.; Duparré, J.; Höfer, B.; Schreiber, P.; Scholles, M.

    2007-01-01

    The development of new MOEMS demands for cooperation between researchers in micromechanics, optoelectronics and microoptics at a very early state. Additionally, microoptical technologies being compatible with structured silicon have to be developed. The microoptical technologies used for two silicon based microsystems are described in the paper. First, a very small scanning laser projector with a volume of less than 2 cm 3, which operates with a directly modulated lasers collimated with a microlens, is shown. The laser radiation illuminates a 2D-MEMS scanning mirror. The optical design is optimized for high resolution (VGA). Thermomechanical stability is realized by design and using a structured ceramics motherboard. Secondly, an ultrathin CMOS-camera having an insect inspired imaging system has been realized. It is the first experimental realization of an artificial compound eye. Micro-optical design principles and technology is used. The overall thickness of the imaging system is only 320 μm, the diagonal field of view is 21°, and the f-number is 2.6. The monolithic device consists of an UV-replicated microlens array upon a thin silica substrate with a pinhole array in a metal layer on the back side. The pitch of the pinholes differs from that of the lens array to provide individual viewing angle for each channel. The imaging chip is directly glued to a CMOS sensor with adapted pitch. The whole camera is less than 1mm thick. New packaging methods for these systems are under development.

  18. Compatibility tests of steels in flowing liquid lead-bismuth

    Energy Technology Data Exchange (ETDEWEB)

    Barbier, F.; Benamati, G. E-mail: benamati@brasimone.enea.it; Fazio, C.; Rusanov, A

    2001-06-01

    The behaviour of steels exposed to flowing Pb-55Bi was evaluated. The materials tested are the two austenitic steels AISI 316L and 1.4970, and the six martensitic steels Optifer IVc, T91, Batman 27, Batman 28, EP823 and EM10 which were exposed to flowing Pb-55Bi for 1000, 2000 and 3000 h and at two temperatures (573 and 743 K). The corrosion tests were conducted in the non-isothermal loop of IPPE-Obninsk under a controlled oxygen level (10{sup -6} wt%). The compatibility study showed that at a lower temperature, a very thin oxide layer (<1 {mu}m) was formed on the steels. At higher temperature, austenitic steels also exhibited a thin oxide layer sufficient to prevent their dissolution in the melt. A thicker oxide, which grew according to a parabolic law, was observed on the surface of the martensitic steels. The oxidation resistance behaviour of the martensitic steels was correlated with their alloying elements.

  19. Compatibility tests of steels in flowing liquid lead-bismuth

    Science.gov (United States)

    Barbier, F.; Benamati, G.; Fazio, C.; Rusanov, A.

    2001-06-01

    The behaviour of steels exposed to flowing Pb-55Bi was evaluated. The materials tested are the two austenitic steels AISI 316L and 1.4970, and the six martensitic steels Optifer IVc, T91, Batman 27, Batman 28, EP823 and EM10 which were exposed to flowing Pb-55Bi for 1000, 2000 and 3000 h and at two temperatures (573 and 743 K). The corrosion tests were conducted in the non-isothermal loop of IPPE-Obninsk under a controlled oxygen level (10 -6 wt%). The compatibility study showed that at a lower temperature, a very thin oxide layer (<1 μm) was formed on the steels. At higher temperature, austenitic steels also exhibited a thin oxide layer sufficient to prevent their dissolution in the melt. A thicker oxide, which grew according to a parabolic law, was observed on the surface of the martensitic steels. The oxidation resistance behaviour of the martensitic steels was correlated with their alloying elements.

  20. Compatibility analysis of DUPIC fuel(4) - thermal hydraulic analysis

    International Nuclear Information System (INIS)

    Thermal-hydraulic compatibility of the DUPIC fuel bundle in the CANDU reactor has been studied. The critical channel power, the critical power ratio, the channel exit quality and the channel flow are calculated for the DUPIC and the standard fuels by using the NUCIRC code. The physical models and associated parametric values for the NUCIRC analysis of the fuels are also presented. Based upon the slave channel analysis, the critical channel power and the critical power ratios have been found to be very similar for the two fuel types. The same dryout model is used in this study for the standard and the DUPIC fuel bundles. To assess the dryout characteristics of the DUPIC fuel bundle, the ASSERT-PV code has been used for the subchannel analysis. Based upon the results of the subchannel analysis, it is found that the dryout location and the power for the two fuel types are indeed very similar. This study shows that thermal performance of the DUPIC fuel is not significantly different from that of the standard fuel

  1. Left-right compatibility in the processing of trading verbs

    Directory of Open Access Journals (Sweden)

    Carmelo Mario Vicario

    2014-01-01

    Full Text Available The research investigating the nature of cognitive processes involved in the representation of economical outcomes is growing. Within this research, the mental accounting model proposes that individuals may well use cognitive operations to organize, evaluate, and keep track of their financial activities (Thaler, 1999. Here we wanted to test this hypothesis by asking to a group of participants to detect a syntax mistake of verbs indicating incoming and going out activities related to economical profit (trading verbs, swapping (swapping verbs and thinking (thinking verbs. We reported a left-right compatibility for trading verbs (i.e. participants were faster with their right hand while detecting verb referring to a monetary gain with respect to a monetary loss; and faster with their left hand while detecting a monetary loss with respect to a monetary gain. However, this pattern of result was not reported while detecting swapping verbs. Results are discussed taking into account the mental accounting theory as well as to the spatial mapping of valence hypothesis.

  2. Hard tissue compatibility of natural hydroxyapatite/chitosan composite

    International Nuclear Information System (INIS)

    The natural hydroxyapatite/chitosan (NHC) composite is a new synthesized material. The aim of this experiment was to assess the bone tissue compatibility of this NHC composite in vivo. Twenty-four healthy New Zealand rabbits were included in this study. Of those, 20 were used as the experimental group and four as the control group. In the experimental group, animals receive a cranium defect procedure and NHC composite repair. In the control group, animals underwent the cranium defect procedure without NHC composite repair. At 1, 4, 12, 24, and 40 weeks after surgery, the animals were sacrificed and samples were taken and assessed by gross observation, three-dimensional (3D) computerized tomographic (CT) reconstruction, histology and scanning electron microscope. Our results showed that at 1 week after repairing the bone defect with the NHC composite in the experimental group, new bone appeared around the composite and matured gradually. At 24 weeks after surgery, there were little collagenous tissues present between the material and surrounding bones. At 40 weeks after surgery, new bone had grown into the mature bone and total osseointegration had occurred. In the control group, however, no bone defect healing was observed at 40 weeks after surgery. All these results of the present in vivo work suggest that the NHC composite has a good hard tissue biocompatibility and an excellent osteoconductivity. It is suitable for artificial bone implants and frame materials of tissue engineering.

  3. Data Quality Objectives for Tank Farms Waste Compatibility Program

    Energy Technology Data Exchange (ETDEWEB)

    BANNING, D.L.

    1999-07-02

    There are 177 waste storage tanks containing over 210,000 m{sup 3} (55 million gal) of mixed waste at the Hanford Site. The River Protection Project (RPP) has adopted the data quality objective (DQO) process used by the U.S. Environmental Protection Agency (EPA) (EPA 1994a) and implemented by RPP internal procedure (Banning 1999a) to identify the information and data needed to address safety issues. This DQO document is based on several documents that provide the technical basis for inputs and decision/action levels used to develop the decision rules that evaluate the transfer of wastes. A number of these documents are presently in the process of being revised. This document will need to be revised if there are changes to the technical criteria in these supporting documents. This DQO process supports various documents, such as sampling and analysis plans and double-shell tank (DST) waste analysis plans. This document identifies the type, quality, and quantity of data needed to determine whether transfer of supernatant can be performed safely. The requirements in this document are designed to prevent the mixing of incompatible waste as defined in Washington Administrative Code (WAC) 173-303-040. Waste transfers which meet the requirements contained in this document and the Double-Shell Tank Waste Analysis Plan (Mulkey 1998) are considered to be compatible, and prevent the mixing of incompatible waste.

  4. The Design of Mechanically Compatible Fasteners for Human Mandible Reconstruction

    Science.gov (United States)

    Roberts, Jack C.; Ecker, John A.; Biermann, Paul J.

    1993-01-01

    Mechanically compatible fasteners for use with thin or weakened bone sections in the human mandible are being developed to help reduce large strain discontinuities across the bone/implant interface. Materials being considered for these fasteners are a polyetherertherketone (PEEK) resin with continuous quartz or carbon fiber for the screw. The screws were designed to have a shear strength equivalent to that of compact/trabecular bone and to be used with a conventional nut, nut plate, or an expandable shank/blind nut made of a ceramic filled polymer. Physical and finite element models of the mandible were developed in order to help select the best material fastener design. The models replicate the softer inner core of trabecular bone and the hard outer shell of compact bone. The inner core of the physical model consisted of an expanding foam and the hard outer shell consisted of ceramic particles in an epoxy matrix. This model has some of the cutting and drilling attributes of bone and may be appropriate as an educational tool for surgeons and medical students. The finite element model was exercised to establish boundary conditions consistent with the stress profiles associated with mandible bite forces and muscle loads. Work is continuing to compare stress/strain profiles of a reconstructed mandible with the results from the finite element model. When optimized, these design and fastening techniques may be applicable, not only to other skeletal structures, but to any composite structure.

  5. Compatibility of ITER candidate materials with static gallium

    International Nuclear Information System (INIS)

    Corrosion tests have been conducted to determine the compatibility of gallium with candidate structural materials for the International Thermonuclear Experimental Reactor (ITER) first wall/blanket systems, e.g., Type 316 stainless steel (SS), Inconel 625, and Nb-5 Mo-1 Zr. The results indicate that Type 316 SS is least resistant to corrosion in static gallium and Nb-5 Mo-1 Zr alloy is most resistant. At 400 C, corrosion rates for Type 316 SS, Inconel 625, and Nb-5 Mo-1 Zr alloy are ∼ 4.0, 0.5, and 0.03 mm/yr, respectively. Iron, nickel, and chromium react rapidly with gallium. Iron shows greater corrosion than nickel at 400 C (≥ 88 and 18 mm/yr, respectively). The present study indicates that at temperatures up to 400 C, corrosion occurs primarily by dissolution and is accompanied by formation of metal/gallium intermetallic compounds. The growth of intermetallic compounds may control the overall rate of corrosion

  6. Compatibility of ITER candidate structural materials with static gallium

    International Nuclear Information System (INIS)

    Tests were conducted on the compatibility of gallium with candidate structural materials for the International Thermonuclear Experimental Reactor, e.g., Type 316 SS, Inconel 625, and Nb-5 Mo-1 Zr alloy, as well as Armco iron, Nickel 270, and pure chromium. Type 316 stainless steel is least resistant to corrosion in static gallium and Nb-5 Mo-1 Zr alloy is most resistant. At 400 degrees C, corrosion rates are ∼4.0, 0.5, and 0.03 mm/yr for type 316 SS, Inconel 625, and Nb-5 Mo- 1 Zr alloy, respectively. The pure metals react rapidly with gallium. In contrast to findings in earlier studies, pure iron shows greater corrosion than nickel. The corrosion rates at 400 degrees C are ≥88 and 18 mm/yr, respectively, for Armco iron and Nickel 270. The results indicate that at temperatures up to 400 degrees C, corrosion occurs primarily by dissolution and is accompanied by formation of metal/gallium intermetallic compounds. The solubility data for pure metals and oxygen in gallium are reviewed. The physical, chemical, and radioactive properties of gallium are also presented. The supply and availability of gallium, as well as price predictions through the year 2020, are summarized

  7. Electromagnetic compatibility of implantable neurostimulators to RFID emitters

    Science.gov (United States)

    2011-01-01

    Background The objective of this study is to investigate electromagnetic compatibility (EMC) of implantable neurostimulators with the emissions from radio frequency identification (RFID) emitters. Methods Six active implantable neurostimulators with lead systems were tested for susceptibility to electromagnetic fields generated by 22 RFID emitters. These medical devices have been approved for marketing in the U.S. for a number of intended uses that include: epilepsy, depression, incontinence, Parkinsonian tremor and pain relief. Each RFID emitter had one of the following carrier frequencies: 125 kHz, 134 kHz, 13.56 MHz, 433 MHz, 915 MHz and 2.45 GHz Results The test results showed the output of one of the implantable neurostimulators was inhibited by 134 kHz RFID emitter at separation distances of 10 cm or less. The output of the same implantable neurostimulator was also inhibited by another 134 kHz RFID emitter at separation distances of 10 cm or less and also showed inconsistent pulsing rate at a separation distance of 15 cm. Both effects occurred during and lasted through out the duration of the exposure. Conclusions The clinical significance of the effects was assessed by a clinician at the U.S. Food and Drug Administration. The effects were determined to be clinically significant only if they occurred for extended period of time. There were no observed effects from the other 5 implantable neurostimulators or during exposures from other RFID emitters. PMID:21658266

  8. Compatibility of gas turbine materials with steam cooling

    Energy Technology Data Exchange (ETDEWEB)

    Desai, V.; Tamboli, D.; Patel, Y. [Univ. of Central Florida, Orlando, FL (United States)

    1995-10-01

    Gas turbines had been traditionally used for peak load plants and remote locations as they offer advantage of low installation costs and quick start up time. Their use as a base load generator had not been feasible owing to their poor efficiency. However, with the advent of gas turbines based combined cycle plants (CCPs), continued advances in efficiency are being made. Coupled with ultra low NO{sub x} emissions, coal compatibility and higher unit output, gas turbines are now competing with conventional power plants for base load power generation. Currently, the turbines are designed with TIT of 2300{degrees}F and metal temperatures are maintained around 1700{degrees}F by using air cooling. New higher efficiency ATS turbines will have TIT as high as 2700{degrees}F. To withstand this high temperature improved materials, coatings, and advances in cooling system and design are warranted. Development of advanced materials with better capabilities specifically for land base applications are time consuming and may not be available by ATS time frame or may prove costly for the first generation ATS gas turbines. Therefore improvement in the cooling system of hot components, which can take place in a relatively shorter time frame, is important. One way to improve cooling efficiency is to use better cooling agent. Steam as an alternate cooling agent offers attractive advantages because of its higher specific heat (almost twice that of air) and lower viscosity.

