EFICÁCIA DA SISALANINA NA PRESERVAÇÃO DO MILHO CONTRA FORMAÇÃO DE AFLATOXINAS

Directory of Open Access Journals (Sweden)

KEIDI UJIKAWA

2007-01-01

Full Text Available A aplicação de sisalanina complexa na preservação do milho contra o desenvolvimento de Aspergillus flavus e a formação de aflatoxina B1, foi estudada. A sisalanina complexa (uma mistura de glicosídeos de Agave sisalana – sisal foi dissolvida na água e aplicada nos grãos de milho que foram incubados com o fungo citado. Após 30 dias de incubação a 30°C, 100% de umidade relativa do ar e concentrações de 0, 15, 150 e 1.500 ppm de sisalanina, os teores de aflatoxina B1 encontrados foram, respectivamente, 30, 12, 8 e 4 ppb.

Association between aflatoxin and aflatoxigenic fungi in Brazil nut (Bertholletia excelsa H.B.K. Associação de aflatoxinas e fungos aflatoxigênicos em castanha-do-Brasil (Bertholletia excelsa H.B.K.

Directory of Open Access Journals (Sweden)

Ariane Mendonça Pacheco

2010-06-01

Full Text Available Brazil nut has a high nutritional content and is a very important trade commodity to some Latin American countries. In order to evaluate its safety, 120 samples from different stages of the productive chain were analyzed in terms of: moisture content (mc, aflatoxigenic fungi and aflatoxin (LOQ = 1.95 μg.kg-1 total aflatoxin using TLC. Among all samples, 4 (6.7% from the receiving area, and 5 (16.7%, from retail presented aflatoxins above the LOQ, but the amount of aflatoxins was below the LOQ after the samples were dried in the plant. The positive samples were above the limit of total aflatoxin permitted by the European Union (4.0 μg.kg-1 and Brazil (30 μg.kg-1. The mc mean was 22.43% in the receiving area, which is higher than that in the other stages samples. All the A. flavus strains were aflatoxigenic, and there was statistic association between the presence of aflatoxin and flavus strains. The aflatoxigenic fungi strains associated to the aflatoxins levels in the samples show that an effective control is necessary for the food safety in the Brazil nut production chain.A castanha-do-Brasil tem um alto teor nutricional e é um importante produto comercial para alguns países da América Latina. Com objetivo de avaliar a segurança, 120 amostras de diferentes etapas da cadeia produtiva, foram analisadas quanto a: teor de umidade, fungos aflatoxigênicos e aflatoxinas (LOQ = 1,95 μg.kg-1 aflatoxinas totais por CCD. Das amostras, 4 (6,7% da área de recepção, e 5 (16,7% do varejo apresentaram aflatoxinas acima do LOQ. Nas amostras após secagem na usina não foram detectadas aflatoxinas(< LOQ. As amostras positivas estavam acima dos limites aceitos pela União Européia (4,0 μg.kg-1 e Brasil (30 μg.kg-1. A média do teor de umidade foi de 22,43% na etapa de recepção, maior do que as outras etapas estudadas. Todas as cepas de A. flavus eram aflatoxigênicas e houve associação estatística entre a presença de aflatoxinas e a presen

Efeitos da adição de montmorilonita sódica na dieta sobre o perfil bioquímico de frangos de corte intoxicados com aflatoxina The effects of the addition of sodic montmorilonite on the feeding diet on the biochemical profile of broiler chicken intoxicated by aflatoxin

Directory of Open Access Journals (Sweden)

Patricia Neves Batina

2005-08-01

Full Text Available Este estudo teve como objetivo avaliar os valores bioquímicos e atividade enzimática hepática e renal em frangos de corte submetidos à intoxicação experimental com aflatoxina B1 com e sem a adição de montmorilonita sódica na dieta. Foram utilizados 528 frangos de corte, da linhagem Cobb, subtimetidos a seis tratamentos entre 1° ao 42° dia de vida: (T1 Controle: dieta normal; (T2 dieta com 5 ppm de aflatoxina; (T3 dieta com 0,25% montmorilonita sódica; (T4 dieta com 5ppm de aflatoxina + 0,25% montmorilonita sódica; (T5 dieta com 0,5% montmorilonita sódica; (T6 dieta com 5ppm de aflatoxina + 0,5% montmorilonita sódica. O tratamento (T2 com aflatoxina demonstrou significante (PThe aim of this research was to evaluate the hepatic biochemical profile and the renal enzymatic activity of broiler chicken experimentally intoxicated with aflatoxin and supplemented with sodic montmorilonite on the diet. 528 Cobb’s broiler chickens were used divided in 6 treatments (from 1st to the 42th day of life as described: (T1 control: normal diet; (T2 diet with 5ppm of aflatoxin; (T3 diet with 0.25% sodic montmorilonite; (T4 diet with 5 ppm of aflatoxin + 0.25% sodic montmorilonite; (T5 diet with 0.5% sodic montmorilonite; (T6 diet with 5 ppm of aflatoxin + 0.5% sodic montmorilonite. The treatment T2 showed significantly decreased levels of uric acid, albumin, cholesterol, creatinine, triglycerides, globulins and total serum proteins and an increase of serum alanine aminotransferase (ALT activity. Aspartate aminotransferase (AST did not showed important differences among treatments. In treatments T3 and T5, there were no variations on the biochemical values, when compared to treatment T1. Addition of 0.5% of montmorilonite in the diet (T6, presented better results on the increase of the adsorption of aflatoxin when compared to 0.25% sodic montmorilonite (T4. Clearly, the results showed that high levels of aflatoxin in the diet (5ppm causes important

Transformación de la aflatoxina B1 de alimentos, en el cancerígeno humano, aducto AFB1-ADN

Directory of Open Access Journals (Sweden)

Magda Carvajal

2013-01-01

Full Text Available Las aflatoxinas (AF son metabolitos secundarios tóxicos principalmente de los hongos Aspergillus flavus y A. parasiticus, son potentes mutágenos y cancerígenos de alimentos y la exposición del hombre a ellas es continuo. Las AF se ligan al ADN, ARN y proteínas formando aductos AFB1-ADN que se acumulan por años y dañan desde los virus hasta el hombre. Es importante identificar y cuantificar estos aductos como biomarcadores de largo tiempo de riesgo de enfermedad, ya que originan mutaciones y cáncer, y están validados en animales y humanos. Las AF se activan en presencia del citocromo P450 como una molécula inestable 8,9 epóxido AFB1, que se liga al N7 de la guanina, y se transforma en los cancerígenos activos o aductos AFB1-Gua y, finalmente, en los aductos AFB1-FAPY y son una medida objetiva de la exposición humana a cancerígenos ambientales. Los aductos representan la exposición, absorción, distribución, metabolismo, reparación del ADN y cambio celular. Los temas tratados aquí son la formación de aductos AFB1-ADN, estudios in vitro e in vivo, exposición a una dieta con AFB1, efectos, desarrollo de cáncer y mutaciones en el gen supresor p53, rutas de exposición, vitaminas, tipos de aducto AFB1-ADN, metodología y su control.

Effect of powdered spice treatments on mycelial growth, sporulation and production of aflatoxins by toxigenic fungi Efeito de tratamentos com condimentos em pó sobre o crescimento micelial, esporulação e produção de aflatoxinas por fungos toxigênicos

Directory of Open Access Journals (Sweden)

Sára Maria Chalfoun

2004-08-01

Full Text Available The effect of ten powdered spice plants was evaluated at the concentration of 1, 2, 3 and 4% to observe the mycelial growth and sporulation of Aspergillus niger and Eurotium repens. The spices were added to the culture media PDA and CYA20S. Clove completely inhibited the mycelial growth of the tested fungi. The other spices: cinnamon, garlic, thyme, mint, anis, oregano and onion were, in a decreasing order, promising antifungals. Bay leaf and basil did not show a pronounced fungistatic effect. The antitoxigenic potential of the spices was tested against one aflatoxin-producing strain of AspergiIIus flavus. The spices were tested at the same concentrations previously mentioned and were added to the culture medium YES, appropriate for the production of those metabolites. Clove completely inhibited the mycelial growth of Aspergillus flavus. Cinnamon and anis totally inhibited the production of Bl and B2 aflatoxin. Both bay leaf and basil inhibited the synthesis of aflatoxin starting from the concentration of 2%. The other spices did not have a pronounced antiaflatoxigenic effect.O efeito de dez plantas condimentares em pó foi avaliado nas concentrações de 1, 2, 3 e 4%, para observar o desenvolvimento micelial e esporulação de Aspergillus niger e Eurotium repens. Os condimentos foram adicionados aos meios de cultura BDA e CYA 20S. O cravo inibiu completamente o desenvolvimento micelial dos fungos testados. Os outros condimentos: canela, alho, tomilho, menta, erva-doce, orégano e cebola foram, em ordem decrescente, antifúngicos promissores. Louro e manjericão não apresentaram um efeito fungistático pronunciado. O potencial antitoxigênico dos condimentos foi testado contra uma cepa de Aspergillus flavus, produtora de aflatoxina. Os condimentos foram testados nas mesmas concentrações previamente mencionadas e foram adicionados ao meio de cultura YES, apropriado para a produção daqueles metabólitos. O cravo inibiu completamente o

Adição de bentonita sódica como adsorvente de aflatoxinas em rações de frangos de corte Utilization of sodium bentonite as adsorbent of aflatoxins in broiler feed

Directory of Open Access Journals (Sweden)

Juarez Morbini Lopes

2006-10-01

Full Text Available A presença de micotoxinas nas matérias-primas, principalmente no milho utilizado para rações para aves, é uma das maiores preocupações atuais devido aos danos causados por essa substâmcia não só aos animais, mas também aos produtores e às empresas do setor avícola. Considerando a utilização de adsorvente ou seqüestrante na ração para minimizar os efeitos deletérios, realizou-se um experimento para avaliar o efeito da adição de um adsorvente, baseado em bentonita sódica, na ração de frangos de corte, a fim de reduzir os efeitos de aflatoxinas. Foram utilizados 960 pintos Cobb de um dia de idade, distribuídos em oito repetições de 20 animais nos tratamentos: T1=sem aflatoxina;T2=3mg kg-1 de aflatoxina;T3=sem aflatoxina+0,5% de bentonita; T4=3mg kg-1 de aflatoxina+0,1% de bentonita; T5=3mg kg-1 de aflatoxina+0,3% de bentonita e T6=3mg kg-1 de aflatoxina+0,5% de bentonita. O consumo alimentar, o peso corporal e a conversão alimentar foram afetados pela presença da toxina na ração. A adição de bentonita sódica na ração sem aflatoxina não causou nenhum efeito depressivo nas aves. Nos tratamentos que continham 3mg kg-1 de aflatoxinas, a adição do adsorvente promoveu um melhor desempenho das aves, sendo que 0,3% de adição de bentonita apresentou melhores resultados.High concentrations of micotoxins in raw materials, mainly in corn used in poultry rations of food, is an important subject of study due to hazardous problems not only to the animals themselves but also to the producer and to the poultry industry due to the reduction of performance by aflatoxins. Taking into account the lack of efficient tecnique for its elimination, from the feed, an adsorbent was added to the diets in order to reduce the effects of aflatoxins. Nine hundred sixty day old Cobb chicks, distributed in 8 replicates of 20 birds per pen the following treatments: T1=No aflatoxin; T2=3mg kg-1 of aflatoxin; T3=no aflatoxin+0.5% of bentonite; T

Comparison of methods by TLC and HPTLC for determination of aflatoxin M1 in milk and B1 in eggs Comparação de metodologia para análise de aflatoxina M1 em leite e aflatoxina B1 em ovos por CCD e CCDAE

Directory of Open Access Journals (Sweden)

V. M. Scussel

2003-12-01

Full Text Available Milk and egg matrixes were assayed for aflatoxin M1 (AFM1 and B1 (AFB1 respectively, by AOAC official and modified methods with detection and quantification by thin layer chromatography (TLC and high performance thin layer chromatography (HPTLC. The modified methods: Blanc followed by Romer, showed to be most appropriate for AFM1 analysis in milk. Both methods reduced emulsion formation, produced cleaner extracts, no streaking spots, precision and accuracy improved, especially when quantification was performed by HPTLC. The use of ternary mixture in the Blanc Method was advantageous as the solvent could extract AFM1 directly from the first stage (extraction, leaving other compounds in the binary mixture layer, avoiding emulsion formation, thus reducing toxin loss. The relative standard deviation (RSD% values were low, 16 and 7% when TLC and HPTLC were used, with a mean recovery of 94 and 97%, respectively. As far as egg matrix and final extract are concerned, both methods evaluated for AFB1 need further studies. Although that matrix leads to emulsion with consequent loss of toxin, the Romer modified presented a reasonable clean extract (mean recovery of 92 and 96% for TLC and HPTLC, respectively. Most of the methods studied did not performed as expected mainly due to the matrixes high content of triglicerides (rich on saturated fatty acids, cholesterol, carotene and proteins. Although nowadays most methodology for AFM1 is based on HPLC, TLC determination (Blanc and Romer modified for AFM1 and AFB1 is particularly recommended to those, inexperienced in food and feed mycotoxins analysis and especially who cannot afford to purchase sophisticated (HPLC,HPTLC instrumentation.Aflatoxinas M1 (AFM1 e B1 (AFB1 foram analisadas em leite e ovos respectivamente, por diferentes métodos oficiais da AOAC e modificações usando detecção por cromatografia em camada delgada (CCD e CCD de alta eficiência (CCDAE. Os métodos modificados: Blanc e Romer

Análise de trilha da contaminação por aflatoxinas em grãos de milho armazenados

Directory of Open Access Journals (Sweden)

Adriana Sbardelotto Di Domenico

2015-06-01

Full Text Available O objetivo deste trabalho foi determinar a magnitude dos efeitos diretos e indiretos de parâmetros físico-químicos e microbiológicos sobre a ocorrência de aflatoxinas em grãos de milho armazenados, por meio da análise de trilha. Os dados foram coletados em dois experimentos: um cultivo de inverno (colheita do milho em julho de 2012 e um cultivo de verão (colheita em fevereiro de 2013. Os grãos foram armazenados por 12 meses, em dois tipos de acondicionamentos: em sacarias convencionais de polipropileno e a granel em silo metálico. Avaliaram-se 14 características dos grãos. Calculou-se a matriz de correlações de Pearson entre todos os parâmetros, realizou-se o diagnóstico de multicolinearidade e, posteriormente, aplicou-se a análise de trilha com regressão em crista. Observou-se forte influência das condições ambientais entre as safras de inverno e de verão, e entre época e tipo de armazenagem, nos coeficientes de análise de trilha. As variáveis teor de umidade, conteúdo de cinzas, proteínas, lipídios, grãos sem defeitos, massa volumétrica, incidência de Penicillium sp., Aspergillus sp. e Fusarium sp. devem ser consideradas conjuntamente na definição da possibilidade de ocorrência de aflatoxinas na massa de grãos armazenados.

Verificación de la contaminación del maíz por flatoxina B1

Directory of Open Access Journals (Sweden)

Lisa Vallone

2010-10-01

Full Text Available “Aflaflesh” es un instrumento computarizado, diseñado para combinar un metodo de adquisición de datos visuales, con sofisticados sistemas operativosde software y análisis de imágenes. Esto, mediante la exposicion de la fluorescencia de maíz sometido a la radiación UV, ya que si hay contaminación con aflatoxinas B1, es posible transformar directamente el número de pixeles de la fluorescencia, en la concentración de AFB1 correspondiente.

Evaluation of viability of Aspergillus flavus and aflatoxins degradation in irradiated samples of maize Avaliação da viabilidade de Aspergillus flavus e degradação de aflatoxinas em amostras de milho irradiadas

Directory of Open Access Journals (Sweden)

Simone Aquino

2005-12-01

Full Text Available One of the currently most important fungi in stored grains is Aspergillus flavus, which produce aflatoxins. This fungus can grow on diverse substrates and represents a serious public health and animal nutritional problem. Therefore, the study of techniques that can be applied to the control of aflatoxins is of great importance. The objective of the present study was to determine the effects of gamma radiation on the growth of Aspergillus flavus Link and on degradation of aflatoxin B1 and B2 (AFB1 and AFB2 at a relative humidity of 97 99% and a water activity (Aw of 0.88-0.94. Samples of corn grains were irradiated using a cobalt 60 source emitting gamma rays at doses of 2, 5 and 10 kGy. Irradiation was found to be effective in reducing the number colony-forming units of A. flavus, per gram, in the corn samples analyzed. In addition, the fluorescent viability test (fluorescein diacetate and ethidium bromide revealed a decrease in the number of viable cells with increasing irradiation doses and three different fluorescence patterns. Furthermore, irradiation induced a partial reduction in AFB1 and AFB2 levels at the doses of 2 and 5 kGy, whereas complete degradation of aflatoxins was observed in the assay employing 10 kGy.Um dos fungos mais importantes atualmente em grãos armazenados é o Aspergillus flavus, o qual produz aflatoxinas. Este fungo pode crescer em diversos substratos e representa uma séria preocupação em saúde pública e nutrição animal. Portanto, o estudo de técnicas que possam ser aplicadas no controle das aflatoxinas é de grande importância. Assim sendo, o objetivo do presente trabalho foi estudar os efeitos da radiação gama no crescimento de Aspergillus flavus Link e na degradação das aflatoxinas B1 e B2, (AFB1 e AFB2 em umidade relativa (UR de 97-99% e atividade de água (Aa de 0,88-0,94. Amostras de grãos de milho foram irradiadas, utilizando-se uma fonte de Cobalto 60, emissora de raios gama, com as doses de 2; 5

Brazil nuts: determination of natural elements and aflatoxin Castanha do Brasil: determinação de elementos naturais e aflatoxinas

Directory of Open Access Journals (Sweden)

Maristela Martins

2012-03-01

Full Text Available A study was carried out to evaluate the association of levels of radioactivity, selenium and aflatoxin in shelled Brazil nuts, which were classified in different sizes, for export. The selenium determinations were performed by inductively coupled plasma optical emission spectrometry (LOQ = 3.0 µg g-1, and aflatoxins were detected by Liquid chromatography-mass spectrometry (LOQ = 0.85 µg kg-1, recovery rates were between 92 and 100%. Radioactivity was measured by high-resolution gamma spectrometry. The selenium mean concentration was (22.7 ± 7.4 µg g-1. (n = 30. Mean activities determined for the following radium isotopes were: 15.77 Bq kg-1 for 224Ra, 104.8 Bq kg-1 for 226Ra and 99.48 Bq kg-1 for 228Ra. For 226Ra, the levels did not vary significantly with nut sizes, although such differences were observed for 224Ra and 228Ra. There was no statistically significant association between the level of selenium and the activity of radionuclides, however, there was correlation between the radionuclides. Aflatoxins above the quantification limit were not found.Um estudo foi realizado para avaliar a associação dos níveis de radioatividade, selênio e aflatoxinas em castanha-do-Brasil descascada, que foram classificadas em diferentes tamanhos, para exportação. As determinações de selênio foram realizadas por espectrometria de emissão óptica com plasma indutivamente acoplado (LOQ=3,0 µg kg-1 e aflatoxinas foram detectadas por LC-MSMS (LOQ=0,85 µg kg-1, as taxas de recuperação ficaram entre 92 e 100%. A radioatividade foi medida por espectrometria gama de alta resolução. A concentração média de selênio foi de (22,7 ± 7,4 µg g-1. (n = 30. A atividade média determinada para os radioisótopos foram: 15,77 Bq kg-1 para o 224Ra, 104,8 Bq kg-1 para 226Ra e 99,48 Bq kg-1 para 228Ra. Para 226Ra, os níveis não variaram significativamente com o tamanho das nozes, embora tais diferenças foram observadas para 224Ra e 228Ra. Não houve

Biomarcadores para avaliação da exposição humana às micotoxinas Biomarkers for assessment of human exposure to mycotoxins

Directory of Open Access Journals (Sweden)

Érika Bando

2007-06-01

Full Text Available Atualmente, as micotoxinas representam um risco de contaminação ambiental, acarretando sérios prejuízos à saúde humana. Essas toxinas podem estar presentes em diferentes tipos de alimentos, que constituem a principal fonte de exposição para o homem. As exposições podem ser monitoradas através do uso de biomarcadores, que elucidam a relação causa/efeito e dose/efeito na avaliação de risco à saúde para fins de diagnóstico clínico e laboratorial. Realizou-se uma revisão bibliográfica do período de 1981-2005, no MEDLINE, sobre utilização e propostas de biomarcadores para a exposição a aflatoxinas, fumonisinas, desoxinivalenol e ocratoxina A. Os possíveis biomarcadores para avaliar a exposição humana às aflatoxinas foram os metabólitos urinários de aflatoxina B1, como aflatoxina M1, aflatoxina P1, aflatoxina Q1, aflatoxina livre em soro ou plasma, os adutos de AFB-N7-guanina, os adutos de albumina ou mutação no gene supressor de tumor p53, presentes em fluidos biológicos. Para as fumonisinas, os biomarcadores foram os níveis de fumonisina B1 e fumonisina B2 livres, ou de esfinganina e esfingosina em sangue e urina. O desoxinivalenol tem como biomarcadores de exposição os produtos de seu metabolismo e adutos macromoleculares (proteína/DNA presentes nos fluidos biológicos. Para a exposição à ocratoxina A (OA os biomarcadores se restringem à quantificação da própria toxina nos fluidos biológicos. A avaliação da exposição às micotoxinas constitui um importante aspecto para a saúde pública, tendo em vista a possibilidade de prevenir ou minimizar a incidência de doenças decorrentes da sua interação com o organismo.Currently, mycotoxins represent a risk of environmental contamination, causing serious damages to human health. Those toxins can be found in different kinds of foods, and they constitute the main source of human exposure. The evaluation of such exposures can be monitored through the use