  9. Automated generation of spectrum-compatible artificial time histories

    International Nuclear Information System (INIS)

    Criteria for the seismic design of nuclear power plants are usually defined in the form of response spectra, and it is often necessary to generate artificial time histories of ground motions to 'match' these spectra. A recently developed automated iterative procedure employing a combination of frequency- and time-domain techniques in any desired sequence for the development of spectrum-compatible artificial time histories is presented. The procedure employs four basic steps: (1) generation of an initial (starting) time history using either sinusoidal superposition with an envelope function or specification of a real time history of a recorded ground motion; (2) manipulation of the amplitude and phase of the Fourier transform representation of this time history, and generation of successive time histories which have response spectra converging to the target design spectrum; (3) manipulation of the amplitude and phase of the Fourier transform representation only locally in areas where the peaks of the computed spectrum have larger magnitudes of deviations than desirable; and (4) manipulation of local areas of the latest time history. Computer program EDAC/SEQGEN, which completely automates the above steps, is described. Results are presented for the development of two artificial time histories with corresponding spectra matching the target USNRC Regulatory Guide 1.60 response spectra within about 5-7%. (Auth.)

  10. CMOS-compatible graphene photodetector covering all optical communication bands

    Science.gov (United States)

    Pospischil, Andreas; Humer, Markus; Furchi, Marco M.; Bachmann, Dominic; Guider, Romain; Fromherz, Thomas; Mueller, Thomas

    2013-11-01

    Optical interconnects are becoming attractive alternatives to electrical wiring in intra- and interchip communication links. Particularly, the integration with silicon complementary metal-oxide semiconductor (CMOS) technology has received considerable interest because of the ability of cost-effective integration of electronics and optics on a single chip. Although silicon enables the realization of optical waveguides and passive components, the integration of another, optically absorbing, material is required for photodetection. Traditionally, germanium or compound semiconductors are used for this purpose; however, their integration with silicon technology faces major challenges. Recently, graphene emerged as a viable alternative for optoelectronic applications, including photodetection. Here, we demonstrate an ultra-wideband CMOS-compatible photodetector based on graphene. We achieved a multigigahertz operation over all fibre-optic telecommunication bands beyond the wavelength range of strained germanium photodetectors, the responsivity of which is limited by their bandgap. Our work complements the recent demonstration of a CMOS-integrated graphene electro-optical modulator, and paves the way for carbon-based optical interconnects.

  11. OPTIMAL AND INCENTIVE COMPATIBLE PRICING FOR HETEROGENEOUS PERIODS

    Institute of Scientific and Technical Information of China (English)

    Jian CHEN; Nan ZHANG; Shuo HUANG

    2008-01-01

    This paper studies a service firm whose business time can be divided into several periods,each providing different value to customers.Heterogeneous service is a major reason resulting in imbalances between supply and demand.Since customers differ in their degree of impatience,firms Can use differential pricing mechanisms to optimize their objectives and match supply with demand in each period,by inducing customers to choose different periods.We study two types of firms,an internal firm,the objective of which is to maximize the system's(including the firm and all the customers)total net value,and a commercial firm,which aims to optimize its own profit.Though impatience factors are customers'private information,for each type of firm,we derive the optimal incentive compatible pricing policy,under which all the coming customers will follow the firm's assignment,that is,patient customers will buy the service in high-value periods,but their waiting time will be longer,while impatient customers will enter into the low-value periods,but they will be compensated by shorter waiting times.Furthermore,in the internal firm,we also prove that this mechanism enables the decentralization of decisions,while maintaining centralized system-wide optimality.Numerical analysis shows that when there is sufficient capacity,the internal firm does not always need to set lower prices than the commercial firm in every period.

  12. Laundry detergent compatibility of the alkaline protease from Bacillus cereus.

    Science.gov (United States)

    Banik, Rathindra Mohan; Prakash, Monika

    2004-01-01

    The endogenous protease activity in various commercially available laundry detergents of international companies was studied. The maximum protease activity was found at 50 degrees C in pH range 10.5-11.0 in all the tested laundry detergents. The endogenous protease activity in the tested detergents retained up to 70% on incubation at 40 degrees C for 1 h, whereas less than 30% activity was only found on incubation at 50 degrees C for 1 h. The alkaline protease from an alkalophilic strain of Bacillus cereus was studied for its compatibility in commercial detergents. The cell free fermented broth from shake flask culture of the organism showed maximum activity at pH 10.5 and 50 degrees C. The protease from B. cereus showed much higher residual activity (more than 80%) on incubation with laundry detergents at 50 degrees C for 1 h or longer. The protease enzyme from B. cereus was found to be superior over the endogenous proteases present in the tested commercial laundry detergents in comparison to the enzyme stability during the washing at higher temperature, e.g., 40-50 degrees C. PMID:15293947

  13. Left-right compatibility in the processing of trading verbs.

    Science.gov (United States)

    Vicario, Carmelo M; Rumiati, Raffaella I

    2014-01-01

    The research investigating the nature of cognitive processes involved in the representation of economical outcomes is growing. Within this research, the mental accounting model proposes that individuals may well use cognitive operations to organize, evaluate, and keep track of their financial activities (Thaler, 1999). Here we wanted to test this hypothesis by asking to a group of participants to detect a syntax mistake of verbs indicating incoming and going out activities related to economical profit (trading verbs), swapping (swapping verbs) and thinking (thinking verbs). We reported a left-right compatibility for trading verbs (i.e., participants were faster with their right hand while detecting verb referring to a monetary gain with respect to a monetary loss; and faster with their left hand while detecting a monetary loss with respect to a monetary gain). However, this pattern of result was not reported while detecting swapping verbs. Results are discussed taking into account the mental accounting theory as well as to the spatial mapping of valence hypothesis. PMID:24478662

  14. Data Quality Objectives for Tank Farms Waste Compatibility Program

    International Nuclear Information System (INIS)

    There are 177 waste storage tanks containing over 210,000 m3 (55 million gal) of mixed waste at the Hanford Site. The River Protection Project (RPP) has adopted the data quality objective (DQO) process used by the U.S. Environmental Protection Agency (EPA) (EPA 1994a) and implemented by RPP internal procedure (Banning 1999a) to identify the information and data needed to address safety issues. This DQO document is based on several documents that provide the technical basis for inputs and decision/action levels used to develop the decision rules that evaluate the transfer of wastes. A number of these documents are presently in the process of being revised. This document will need to be revised if there are changes to the technical criteria in these supporting documents. This DQO process supports various documents, such as sampling and analysis plans and double-shell tank (DST) waste analysis plans. This document identifies the type, quality, and quantity of data needed to determine whether transfer of supernatant can be performed safely. The requirements in this document are designed to prevent the mixing of incompatible waste as defined in Washington Administrative Code (WAC) 173-303-040. Waste transfers which meet the requirements contained in this document and the Double-Shell Tank Waste Analysis Plan (Mulkey 1998) are considered to be compatible, and prevent the mixing of incompatible waste

  15. Statistical analysis in dBASE-compatible databases.

    Science.gov (United States)

    Hauer-Jensen, M

    1991-01-01

    Database management in clinical and experimental research often requires statistical analysis of the data in addition to the usual functions for storing, organizing, manipulating and reporting. With most database systems, transfer of data to a dedicated statistics package is a relatively simple task. However, many statistics programs lack the powerful features found in database management software. dBASE IV and compatible programs are currently among the most widely used database management programs. d4STAT is a utility program for dBASE, containing a collection of statistical functions and tests for data stored in the dBASE file format. By using d4STAT, statistical calculations may be performed directly on the data stored in the database without having to exit dBASE IV or export data. Record selection and variable transformations are performed in memory, thus obviating the need for creating new variables or data files. The current version of the program contains routines for descriptive statistics, paired and unpaired t-tests, correlation, linear regression, frequency tables, Mann-Whitney U-test, Wilcoxon signed rank test, a time-saving procedure for counting observations according to user specified selection criteria, survival analysis (product limit estimate analysis, log-rank test, and graphics), and normal t and chi-squared distribution functions. PMID:2004275

  16. The compatibility of flexible instruments under the Kyoto Protocol

    International Nuclear Information System (INIS)

    The compatibility of the Kyoto Protocol flexible instruments and the lessons that can be learned form the AIJ-phase (AIJ stands for Activities Implemented Jointly) are discussed. The key point to be made is that there may be various applications of flexible instruments which can create situations where the various instruments would crowd out each other. On the other hand, applying flexible instruments may create a leverage for Parties in terms of achieving domestic environmental objectives. In addition, several issues related to the implementation of Joint Implementation (JI) , Clean Development Mechanism (CDM) and international emissions trading are discussed. The issues concern mainly those that have been included in the working programme on flexible instruments for CoP4 and CoP5 (CoP stands for Convention of Parties). As such the report discusses the consequences of possible negotiations outcomes at CoP for the effectiveness of flexible instruments, Parties' capabilities to achieve their Kyoto Protocol commitments cost-effectively, and the role of the private sector on the national and international credits markets(s). 106 refs

  17. Word Meaning Frequencies Affect Negative Compatibility Effects In Masked Priming.

    Science.gov (United States)

    Brocher, Andreas; Koenig, Jean-Pierre

    2016-01-01

    Negative compatibility effects (NCEs)-that is, slower responses to targets in related than unrelated prime-target pairs, have been observed in studies using stimulus-response (S-R) priming with stimuli like arrows and plus signs. Although there is no consensus on the underlying mechanism, explanations tend to locate NCEs within the motor-response system. A characteristic property of perceptuo-motor NCEs is a biphasic pattern of activation: A brief period in which very briefly presented (typically) masked primes facilitate processing of related targets is followed by a phase of target processing impairment. In this paper, we present data that suggest that NCEs are not restricted to S-R priming with low-level visual stimuli: The brief (50 ms), backward masked (250 ms) presentation of ambiguous words (bank) leads to slower responses than baseline to words related to the more frequent (rob) but not less frequent meaning (swim). Importantly, we found that slowed responses are preceded by a short phase of response facilitation, replicating the biphasic pattern reported for arrows and plus signs. The biphasic pattern of priming and the fact that the NCEs were found only for target words that are related to their prime word's more frequent meaning has strong implications for any theory of NCEs that locate these effects exclusively within the motor-response system. PMID:27152129

  18. Design of a small animal MR compatible PET scanner

    International Nuclear Information System (INIS)

    Using a combination of Monte-Carlo simulations and experimental measurements, the authors have designed a small animal MR compatible PET (McPET) scanner for simultaneous PET and MR imaging of mice and rats in vivo. The scanner consists of one ring of 480 LSO crystals arranged in 3 layers with 160 crystals per layer. The crystal dimensions are 2 x 3 x 7.5 mm3. This was based on a target resolution of 2.5 mm and simulations showing that a depth of 7.5 mm avoided significant depth of interaction effects across the desired field of view. The system diameter of 11.2 cm is large enough to accommodate the animal positioned inside a stereotactic frame. Each crystal will be coupled through 2 mm diameter optical fibers to multi-channel PMT's which reside outside the main magnetic field. Through 50 cm of optical fiber, a photopeak is clearly seen and the measured energy resolution is 25%. Prototype optical fiber connectors have been tested to increase the flexibility of the system and result in a light loss of only 6%. The proposed system will have adequate resolution and sensitivity for a number of applications in small animals and will be the first practical device for simultaneous in vivo imaging with PET and MR

  19. Electromagnetic compatibility of implantable neurostimulators to RFID emitters

    Directory of Open Access Journals (Sweden)

    Guag Joshua W

    2011-06-01

    Full Text Available Abstract Background The objective of this study is to investigate electromagnetic compatibility (EMC of implantable neurostimulators with the emissions from radio frequency identification (RFID emitters. Methods Six active implantable neurostimulators with lead systems were tested for susceptibility to electromagnetic fields generated by 22 RFID emitters. These medical devices have been approved for marketing in the U.S. for a number of intended uses that include: epilepsy, depression, incontinence, Parkinsonian tremor and pain relief. Each RFID emitter had one of the following carrier frequencies: 125 kHz, 134 kHz, 13.56 MHz, 433 MHz, 915 MHz and 2.45 GHz Results The test results showed the output of one of the implantable neurostimulators was inhibited by 134 kHz RFID emitter at separation distances of 10 cm or less. The output of the same implantable neurostimulator was also inhibited by another 134 kHz RFID emitter at separation distances of 10 cm or less and also showed inconsistent pulsing rate at a separation distance of 15 cm. Both effects occurred during and lasted through out the duration of the exposure. Conclusions The clinical significance of the effects was assessed by a clinician at the U.S. Food and Drug Administration. The effects were determined to be clinically significant only if they occurred for extended period of time. There were no observed effects from the other 5 implantable neurostimulators or during exposures from other RFID emitters.