Reduction of toxic effects of aflatoxin B1 by using baker yeast (Saccharomyces cerevisiae in growing broiler chicks diets Redução dos efeitos tóxicos da aflatoxina B1, utilizando-se levedura de panificação (Saccharomyces cerevisiae, na dieta de pintos de corte em crescimento

Directory of Open Access Journals (Sweden)

Kemal Çelýk

2003-06-01

Full Text Available This study was carried out to investigate the effects of adding baker yeast (BY, chlortetracycline (CTC and both BY + CTC to a control diet containing 200 ng/g of aflatoxin B1 (C + AFB1 on performance, serum parameters and pathologyc alterations of broilers. A total 100 chicks (Ross PM 3 were divided into five groups in individual cages and each containing 20 animals. BY, a rich source of protein and vitamin B complex, was mixed into the diets at 2.0 %, CTC was mixed into the diet at 2.5 ng/g. Feed consumption, body weight and feed efficiency were recorded weekly. Serum parameters and pathologyc alterations were determined at the end of the study. Dead animals were recorded daily. Liver changes were clearly apparent in the C+AFB1and C+ AFB1+CTC most of the livers were enlarged, yellow and had pethecial hemorrhages. Canalicula cholestosis was absent in group C+AFB1 and C+ AFB1+CTC, but not others. When compared to the control (C group, alkaline phosphatase (ALP, appear to be significantly increased in the C+AFB1 and C+CTC+ AFB1 groups. Serum glutamic oxalacetic transaminase (GOTwas increased in C+AFB1 birds. Serum alphaphetoprotein was not affected by the treatments. Feed consumption and body weight were significantly reduced in group AFB1. Birds receiving BY + AFB1, CTC + AFB1 and BY + CTC + AFB1 had a significantly higher body weight than group C+AFB1. Feed efficiency was better in group CTC + AFB1 than the others. The findings of this research suggest tha BY (2% can partly counteract some of the toxic effects of AFB1.Este estudo foi desenvolvido para avaliar os efeitos da adição de Levedura de panificação (BY e cortetraciclina (CTC e ambos BY+CTC a uma dieta controle © contendo 200 ng/g de aflatoxina B1 (C+AFB1 sobre desempenho, parâmetros séricos e alterações patológicas de frangos de corte. Um total de 100 pintinhos (Ross PM3 foi dividido em cinco grupos, em gaiolas individuais, contendo 20 animais para cada grupo. A levedura de

Effect of gamma radiation on the inactivation of aflatoxin B1 in food and feed crops Efeito da radiação gama na inativação de aflatoxina B1 em alimentos e ração

Directory of Open Access Journals (Sweden)

I. Ghanem

2008-12-01

Full Text Available Samples of food crops (peanut, peeled pistachio, unpeeled pistachio, rice, and corn and feed (barley, bran, corn were autoclave-sterilized, and inoculated with 10(6 of spore suspension of an isolate of Aspergillus flavus fungus known to produce aflatoxin B1 (AFB1 . Following a 10-day period of incubation at 27 C to allow for fungal growth, food and feed samples were irradiated with gamma radiation at the doses 4, 6, and 10 kGy. Results indicated that degradation of AFB1 was positively correlated with the increase in the applied dose of gamma ray for each tested sample. At a dose of 10 kGy percentages of AFB1 degradation reached highest values at 58.6, 68.8, 84.6, 81.1 and 87.8% for peanuts, peeled pistachios, unpeeled pistachios, corn and rice samples, respectively. In feed samples percentages of AFB1 degradation were 45, 66, and 90% in barley, 47, 75, and 86% in bran, and 31, 72, and 84% in corn for the doses of 4, 6, and 10 kGy, respectively. AFB1 degradation in food samples correlated negatively with oil content in irradiated samples. Thus, in peanuts, which contained the highest oil content, percentage of AFB1 degradation at 10 kGy was not more than 56.6%, whereas, the corresponding value in corn, which contained the lowest oil content, reached as high as 80%. The above results indicate the possibility of using gamma radiation as a means of degradation of AFB1 in food and feed crops to levels lower than the maximum allowed levels.Amostras de alimentos (amendoim, pistache descascada, pistache com casca, arroz e milho e de ração (cevada, farelo de trigo e milho foram esterilizadas por autoclavação e inoculadas com uma suspensão de esporos (10(6 de um isolado de Aspergillus flavus produtor de aflatoxina B1 (AFB1. Após incubação por 10 dias a 27ºC para multiplicação do fungo, as amostras foram irradiadas com radiação gama nas doses de 4, 6 e 10 kGy. Os resultados indicaram que a degradação da AFB1 correlacionou-se positivamente

Evaluation of antifungal activity of Pittosporum undulatum L. essential oil against Aspergillus flavus and aflatoxin production Avaliação da atividade antifúngica do óleo essencial de Pittosporum undulatum L. em Aspergillus flavus e produção de aflatoxina

Directory of Open Access Journals (Sweden)

Rosane Tamara da Silva Medeiros

2011-02-01

Full Text Available The presence of mycotoxins as a result of fungal attack can occur before, after and during the harvest and storage operations on agricultural crops and food commodities. Considering the inhibitory property of essential plant oils on the mycelial development of fungi and the importance of Aspergillus flavus, the main producer of aflatoxins, this research was designed to evaluate the toxicity of essential oil from Pittosporum undulatum against A. flavus. The essential oils were obtained from P. undulatum leaves, collected in different months and analyzed by GC/MS. The oils were rich in hydrocarbon, monoterpenes and sesquiterpenes and it was observed a significant variation on the chemical composition of the essential oil of leaves at different months. Besides, the essential oils were tested against fungal growth and the results showed different spectrum of inhibition on A. flavus. However, the essential oils inhibited the aflatoxin B1 production.A presença de micotoxinas como resultado do ataque fúngico pode ocorrer antes, após e durante a colheita e também no armazenamento de grãos e alimentos. Considerando as propriedades inibitórias dos óleos essenciais de plantas no desenvolvimento do micélio dos fungos e a importâncias do Aspergillus flavus, principal produtor de aflatoxinas, relatou-se neste trabalho, a atividade tóxica do óleo essencial do Pittosporum undulatum em cultura de A. flavus. Os óleos essenciais de P. undulatum foram obtidos a partir de folhas coletadas em diferentes meses e analisado por CG/EM. Os óleos se mostraram ricos em hidrocarbonetos, monoterpenos e sesquiterpenos e foi observada uma significante variação na composição química destes óleos nos diferentes meses de coleta. Os óleos essenciais mostraram diferentes espectros de inibição do crescimento de A. flavus, porém todos foram capazes de inibir a produção de aflatoxina B1.

Avaliação do hemograma, reticulócitos e mielograma na intoxicação subaguda experimental por aflatoxina em cães Experimentally induced sub-acute aflatoxicosis in dogs: evaluation of hemogram, reticulocyte and myelogram

Directory of Open Access Journals (Sweden)

Rosana Lopes

1998-06-01

Full Text Available As aflatoxinas estão entre os produtos metabólicos de natureza tóxica e são produzidos por fungos do gênero Aspergillus. O presente trabalho tem como objetivo, verificar as possíveis alterações da aflatoxicose através da avaliação do hemograma, contagem de reticulócitos e mielograma em cães. Foram utilizados vinte cães (9 fêmeas e 11 machos, os quais foram divididos aleatoriamente em dois grupos de dez animais. O grupo I recebeu l4g de aflatoxina/kg/dia e o grupo II 21 g de aflatoxina/kg/dia, via oral, durante vinte dias. Após foram realizadas colheitas de sangue e medula óssea, a cada sete dias, durante seis semanas. Ambos os grupos apresentaram sinais clínicos de intoxicação por aflatoxina, o hemograma e a contagem de reticulócitos não demonstraram variações significativas. No mielograma, observou-se acentuada diminuição da série eritróide e do número de megacariócitos, aumento significativo da série mielóide e proporção mielóide: eritróide (M:E.The aflatoxins are between the metabolics products nature of toxic and produced are by genus of fungi Aspergillus. The objective of the present study was to verify alterations of aflatoxicosis through of evaluation hemogram, reticulocyte count and myelogram in dogs. Eleven males and nine female dogs were used. Dogs were randomly allocated into two groups. Group I was treated with l4g/kg/day of aflatoxin and group II with 2lg/kg/day. The drug was given miled with feed and treatment lasted for 20 days. After the beginning of intoxication, individual blood and bone marrow samples were taken weekly for six weeks. The two group to clinical signs present of intoxication by aflatoxin the hemogram and reticulocyte count not showed significative variation. The myelogram showed a total reduction in the erythroid series and number of megacaryocytes significative increase myeloid serie and myeloid: erythroid ratio (M: E.

Classificação Macroscópica, identificação da microbiota fúngica e produção de aflatoxinas em híbridos de milho

OpenAIRE

Dilkin,Paulo; Mallmann,Carlos Augusto; Santurio,Janio Morais; Hickmann,José Luis

2000-01-01

Com o objetivo de medir o potencial de resistência de 5 diferentes híbridos de milho, logo após a colheita, ao crescimento de fungos e produção de aflatoxinas (AFs), foram avaliados os seguintes parâmetros: 1) aspecto macroscópico dos grãos, sendo os grãos de cada híbrido classificados como íntegros, danificados por insetos (DI) ou danificados por fungos (DF); 2) contaminação fúngica dos híbridos; 3) potencial para resistência à produção de AFs, através do cultivo de Aspergillus parasiticus, ...

IDENTIFICACIÓN Y CUANTIFICACIÓN DE HONGOS MICOTOXIGÉNICOS EN ALIMENTO PARA BOVINOS

Directory of Open Access Journals (Sweden)

René Santibáñez Escobar

2011-07-01

Full Text Available Se identificó y cuantificó cepas fúngicas productoras de micotoxinas y grado de contaminación por aflatoxinas B1, B2, G1 y G2, en alimento para bovinos en el municipio de Zapotlán, El Grande Jalisco, México. Se tomaron muestras de alimento para vacas lecheras y ganado de engorda de 30 unidades productoras. La identificación de las cepas fúngicas productoras de micotoxinas se realizó mediante caracterización macroscópica de colonias cultivadas bajo la técnica de vaciado en placa, y la identificación posterior de la morfología microscópica del hongo, para la cual se aislaron las cepas identificadas mediante la técnica de microcultivo. La cuantificación de cepas fúngicas se realizó mediante el conteo de unidades formadoras de colonias (UFC y clasificadas bajo el criterio de tres escalas; a Recuentos bajos (102-103; b Recuentos moderados (104-105 y c Recuentos altos (106–107. Para la identificación del tipo de aflatoxinas se utilizó la técnica de cromatografía en capa fina. De las muestras procesadas se obtuvieron recuentos de UFC en la siguiente proporción: Recuentos altos (106-107 UFC g-1 56.66%, recuentos moderados: (104-105 UFC g-1 36.66%, recuentos bajos: (102-103 UFC g-1 6.66%. Se aislaron un total de 148 cepas fúngicas, correspondiendo los porcentajes más altos a los siguientes géneros: Cladosporium spp., Penicillium spp. y Aspergillus spp. Se detectaron 33.33% de muestras positivas a aflatoxinas, dentro de las cuales se identificaron B1, B2, G1 y G2, todas en alta concentración, con 46.66% de muestras con fluorescencia positiva que no correspondieron a los estándares de aflatoxinas y 20% de muestras negativas.

Classificação Macroscópica, identificação da microbiota fúngica e produção de aflatoxinas em híbridos de milho Macroscopic classification, identification of fungal microbiota and aflatoxins production in corn hybrids

Directory of Open Access Journals (Sweden)

Paulo Dilkin

2000-03-01

Full Text Available Com o objetivo de medir o potencial de resistência de 5 diferentes híbridos de milho, logo após a colheita, ao crescimento de fungos e produção de aflatoxinas (AFs, foram avaliados os seguintes parâmetros: 1 aspecto macroscópico dos grãos, sendo os grãos de cada híbrido classificados como íntegros, danificados por insetos (DI ou danificados por fungos (DF; 2 contaminação fúngica dos híbridos; 3 potencial para resistência à produção de AFs, através do cultivo de Aspergillus parasiticus, linhagem NRRL 2999, sobre grãos de cada híbrido estudado; 4 consumo de matéria seca dos híbridos pelo cultivo fúngico. Como resultado, observou-se que 38% do milho de todos os híbridos apresentaram comprometimento macroscópico, sendo 26,7% DI e 11,3% DF. Os híbridos recém-colhidos apresentaram contaminação fúngica por Penicillium sp. (14,3%; Aspergillus sp. (23,6% e Fusarium sp. (57,1%. O potencial de produzir AFs pelos diferentes híbridos em cultivos por 5 e 10 dias apresentou diferença somente com relação à aflatoxina G2 em cultivos por 5 dias. A média de consumo de matéria seca dos híbridos de milho foi de 1,25 e 2,69% submetidos ao cultivo de fungos por períodos de 5 e 10 dias, respectivamente.To determine the resistance of five different recently harvested corn hybrids to fungal growth and aflatoxins (AFs production the following parameters were measured: 1 Macroscopic aspect of the grain and each hybrid classified as whole, damaged by insects (DI or damaged by fungi (DF; 2 Fungal contamination of hybrids 3 Resistance to AFs production, through the culture of Aspergillus parasiticus, NRRL 2999 strain, on each hybrid grain studied and 4 Consumption of dry matter of hybrids by the fungal culture. It was observad that 38% of all corn hybrids had macroscopic damage, being 26.7% DI and 11.3% DF. The recently harvested hybrids showed fungal contamination by Penicillium sp. (14.3%; Aspergillus sp. (23.6% and Fusarium sp. (57.1

Datos básicos sobre la tuberculosis (Basic Tuberculosis Facts)

Centers for Disease Control (CDC) Podcasts

En este podcast el doctor Kenneth Castro, Director de la División de Eliminación de la Tuberculosis, presenta información básica sobre la prevención, las pruebas y el tratamiento de la tuberculosis.

Perfil da contaminação com aflatoxina entre embalagens de produtos de amendoim Afloxin contamination profile among packages of peanut candies

Directory of Open Access Journals (Sweden)

Eduardo Micotti da Gloria

2006-09-01

Full Text Available Este estudo foi realizado com o objetivo de avaliar o perfil da distribuição da contaminação com aflatoxinas entre embalagens constituintes de lotes de confeitos de amendoim, expostos à venda no comércio. Os dados da distribuição da ocorrência e dos níveis de contaminação, aqui obtidos, sugerem que os procedimentos de amostragem, visando à detecção de aflatoxinas em produtos processados, sempre estarão associando um grau de incerteza muito elevado quanto à presença ou não e quanto ao nível médio de contaminação de um lote de produto processado. Entretanto, para melhorá-los, devem-se considerar as diferenças existentes entre os produtos com relação ao processamento ou não dos grãos que constituem sua matéria-prima, pois, em lotes de produtos em que a matéria-prima foi triturada ou moída, como por exemplo, o doce de amendoim do tipo paçoca, a distribuição da ocorrência e dos níveis mostrou um grau bem mais elevado de homogeneidade, quando comparado ao amendoim japonês que mantém a integridade da matéria-prima durante o seu processo de fabricação.This study was carried out to evaluate the profile of aflatoxin contamination distribution among packages of peanut candies trading. Aflatoxin occurrence and distribution date from this study suggest that sampling plans to aflatoxin detection in processed products are always associated with high degree of uncertain of presence or not and of the true average level of contamination. To improve sampling plans it is necessary to consider the differences among product types. There are processed products whose the raw material is grounded, like "paçoca" and other that it is not, like "amendoim japonês". Occurrence and distribution of aflatoxin contamination among packages in lots of "paçoca" was more homogeneus than in lots of "amendoim japonês".

Datos básicos sobre la tuberculosis (Basic Tuberculosis Facts)

Centers for Disease Control (CDC) Podcasts

2012-03-12

En este podcast el doctor Kenneth Castro, Director de la División de Eliminación de la Tuberculosis, presenta información básica sobre la prevención, las pruebas y el tratamiento de la tuberculosis.  Created: 3/12/2012 by National Center for HIV/AIDS, Viral Hepatitis, STD, and TB Prevention (NCHHSTP).   Date Released: 3/13/2012.

Efeito da corticotropina sobre a absorção de vitamina B12 na mielose funicular

Directory of Open Access Journals (Sweden)

Horacio M. Canelas

1965-06-01

Full Text Available Foi estudada a absorção de vitamina B12 em 9 casos de mielose funicular antes e após a administração de ACTH por via intravenosa em um esquema terapêutico com duração variável entre 19 e 43 dias. Em 7 casos foi verificado aumento da absorção. A diferença média de modificação no teste de excreção urinaria de vitamina B12 radioativa situou-se próximo do nível de significancia estatística. Este resultado reforça a indicação do emprego de corticotropina na mielose funicular, pois o hormônio irá atuar tanto sobre o componente alérgico do prccesso desmielinizante, quanto sobre a carência de vitamina B12 resultante do déficit de absorção. Embora o material aqui analisado seja muito pequeno para garantir uma conclusão definitiva, nossos resultados demonstram que, provavelmente, o ACTH age sobre a absorção da vitamina B12 através da mucosa intestinal, e não mediante o aumento de secreção do fator intrínseco ou a mobilização dos depósitos dessa vitamina. In order to study a possible mobilizing effect of ACTH on the radioactive vitamin B12 stores, the intervals between the last urinary excretion test and the test after completion of treatment were analyzed (Table 1. It is easily noticed that in the 7 cases with increase of vitamin B12 absorption these periods were the most varied, lasting from 9 to 62 days. And also in the 2 cases with decrease of absorption the intervals were very dissimilar, namely 15 and 56 days. So, it seems that this effect of ACTH did not play a significant role in the results. Likewise, the time elapsed between the completion of treatment and the repetition of the Schilling's test had no apparent relationship with the results.

Conocimientos, practicas y habilidades sobre la búsqueda bibliográfica y percepción estudiantil sobre la capacitación universitaria en investigación, en estudiantes de obstetricia

Directory of Open Access Journals (Sweden)

Mauro Huamani-Navarro

Full Text Available Introducción: Se observan estudiantes del pregrado de obstetricia con insuficientes habilidades para utilizar toda la información que necesitan. Por ello, nos proponemos determinar el nivel de conocimiento, las prácticas y habilidades sobre la búsqueda de información en Internet, además de la percepción estudiantil sobre la capacitación brindada por la universidad y sobre su nivel en investigación. Sujetos y métodos: Estudio descriptivo transversal, periodo abril-julio de 2009, en 150 estudiantes de obstetricia de la Facultad de Medicina de la Universidad Nacional Mayor de San Marcos, en Perú. Por medio de un cuestionario estructurado, se realizó un análisis univariado. Resultados: El 78,7% presentó conocimientos bajos; el 55,3%, prácticas incorrectas, y el 74,7%, deficientes habilidades para realizar una búsqueda. El 60% consideraba que la preparación en búsqueda de información era regular o deficiente, con igual proporción para los procesos de publicación, redacción, lectura crítica y metodología de la investigación. Conclusiones: Identificar los conocimientos, prácticas, habilidades y percepciones sobre la investigación es importante para promover programas de capacitación extracurricular en los estudiantes durante el pregrado.