  20. CMOS compatible IR sensors by cytochrome c protein

    Science.gov (United States)

    Liao, Chien-Jen; Su, Guo-Dung

    2013-09-01

    In recent years, due to the progression of the semiconductor industrial, the uncooled Infrared sensor - microbolometer has opened the opportunity for achieving low cost infrared imaging systems for both military and commercial applications. Therefore, various fabrication processes and different materials based microbolometer have been developed sequentially. The cytochrome c (protein) thin film has be reported high temperature coefficient of resistance (TCR), which is related to the performance of microbolometer directly. Hence the superior TCR value will increase the performance of microbolometer. In this paper, we introduced a novel fabrication process using aluminum which is compatible with the Taiwan Semiconductor Manufacture Company (TSMC) D35 2P4M process as the main structure material, which benefits the device to integrate with readout integrated circuit (ROIC).The aluminum split structure is suspended by sacrificial layer utilizing the standard photolithography technology and chemical etching. The height and thickness of the structure are already considered. Besides, cytochrome c solutions were ink-jetted onto the aluminum structure by using the inkjet printer, applying precise control of the Infrared absorbing layer. In measurement, incident Infrared radiation can be detected and later the heat can be transmitted to adjacent pads to readout the signal. This approach applies an inexpensive and simple fabrication process and makes the device suitable for integration. In addition, the performance can be further improved with low noise readout circuits.

  1. Lubricants for HFC-134a Compatible Rotary Compressors

    Science.gov (United States)

    Takaichi, Kenji; Sakai, Hisakazu

    In replacing CFC-12 with HFC-134a for refrigerator compressors, the compatibility with lubricating oil, and lubrication in general, are of major concern. HFC-134a dose not have adequate solubility with current lubricating oils because of its molecular structure. Current oils also do not provide enough lubricating action when using HFC-134a. A new oil and new materials have to be utilized in order to use HFC-134a. Developing a new lubricating oil involved numerous tests of different combinations of many polyolester synthetic oils and additives. One of the pre-evaluated methods was pursued via sealed tube tests. Lubricated parts were selected by studies involving a plane-on-roller type of wear test machine and by analyzing the traces of acid material commonly created during the lubricating action. The matrices of new lubricating oils and new lubricated materials were estimated based on durability tests conducted on compressors and refrigerators. Results showed that polyolester synthetic oils having a low total acid value and including certain quantities of additives did not break down into a tar-like substance and they did not produce composite particles in the operating compressors and refrigerators. The study also found that ceramics and anti-corrosion alloy steel possessed good adrasion-reducing qualities. Based on our evaluation, we will implement compressor reliability tests and apply HFC-134a to rotary compressors for refrigerators.

  2. Undergraduate nursing students' compatibility with the nursing profession

    Directory of Open Access Journals (Sweden)

    Dianati Mansur

    2005-07-01

    Full Text Available Abstract Background The high rate of attrition among nursing students has caused some nursing leaders to think about the necessity of considering students' personality during the process of admission into nursing schools. Due to the lack of studies on Iranian nursing students' personality traits, this study was designed to assess freshmen nursing students' personality characteristics and their compatibility with the demands of the nursing profession. Methods A descriptive study was conducted at Tehran and kashan medical universities and one of the branches of Azad University. Convenience sampling was used and 52 freshmen nursing students were assessed using Holland's Vocational Interests Inventory. Results From the total participants 63.5% were females and 36.5% were males. Based on the Holland's Vocational Interests Inventory 44% did not have appropriate personality characteristics for the nursing profession. 77% of the nursing students participating in the study reported that they lacked information about nursing. Conclusion It seems that personality tests can help to select the best students for nursing schools from those who show good academic capabilities. This would decrease the rate of attrition and could improve the quality of care.

  3. Blood compatibility of gas plasma-treated diamond-like carbon surface-Effect of physicochemical properties of DLC surface on blood compatibility

    International Nuclear Information System (INIS)

    From the knowledge that zwitterion-type polymers show good blood compatibility, the introduction of both cationic and anionic functional groups onto diamond-like carbon (DLC) surface is expected to improve blood compatibility. Thus, DLC films were treated with oxygen and ammonia gas plasmas. The surfaces were characterized in terms of chemical composition by XPS, contact angle, and zeta potential. XPS analysis showed the introductions of a carboxyl group by oxygen plasma treatment and nitrogen atoms by ammonia plasma treatment. The evaluation of blood compatibility for the DLC surfaces was carried out in terms of platelets and the coagulation system. Excellent improvement of platelet compatibility was observed by the treatment with the gas plasmas, regardless of the plasma species. As for the compatibility with the coagulation system, DLC surfaces with a high concentration of carboxyl groups (COOH) markedly activated the system via the intrinsic pathway. However, the surfaces treated with ammonia plasma did not activate the system even though they had high COOH concentration. Measurement of the zeta potential revealed that the ammonia plasma treatment raised the potential from a negative value to a positive one. Though the introduction of amino groups to the surface was not detected directly, the treatment of ammonia plasma changed the electrical state of the DLC surface having COOH group, causing a difference in blood compatibility among the DLCs obtained by various plasma conditions.

  4. Study of blood compatibility with poly(2-methoxyethyl acrylate). Relationship between water structure and platelet compatibility in poly(2-methoxyethylacrylate-co-2-hydroxyethylmethacrylate).

    Science.gov (United States)

    Tanaka, Masaru; Mochizuki, Akira; Ishii, Naoki; Motomura, Tadahiro; Hatakeyama, Tatsuko

    2002-01-01

    Previously, we reported that poly(2-methoxyethylacrylate) (PMEA) showed excellent blood compatibility and implied that the water structure in PMEA contributed to the blood compatibility. In this study, the relationship between the water structure and the blood compatibility is clarified by studying the influence of the monomer composition of poly(MEA-co-HEMA) on the water structure and the blood compatibility of the copolymers. The water in the polymer was classified into three types: free water, freezing bound water, and nonfreezing water. The polymers with 0-30 mol % of HEMA content had a significant amount of freezing bound water, and the amount decreases greatly when the composition of HEMA exceeded 30 mol %. On the other hand, the amount of other water increased simply with an increase of HEMA content. The evaluation of the platelet compatibility of poly(MEA-co-HEMA) revealed that the adhesion number and the morphological change of platelet on the copolymer surface were least when the HEMA content was 0-20 mol %. These two results strongly suggest that the freezing bound water relates to the platelet compatibility of the polymers. PMID:11866553

  5. 76 FR 39095 - Compatibility of Underground Storage Tank Systems With Biofuel Blends

    Science.gov (United States)

    2011-07-05

    ... operators to use the American Petroleum Institute's (API) Recommended Practice 1626, an industry code of practice, to meet the compatibility requirement for ethanol-blended fuels. The original version of API 1626... practice has been for tank owners to demonstrate compatibility by using equipment that is certified...

  6. 76 FR 23824 - Guidance for Industry: “Computer Crossmatch” (Computerized Analysis of the Compatibility Between...

    Science.gov (United States)

    2011-04-28

    ...The Food and Drug Administration (FDA) is announcing the availability of a document entitled ``Guidance for Industry: `Computer Crossmatch' (Computerized Analysis of the Compatibility between the Donor's Cell Type and the Recipient's Serum or Plasma Type)'' dated April 2011. The guidance document provides blood establishments that perform compatibility testing using a computer crossmatch......

  7. Study on the Compatibility of SMA and Composite Materials by Holographic Interferometry

    Institute of Scientific and Technical Information of China (English)

    ZHAO Zhimin

    2000-01-01

    With the help of holographic interferometry a study is conducted on the compatibility of SMA (shape memory alloy) and epoxy resin composite material. The paper gives experiment results and analysis which show that after coupling SMA with the composite material, the flexural rigidity of composite material is somewhat reinforced. Under certain conditions, SMA and the epoxy resin composite material are compatible.

  8. 47 CFR 68.317 - Hearing aid compatibility volume control: technical standards.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 3 2010-10-01 2010-10-01 false Hearing aid compatibility volume control... for Terminal Equipment Approval § 68.317 Hearing aid compatibility volume control: technical standards. (a) An analog telephone complies with the Commission's volume control requirements if the...

  9. 75 FR 78799 - Noise Compatibility Program Notice, Fort Worth Alliance Airport, Fort Worth, TX

    Science.gov (United States)

    2010-12-16

    ... Federal Aviation Administration Noise Compatibility Program Notice, Fort Worth Alliance Airport, Fort... 5, 2009. On December 1, 2010, the FAA approved the Fort Worth Alliance Airport noise compatibility... Date: The effective date of the FAA's approval of the Fort Worth Alliance Airport noise...

  10. 46 CFR 153.436 - Heat transfer fluids: compatibility with cargo.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 5 2010-10-01 2010-10-01 false Heat transfer fluids: compatibility with cargo. 153.436... Equipment Cargo Temperature Control Systems § 153.436 Heat transfer fluids: compatibility with cargo. A heat transfer fluid separated from the cargo by only one wall (for example, the heat transfer fluid in a...

  11. Incorporating Ecologically Relevant Measures of Pesticide Effect for Estimating the Compatibility of Pesticides and Biocontrol Agents

    Science.gov (United States)

    The compatibility of biological control agents with pesticides is a central concern in integrated pest management programs. The most common assessments of compatibility consist of simple comparisons of acute toxicity among pest species and select biocontrol agents. A more sophisticated approach, d...

  12. 77 FR 32712 - Technical Report: Evaluation of the Enhancing Vehicle-to-Vehicle Crash Compatibility Agreement...

    Science.gov (United States)

    2012-06-01

    ...This notice announces NHTSA's publication of a Technical Report reviewing and evaluating the Enhancing Vehicle-to-Vehicle Crash Compatibility Agreement. The report's title is: Evaluation of the Enhancing Vehicle-to-Vehicle Crash Compatibility Agreement: Effectiveness of the Primary and Secondary Energy-Absorbing Structures on Pickup Trucks and...

  13. 75 FR 48411 - Noise Compatibility Program Notice; Fort Worth Alliance Airport, Fort Worth, TX

    Science.gov (United States)

    2010-08-10

    ... Federal Aviation Administration Noise Compatibility Program Notice; Fort Worth Alliance Airport, Fort... Administration (FAA) announces that it is reviewing a proposed noise compatibility program that was submitted for... Noise Abatement Act, hereinafter referred to as ``the Act'') and 14 CFR Part 150 by the city of...

  14. 78 FR 64264 - Receipt of Noise Compatibility Program and Request for Review; Southwest Florida International...

    Science.gov (United States)

    2013-10-28

    ... Federal Aviation Administration Receipt of Noise Compatibility Program and Request for Review; Southwest... Noise Compatibility Program that was submitted for Southwest Florida International Airport under the provisions of 49 U.S.C. 47504 et seq (the Aviation Safety and Noise Abatement Act hereinafter referred to...

  15. Same-Sex Dyads and Toman's Theory of Birth-Order Compatability.

    Science.gov (United States)

    Scheidt, Rick J.

    Toman's theory of the relation of birth-order compatibility and interpersonal relations was extended to dyads (pairs) with members of the same sex. It was predicted that interpersonal compatibility between members of same-sex dyads (50 female, 27 male pairs of Vassar College roommates) would be positively correlated with birth-order compatibility…

  16. 32 CFR 256.8 - Land use compatibility guidelines for accident potential.

    Science.gov (United States)

    2010-07-01

    ... 4170.7, “Natural Resources—Forest Management,” June 21, 1965 (32 CFR 233) and DoD Instruction 7310.1... 32 National Defense 2 2010-07-01 2010-07-01 false Land use compatibility guidelines for accident... guidelines for accident potential. Zones and Footnotes—Land Use Category Compatibility 1 Clear zone APZ I...

  17. From Sunshine to Double Arrows: An Evaluation Window Account of Negative Compatibility Effects

    Science.gov (United States)

    Klauer, Karl Christoph; Dittrich, Kerstin

    2010-01-01

    In category priming, target stimuli are to be sorted into 2 categories. Prime stimuli preceding targets typically facilitate processing of targets when primes and targets are members of the same category, relative to the case in which both stem from different categories, a positive compatibility effect (PCE). But negative compatibility effects…

  18. High-temperature compatibility study of iridium (DOP-26 alloy) with graphite and plutonia

    International Nuclear Information System (INIS)

    This report outlines the materials compatibility tests conducted on DOP-26 iridium alloy and carbon. The carbon used was in the form of woven graphite as present in the impact shell used to encase plutonia in nuclear heat sources. In addition, compatibility tests of the DOP-26 alloy with plutonia are described. The reactivity observed in both systems is discussed. 4 refs., 6 figs

  19. SILICON COMPATIBLE ACOUSTIC WAVE RESONATORS: DESIGN, FABRICATION AND PERFORMANCE

    Directory of Open Access Journals (Sweden)

    Aliza Aini Md Ralib

    2014-12-01

    Full Text Available ABSTRACT: Continuous advancement in wireless technology and silicon microfabrication has fueled exciting growth in wireless products. The bulky size of discrete vibrating mechanical devices such as quartz crystals and surface acoustic wave resonators impedes the ultimate miniaturization of single-chip transceivers. Fabrication of acoustic wave resonators on silicon allows complete integration of a resonator with its accompanying circuitry.  Integration leads to enhanced performance, better functionality with reduced cost at large volume production. This paper compiles the state-of-the-art technology of silicon compatible acoustic resonators, which can be integrated with interface circuitry. Typical acoustic wave resonators are surface acoustic wave (SAW and bulk acoustic wave (BAW resonators.  Performance of the resonator is measured in terms of quality factor, resonance frequency and insertion loss. Selection of appropriate piezoelectric material is significant to ensure sufficient electromechanical coupling coefficient is produced to reduce the insertion loss. The insulating passive SiO2 layer acts as a low loss material and aims to increase the quality factor and temperature stability of the design. The integration technique also is influenced by the fabrication process and packaging.  Packageless structure using AlN as the additional isolation layer is proposed to protect the SAW device from the environment for high reliability. Advancement in miniaturization technology of silicon compatible acoustic wave resonators to realize a single chip transceiver system is still needed. ABSTRAK: Kemajuan yang berterusan dalam teknologi tanpa wayar dan silikon telah menguatkan pertumbuhan yang menarik dalam produk tanpa wayar. Saiz yang besar bagi peralatan mekanikal bergetar seperti kristal kuarza menghalang pengecilan untuk merealisasikan peranti cip. Silikon serasi  gelombang akustik resonator mempunyai potensi yang besar untuk menggantikan unsur