Efeitos da suplementação de b-hidroxi-b-metilbutirato sobre a força e a hipertrofia Effects of b-hydroxy-b-methylbutyrate supplementation on strength and hypertrophy

Directory of Open Access Journals (Sweden)

Thiago da Silveira Alvares

2008-02-01

Full Text Available O b-hidroxi-b-metilbutirato é um metabólito da leucina estudado devido aos seus efeitos anticatabólicos e possíveis implicações sobre os ganhos de força e massa muscular associados ao treinamento contra-resistência (conhecido como musculação. O objetivo deste trabalho foi revisar a literatura referente à suplementação de b-hidroxi-b-metilbutirato e os seus efeitos sobre força e hipertrofia em adultos jovens e idosos iniciantes ou treinados em treinamento contra-resistência. Estudos em indivíduos iniciando um programa de treinamento contra-resistência sugerem que a suplementação diária de 1,5 a 3,0g de b-hidroxi-b-metilbutirato pode trazer benefício ergogênico durante as primeiras quatro ou cinco semanas. Entretanto, à medida que o programa de treinamento evolui, tais efeitos não permanecem e os ganhos de força e massa muscular são proporcionados apenas pelo treinamento contra-resistência. Em indivíduos treinados, os resultados parecem não ser os mesmos, uma vez que, desde o início da suplementação, o b-hidroxi-b-metilbutirato não demonstra qualquer benefício adicional aos induzidos pelo treinamento contra-resistência. Alguns efeitos do b-hidroxi-b-metilbutirato na redução do colesterol total e lipoproteína de baixa densidade também foram observados, porém, devido às poucas evidências, não há recomendações para tal finalidade. Nenhum efeito adverso da suplementação foi observado, sendo, aparentemente, segura, contudo a maioria dos estudos foi realizada em curto prazo (menos de 4 semanas e em indivíduos destreinados. Assim, mais estudos são necessários para esclarecer o mecanismo fisiológico por meio do qual o b-hidroxi-b-metilbutirato exerce seus efeitos anticatabólicos em destreinados e para observar possíveis efeitos adversos.b-hydroxy-b-methylbutyrate is a leucine metabolite studied for its anticatabolic effects and potential benefits on strength and muscle mass gains associated with

REVISÃO INTEGRATIVA DA LITERATURA SOBRE A INFLUENZA AH1N1

Directory of Open Access Journals (Sweden)

Laura Cavalcanti de Farias Brehmer

2011-01-01

Full Text Available Tuvo como objetivo conocer la producción de conocimiento acerca de la influenza AH1N1, de la literatura sobre el tema relacionado con la aparición de la pandemia. Se trata de una revisión integradora de la literatura, que fue utilizado como criterio de selección, los artículos indizados en PubMed y SciELO en el período 2005 a 2009, en portugués, inglés o español. La muestra consistió de 14 publicaciones, todos publicados en 2009. Hubo una importante contribución de los estudios brasileños sobre el tema y los investigadores en salud pública. La investigación ha ayudado a entender la epidemiología de la enfermedad, incluyendo el perfil de los casos, la mortalidad de la enfermedad, el manejo terapéutico y factores de riesgo. Era evidente que no hay estudios sobre la enfermedad, que puede subsidiar la construcción de políticas para hacer frente mejor a esta y otras pandemias, así como ser capaces de sensibilizar a la sociedad sobre la importancia de las medidas preventivas

Apuntes sobre esporotricosis

OpenAIRE

Londoño, Fabio

2011-01-01

Se hace una breve reseña histórica de las primeras comunicaciones sobre esporotricosis. Se destaca la amplia difusión de la enfermedad en nuestro país. 3. Se hace notar la no existencia de datos bibliográficos sobre formas extracutáneas. 4. Se llama la atención sobre la eficaz ayuda de la intradermo-reacción con esporotriquina en el diagnóstico de la enfermedad. 5- Se comunica un caso de esporotricosis verrugosa tratado con anfotericin B, con excelentes resultados

Apuntes sobre esporotricosis

Directory of Open Access Journals (Sweden)

Fabio Londoño

1960-01-01

Full Text Available Se hace una breve reseña histórica de las primeras comunicaciones sobre esporotricosis. Se destaca la amplia difusión de la enfermedad en nuestro país. 3. Se hace notar la no existencia de datos bibliográficos sobre formas extracutáneas. 4. Se llama la atención sobre la eficaz ayuda de la intradermo-reacción con esporotriquina en el diagnóstico de la enfermedad. 5- Se comunica un caso de esporotricosis verrugosa tratado con anfotericin B, con excelentes resultados

Estudio sobre el proceso de implantación y seguimiento de las competencias básicas en los centros de educación secundaria de la ciudad de Burgos.

OpenAIRE

Hortigüela Alcalá, David

2017-01-01

El objeto de estudio de esta tesis doctoral se centra en: 1. Analizar la percepción de los equipos directivos sobre los procesos implantación de las competencias básicas (CCBB) en los centros educativos en la educación secundaria; 2. Estudiar la percepción sobre los docentes de Educación Física (EF) en la incorporación y tratamiento de las CCBB como elemento metodológico y evaluativo en el aula; 3. Comprobar el trabajo que realiza el profesorado de EF sobre las CCBB, en un centro de educación...

Production of aflatoxins by Aspergillus flavus and of fumonisins by Fusarium species isolated from Brazilian sorghum Avaliação da toxigenidade das cepas de Aspergillus flavus e Fusarium spp. isoladas de amostras de sorgo

Directory of Open Access Journals (Sweden)

Josefa B. da Silva

2004-09-01

Full Text Available Fifty-nine Aspergillus flavus and 35 Fusarium verticillioides strains, isolated from freshly harvested (10 and stored (130 Brazilian sorghum samples, were tested regarding their ability to produce aflatoxins (coconut milk agar and fumonisins (rice culture, respectively. Aflatoxins B1 and B2 were detected by TLC, and fumonisins B1 and B2 were analyzed by HPLC. Thirty-eight (64.4% A. flavus strains produced detectable levels of aflatoxins at concentrations ranging from 12.00 to 3282.50 µg/kg (AFB1 + AFB2, while thirty two (91% F. verticillioides strains produced FB1 at concentrations ranging from 0.12 to 5.38 µg/g. Two F. proliferatum strains produced low fumonisin levels. The toxigenic potential of A. flavus (64.4% and F. verticillioides (91.5% strains observed in sorghum samples indicates that rigorous control should be directed at the storage conditions of these products to minimize contamination with toxigenic deteriorating fungi, preventing further hazard to human and animal health.A produção de aflatoxinas por 59 cepas de Aspergillus flavus e fumonisinas por 35 cepas de Fusarium verticillioides isoladas de amostras de grãos de sorgo recém colhido (10 amostras e armazenado (130 amostras, foram avaliadas. A detecção de aflatoxinas (AFB1 e AFB2 foi efetuada por Cromatografia em Camada Delgada (CCD e fumonisinas (FB1 e FB2 foram analisadas por Cromatografia Líquida de Alta Eficiência (CLAE. Os resultados demonstram a produção de AFB1 e AFB2 em 38 cepas (64,4% de A. flavus cujos níveis variaram de 12,00 a 3282,50 µg/kg. Referente às cepas de F. verticillioides, 32 (91% produziram FB1, nas concentrações de 0,12 a 5,38 µg/g. Baixos níveis de fumonisinas foram detectados em 2 cepas de F. proliferatum. A constatação da potencialidade toxígena das cepas de A. flavus (64,4% e de F. verticillioides (91,5% nesta investigação, revelam a importância da pesquisa de aflatoxinas e fumonisinas nas amostras de sorgo. Diante disto

Notas sobre escrofulariáceas de Colombia: I. - Nueva especie de Buchnera afin A B. Rubriflora Philcox

Directory of Open Access Journals (Sweden)

Fernández Soto José Luis

1986-12-01

Full Text Available Se describe una nueva especie de Buchnera que presenta pilosidad glandular, la única entre las especies americanas del género y próxima a  B. rubriflora Philcox. Se aportan nuevos datos sobre la distribución y variabilidad de esta última, comentando finalmente la relación entre ambos táxones.  Al revisar las escrofulariáceas del Herbario Nacional Colombiano (COL, se tuvo la oportunidad de estudiar una serie de colecciones del género Buchnera, que son el objeto de esta primera nota sobre escrofulariáceas colombianas. Aparte de la localización de nuevos registros de B. rubriflora, que amplían la distribución conocida de la especie y otras puntualizaciones relativas a su parentesco y ecología; sin duda el dato más interesante lo aportó el estudio de unas plantas procedentes del sur de la Sierra de La Macarena (Depto. del Meta, que presentan indumento glandular, mezclado con pilosidad más corta no glandular. Este carácter único conocido hasta ahora en las buchneras americanas, permite describir esta planta como nueva. Este nuevo taxon está morfológicamente relacionado con B. rubriflora, con la que comparte además y con carácter exclusivo en las especies americanas la coloración roja de sus corolas. Se hacen por último algunos comentarios sobre este pequeño grupo de buchneras, del que probablemente falte aún mucho por conocer en cuanto a distribución y diversidad, por la falta de muestreo en amplios territorios colombianos ecológica y geológicamente similares a los enclaves hasta ahora conocidos para estos táxones.

Conhecimento dos obstetras sobre a transmissão vertical da hepatite B Knowledge of obstetricians about the vertical transmission of hepatitis B virus

Directory of Open Access Journals (Sweden)

Joseni Santos da Conceição

2009-03-01

Full Text Available CONTEXTO: A transmissão vertical é responsável por 35% a 40% dos novos casos de hepatite B no mundo e a infecção precoce pelo vírus da hepatite B aumenta o risco de evolução para a hepatite crônica, cirrose e carcinoma hepatocelular. OBJETIVO: Determinar o conhecimento dos obstetras sobre as práticas para o diagnóstico da infecção pelo vírus da hepatite B em gestantes e as condutas para a prevenção desta infecção em recém-nascidos de mães infectadas. MÉTODOS: Foram sorteados aleatoriamente profissionais de saúde cadastrados na Sociedade de Obstetrícia e Ginecologia da Bahia, que foram convidados a responder um questionário anônimo com informações sobre sua formação acadêmica, o local de trabalho, o contato com estudantes e as suas práticas profissionais em relação ao vírus da hepatite B. Adotou-se como critério de exclusão o não exercício atual da obstetrícia e a não residência na Bahia. A análise dos dados foi feita através do programa estatístico Epiinfo e para análise das correlações foi adotado intervalo de confiança de 95%. RESULTADOS: Foram entrevistados 301 obstetras, dos quais 90,3% reconheciam a transmissibilidade vertical do vírus da hepatite B e 81,7% solicitavam algum exame para detecção de hepatite B durante o pré-natal de suas pacientes. Sessenta e seis por cento dos médicos entrevistados referiram o AgHBs como o marcador sorológico mais adequado para avaliar a presença de infecção pelo VHB. Apenas 13,0% destes profissionais indicavam de modo sistemático a vacina contra a hepatite B e a administração de imunoglobulina nas primeiras 12 horas de vida do recém-nascido de mães infectadas. O número de respostas corretas quanto à transmissibilidade vertical do VHB, ao marcador sorológico mais adequado e à conduta para o recém-nascido de mãe infectada foi maior entre os obstetras que possuíam o Título de Especialista em Ginecologia e Obstetrícia que entre os demais

Surto de aflatoxicose aguda em cães no município de Pelotas/RS

Directory of Open Access Journals (Sweden)

Karina Guterres

Full Text Available RESUMO: As aflatoxinas pertencem ao grupo das micotoxinas e são substâncias sintetizadas durante a multiplicação de fungos que podem contaminar alimentos e rações animais, produzindo efeitos agudos ou crônicos naqueles que os consomem. Os cães são sensíveis aos efeitos tóxicos das aflatoxinas, havendo dificuldades de diagnóstico definitivo desta doença devido a fatores, como a inespecificidade dos sinais clínicos e o custo elevado da análise da presença de toxinas na alimentação. Desta forma, o objetivo deste artigo foi relatar um surto de aflatoxicose em dezoito caninos, no município de Pelotas - RS, no qual apenas um canino não veio a óbito, após a ingestão de quirelas de milho e arroz contaminadas. O diagnóstico definitivo de aflatoxicose aguda foi obtido através dos dados da anamnese, exames complementares, resultados de necropsia e histopatologia, além de análise da presença de toxinas na alimentação dos animais. Na necropsia observou-se degeneração e necrose hepática severa e na análise das amostras de alimento foi constatada a presença de aflatoxinas B1, B2, G1 e G2, em um somatório de 898,2μg/kg na quirela de milho e de 409,86μg/kg na de arroz. Assim sendo, medidas de conscientização acerca do controle e prevenção das micotoxicoses devem ser tomadas, salientando os possíveis danos à saúde dos animais. Além disto, métodos de identificação de micotoxinas, devem ser implementados na rotina hospitalar, incluindo a análise da ração oferecida, visto que a aflatoxicose, muitas vezes é subestimada.

Qualidade da castanha-do-brasil do comércio de Rio Branco, Acre Quality of Brazil nuts marketed in Rio Branco, Acre

Directory of Open Access Journals (Sweden)

Virgínia de Souza Álvares

2012-06-01

Full Text Available Este trabalho teve como objetivo avaliar a qualidade de castanhas-do-brasil beneficiadas e comercializadas em Rio Branco, Acre. Foram analisadas amostras das três marcas de castanha encontradas no mercado local quanto às variáveis: atividade de água, teor de umidade, contagem total de fungos filamentosos, quantificação de Aspergillus flavus e de A. parasiticus, bem como quantificação de aflatoxinas B1, B2, G1 e G2. As castanhas do comércio se encontravam com um teor de umidade e atividade de água adequados, o que pode ter sido responsável pela baixa contaminação por fungos e por aflatoxinas. Quanto a estas micotoxinas, as amostras estão de acordo com o recomendado pela Anvisa, podendo ser esta uma consequência da grande divulgação no Estado do uso de Boas Práticas no manejo da castanha.The goal of this paper was to evaluate the quality of Brazil nuts processed and marketed in the city of Rio Branco, in the state of Acre (Brazil. We analysed three samples for water activity, moisture content, total fungus quantification of Aspergillus flavus and A. parasiticus, as well as quantification of total aflatoxin, Afla B1, Afla B2, Afla G1 and Afla G2. The nut samples from the market showed an appropriate moisture content and water activity, which may have been responsible for the low fungus contamination and aflatoxin production. As to these mycotoxins, the samples were consistent with Anvisa's recommendations, which may be a consequence of good management of the nuts in Acre.

Percepción del profesor sobre el uso del b-learning para fortalecer competencias laborales

Directory of Open Access Journals (Sweden)

Arturo Ocampo López

2015-10-01

Full Text Available En este artículo presentamos un análisis sobre la percepción de un grupo de profesores sobre el proceso de certificación en modalidad de aprendizaje combinado, llamada blended learning, para el desarrollo de competencias docentes y del uso básico de las tecnologías de información y comunicación en los docentes. Investigamos por medio de entrevistas y cuestionarios el proceso de formación blended learning mediante una plataforma educativa, a la cual se incorporaron los contenidos y recursos de la certificación docente para la elaboración de proyectos de aprendizaje con la integración de las tecnologías y el aval de la Secretaría de Educación Pública, que da fe de las competencias laborales en México. Los resultados muestran la aceptación de los participantes del uso de la plataforma educativa Blackboard, con el refuerzo de sesiones de asesorías presenciales que les permiten prepararse para intervenir en procesos de certificación.

Contabilidad de Costos I. - Problemas sobre contabilización de las actividades relacionadas con los materiales

OpenAIRE

Morillo Moreno, Marysela C.

2008-01-01

ÍNDICE Introducción Problemas sobre terminología básica Problemas básicos sobre el Ciclo de la Contabilidad de Costos Problemas sobre contabilización de las actividades relacionadas con los materiales Problemas sobre la contabilización de las actividades relacionadas con la mano de obra Problemas sobre la contabilización de las actividades relacionadas con los costos indirectos de fabricación Problemas sobre el Ciclo de la Contabilida...

1er. Taller internacional sobre oso hormiguero gigante (Myrmecophaga tridactyla)

OpenAIRE

M.V. Guillermo Pérez Jimeno

2008-01-01

ResumenLos pasados días 2 y 3 de noviembre se llevó a cabo el 1er. Taller internacional sobre oso hormiguero gigante (Myrmecophaga tridactyla), en instalaciones del Zoológico de Florencio Varela. Participaron activamente representantes de Brasil, Colombia, Holanda, Alemania y Argentina.

FARMACOLOGÍA AVIAR 1ª PARTE: PRINCIPIOS BÁSICOS SOBRE LA ADMINISTRACIÓN DE FÁRMACOS ANTIINFECCIOSOS EN AVICULTURA

OpenAIRE

G. Sánchez

2005-01-01

El presente artículo es una revisión sobre los principios básicos de los fármacos antiinfec¬ciosos utilizados en la avicultura. Se discuten las indicaciones de los fármacos, sus dosis y vías de administración. También incluye una discusión sobre el uso de los fármacos en la prevención de enfermedades y los riesgos y precauciones que se deben tener para evitar problemas en la salud humana.

Efeito inseticida sistêmico de nanoformulações à base de nim sobre Bemisia tabaci (Hemiptera: Aleyrodidae biótipo B em tomateiro

Directory of Open Access Journals (Sweden)

Sheila Salles de Carvalho

2015-01-01

Full Text Available Este estudo avaliou a ação inseticida sistêmica e o efeito residual de nanoformulações à base de derivados de nim (Azadirachta indica A. Juss, Meliaceae sobre ninfas de Bemisia tabaci biótipo B (Hemiptera: Aleyrodidae, espécie-praga de diversas culturas de importância econômica. Suspensões coloidais contendo nanocápsulas carregadas com produtos derivados de A. indica foram preparadas utilizando polímeros biodegradáveis como poli-ε-caprolactona (PCL e poli-β-hidroxibutirato (PHB. A matriz encapsulada era composta por uma formulação comercial contendo uma quantidade enriquecida e conhecida dos limonoides azadiractina e 3-tigloilazadiractol (Azamax® 1,2 CE. Inicialmente foi estimada a CL50, para ninfas de B. tabaci, de soluções contendo óleo de nim, que foram aplicadas via água de irrigação (solo em tomateiro. Posteriormente, dois lotes de nanoformulações, com variação no tipo e quantidade dos polímeros e na quantidade do óleo comercial, foram testados quanto à ação sistêmica. As nanoformulações NC L5-2 (com nanocápsulas de PCL e NC L6-1 (com nanocápsulas de PHB, as mais eficazes entre as testadas, foram avaliadas quanto ao efeito residual. A CL50 estimada foi de 180,67 mg L–1 de azadiractina. Constatou-se também que a ação sistêmica de óleos e nanoformulações contendo compostos de nim dependem das condições ambientais em que são aplicados. O Azamax® não apresenta efeito deterrente sobre a oviposição, nem age sobre o desenvolvimento embrionário da mosca-branca quando aplicado via água de irrigação no solo no momento da infestação. As nanoformulações selecionadas são bioativas mesmo cerca de 30 dias após a aplicação, não diferindo do produto comercial.

Creencias de profesores universitarios sobre la enseñanza-aprendizaje de cursos B-Learning. Revisión bibliográfica

Directory of Open Access Journals (Sweden)

Blanca Isela Robles Haros

2016-11-01

Full Text Available El presente trabajo tiene por objetivo realizar una revisión bibliográfica sobre los estudios de las creencias de los profesores acerca de la enseñanza y aprendizaje en la modalidad Blended Learning (B-Learning. A partir de su presencia en el contexto educativo, el B-Learning emerge como una modalidad con identidad propia. Con base a su evolución, circula por contextos configurados de manera presencial y virtual, combinando métodos y estrategias de ambas modalidades. Esta modalidad ha adquirido diversas representaciones en su desarrollo, manifestando un acervo de conocimiento que debe ser compartido y sistematizado para referencia de otros contextos. Sin embargo, existe poca información en cuanto a las creencias que poseen los profesores sobre el proceso de enseñanza-aprendizaje que se sigue en esta modalidad. Entre las principales conclusiones que arrojó esta revisión, se encuentran que existe muy pocos estudios realizados a nivel mundial y menos aún localizados en Latinoamérica, lo cual dificulta el emprendimiento de las innovaciones educativas, utilizando las modalidades emergentes.

Impacto dos polimorfismos genéticos SLCO1B1 sobre a hiperbilirrubinemia neonatal: revisão sistemática com metanálise

Directory of Open Access Journals (Sweden)

Jiebo Liu

2013-10-01

Full Text Available OBJETIVO: Determinar se três variantes (388 G>A, 521 T>C, 463 C>A do membro 1B1 da família de transportadores de ânions orgânicos portadores de solutos (SLCO1B1 se associam à hiperbilirrubinemia neonatal. FONTE DE DADOS: Foi realizada busca na Infraestrutura do Conhecimento Nacional da China e em MEDLINE. A revisão sistemática com metanálise incluiu estudos genéticos que avaliaram a associação entre hiperbilirrubinemia neonatal e as variantes 388 G>A, 521 T>C, 463 C>A de SLCO1B1 entre janeiro de 1980 e dezembro de 2012. Foi realizada seleção e extração de dados por dois analistas, de forma independente. SUMÁRIO DOS ACHADOS: Foram incluídos dez artigos no estudo. Os resultados revelaram que SLCO1B1 388 G>A se associa a um aumento do risco de hiperbilirrubinemia neonatal (ORC mostrou baixo risco de hiperbilirrubinemia neonatal em recém-nascido chineses, e não foram encontradas associações importantes no Brasil nem em recém-nascidos caucasianos, asiáticos, tailandeses e malaios. Não houve diferenças significativas da SLCO1B1 463 C>A entre o grupo com hiperbilirrubinemia e o grupo controle. CONCLUSÃO: O estudo mostrou que a mutação 388 G>A do gene SLCO1B1 é fator de risco para desenvolver hiperbilirrubinemia neonatal em recém-nascidos chineses, mas não em populações caucasianas, tailandesas, brasileiras ou malaias; a mutação SLCO1B1 521 T>C fornece proteção de hiperbilirrubinemia neonatal em recém-nascidos chineses, mas não nas populações caucasianas, tailandesas, brasileiras ou malaias.