  20. Materials compatibility studies for the Spallation Neutron Source

    International Nuclear Information System (INIS)

    The Spallation Neutron Source (SNS) is a high power facility for producing neutrons that utilizes flowing liquid mercury inside an austenitic stainless steel container as the target for a 1.0 GeV proton beam. Type 316 SS has been selected as the container material for the mercury and consequences of exposure of 316 SS to radiation, thermal shock, thermal stress, cavitation and hot, flowing mercury are all being addressed by R and D programs. In addition, corrosion studies also include evaluation of Inconel 718 because it has been successfully used in previous spallation neutron systems as a window material. Two types of compatibility issues relative to 316 SS/mercury and Inconel 718/mercury are being examined: (1) liquid metal embrittlement (LME) and (2) temperature gradient mass transfer. Studies have shown that mercury does not easily wet type 316 SS below 275 C. In the LME experiments, attempts were made to promote wetting of the steel by mercury either by adding gallium to the mercury or coating the specimen with a tin-silver solder that the mercury easily wets. The latter proved more reliable in establishing wetting, but there was no evidence of LME in any of the constant extension rate tensile tests either at 23 or 100 C. Inconel 718 also showed no change in room temperature properties when tested in mercury or mercury-gallium. However, there was evidence that the fracture was less ductile. Preliminary evaluation of mass transfer of either type 316 SS or Inconel 718 in mercury or mercury-gallium at 350 C (maximum temperature) did not reveal significant effects. Two 5,000 h thermal convection loop tests of type 316 SS are in progress, with specimens in both hot and cold test regions, at 300 and 240 C, respectively

  1. A High Resolution Monolithic Crystal, DOI, MR Compatible, PET Detector

    Energy Technology Data Exchange (ETDEWEB)

    Robert S Miyaoka

    2012-03-06

    The principle objective of this proposal is to develop a positron emission tomography (PET) detector with depth-of-interaction (DOI) positioning capability that will achieve state of the art spatial resolution and sensitivity performance for small animal PET imaging. When arranged in a ring or box detector geometry, the proposed detector module will support <1 mm3 image resolution and >15% absolute detection efficiency. The detector will also be compatible with operation in a MR scanner to support simultaneous multi-modality imaging. The detector design will utilize a thick, monolithic crystal scintillator readout by a two-dimensional array of silicon photomultiplier (SiPM) devices using a novel sensor on the entrance surface (SES) design. Our hypothesis is that our single-ended readout SES design will provide an effective DOI positioning performance equivalent to more expensive dual-ended readout techniques and at a significantly lower cost. Our monolithic crystal design will also lead to a significantly lower cost system. It is our goal to design a detector with state of the art performance but at a price point that is affordable so the technology can be disseminated to many laboratories. A second hypothesis is that using SiPM arrays, the detector will be able to operate in a MR scanner without any degradation in performance to support simultaneous PET/MR imaging. Having a co-registered MR image will assist in radiotracer localization and may also be used for partial volume corrections to improve radiotracer uptake quantitation. The far reaching goal of this research is to develop technology for medical research that will lead to improvements in human health care.

  2. Thermal stability and environmental compatibility of Inconel 617

    International Nuclear Information System (INIS)

    The thermal stability and environmental compatibility of Inconel 617, a prime nuclear process heat steam reformer candidate alloy, are described in this paper. This commercially available wrought nickel-base alloy has excellent high-temperature strength but is subject to loss of toughness and ductility due to thermal instability. Work done to improve the thermal stability of this alloy is discussed. Room-temperature tensile and toughness data and microstructural information for Inconel 617 specimens exposed at elevated temperatures are presented. Preliminary data indicate that controlling the chemistry of Inconel 617 can provide a substantial improvement in thermal stability. Preliminary work to define the range of high-temperature gas-cooled reactor (HTGR) primary coolant compositions within which minimal deleterious gas/metal reactions occur with Inconel 617 is described. Within this gas chemistry range a stable surface oxide forms and only slight carburization occurs. In other gas chemistry ranges, rapid carburization or decarburization can occur. The gas corrosion experiments discussed are part of a series of relatively short-term exposures to HTGR helium in which the effects of different H2O concentrations (0.01 to 1.0 Pa) were determined as a function of the systematic variation of a second constituent (CO and CH4 for this work) in the test gas. The composition of the basic HTGR helium was 40 Pa H2, 4 Pa CO, 0.02 Pa CO2, 2 Pa CH4 in helium at 0.2 MPa. Two other CO levels (1 and 12 Pa) and one additional CH4 level (0.63 Pa) were used in these experiments. Experimental exposure methods are discussed and the results of gas-metal interaction studies are presented. These results include carbon analyses and optical and scanning electron microscopy to determine the morphology and type of surface and subsurface microstructures. (author). 15 refs, 6 figs, 5 tabs

  3. A new VLSI compatible rapid thermal processing system

    Science.gov (United States)

    Aitken, D.; Mehta, S.; Parisi, N.; Russo, C. J.; Schwartz, V.

    Rapid thermal processing (RTP) is increasingly becoming a significant tool to meet the challenge of fabricating miniaturized MOS and bipolar devices. The primary advantages of RTP over conventional furnace annealing include the shorter heat cycle, well-controlled soak times at peak temperatures and the capability to rapidly change anneal ambients, thereby enhancing its flexibility as a process tool. The major applications of RTP in VLSI technology that are presently being pursued include: (i) implant-damage annealing/dopant activation, (ii) silicide formation, (iii) glass reflow, (iv) thin film growth/deposition (oxides, nitrides, oxy-nitrides) and (v) contact alloying. This paper discusses a new rapid thermal processor, RTP-800/8000, recently introduced by Varian. The discussion will include mechanical and electrical design, software, heating process compatibility, process uniformity and repeatability, process setup and noncontact temperature measurement. The heating system consists of a tungsten lamp array surrounded by a highly reflective mirror system designed to provide good temperature uniformity for wafer sizes up to 200 mm. The RTP-8000 has a serial cassette-to-cassette automatic wafer handling system. The RTP-800 possesses a single wafer, operator-assisted wafer handling system. The RTP-800/8000 has an automated multiple gas flow control and also has the optional capability of processing wafers in vacuum. An infrared optical pyrometer measures the wafer temperature from the backside of the wafer. In the RTP-8000, touch screen operation of the menu-driven recipes is easy with user-friendly software. A separate electroluminescent flat panel display provides information for maintenance and servicing and reports the system status. Process information is provided on this display in the RTP-800.

  4. Compatible or incompatible?: Intelligence and human rights in terrorist trials

    Directory of Open Access Journals (Sweden)

    Quirine Eijkman

    2012-02-01

    Full Text Available

    This article focuses on the special criminal procedures for the use of intelligence in terrorism-related court cases in Canada, France, the Netherlands and the United Kingdom. Since 9/11 and the terror attacks in London and Madrid, both gathering intelligence as well as the prosecution of suspects of terrorist crimes have become strategic tools in countering terrorism. By reviewing the special procedures for the use of intelligence in terrorist trials, their compatibility with human rights standards, including the right to fair trial, is discussed. Among others concerns include: the extent to which disclosure is made possible and to who. The differences in criminal procedures for the use of intelligence in terrorist trials raise questions when intelligence information origins from a third state, in which different regulations with regard to disclosure of information apply.

  5. ES and H-compatible lubrication for duplex bearings

    Energy Technology Data Exchange (ETDEWEB)

    Steinhoff, R.G.

    1997-10-01

    Two ES and H-compatible lubricants (environment, safety, and health) for duplex bearing applications and one hybrid material duplex bearing were evaluated and compared against duplex bearings with trichlorotrifluoroethane (Freon) deposition of low molecular weight polytetrafluoroethylene (PTFE) bearing lubricant extracted from Vydax{trademark}. Vydax is a product manufactured by DuPont consisting of various molecular weights of PTFE suspended in trichlorotrifluoroethane (Freon), which is an ozone-depleting solvent. Vydax has been used as a bearing lubricant in strong link mechanisms since 1974. Hybrid duplex bearings with silicon nitride balls and molded glass-nylon-Teflon retainers, duplex bearings lubricated with sputtered MoS{sub 2} on races and retainers, and duplex bearings lubricated with electrophoretic deposited MoS{sub 2} were evaluated. Bearings with electrophoretic deposited MoS{sub 2} performed as well as bearings with Freon deposition of PTFE from Freon-based Vydax. Hybrid bearings with silicon nitride balls performed worse than bearings lubricated with Vydax, but their performance would still be acceptable for most applications. Bearings lubricated with sputtered MoS{sub 2} on the races and retainers had varying amounts of film on the bearings. This affected the performance of the bearings. Bearings with a uniform coating performed to acceptable levels, but bearings with no visible MoS{sub 2} on the races and retainers did not perform as well as bearings with the other coatings. Unless process controls are incorporated in the sputtering process or the bearings are screened, they do not appear to be acceptable for duplex bearing applications.

  6. [Sexual compatibility between two types of Hylocerus (Cactaceae)].

    Science.gov (United States)

    Castillo, Roberta; Livera, Manuel; Brechú, Alicia E; Márquez-Guzmán, Judith

    2003-01-01

    There are two types of pitahaya that are cultivated in Yucatan Peninsula of Mexico. They differ mainly in the skin color of the fruit, one of them has a red skin (Uqroo1), while the other has a light yellow skin (Uqroo2) both belong to Hylocereus undatus (Haworth) Britt. & Rose. The yellow skin pitahaya is the sweetest. The studies were conducted using the methods of self pollination and cross pollination, with direct crosses and reciprocal pollination in order to evaluate the effect related to the quantity of fruits that accomplish their growing process. Some characteristic parameters of fruits, thus obtained, were used to detect the possible xenic effect. The control samples were collected from naturally pollinated flowers. The experimental design used was completely random and the experiment was repeated fifteen times. The results revealed that the Uqroo1 turned out to be self-compatible, and their fruits reached one hundred percent of development. On the other hand, Uqroo2 was self-incompatible, that is, it did not accept self pollen. The control samples of both types reached the same weight, and the fruits of the Uqroo2 produced by cross pollination had the same or more weight than the control samples. Several parameters were positively correlated. The coefficient between the number of seeds and the fruit weight was r = 0.84. The highest correlation that was found (r = 0.97) in the fruit weight and the pulp weight within both types. The fruits obtained by cross-pollination maintained the characteristic of the female progenitor. It is suggest intercalate the yellow pitahaya plants with another types or species of pitahaya, other than the Uqroo1. PMID:15162776

  7. Nuclear fusion and renewable energy forms: Are they compatible?

    International Nuclear Information System (INIS)

    Highlights: ► The integration of intermittent renewable power sources like wind and PV is in a powerful European power grid much simpler due to smoothing effects. ► The often quoted incompatibility between intermittent and base-load technologies is also much less pronounced in large scale power grids. ► Nuclear fusion in combination with renewable power sources could simplify to reach ambitious greenhouse gas reduction goals. -- Abstract: Nuclear fusion can be considered as a base-load power plant technology: High investment costs and limited operational flexibility require continuous operation. Wind and solar, on the other hand, as the putative main pillars of a future renewable energy system, are intermittent power sources. The resulting variations that occur on many different time scales require at first sight a rather flexible back-up system to balance this stochastic behavior. Fusion would appear not to be well suited for this task. The situation changes, however, if a large-scale renewable energy system is envisaged based on a transnational, or even transcontinental power grid. The present paper discusses a possible European power system in the year 2050 and beyond. A high percentage share of renewable energies and a strong power grid spanning the whole of Europe and involving neighboring countries, in particular those in North Africa, are assumed. The linear programming model URBS is used to describe the power system. The model optimizes the overall system costs and simulates power plant operation with an hourly resolution for one whole year. The geographical resolution is at least at the country level. The renewable technologies are modeled first on a more local level and then summed together at the country or regional level. The results indicate that the smoothing effects of the large-scale power grid transform the intermittent renewable supply, which is then more compatible with base-load power plants such as fusion reactors

  8. Observation on the compatible stability of injected cefoxitin sodium and dexamethasone

    Institute of Scientific and Technical Information of China (English)

    Yan-Qing Xie

    2015-01-01

    Objective:To observe the compatible stability of cefoxitin sodium in 0.9% sodium chloride injection and dexamethasone sodium phosphate. Methods:The cefoxitin sodium was compatible with dexamethasone sodium phosphate in 0.9% sodium chloride injection at 25℃. HPLC was used to determine the change of cefoxitin sodium content in the compatible liquids within 0-6 h. The appearance of pharmaceutical liquids was observed, and the change of PH value was detected.Results:No obvious change of cefoxitin sodium content in the compatible liquids within 0-6 h, and no change of PH value, appearance, and characteristics were observed. The insoluble particles conformed to the specifications.Conclusions:Cefoxitin sodium can be compatible with dexamethasone sodium phosphate in 0.9% sodium chloride injection within 6 h.

  9. [Theoretical model for compatibility of medicinal property combination of traditional Chinese medicines].

    Science.gov (United States)

    Sun, Jing; Zhang, Yan-ling; Gu, Hao; Wang, Yun

    2015-08-01

    Medicinal properties are specific attributes of traditional Chinese medicines(TCM). The medicinal property theory is an important principle for the compatibility of traditional Chinese medicines. In this paper, medicinal properties, flavors and meridian tropism were combined to represent TCM medicinal properties; and multiple medicinal properties were further combined into medicinal property combination modes. TCMs and medicinal property combination modes were divided according to their efficacies, which were regarded as the concept of inductive logic programming and finally got medicinal property combination and compatibility rules with different efficacies. These medicinal property combination and compatibility rules were used to form the theoretical model through the entity grammar system, realize the automatic reasoning process from the medicinal property combination and compatibility to the efficacies, verify the reasoning result and analyze their rationality and limitations, in order to provide new ideas for revealing the relations between the TCM compatibility rules and efficacies. PMID:26790316

  10. Compatibility of anhydride cured epoxies with hexanitroazobenzene (HNAB) and hexanitrostilbene (HNS)

    Energy Technology Data Exchange (ETDEWEB)

    Massis, T.M.; Wischmann, K.B.

    1985-01-01

    The explosives HNAB (hexanitroazobenzene) and HNS (hexanitrostilbene) have compatibility problems with amine-cured epoxy systems. A program was instituted to find compatible polymeric substitutes for use with these explosives. These polymeric materials must have rigid structures after curing for both adhesive and encapsulant applications. A promising class of epoxy materials using anhydride curing agents with various catalysts to trigger the cure reaction were developed. These polymeric systems have very good compatibility with HNS. Of those tested with HNAB, the anhydride epoxy system that used uranyl nitrate as the catalyst was found to be marginally compatible while the others were incompatible. These results indicated further studies are needed. The CRT (chemical reactivity test) was used to evaluate the compatibility of these materials. 6 references, 2 figures, 5 tables.

  11. Compatibility of anhydride cured epoxies with hexanitroazobenzene (HNAB) and hexanitrostilbene (HNS)

    International Nuclear Information System (INIS)

    The explosives HNAB (hexanitroazobenzene) and HNS (hexanitrostilbene) have compatibility problems with amine-cured epoxy systems. A program was instituted to find compatible polymeric substitutes for use with these explosives. These polymeric materials must have rigid structures after curing for both adhesive and encapsulant applications. A promising class of epoxy materials using anhydride curing agents with various catalysts to trigger the cure reaction were developed. These polymeric systems have very good compatibility with HNS. Of those tested with HNAB, the anhydride epoxy system that used uranyl nitrate as the catalyst was found to be marginally compatible while the others were incompatible. These results indicated further studies are needed. The CRT (chemical reactivity test) was used to evaluate the compatibility of these materials. 6 references, 2 figures, 5 tables

  12. Evaluating the compatibility of multi-functional and intensive urban land uses

    Science.gov (United States)

    Taleai, M.; Sharifi, A.; Sliuzas, R.; Mesgari, M.

    2007-12-01

    This research is aimed at developing a model for assessing land use compatibility in densely built-up urban areas. In this process, a new model was developed through the combination of a suite of existing methods and tools: geographical information system, Delphi methods and spatial decision support tools: namely multi-criteria evaluation analysis, analytical hierarchy process and ordered weighted average method. The developed model has the potential to calculate land use compatibility in both horizontal and vertical directions. Furthermore, the compatibility between the use of each floor in a building and its neighboring land uses can be evaluated. The method was tested in a built-up urban area located in Tehran, the capital city of Iran. The results show that the model is robust in clarifying different levels of physical compatibility between neighboring land uses. This paper describes the various steps and processes of developing the proposed land use compatibility evaluation model (CEM).

  13. Isothermal Microcalorimetric Evaluation of Compatibility of Proposed Injector Materials with High-Test Hydrogen Peroxide Propellant

    Science.gov (United States)

    Gostowski, Rudy

    2003-01-01

    High-test hydrogen peroxide (HTP) is receiving renewed interest as a monopropellant and as the oxidizer for bipropellant systems. HTP is hydrogen peroxide in concentrations ranging from 70 to 98%. All surfaces wetted by HTP must be evaluated for compatibility with the fluid. In the case of tanks, lines and valves compatibility is required to preserve the HTP oxygen and energy content and to avoid overpressurization due to decomposition. With injectors and regenerative cooling passages shorter exposure time reduces these concerns. However, phase changes from fluid to gas impact heat transfer and become the dominant compatibility concern. Isothermal microcalorimetry (IMC) provides a convenient and reproducible means to observe the decomposition of HTP when exposed to structural materials and therefore the compatibility of those materials'. The instrument provides heat flow values in terms of watts that may be converted to a reaction rate given the heat of reaction for the decomposition of hydrogen peroxide. These values are then converted to percent active oxygen loss per week (%AOL/wk) to preserve an earlier convention for quantifying HTP compatibility. Additionally, qualitative designations of compatibility have been assigned to these values. This scheme consists of four classes with Class 1 being the most compatible. While historical compatibility data is available its current applicability is in question due to subtle changes in the compositions of both HTP and structural materials. Trace levels of molecules can have significant influence on compatibility. Therefore representative samples of materials must be evaluated with current HTP formulations. In this work seven materials were selected for their strength characteristics at high temperature as expected in a HTP injector. The materials were then evaluated by IMC for HTP compatibility.

  14. Semantic Web Compatible Names and Descriptions for Organisms

    Science.gov (United States)

    Wang, H.; Wilson, N.; McGuinness, D. L.

    2012-12-01

    Modern scientific names are critical for understanding the biological literature and provide a valuable way to understand evolutionary relationships. To validly publish a name, a description is required to separate the described group of organisms from those described by other names at the same level of the taxonomic hierarchy. The frequent revision of descriptions due to new evolutionary evidence has lead to situations where a single given scientific name may over time have multiple descriptions associated with it and a given published description may apply to multiple scientific names. Because of these many-to-many relationships between scientific names and descriptions, the usage of scientific names as a proxy for descriptions is inevitably ambiguous. Another issue lies in the fact that the precise application of scientific names often requires careful microscopic work, or increasingly, genetic sequencing, as scientific names are focused on the evolutionary relatedness between and within named groups such as species, genera, families, etc. This is problematic to many audiences, especially field biologists, who often do not have access to the instruments and tools required to make identifications on a microscopic or genetic basis. To better connect scientific names to descriptions and find a more convenient way to support computer assisted identification, we proposed the Semantic Vernacular System, a novel naming system that creates named, machine-interpretable descriptions for groups of organisms, and is compatible with the Semantic Web. Unlike the evolutionary relationship based scientific naming system, it emphasizes the observable features of organisms. By independently naming the descriptions composed of sets of observational features, as well as maintaining connections to scientific names, it preserves the observational data used to identify organisms. The system is designed to support a peer-review mechanism for creating new names, and uses a controlled

  15. Thermodynamic analysis of chemical compatibility of several compounds with Fe-Cr-Al alloys

    Science.gov (United States)

    Misra, Ajay K.

    1993-01-01

    Chemical compatibility between Fe-19.8Cr-4.8Al (weight percent), which is the base composition for the commercial superalloy MA956, and several carbides, borides, nitrides, oxides, and silicides was analyzed from thermodynamic considerations. The effect of addition of minor alloying elements, such as Ti, Y, and Y2O3, to the Fe-Cr-Al alloy on chemical compatibility between the alloy and various compounds was also analyzed. Several chemically compatible compounds that can be potential reinforcement materials and/or interface coating materials for Fe-Cr-Al based composites were identified.

  16. Thermodynamic analysis of chemical compatibility of several reinforcement materials with niobium aluminides. Final contractor report

    International Nuclear Information System (INIS)

    Chemical compatibility of several reinforcement materials with three niobium aluminides, Nb3Al, Nb2Al, and NbAl3, were examined from thermodynamic considerations. The reinforcement materials considered in this study include carbides, borides, nitrides, oxides, silicides, and Engel-Brewer compounds. Thermodynamics of the Nb-Al system were reviewed and activities of Nb and Al were derived at desired calculation temperatures. Criteria for chemical compatibility between the reinforcement material and Nb-Al compounds have been defined and several chemically compatible reinforcement materials have been identified

  17. Waste compatibility safety issues and final results for tank 241-SY-102 grab samples

    International Nuclear Information System (INIS)

    Three grab samples (2SY-96-1, 2SY-96-2, and 2SY-96-3) were taken from Riser 1A of Tank 241-SY 102 on January 14, 1997, and received by 222-S Laboratory on January 14, 1997. These samples were analyzed in accordance with Compatibility Grab Sampling and Analysis Plan (TSAP) and Data Quality Objectives for Tank Farm Waste Compatibility Program (DQO) in support of the Waste Compatibility Program. No notifications were required based on sample results. Acetone analysis was not performed in accordance with Cancellation of Acetone Analysis for Tank 241-SY-102 Grab Samples

  18. 60-Day waste compatibility safety issues and final results for AY-102 grab samples

    Energy Technology Data Exchange (ETDEWEB)

    Nuzum, J.L.

    1997-01-31

    Four grab samples (2AY-96-15, 2AY-96-16, 2AY-96-17, and 2AY-96-18) were taken from Riser 15D of Tank 241-AY-102 on October 8, 1996, and received by 222-S Laboratory on October 8, 1996. These samples were analyzed in accordance with Compatibility Grab Sampling and Analysis Plan (TSAP) and Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) in support of the Waste Compatibility Program. No notifications were required based on sample results.

  19. Thermodynamic analysis of chemical compatibility of ceramic reinforcement materials with niobium aluminides

    Science.gov (United States)

    Misra, Ajay K.

    1990-01-01

    Chemical compatibility of several reinforcement materials with three niobium aluminides, Nb3Al, Nb2Al, and NbAl3, were examined from thermodynamic considerations. The reinforcement materials considered in this study include carbides, borides, nitrides, oxides, silicides, and Engel-Brewer compounds. Thermodynamics of the Nb-Al system were reviewed and activities of Nb and Al were derived at desired calculation temperatures. Criteria for chemical compatibility between the reinforcement material and Nb-Al compounds have been defined and several chemically compatible reinforcement materials have been identified.

  20. Thermodynamic analysis of chemical compatibility of several reinforcement materials with niobium aluminides

    Science.gov (United States)

    Misra, Ajay K.

    1989-01-01

    Chemical compatibility of several reinforcement materials with three niobium aluminides, Nb3Al, Nb2Al, and NbAl3, were examined from thermodynamic considerations. The reinforcement materials considered in this study include carbides, borides, nitrides, oxides, silicides, and Engel-Brewer compounds. Thermodynamics of the Nb-Al system were reviewed and activities of Nb and Al were derived at desired calculation temperatures. Criteria for chemical compatibility between the reinforcement material and Nb-Al compounds have been defined and several chemically compatible reinforcement materials have been identified.

  1. The Mars Environmental Compatibility Assessment MECA Abrasion Tool

    Science.gov (United States)

    Kuhlman, K. R.; Anderson, M. S.; Hinde, B. D.; Hecht, M. H.; Pike, W. T.; Marshall, J.; Meloy, T. P.; Cobbly, T.

    1999-09-01

    The Mars Environmental Compatibility Assessment (MECA) experiment, an instrument suite to be flown on Mars Surveyor 2001, will include a tool for doing simple mineralogical scratch and streak tests on particles from the Martian regolith. The Abrasion Tool will be applied to particles that adhere to highly polished substrates of various hardnesses. Granular soil components will be subjected to a compressive force of about 3 N using a leaf spring. The spring will be applied with a paraffin actuator capable of a 0.76 mm throw to achieve a maximum displacement of about 7.5 mm at the tip of the tool. The pressure per grain will be dependent on the grain size, the number of grains that adhere to the substrate and the number of grains in compression. The pressure per particle is expected to be on the order of 100 MPa - 1 GPa. The MECA sample wheel containing the substrates will be rotated after the particles are placed in compression to produce scratches or pits. A primary goal of the Abrasion Tool is to identify quartz (Mohs' hardness = 7) using substrates of varying hardnesses. Quartz is considered hazardous to future human explorers of Mars because it can cause silicosis of the lungs if it is of respirable size. It is also hazardous to machinery, structures, and space suits because of its ability to abrade and scratch surfaces. Since large quantities of minerals harder than quartz are not expected, any scratches produced on polished quartz substrates might be reasonably attributed to quartz particles, although there may be minerals such as impact metamorphic diamond in the soils. Careful calibration of the tool will be necessary to ensure that grains are not overloaded; for example, a steel ball pressed into glass will produce a Hertzian fracture, even though it is softer than glass. Other minerals, such as magnetite (Mohs'hardness = 6.5) have been shown to scratch glass ceramics such as Zerodur (Mohs' hardness = 6.5). Thus, minerals can be differentiated: note that

  2. Compatibility performance as a fundamental requirement for the repair of concrete structures with Self-Compacting Repair Mortars

    OpenAIRE

    Courard, Luc; Bissonnette, Benoît

    2007-01-01

    Durable adhesion of repair material on concrete substrate requires compatibility between the materials to be bonded. There are four main compatibility components to be addressed in any concrete repair scenario: dimensional, permeability, chemical and electrochemical compatibility. Among those, dimensional compatibility is often prevalent: while a cement-base repair material inevitably undergoes shrinkage, the substrate opposes to its free movement, a situation that can lead to cracking and, ...

  3. Microgravity Compatible Gas-Liquid Separation using Capillary Pressure Gradients Project

    Data.gov (United States)

    National Aeronautics and Space Administration — An innovative microgravity and hypogravity compatible Gas-Liquid Separator (GLS) is proposed. This novel GLS consists of an ordered array of variable sized water...

  4. A CT-, PET- and MR-imaging-compatible hyperbaric pressure chamber for baromedical research

    DEFF Research Database (Denmark)

    Hansen, Kasper; Søvsø Szocska Hansen, Esben; Tolbod, Lars P;

    2015-01-01

    OBJECTIVES: We describe the development of a novel preclinical rodent-sized pressure chamber system compatible with computed tomography (CT), positron emission tomography (PET) and magnetic resonance imaging (MRI) that allows continuous uncompromised and minimally invasive data acquisition throug...