Efficiency of neem oil nanoformulations to Bemisia tabaci (GENN. Biotype B (Hemiptera: AleyrodidaeEficiência de nanoformulações a base de óleo de nim sobre Bemisia tabaci (GENN. Biótipo B (Hemiptera: Aleyrodidae

Directory of Open Access Journals (Sweden)

Sheila Salles Carvalho

2012-04-01

Full Text Available The nanotechnology, through encapsulation of active ingredients, has showed an important way to avoid problems with quickly degradation of the pesticide molecules. Thus, neem (Azadirachta indica oil nanoformulations containing ?-ciclodextrin and poli-?-caprolactone (PCL were tested as to their control efficiency against eggs and nymphs of Bemisia tabaci (Genn. biotype B reared in soybean. The Lethal Concentration (LC50 was estimated using a commercial neem oil (Organic Neem® on first-instar nymphs to establish the adequate volume of the nanoformulations per treatment. After that, they were sprayed on eggs and first-instar nymphs in laboratory and greenhouse and on third-instar nymphs in greenhouse. The commercial neem oil and distilled water were used as controls. Egg viability was not affected by any treatment. Among six nanoformulations, only one was efficient against the first-instar nymphs in laboratory conditions. However, its effective period was not increased as expected. In greenhouse, first-instar nymphs were more affected by two nanoformulations which were significantly different of the commercial neem oil - the most effective one. No mortality differences among the formulations in the third-instar test were observed. The nanoformulations were less efficient to control the B. tabaci biotype B nymphs than the commercial neem oil. A nanotecnologia, através do encapsulamento de ingredientes ativos, tem-se revelado uma importante estratégia para evitar problemas com a rápida degradação de moléculas inseticidas. Assim, nanoformulações à base de óleo de nim (Azadirachta indica utilizando os polímeros ?-ciclodextrina e poli-?-caprolactona (PCL foram testadas quanto a sua eficiência de controle de ovos e ninfas de Bemisia tabaci (Genn. biótipo B mantidas em soja. Foi estimada a CL50 utilizando uma formulação comecial de óleo de nim (Organic Neem® sobre ninfas em 1º ínstar da qual se estipulou o volume das nanoformula

Contabilidad de Costos I. - Problemas sobre la contabilización de las actividades relacionadas con la mano de obra

OpenAIRE

Morillo Moreno, Marysela C.

2008-01-01

ÍNDICE Introducción Problemas sobre terminología básica Problemas básicos sobre el Ciclo de la Contabilidad de Costos Problemas sobre contabilización de las actividades relacionadas con los materiales Problemas sobre la contabilización de las actividades relacionadas con la mano de obra Problemas sobre la contabilización de las actividades relacionadas con los costos indirectos de fabricación Problemas sobre el Ciclo de la Contabilida...

Foxp1 controls mature B cell survival and the development of follicular and B-1 B cells

Science.gov (United States)

Patzelt, Thomas; Keppler, Selina J.; Gorka, Oliver; Thoene, Silvia; Wartewig, Tim; Reth, Michael; Förster, Irmgard; Lang, Roland; Buchner, Maike; Ruland, Jürgen

2018-01-01

The transcription factor Foxp1 is critical for early B cell development. Despite frequent deregulation of Foxp1 in B cell lymphoma, the physiological functions of Foxp1 in mature B cells remain unknown. Here, we used conditional gene targeting in the B cell lineage and report that Foxp1 disruption in developing and mature B cells results in reduced numbers and frequencies of follicular and B-1 B cells and in impaired antibody production upon T cell-independent immunization in vivo. Moreover, Foxp1-deficient B cells are impaired in survival even though they exhibit an increased capacity to proliferate. Transcriptional analysis identified defective expression of the prosurvival Bcl-2 family gene Bcl2l1 encoding Bcl-xl in Foxp1-deficient B cells, and we identified Foxp1 binding in the regulatory region of Bcl2l1. Transgenic overexpression of Bcl2 rescued the survival defect in Foxp1-deficient mature B cells in vivo and restored peripheral B cell numbers. Thus, our results identify Foxp1 as a physiological regulator of mature B cell survival mediated in part via the control of Bcl-xl expression and imply that this pathway might contribute to the pathogenic function of aberrant Foxp1 expression in lymphoma. PMID:29507226

Más sobre AEXMUN y sus propósitos

Directory of Open Access Journals (Sweden)

Antonio Alejandro Ramírez Soto

1996-07-01

Centro de Tuberculosis del Hospital de San Juan de Dios con el apoyo del Ministerio de Salud y de la Secretaria de Salud del Distrito Capital, incursionando en temas indispensables en el ejercicio profesional como son los de: vacunología, esquema básico de inmunización activa para países en desarrollo, el desarrollo de la vacuna anti-malárica, Torchs, tetanos, difteria, tosferina, tuberculosis, poliomielitis, sarampión, rubeola, parotiditis, hepatitis B, vacunas de polisacáridos bacterianos, cólera, fiebre tifoidea, zoonosis, VIH/Sida en Colombia, vigilancia epidemiológica de las enfermedades inmunoprevenibles y el manejo seguro de las vacunas. EI contenido de todos estos gran des capítulos fue publicado en los boletines 2 y 3 del volumen 6 de Aexmun. En la misma forma, fue publicado en el No.1 del mismo volumen el lema sobre la Formación Continuada del Médico y sobre el inagotable campo de los Trastornos del Sueño.

Antimutagenicity and Antiproliferative Studies of Lipidic Extracts from White Shrimp (Litopenaeus vannamei

Directory of Open Access Journals (Sweden)

Carolina Moreno-Félix

2010-11-01

Full Text Available An organic extract from fresh shrimp (Litopenaeus vannamei was studied for antimutagenic and antiproliferative properties using Salmonella typhimurium tester strains TA98 and TA100 with metabolic activation (S9 and a cancer cell line (B-cell lymphoma, respectively. Shrimp extract was sequentially fractionated by thin layer chromatography (TLC and each fraction was tested for antimutagenic and antiproliferative activities. Crude organic extracts obtained from shrimp reduced the number of revertants caused by aflatoxina B1, showing a dose-response type of relationship. Sequential TLC fractionation of the active extracts produced several antimutagenic and/or antiproliferative fractions. These results suggested that the lipid fraction of the tested species contained compounds with chemoprotective properties that reduce the mutagenicity of AFB1 and proliferation of a cancer cell line.

Contabilidad de Costos I. - Problemas sobre la contabilización de las actividades relacionadas con los costos indirectos de fabricación

OpenAIRE

Morillo Moreno, Marysela C.

2008-01-01

ÍNDICE Introducción Problemas sobre terminología básica Problemas básicos sobre el Ciclo de la Contabilidad de Costos Problemas sobre contabilización de las actividades relacionadas con los materiales Problemas sobre la contabilización de las actividades relacionadas con la mano de obra Problemas sobre la contabilización de las actividades relacionadas con los costos indirectos de fabricación Problemas sobre el Ciclo de la Contabilida...

DISERTACIÓN SOBRE JUSTICIA Y EQUIDAD

Directory of Open Access Journals (Sweden)

Sayuri P. Tamura M.

2001-01-01

Full Text Available «Disertación sobre equidad y justicia» es básicamente una respuesta a una inquietud en particular que yo tenía sobre las distintas posiciones que existen sobre estos dos temas y cómo definir cuál es la más acertada. Hice una descripción del punto de vista de Amartya Sen –la violación de los derechos sobre la propiedad privada es justificable si evitan las hambrunas2– frente al de Robert Nozick –la propiedad privada es un derecho fundamental y como tal debe ser respetado3–, sin embargo, aunque ambos enfoques son totalmente contrarios tienen mucho sentido, por lo cual es bastante difícil decidirse por uno en particular. Fue de esta forma, enfrentando sus opiniones, que yo logré desarrollar una posición frente a estas dos perspectivas, y así dar mi opinión al DISERTACIÓN SOBRE JUSTICIA Y EQUIDAD SAYURI P. TAMURA M. Estudiante de Economía y Negocios Internacionales de la Universidad ICESI. respecto. Al final, llegué a una conclusión, que aunque no es la más original y tampoco es la única, tiene mucho sentido y seguramente de ser posible, la situación del país podría cambiar para bien.

Vitamin B1

Science.gov (United States)

... Prize Alfred Nobel's Life and Work Teachers' Questionnaire Vitamin B1 - About The Chicken Farm educational game and ... the game window. Reading: "Christian Eijkman, Beriberi and Vitamin B1" - Who was Eijkman and why did he ...

26 CFR 1.267(b)-1 - Relationships.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Relationships. 1.267(b)-1 Section 1.267(b)-1...) INCOME TAXES Items Not Deductible § 1.267(b)-1 Relationships. (a) In general. (1) The persons referred to... partnership separately. Therefore, if the other person and a partner are within any one of the relationships...

La comprensi??n lectora en Educaci??n Primaria: una investigaci??n sobre las inferencias como estrategia b??sica de lectura

OpenAIRE

Rico Tello, Marina

2015-01-01

La comprensi??n lectora es una capacidad b??sica que debe adquirir el alumnado a lo largo su vida escolar y familiar, es por ello por lo que se llevar a cabo una investigaci??n educativa sobre la comprensi??n literal e inferencial en 22 alumnos de 3o de Educaci??n Primaria en el Centro de Educaci??n Infantil y Primaria Alcazaba (Granada). Se examinan las destrezas de las que disponen para comprender el significado literal e inferencial de un texto continuo o discontinuo a trav??s de una in...

Polycyclic phloroglucinols as PTP1B inhibitors from Hypericum longistylum: Structures, PTP1B inhibitory activities, and interactions with PTP1B.

Science.gov (United States)

Cao, Xiangrong; Yang, Xueyuan; Wang, Peixia; Liang, Yue; Liu, Feng; Tuerhong, Muhetaer; Jin, Da-Qing; Xu, Jing; Lee, Dongho; Ohizumi, Yasushi; Guo, Yuanqiang

2017-12-01

Protein tyrosine phosphatase 1B (PTP1B) has been regarded asa target for the research and development of new drugs to treat type II diabetes and PTP1B inhibitors are potential lead compounds for this type of new drugs. A phytochemical investigation to obtain new PTP1B inhibitors resulted in the isolation of four new phloroglucinols, longistyliones A-D (1-4) from the aerial parts of Hypericum longistylum. The structures of 1-4 were elucidated on the basis of extensive 1D and 2D NMR spectroscopic data analysis, and the absolute configurations of these compounds were established by comparing their experimental electronic circular dichroism (ECD) spectra with those calculated by the time-dependent density functional theory method. Compounds 1-4 possess a rare polycyclic phloroglucinol skeleton. The following biological evaluation revealed that all of the compounds showed PTP1B inhibitory effects. The further molecular docking studies indicated the strong interactions between these bioactive compounds with the PTP1B protein, which revealed the possible mechanism of PTP1B inhibition of bioactive compounds. All of the results implied that these compounds are potentially useful for the treatment of type II diabetes. Copyright © 2017 Elsevier Inc. All rights reserved.