  5. Mining Compatibility Rules from Irregular Chinese Traditional Medicine Database by Apriori Agorithm

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    This paper aims to mine the knowledge and rules on compatibility of drugs from the prescriptions for curing arrhythmia in the Chinese traditional medicine database by Apriori algorithm. For data preparation, 1 113 prescriptions for arrhythmia, including 535herbs (totally 10884 counts of herbs) were collected into the database. The prescription data were preprocessed through redundancy reduction, normalized storage, and knowledge induction according to the pretreatment demands of data mining. Then the Apriori algorithm was used to analyze the data and form the related technical rules and treatment procedures. The experimental result of compatibility of drugs for curing arrhythmia from the Chinese traditional medicine database shows that the prescription compatibility obtained by Apriori algorithm generally accords with the basic law of traditional Chinese medicine for arrhythmia. Some special compatibilities unreported were also discovered in the experiment, which may be used as the basis for developing new prescriptions for arrhythmia.

  6. Project W-314 Polyurea Special Protective Coating (SPC) Test Plan Chemical Compatibility and Physical Characteristics Testing

    International Nuclear Information System (INIS)

    This Test Plan outlines the testing to be done on the Special Protective Coating (SPC) Polyurea which includes: Tank Waste Compatibility, Decontamination Factor Testing, and Adhesion Strength Testing after a sample has been exposed to Radiation

  7. Compatibility Determination [Monitoring and Collection of Black Flies and Other Insects Attracted to Carbon Dioxide

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This document provides the compatibility determination for research by the International Crane Foundation to deploy carbon dioxide traps to monitor insect...

  8. Plug-and-Play Compatibility for CubeSat Attitude Determination and Control Systems Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The development of Plug-and-play Compatibility for CubeSat Attitude Determination and Control Systems (ADACS) is proposed. Existing Maryland Aerospace (MAI) ADACS...

  9. Pesticide compatibility with natural enemies for pest management in greenhouse gerbera daisies.

    Science.gov (United States)

    Abraham, Cheri M; Braman, S K; Oetting, R D; Hinkle, N C

    2013-08-01

    Pesticides commonly used in commercial greenhouse management were evaluated for compatibility with two biological control agents: a leafminer parasitoid (Diglyphus isaea [Walker]), and a predatory mite (Neoseiulus californicus [McGregor]). These natural enemies were exposed to miticides, fungicides, and insecticides targeting leafminers, thrips, and whiteflies, according to label directions in laboratory vial assays, after which mortality at 12, 24, and 48 h was recorded. Greater mortality of predatory mites than leafminer parasitoids was observed overall, illustrating that fewer pesticides were compatible with predatory mites compared with the parasitoid. However, some commonly used pesticides were found to cause high mortality to both the leafminer parasitoid and predatory mites. Twospotted spider mite (Tetranychus urticae Koch) infestations often disrupt leafminer (Liriomyza trifolii [Burgess]) biocontrol programs. Therefore, potentially compatible miticides (bifenazate, hexythiazox, spiromesifen, acequinocyl, etoxazole, and clofentezine) identified in laboratory trials were also evaluated in a greenhouse study and found to be compatible with leafminer biocontrol. PMID:24020270

  10. INPE LANDSAT-D thematic mapper computer compatible tape format specification

    Science.gov (United States)

    Parada, N. D. J. (Principal Investigator); Desouza, R. C. M.

    1982-01-01

    The format of the computer compatible tapes (CCT) which contain Thematic Mapper (TM) imagery data acquired from the LANDSAT D and D Prime satellites by the INSTITUTO DE PERSQUISAS ESPACIALS (CNPq-INPE/BRAZIL) is defined.

  11. A model of the immune-compatibility using the install problem in computer science

    Science.gov (United States)

    Díaz, Felipe

    2014-05-01

    We simulate the immune compatibility using the Install Problem: The idea is to define a Boolean variable for each antibody. This variable is true if the antibody must be in the immune system. The Install Problem refers to the incompatibility that some programs may have with an specific operative system making it impossible to be installed. The analysis was implemented using SMT-solvers, specifically Z3, and the code was wrote using the commands "DependsOn", "Conflict" and "Compatibility_check", making it possible to check the antibody compatibility. The programming languages used to build up the code were Z3-Python and Z3-SMT-Lib. The results can be used in systems biology and in the analysis of immunological therapies. As future line of research it could be developed a more complex algorithm to verify the immunological compatibility.

  12. 68 FR 2278 - Commercial Availability of Navigation Devices; Compatibility Between Cable Systems and Consumer...

    Science.gov (United States)

    2003-01-16

    ...), 65 FR 58255, September 28, 2000. In its Compatibility Between Cable Systems and Consumer Electronics.... See Electronic Filing of Documents in Rulemaking Proceedings, 63 FR 24121 (1998). 9. Comments filed... Systems and Consumer Electronics Equipment AGENCY: Federal Communications Commission. ACTION:...

  13. On the Compatibility Between Quantum and Relativistic Effects in an Electromagnetic Bridge Theory

    CERN Document Server

    Auci, Massimo

    2010-01-01

    The Dipolar Electromagnetic Source (DEMS) model, based on the Poynting Vector Conjecture, conduces in Bridge Theory to a derivation of the Lorentz transformation connecting pairs of events. The results prove a full compatibility between quantum and relativistic effects.

  14. Compatibility of entomopathogenic nematodes (Nematoda: Rhabditida with insecticides used in the tomato crop

    Directory of Open Access Journals (Sweden)

    Paulo Henrique de Siqueira Sabino

    2014-07-01

    Full Text Available Entomopathogenic nematodes (EPNs are agents that can be used for the biological control of pests associated with insecticides in a tank mix. Compatibility studies need to be conducted to analyze which products are compatible with nematodes. The aim of this work was to evaluate the compatibility between EPNs and the insecticides that are most used on the tomato crop, and to correlate the toxicological classification of the chemical products with two species of EPNs that have the potential to control tomato leaf miner, Tuta absoluta. Among the products tested, Certero (triflumuron, Decis (deltamethrin, Previcur (dimethylamino-propyl, Ampligo (lambdacyhalothrin + chlorantranilprole, Premio (clorantranilprole, Engeo Pleno (thiamethoxam + lambda-cyhalothrin were compatible (IOBC class 1 with both nematode species.

  15. S-R compatibility effects on motor potentials associated with hand and foot movements.

    Science.gov (United States)

    Miller, Jeff

    2016-04-01

    Two four-choice reaction time (RT) experiments used the lateralized readiness potential (LRP) and the limb selection potential (LSP) to assess the effects of spatial S-R compatibility on motor processes. Individual stimuli were presented at one corner of a square centered at fixation, and each response was made with the left or right hand or foot. In Experiment 1, the correct response was determined by stimulus location, whereas in Experiment 2 it was determined by stimulus identity. Horizontal and vertical compatibility affected both RT and response accuracy, but the LRP and LSP results suggested that compatibility had little or no direct effect on the duration of motor processes. In addition, the results suggest that the relatively new LSP measure is a useful index of motor activation processes. Its insensitivity to horizontal stimulus artifacts makes it especially useful for studying the effects of horizontal spatial compatibility. PMID:26544150

  16. Genetic structure of the gentle Africanized honey bee population (gAHB) in Puerto Rico

    OpenAIRE

    Galindo-Cardona, Alberto; Acevedo-Gonzalez, Jenny P; Rivera-Marchand, Bert; Giray, Tugrul

    2013-01-01

    Background The Africanized honey bee is one of the most spectacular invasions in the Americas. African bees escaped from apiaries in Brazil in 1956, spread over Americas and by 1994 they were reported in Puerto Rico. In contrast to other places, the oceanic island conditions in Puerto Rico may mean a single introduction and different dynamics of the resident European and new-coming Africanized bees. To examine the genetic variation of honey bee feral populations and colonies from different lo...

  17. Design and Implementation of High Performance AHB Arbiter for on chip Bus Architecture

    Directory of Open Access Journals (Sweden)

    ASHUTOSH KUMAR SINGH,

    2011-03-01

    Full Text Available Resolution is a big issue in SOC( system On Chip while dealing with number of master trying to sense a single data bus . The ffectiveness of a system to resolve this priority resides in its ability to logical assignment of the chance to transmit data width of the data, response to the interrupts etc. The purpose of this paper is to propose the scheme to implement such a system using the specification of AMBA bus protocol .The scheme involves the typical AMBA features of ‘single clock edge transition ‘, Split transaction ‘,’several bus masters ‘, ‘burst transfer ’.The bus arbiter ensures that only one bus master at a time is allowed to initiate data ransfers. Even though the arbitration protocol is fixed, any arbitration algorithm, such as highest priority or fair access can be implemented depending on the application requirements .The design architecture is written using VHDL(Very High Speed Integrated CircuitsHardware Description Language code using Xilinx ISE Tools .The architecture is modeled and synthesized using RTL(Register Transfer Level abstraction and Implemented on Virtex2 series.

  18. Effect of the Technological Procedures on the Compatibility Characteristics of the W-Na

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    In the accelerator driven system(ADS), tungsten and fast reactor may be the one of the options as thetarget and the subcritical reactor, so it is important to research the compatibility characteristics betweenthe tungsten and sodium. Because the compatibility characteristics of the materials and medium will beeffected by many factors, such as technological procedures, the main purpose of this job is to research thecompatibility of the forging tungsten and polishing tungsten with the sodium, compare their differences,

  19. Evaluation and Usage of Browser Compatibility Tools during the Software Development Process

    OpenAIRE

    Boyaci, Burak

    2016-01-01

    The software testing process is one of the most important phases during software development to check that the developed software product meets its specified specifications/requirements. This is especially true for the software products used in the health-industry. Supported browsers can also be documented into the requirements. Thus browser compatibility testing needs to be considered, especially while performing testing on web-based software products. Browser compatibility testing is perfor...

  20. Molecular characterisation of the mechanisms of compatible solute accumulation in Listeria monocytogenes

    OpenAIRE

    Sleator, Roy D.

    2001-01-01

    The ability of the Gram-positive foodborne pathogen Listeria monocytogenes to survive and grow in environments of elevated osmolarity can be attributed, at least in part, to the accumulation of a restricted range of low molecular mass solutes compatible with cellular function. Accumulated to high internal concentrations in hyper-saline environments, compatible solutes, either transported into the cell or synthesized de novo, play a dual role: helping to stabilize protein structure and functio...

  1. Compatibility of Pretreated Coir Fibres (Cocos nucifera L.) with Portland Cement to Produce Mineral Composites

    OpenAIRE

    Ferraz, Joana M.; Cláudio H. S. Del Menezzi; Mario R. Souza; Okino, Esmeralda Y. A.; Martins, Sabrina A.

    2012-01-01

    The objectives of the present work were to evaluate the chemical compatibility between coir (Cocos nucifera L.) and cement and to study treatment methods to improve this compatibility. In the inhibition test, cement hydration temperature evolution was measured in the absence and presence of untreated and treated coir fibres (cold water, hot water and NaOH), besides the addition of 4% of CaCl2. The chemical characterization of untreated and treated coir fibres was done by determining the conte...

  2. Scheduling chains of operations on a batching machine with disjoint sets of operation compatibility

    OpenAIRE

    Brauner, Nadia; Naves, Guyslain

    2008-01-01

    We consider a scheduling problem that arises from an industrial application in chemical experimentations, where a single machine can process a fixed number of compatible jobs simultaneously. The precedence graph is restricted to be a disjoint union of chains, and the compatibility constraints are given by a partition of the tasks. Nevertheless, with these restrictions we prove the NP-completeness of the problem when the machine has a capacity of two, implying the difficulties for greater capa...

  3. Compatibility of vegetable fibers with Portland cement and its relationship with the physical properties

    OpenAIRE

    Maria L. Marques; Francisco H. M. Luzardo; Fermin G. Velasco; Luis Nieto González; Everton J. da Silva; Wellington G. de Lima

    2016-01-01

    ABSTRACT The use of vegetable fiber residue in cementitious matrices can be a sustainable technological alternative; however, it still has problems related to the chemical compatibility between the cement and the fibers. The present study evaluated the compatibility of vegetable fibers with cement using three methods of calculation and determined certain physical properties of the fibers and the curve of the temporal evolution of temperature for each composite. The surfaces of the composites ...

  4. Avionics-compatible video facial cognizer for detection of pilot incapacitation.

    Science.gov (United States)

    Steffin, Morris

    2006-01-01

    High-acceleration loss of consciousness is a serious problem for military pilots. In this laboratory, a video cognizer has been developed that in real time detects facial changes closely coupled to the onset of loss of consciousness. Efficient algorithms are compatible with video digital signal processing hardware and are thus configurable on an autonomous single board that generates alarm triggers to activate autopilot, and is avionics-compatible. PMID:16404114

  5. Comparison of various stress responses in oat in compatible and nonhost resistant interactions with rust fungi

    OpenAIRE

    Fink, Werner; Liefland, Mathias; Mendgen, Kurt

    1990-01-01

    The role of extracellular beta-1,3-glucanases and chitinases was investigated in oat leaves after infection with different rust fungi. The oat leaves (Avena sativa L .) were inoculated with the compatible rust Puccinia coronata f. sp . avenae and the two nonpathogens Puccinia recondita f. sp. tritici and Puccinia graminis f. sp. tritici. No alterations in enzyme activities were found in the compatible interaction . In the nonhost interaction with P. recondita ff sp. tritici beta-1,3-glucanase...

  6. The compatibility polymorphism in invertebrate host/trematodes interactions: research of molecular determinants

    Directory of Open Access Journals (Sweden)

    Bouchut A.

    2008-09-01

    Full Text Available The co-evolutionary dynamics that exist in many host-parasite interactions sometimes leads to compatibility polymorphism. This phenomenon is well documented in mollusc/trematodes interactions but its molecular base is unknown. In order to identify key molecules involved in this phenomenon, we developed several molecular approaches comparing compatible or incompatible strains of mollusc or parasite. These comparisons led to the identification of numerous candidate genes listed and discussed (some of them in the present review.

  7. The compatibility polymorphism in invertebrate host/trematodes interactions: research of molecular determinants

    OpenAIRE

    Bouchut A.; Roger E.; Gourbal B.; Grunau C.; Coustau C.; Mitta G.

    2008-01-01

    The co-evolutionary dynamics that exist in many host-parasite interactions sometimes leads to compatibility polymorphism. This phenomenon is well documented in mollusc/trematodes interactions but its molecular base is unknown. In order to identify key molecules involved in this phenomenon, we developed several molecular approaches comparing compatible or incompatible strains of mollusc or parasite. These comparisons led to the identification of numerous candidate genes listed and discussed (s...

  8. Profile of Intravenous Admixture Compatibility in the Intensive Care Unit (ICU) Patients

    OpenAIRE

    Sharly Dwijayanti; Sylvi Irawati; Eko Setiawan

    2016-01-01

    which may directly impact to the outcome of treatment to the Intensive Care Unit (ICU) patients. The objective of this study was to identify the profile of compatibility and incompatibility among IV admixtures given to the ICU patients. This observational research was conducted prospectively to the patients admitted in the ICU at a private hospital in Surabaya from October–December 2014. In this research, compatibility data of IV drug and its solution was compared with drug brochure and Handb...

  9. Factor of the compatibility while completing teams in rhythmic gymnastics group exercises

    Directory of Open Access Journals (Sweden)

    Nesterova Tat'yana Vladimirovna

    2009-02-01

    Full Text Available Compatibility of sportswomen is grounded as a leading factor of increase of effectiveness of competition activity of commands in group exercises of rhythmic gymnastics. It is suggested to carry out completing of commands on group exercises on the basis of complex estimation of compatibility of sportswomen on the level of their technical and physical preparedness, morphofunctions indexes, level of the functional state, likeness of psychical features of personality, psychophysiologic descriptions.

  10. Genetic compatibility and hatching success in the sea lamprey (Petromyzon marinus)

    OpenAIRE

    Rodríguez-Muñoz, Rolando; Tregenza, Tom

    2008-01-01

    Recent discussion of genetic benefits of polyandry and female mate choice has distinguished between two potential factors influencing offspring quality: (i) some males carry higher quality genes and (ii) males and females differ in their degree of genetic compatibility. We examined evidence for effects of good genes and genetic compatibility on embryonic survival of sea lamprey (Petromyzon marinus), a fish species with external fertilization that spawns in North Atlantic rivers. Using in vitr...

  11. Magnetic resonance imaging compatibility test of a cranial prosthesis with titanium screws

    Science.gov (United States)

    Jimenez, R.; Benavides, A.; Flores, D.; Hidalgo, S. S.; Solis, S. E.; Uribe, E.; Rodriguez, A. O.

    2012-10-01

    The follow-up of patients with skull prosthesis is necessary to provide adequate medical care. Skull prostheses for cranioplasty have been developed at the Faculty of Odontology of Universidad Nacional Autonoma de Mexico. We built a skull prosthesis phantom and tested for compatibility with standard magnetic resonance imaging procedures. Results showed full compatibility but susceptibility artefacts occurred due to titanium used to fix the prosthesis to the skull.

  12. Tank 241-AP-103 08/1999 Compatibility Grab Samples, Analytical Results for the Final Report

    International Nuclear Information System (INIS)

    This document is the format IV, final report for the tank 241-AP-103 (AP-103) grab samples taken in August 1999 to address waste compatibility concerns. Chemical, radiochemical, and physical analyses on the tank AP-103 samples were performed as directed in ''Compatibility Grub Sampling and Analysis Plan for Fiscal Year 1999'' (Sasaki 1999a). Any deviations from the instructions provided in the tank sampling and analysis plan (TSAP) were discussed in this narrative. No notification limits were exceeded

  13. A Replicator Dynamic and Simulation Analysis of Network Externalities and Compatibility Among Standards

    OpenAIRE

    Heinrich, Torsten

    2015-01-01

    In the presence of network externalities, compatibility and tying or bundling of standards may be employed as strategic tools. This has reportedly been done by, e.g., many competitors in ICT industries. It remains, however, less clear which mechanisms exactly are exploited and in what way. The present paper investigates the economic role of compatibility or incompatibility of tied standards for the dynamics of competition between standards. A replicator model operating on an aggregated level ...

  14. Market leadership through technology – Backward compatibility in the U.S. Handheld Video Game Industry

    OpenAIRE

    Claussen, Jörg; Kretschmer, Tobias; Spengler, Thomas

    2010-01-01

    The introduction of a new product generation forces incumbents in network industries to rebuild their installed base to maintain an advantage over potential entrants. We study if backward compatibility moderates this process of rebuilding an installed base. Using a structural model of the U.S. market for handheld game consoles, we show that backward compatibility lets incumbents transfer network effects from the old generation to the new to some extent but that it also reduces supply of new s...

  15. Compatibility of refractory alloys with space reactor system coolants and working fluids

    International Nuclear Information System (INIS)

    The bulk of this report deals with compatibility studies in liquid lithium and boiling potassium. Substantial information is also presented concerning the reactivity of niobium and tantalum alloys with residual gases in high and ultrahigh vacuum atmospheres. The remaining information, which is much less extensive, covers the compatibility behavior of molybdenum and tungsten alloys in alkali metals and a qualitative assessment of the use of refractory metals for containing helium in a closed Brayton cycle. 22 references, 29 figures, 14 tables

  16. Quantitative proteomics and transcriptomics of potato in response to Phytophthora infestans in compatible and incompatible interactions

    OpenAIRE

    Ali, Ashfaq; Alexandersson, Erik; Sandin, Marianne; Resjö, Svante; Lenman, Marit; Hedley, Pete; Levander, Fredrik; Andreasson, Erik

    2014-01-01

    Background In order to get global molecular understanding of one of the most important crop diseases worldwide, we investigated compatible and incompatible interactions between Phytophthora infestans and potato (Solanum tuberosum). We used the two most field-resistant potato clones under Swedish growing conditions, which have the greatest known local diversity of P. infestans populations, and a reference compatible cultivar. Results Quantitative label-free proteomics of 51 apoplastic secretom...

  17. Design of a 2D MRI compatible robot for performing prostate cancer treatment using therapeutic ultrasound

    OpenAIRE

    Yiallouras, Christos

    2015-01-01

    Therapeutic ultrasound is a promising treatment method for many common cancers, including prostate cancer. Magnetic resonance image (MRI) guidance of therapeutic ultrasound permits targeting and monitoring of therapy. In this thesis a prototype MRI compatible positioning device for the treatment of prostate cancer using therapeutic ultrasound is presented. The accuracy, MRI compatibility and functionality of the positioning device was evaluated in in vitro experiments (using gel phantoms and ...

  18. Comparison of formulae used in determination of graft compatibility in different grape- American grape rootstock combinations

    OpenAIRE

    Zeliha GÖKBAYRAK; SÖYLEMEZOĞLU, Gökhan; Ali ERGÜL

    2012-01-01

    Vitis vinifera L. cultivars have to be grafted on American grape rootstocks due to phylloxera and nematode damages, which makes it obligatory to determine their graft compatibility in a vineyard. For this purpose, any of four formulae developed by Perraudine, Branas, Spiegel-Roy & Lavee and Onaran was inconclusive to reliably determine the compatibility of a scion/stock combination. Therefore, it is needed to compare these results with values of pruning weight, yield and quality analyses ...

  19. Comparison of formulae used in determination of graft compatibility in different grape- American grape rootstock combinations

    OpenAIRE

    Zeliha GÖKBAYRAK; SÖYLEMEZOĞLU, Gökhan; Ali ERGÜL

    2012-01-01

    Vitis vinifera L. cultivars have to be grafted on American grape rootstocks due to phylloxera and nematode damages, which makes it obligatory to determine their graft compatibility in a vineyard. For this purpose, any of four formulae developed by Perraudine, Branas, Spiegel-Roy & Lavee and Onaran was inconclusive to reliably determine the compatibility of a scion/stock combination. Therefore, it is needed to compare these results with values of pruning weight, yield and quality analyses obta...

  20. Backward Compatibility to Sustain Market Dominance – Evidence from the US Handheld Video Game Industry

    OpenAIRE

    Claussen, Jörg; Kretschmer, Tobias; Spengler, Thomas

    2010-01-01

    The introduction of a new product generation forces incumbents in network industries to rebuild their installed base to maintain an advantage over potential entrants. We study if backward compatibility can help moderate this process of rebuilding an installed base. Using a structural model of the US market for handheld game consoles, we show that backward compatibility lets incumbents transfer network effects from the old generation to the new to some extent but that it also reduces supply of...

  1. Features of European legislation on electromagnetic compatibility of electrical and electronics equipment

    OpenAIRE

    S. F. Kashtanov

    2015-01-01

    Ukraine is in the process of integration with the European Union, it needs to reform the existing system of industrial safety in accordance with European standards. The basic features of the functioning and application of European law for the electromagnetic compatibility of electrical and electronic equipment are discussed in this paper. The main regulations of the European Union governing the electromagnetic compatibility of electrical and electronic equipment, including Directive 2004/108/...

  2. Citizens' demand for permits and Kwerel''s incentive compatible mechanism for pollution control

    OpenAIRE

    Andrew Yates; Daniel English

    2007-01-01

    An interesting feature of pollution permit markets is that citizens may purchase permits to directly lower the levels of pollution. Kwerel's mechanism (Review of Economic Studies~1977) is not incentive compatible when citizens demand permits. We show that a modification of Kwerel''s mechainism, the minimum-price mechanism, is incentive compatible when citizens demand permits, even in the case where there is uncertainty about the damages from pollution.

  3. The MSP 2001 Mars Environmental Compatibility Assessment (MECA)

    Science.gov (United States)

    Hecht, M. H.; Meloy, T. P.; Anderson, M. S.; Buehler, M. G.; Frant, M. A.; Grannan, S. M.; Fuerstenau, D.; Keller, H. U.; Markiewicz, W. J.; Marshall, J.

    1999-09-01

    The Mars Environmental Compatibility Assessment (MECA) will evaluate the Martian environment for soil and dust-related hazards to human exploration as part of the Mars Surveyor Program 2001 Lander. Sponsored by the Human Exploration and Development of Space (HEDS) enterprise, MECA's goal is to evaluate potential geochemical and environmental hazards that may confront future Martian explorers, and to guide HEDS scientists in the development of high fidelity Mars soil simulants. The integrated MECA payload contains a wet-chemistry laboratory, a microscopy station, an electrometer to characterize the electrostatics of the soil and its environment, and arrays of material patches to study the abrasive and adhesive properties of soil grains. The instrument will acquire soil samples with a robotic arm equipped with a camera. MECA will examine surface and subsurface soil and dust in order to characterize particle size, shape, hardness, and also physical characteristics that may provide clues to mineralogy. MECA will characterize soil/water mixtures with respect to pH, redox potential, total dissolved ions, and trace toxins. MECA will determine the nature of electrostatic charging associated with excavation of soil, and the influence of ionizing radiation on material properties. It will also observe natural dust accumulation on engineering materials. To accomplish these objectives, MECA is allocated a mass of 10 kg within an enclosure of 35 x 25 x 15 cm. The Wet Chemistry Laboratory (WCL) consists of four identical cells that will accept samples from surface and subsurface regions accessible to the Lander's robotic arm, mix them with water, and perform extensive analysis of the solution. Ion-selective electrodes and related sensors will evaluate total dissolved solids, redox potential, pH, and the concentration of many soluble ions and gases in wet Martian soil. These electrodes can detect potentially dangerous heavy-metal ions, emitted pathogenic gases, and the soil

  4. Attentional factors in the occurrence of stimulus-response compatibility effects.

    Science.gov (United States)

    Verfaellie, M; Bowers, D; Heilman, K M

    1988-01-01

    Two major hypotheses have been advanced to account for stimulus-response compatibility effects in the situation in which the location of the target is irrelevant for choosing the correct response. According to the attentional hypothesis, compatibility effects reflect a response bias, favoring the effector on the same side as the stimulus. According to the coding hypothesis, compatibility effects result from a correspondence between the spatial codes of the stimulus and effector. In the present study, two components of attention--selective attention and intention--were independently manipulated by providing selective preparatory information before onset of a target stimulus. Attentional information indicated where the target stimulus would occur; intentional information indicated which hand would have to be used to respond. Compatibility effects were observed only in the condition in which intentional information, but no attentional information, was provided. These findings support the attentional hypothesis and indicate that a specific aspect of attention, namely a selective readiness to respond to the stimulus, is a necessary condition for compatibility effects to occur. PMID:3374802

  5. Mixed waste chemical compatibility: A testing program for plastic packaging components

    International Nuclear Information System (INIS)

    The purpose of hazardous and radioactive materials packaging is to enable these materials to be transported without posing a threat to the health or property of the general public. To achieve this aim, regulations in the United States have been written establishing general design requirements for such packagings. While no regulations have been written specifically for mixed waste packaging, regulations for the constituents of mixed wastes, i.e., hazardous and radioactive substances, have been codified by the US Department of Transportation (DOT, 49 CFR 173) and the US Nuclear Regulatory Commission (NRC, 10 CFR 71). The design requirements for both hazardous [49 CFR 173.24 (e)(1)] and radioactive [49 CFR 173.412 (g)] materials packaging specify packaging compatibility, i.e., that the materials of the packaging at sign d any contents be chemically compatible with each other. Furthermore, Type A [49 CFR 173.412 (g)] and Type B (10 CFR 71.43) packaging design requirements stipulate that there be no significant chemical, galvanic, or other reaction between the materials and contents of the package. Based on these requirements, a Chemical Compatibility Testing Program was developed in the Transportation Systems Department at Sandia National Laboratories (SNL). The program attempts to assure any regulatory body that the issue of packaging material compatibility towards hazardous and radioactive materials has been addressed. This program has been described in considerable detail in an internal SNL document, the Chemical Compatibility Test Plan ampersand Procedure Report (Nigrey 1993)

  6. In situ forming, metal-adhesive heparin hydrogel surfaces for blood-compatible coating.

    Science.gov (United States)

    Joung, Yoon Ki; You, Seung Soo; Park, Kyung Min; Go, Dong Hyun; Park, Ki Dong

    2012-11-01

    Durable and blood-compatible coating of metallic biomaterials remains a major issue in biomedical fields despite its long history of development. In this study, in situ forming, metal-adhesive heparin hydrogels were developed to coat metallic substrates to enhance blood compatibility. The hydrogels are composed of metal-adhesive and enzyme-reactive amphiphilic block copolymer (Tetronic-tyramine/dopamine; TTD) and enzyme-reactive heparin derivatives (heparin-tyramine or heparin-polyethylene glycol-tyramine), which are cross-linkable in situ via an enzyme reaction. The combinations of heparin and Tetronic formed hydrogels with relatively high mechanical strengths of 300-5000 Pa within several tens of seconds; this was also confirmed by observing a dried porous structure as coated on a metal surface. The introduction of dopamine to the hydrogel network enhanced the durability of the hydrogel layers coated on metal, such that more than 60% heparin remained for 7 days. Compared to bare metal surfaces, hydrogel-coated metal surfaces exhibited significantly enhanced blood compatibility. Reduced fibrinogen adsorption and platelet adhesion showed that blood compatibility was 3-5-fold-enhanced on coated hydrogel layers than on the bare metal surface. In conclusion, hydrogels containing heparin and dopamine prepared by enzyme reaction have the potential to be an alternative coating method for enhancing blood compatibility of metallic biomaterials. PMID:22100384

  7. MAGNETIC RESONANCE IMAGING COMPATIBLE ROBOTIC SYSTEM FOR FULLY AUTOMATED BRACHYTHERAPY SEED PLACEMENT

    Science.gov (United States)

    Muntener, Michael; Patriciu, Alexandru; Petrisor, Doru; Mazilu, Dumitru; Bagga, Herman; Kavoussi, Louis; Cleary, Kevin; Stoianovici, Dan

    2011-01-01

    Objectives To introduce the development of the first magnetic resonance imaging (MRI)-compatible robotic system capable of automated brachytherapy seed placement. Methods An MRI-compatible robotic system was conceptualized and manufactured. The entire robot was built of nonmagnetic and dielectric materials. The key technology of the system is a unique pneumatic motor that was specifically developed for this application. Various preclinical experiments were performed to test the robot for precision and imager compatibility. Results The robot was fully operational within all closed-bore MRI scanners. Compatibility tests in scanners of up to 7 Tesla field intensity showed no interference of the robot with the imager. Precision tests in tissue mockups yielded a mean seed placement error of 0.72 ± 0.36 mm. Conclusions The robotic system is fully MRI compatible. The new technology allows for automated and highly accurate operation within MRI scanners and does not deteriorate the MRI quality. We believe that this robot may become a useful instrument for image-guided prostate interventions. PMID:17169653

  8. On The compatibility and dynamic vulcanization of Pom/Nbr blends

    International Nuclear Information System (INIS)

    Polymer blends based on polyacetal butadiene rubber were prepared by melt blending technique. The mixing parameters such ad temperature, time and speed of mixing were varied to obtain a wide range of properties. The mixing parameters were optimized by evaluating the mechanical properties of the blend over a wide range of mixing conditions. The morphology of the blend indicated a two-phase structure. This study describes an attempt to improve the tensile strength of Pom/Nbr blends by means of compatibility and dynamic vulcanization. A commercial compatibility, maleic anhydride (Ma), has been used to control the phase morphology of the blend system. Dicumyl peroxide is used to dynamically vulcanize the Nbr elastomer in the blend. The tensile strength of the compatibility systems showed improvement. Dynamic vulcanization raises elastic recovery and tensile modulus of the blends, but the elongation at break decreases

  9. Compatibility grab sampling and analysis plan for fiscal year 1999; TOPICAL

    International Nuclear Information System (INIS)

    This sampling and analysis plan (SAP) identifies characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for grab samples obtained to address waste compatibility. Analytical requirements are taken from two revisions of the Compatibility data quality objectives (DQOs). Revision 1 of the DQO (Fowler 1995) listed analyses to be performed to meet both safety and operational data needs for the Compatibility program. Revision 2A of the DQO (Mulkey and Miller 1998) addresses only the safety-related requirements; the operational requirements of Fowler (1995) have not been superseded by Mulkey and Miller (1998). Therefore, safety-related data needs are taken from Mulkey and Miller (1998) and operational-related data needs are taken from Fowler (1995). Ammonia and total alpha analyses are also performed in accordance with Fowler (1998a, 1998b)

  10. Compatibility between shape equation and boundary conditions of lipid membranes with free edges.

    Science.gov (United States)

    Tu, Z C

    2010-02-28

    Only some special open surfaces satisfying the shape equation of lipid membranes can be compatible with the boundary conditions. As a result of this compatibility, the first integral of the shape equation should vanish for axisymmetric lipid membranes, from which two theorems of nonexistence are verified: (i) there is no axisymmetric open membrane being a part of torus satisfying the shape equation; (ii) there is no axisymmetric open membrane being a part of a biconcave discodal surface satisfying the shape equation. Additionally, the shape equation is reduced to a second-order differential equation while the boundary conditions are reduced to two equations due to this compatibility. Numerical solutions to the reduced shape equation and boundary conditions agree well with the experimental data [A. Saitoh et al., Proc. Natl. Acad. Sci. U.S.A. 95, 1026 (1998)]. PMID:20192294

  11. Waste compatibility safety issues and final results for Tank 241-AP-103 grab samples

    International Nuclear Information System (INIS)

    Three grab samples (3AP-97-2, 3AP-97-3, and 3AP-97-4) were taken from Riser 1 of Tank 241-AP-103 on August 21, 1997, and received by 222-S Laboratory on August 22, 1997. These samples were analyzed in accordance with Compatibility Grab Sampling and Analysis Plan for Fiscal Year 1997 (TSAP) (Field, 1997) and Data Quality Objectives for Tank Farms Waste and Compatibility Program (Mulkey et. al., 1995) (DQO) in support of the Waste Compatibility Program. No notifications were required based on sample results. Appearance and Sample Breakdown Attachment 1 illustrates subsamples generated in the laboratory for analyses and identifies their sources. Furthermore, this reference relates tank farm identification numbers to their corresponding 222-S Laboratory Information Management System sample numbers. Table 1 summarizes appearance information and over-the-top (OTR) dose readings performed on each sample. For each sample, two 20 ml subsamples were created for inorganic and radiochemical analyses

  12. The Evaluation Technology of Web Compatibility%Web兼容性评测技术

    Institute of Scientific and Technical Information of China (English)

    刘宇

    2015-01-01

    针对Web技术在浏览器中出现的兼容性问题,文章描述在主流浏览器中测试HTML5、CSS3、Javascript兼容性的方法和工具,通过测试工具分析主流浏览器使用HTML5、CSS3、Javascript的兼容程度,为制定Web相关标准提供参考依据.%Aiming at the compatibility problem of Web technology emerging in the browser, this paper describes some methods and tools for testing HTML5, CSS3 and Javascript compatibility in the mainstream browsers, and the compatible level of HTML5, CSS3 and Javascript which are used by mainstream browsers and analyzed with testing tools. It wil provide references for developing relevant Web standards.

  13. Cultural Conflicts and Compatibility between the East and the West in The Joy Luck Club

    Institute of Scientific and Technical Information of China (English)

    王瑾

    2007-01-01

    Via a study of The Joy Luck Club, Amy Tan's first effort, this essay discusses the cultural conflicts and compatibility between the East and the West as manifested by the conflicts and compatibility between two generations of Chinese Americans in the novel. The paper argues that different living environments, different cultural heritages of the East and the West as well as different values are the main causes of the mother-daughter conflicts in the novel. The paper concludes that these causes could also be regarded as the root of the cultural conflicts between the East and the West in general. More importantly, after a series of efforts, the two generations are in harmony, which stands for the cultural compatibility between the East and the West.

  14. LARGELY IMPROVED BLOOD COMPATIBILITY OF POLYURETHANE BY BLENDING WITH FLUORINATED PHOSPHATIDYLCHOLINE POLYURETHANE

    Institute of Scientific and Technical Information of China (English)

    Xiao-qing Zhang; Xia Jiang; Jie-hua Li; Jie Liu; Hong Tan; Yin-ping Zhong; Qiang Fu

    2008-01-01

    The improvement of biocompatibility of polyurethanes was investigated. The results demonstrate that the bloodcompatibility of polyurethanes can be further improved by just simply mixing with the fluorinated phosphatidylcholinepoly(carbonate urethane)s (FPCPCUs). The solution blending was done by mixing poly(ether urethane) (PEU) with FPCPCUin different compositions. An increased blood compatibility of the blend films was observed with the increase of FPCPCUcontent, and when FPCPCU content reached to 40 wt% (40FPCPCU film), 6 times and 23 times decrease of plateletadhesion number have been achieved, compared with that of FPCPCU and PEU, respectively. More interestingly, the blendfilms showed even better blood compatibility than that of FPCPCU. DSC, AFM and XPS were used to characterize themiscibility and surface structure of the blends film. The largely improved blood compatibility was rationalized based on thecombined effect of phase separation between PEU and FPCPCU and the formation of surface nanostructures induced bysegregation of FPCPCU at the surface.

  15. Tensile-Strained Germanium-on-Insulator Substrate Fabrication for Silicon-Compatible Optoelectronics

    CERN Document Server

    Jain, J Raja; Balram, Krishna C; White, Justin S; Brongersma, Mark L; Miller, David A B; Howe, Roger T

    2011-01-01

    We present a method to fabricate tensile-strained germanium-on-insulator (GOI) substrates using heteroepitaxy and layer transfer techniques. The motivation is to obtain a high-quality wafer-scale GOI platform suitable for silicon-compatible optoelectronic device fabrication. Crystal quality is assessed using X-Ray Diffraction (XRD) and Transmission Electron Microscopy. A biaxial tensile film strain of 0.16% is verified by XRD. Suitability for device manufacturing is demonstrated through fabrication and characterization of metal-semiconductor-metal photodetectors that exhibit good responsivity beyond 1.55 {\\mu}m. The substrate fabrication process is compatible with complementary metal-oxide-semiconductor manufacturing and represents a potential route to wafer-scale integration of silicon-compatible optoelectronics.

  16. Sufficient and Necessary Condition to Decide Compatibility for a Class of Interorganizational Workflow Nets

    Directory of Open Access Journals (Sweden)

    Guanjun Liu

    2015-01-01

    Full Text Available Interorganizational Workflow nets (IWF-nets can well model many concurrent systems such as web service composition, in which multiple processes interact via sending/receiving messages. Compatibility of IWF-nets is a crucial criterion for the correctness of these systems. It guarantees that a system has no deadlock, livelock, or dead tasks. In our previous work we proved that the compatibility problem is PSPACE-complete for safe IWF-nets. This paper defines a subclass of IWF-nets that can model many cases about interactions. Necessary and sufficient condition is presented to decide their compatibility, and it depends on the net structures only. Finally, an algorithm is developed based on the condition.

  17. Development of ITER CODAC compatible gyrotron local control system and its operation

    International Nuclear Information System (INIS)

    JAEA has developed a prototype of the gyrotron local control system required in the ITER ECH and CD system. This system is compatible with the ITER plant control design handbook. The code is based on the ITER CODAC Core System and implements functions of the state transition management and monitoring in the gyrotron operating system and the power supply control and data acquisition. We have succeeded in the demonstration test of high power operation of an ITER 170 GHz gyrotron using the present system and the ITER compatible setup and protocol. (J.P.N.)

  18. A study of the applicability/compatibility of inertial energy storage systems to future space missions

    Science.gov (United States)

    Weldon, W. F.

    1980-01-01

    The applicability/compatibility of inertial energy storage systems like the homopolar generator (HPG) and the compensated pulsed alternator (CPA) to future space missions is explored. Areas of CPA and HPG design requiring development for space applications are identified. The manner in which acceptance parameters of the CPA and HPG scale with operating parameters of the machines are explored and the types of electrical loads which are compatible with the CPA and HPG are examined. Potential applications including the magnetoplasmadynamic (MPD) thruster, pulsed data transmission, laser ranging, welding and electromagnetic space launch are discussed.

  19. Analysis and Measurement of Electromagnetic Compatibility of High Power Switching Power Supply

    Institute of Scientific and Technical Information of China (English)

    ZhangShu; BaiZhen; YanHuaihai; FengXiuming; YuanZhengdong

    2003-01-01

    Electromagnetic compatibility (EMC) is capability that the devices and systems can normally operate within electromagnetic environment itself. It is also an applied technology, which is used to study the compatibility of electrical and electronic devices and systems within the common electromagnetic environment without a degradation of performance. EMC includes two meanings. The first is the device and system should be immune from electromagnetic disturbance. The second is electromagnetic interference should be suppressed not only below limit of disturbance, but also couldn't exceed the degree that anything can endure, that includes the other devices and systems, as well as human being, animal and plant.

  20. Blood compatibility of AAc, HEMA, and PEGMA-grafted cellulose film

    International Nuclear Information System (INIS)

    To improve surface blood compatibility on cellulose film for hemodialysis, acrylic acid, 2-hydroxyethyl methacrylate and three kinds of polyethylene glycol methacrylates were grafted onto the cellulose film surface by radiation grafting technique. Heparin was introduced onto the grafted cellulose film surfaces. The grafting and heparinization were confirmed by Fourier transform infrared spectroscopy in the attenuated total reflectance mode and electron spectroscopy for chemical analysis. The blood compatibility of the modified cellulose film was examined by the determination of platelet adhesion and thrombus formation