Efectividad del programa educativo sobre desarrollo psicomotor en el nivel de conocimientos del cuidador familiar y el desarrollo del niño menor de cinco años. P. J. El Porvenir B - Chimbote, 2007

OpenAIRE

Reyna Márquez, Elena Esther

2015-01-01

Investigación de tipo pre - experimental, se realizó con el objetivo de determinar la efectividad del programa educativo sobre desarrollo psicomotor en el nivel de conocimientos del cuidador familiar y el desarrollo psicomotor del niño menor de cinco años en el pueblo joven El Porvenir B. Con una población muestral de 27 cuidadoras familiares y sus niños menores de cinco años. Para la recolección de datos se aplicó el programa educativo sobre desarrollo psicomotor, el cuestionario sobre desar...

26 CFR 1.367(b)-1 - Other transfers.

Science.gov (United States)

2010-04-01

... its successor in interest) that the shareholder is making the election described in § 1.367(b)-3(c)(3... paragraph (c)(2)— (i) A shareholder described in § 1.367(b)-3(b)(1) that realizes income in a transaction described in § 1.367(b)-3(a); (ii) A shareholder that makes the election described in § 1.367(b)-3(c)(3...

Conceções dos alunos do 1.º Ciclo do Ensino Básico sobre o sistema digestivo

OpenAIRE

Moreira, Dalila; Almeida, Liliana; Lopes, Mónica; Veiga, Vânia; Cavadas, Bento

2012-01-01

Este estudo exploratório teve como objetivo determinar os conhecimentos dos alunos do 1º Ciclo do Ensino Básico (1.º CEB) sobre o sistema digestivo. Usou-se uma adaptação do método seguido por Dantas (2006). O instrumento de recolha de dados utilizado foi o desenho. Solicitou-se a 69 alunos (37 raparigas e 32 rapazes) do 4.º ano, de quatro escolas do distrito de Santarém, que elaborassem um desenho sobre a constituição do aparelho digestivo humano. Os alunos fizeram os desenhos em sala de aul...

Efeitos de diferentes níveis das vitaminas tiamina, riboflavina e piridoxina sobre o desempenho de frangos de corte

OpenAIRE

Souza,Ana Lúcia Pozzobon de; Toledo,Geni Salete Pinto de; Costa,Paulo Tabajara Chaves; Alencastro,Ubiratan Gross

1996-01-01

O experimento foi conduzido para analisar os efeitos de níveis altos e baixos das vitaminas tiamina (B1), riboflavina (B2) e piridoxina (B6) sobre o desempenho de frangos de corte. Um total de 576 pintos de corte de um dia, foram distribuídos em desenho experimental trifatorial (2³), inteiramente casualizado onde dois níveis (alto e baixo) de cada vitamina foram testados: vitamina B1 (A=3 mg/kg; B=2 mg/kg), vitamina B2 (A=6 mg/kg; B=4 mg/kg) e vitamina B6 (A=4,5 mg/kg; B=3 mg/kg). Deste modo,...

Association of Neuropeptide Y (NPY), Interleukin-1B (IL1B) Genetic Variants and Correlation of IL1B Transcript Levels with Vitiligo Susceptibility

Science.gov (United States)

Laddha, Naresh C.; Dwivedi, Mitesh; Mansuri, Mohmmad Shoab; Singh, Mala; Patel, Hetanshi H.; Agarwal, Nishtha; Shah, Anish M.; Begum, Rasheedunnisa

2014-01-01

Background Vitiligo is a depigmenting disorder resulting from loss of functional melanocytes in the skin. NPY plays an important role in induction of immune response by acting on a variety of immune cells. NPY synthesis and release is governed by IL1B. Moreover, genetic variability in IL1B is reported to be associated with elevated NPY levels. Objectives Aim of the present study was to explore NPY promoter −399T/C (rs16147) and exon2 +1128T/C (rs16139) polymorphisms as well as IL1B promoter −511C/T (rs16944) polymorphism and to correlate IL1B transcript levels with vitiligo. Methods PCR-RFLP method was used to genotype NPY -399T/C SNP in 454 patients and 1226 controls; +1128T/C SNP in 575 patients and 1279 controls and IL1B −511C/T SNP in 448 patients and 785 controls from Gujarat. IL1B transcript levels in blood were also assessed in 105 controls and 95 patients using real-time PCR. Results Genotype and allele frequencies for NPY −399T/C, +1128T/C and IL1B −511C/T SNPs differed significantly (pvitiligo by 2.3 fold (pvitiligo (p = 0.015), also in female patients than male patients (p = 0.026). Genotype-phenotype correlation showed moderate association of IL1B -511C/T polymorphism with higher IL1B transcript levels. Trend analysis revealed significant difference between patients and controls for IL1B transcript levels with respect to different genotypes. Conclusion Our results suggest that NPY −399T/C, +1128T/C and IL1B −511C/T polymorphisms are associated with vitiligo and IL1B −511C/T SNP influences its transcript levels leading to increased risk for vitiligo in Gujarat population. Up-regulation of IL1B transcript in patients advocates its possible role in autoimmune pathogenesis of vitiligo. PMID:25221996

EFECTO DEL 1-METILCICLOPROPENO (1-MCP Y TRATAMIENTO HIDROTÉRMICO SOBRE LA FISIOLOGÍA Y CALIDAD DEL MANGO 'KEITT'

Directory of Open Access Journals (Sweden)

J. A. Osuna-García

2007-01-01

Full Text Available El objetivo del presente trabajo fue evaluar el efecto del 1-MCP (0 y 300 nl·litro-1 y diferentes niveles de tratamiento hidrotérmico (0, 52 °C por 5 min y 46 °C por 110 min sobre la fisiología y calidad de mango 'Keitt'. Se analizó velocidad de respiración, pérdida de peso, firmeza, color de pulpa, sólidos solubles totales y porcentaje de frutos enfermos. Se encontró que la efectividad del 1-MCP varió acorde al nivel de tratamiento hidrotérmico. En frutos sin hidrotérmico el 1-MCP disminuyó velocidad de respiración, no influyó en la pérdida de peso, mantuvo cuatro veces más la firmeza y retrasó el cambio de color de pulpa y el aumento de los sólidos solubles. Sin embargo, bajo tratamiento hidrotérmico por 5 min el 1-MCP incrementó velocidad de respiración, no influyó en la pérdida de peso, mantuvo dos veces más la firmeza de pulpa, retrasó el desarrollo del color de pulpa y mantuvo sin cambios los sólidos solubles. La efectividad del 1-MCP sobre firmeza y pérdida de peso fue significativamente afectada por el tratamiento hidrotérmico de 110 min, y no tuvo ningún efecto sobre el control de enfermedades, sin embargo, el tratamiento con agua caliente por 5 min redujo en más de 50 % la presencia de frutos enfermos. El 1-MCP en combinación con el tratamiento hidrotérmico de 5 min alargó en cinco días la vida de anaquel de los frutos y podría ser una alternativa viable en mercados que no requieren tratamiento hidrotérmico cuarentenario para el control de mosca de la fruta.

Co-construyendo historias: a la búsqueda de hechos luminosos en los relatos familiares sobre el consumo de drogas

Directory of Open Access Journals (Sweden)

Ayme Pacheco Trejo

2008-01-01

Full Text Available La presente investigación se ubica bajo el marco teórico del construccionismo social. Los relatos familiares sobre el consumo de drogas se exploraron con un enfoque comprensivo-interpretativo, ya que se parte del supuesto de que las personas se relacionan y construyen sus realidades a través de la interacción dialógica entre los participantes, donde se incluye al propio investigador. El propósito del presente estudio fue identificar los hechos que iluminan las contradicciones y potenciar la emergencia de historias alternativas, por medio de puntuar aspectos poco atendidos de la experiencia, y cuestionar prácticas y discursos sociales hegemónicos. Para tal fin se presenta el caso de una familia con un miembro consumidor. Los espacios conversacionales fueron tres y se utilizo la entrevista semi-estructurada con base en la propuesta narrativa de Michael White (2002a, 2002b. Los resultados permiten observar el quebranto del relato dominante; un relato plagado de problemas, de etiquetas que devienen de una relación de saber-poder que se articulan con una red de controles y normas sociales. Un aprendizaje cultural que se materializa en formas de consumo, formas de relacionarse, formas de enfermar, curarse, y morir; esto es, un aprendizaje que penetra la conciencia y la relación con el consumidor, sin que necesariamente se perciba como un mecanismo de control negativo. Se concluye sobre la importancia de una reconstrucción colectiva, que representa una visión de la realidad como producto de una acción reflexiva de los participantes, a través de saberes sociales compartidos, que dan cuenta de la riqueza y complejidad de las narraciones familiares sobre el consumo de drogas.

Association of neuropeptide Y (NPY, interleukin-1B (IL1B genetic variants and correlation of IL1B transcript levels with vitiligo susceptibility.

Directory of Open Access Journals (Sweden)

Naresh C Laddha

Full Text Available BACKGROUND: Vitiligo is a depigmenting disorder resulting from loss of functional melanocytes in the skin. NPY plays an important role in induction of immune response by acting on a variety of immune cells. NPY synthesis and release is governed by IL1B. Moreover, genetic variability in IL1B is reported to be associated with elevated NPY levels. OBJECTIVES: Aim of the present study was to explore NPY promoter -399T/C (rs16147 and exon2 +1128T/C (rs16139 polymorphisms as well as IL1B promoter -511C/T (rs16944 polymorphism and to correlate IL1B transcript levels with vitiligo. METHODS: PCR-RFLP method was used to genotype NPY -399T/C SNP in 454 patients and 1226 controls; +1128T/C SNP in 575 patients and 1279 controls and IL1B -511C/T SNP in 448 patients and 785 controls from Gujarat. IL1B transcript levels in blood were also assessed in 105 controls and 95 patients using real-time PCR. RESULTS: Genotype and allele frequencies for NPY -399T/C, +1128T/C and IL1B -511C/T SNPs differed significantly (p<0.0001, p<0.0001; p = 0.0161, p = 0.0035 and p<0.0001, p<0.0001 between patients and controls. 'TC' haplotype containing minor alleles of NPY polymorphisms was significantly higher in patients and increased the risk of vitiligo by 2.3 fold (p<0.0001. Transcript levels of IL1B were significantly higher, in patients compared to controls (p = 0.0029, in patients with active than stable vitiligo (p = 0.015, also in female patients than male patients (p = 0.026. Genotype-phenotype correlation showed moderate association of IL1B -511C/T polymorphism with higher IL1B transcript levels. Trend analysis revealed significant difference between patients and controls for IL1B transcript levels with respect to different genotypes. CONCLUSION: Our results suggest that NPY -399T/C, +1128T/C and IL1B -511C/T polymorphisms are associated with vitiligo and IL1B -511C/T SNP influences its transcript levels leading to increased risk for vitiligo in

Measurement of the $\\chi_b(3P)$ mass and of the relative rate of $\\chi_{b1}(1P)$ and $\\chi_{b2}(1P)$ production

CERN Document Server

Aaij, Roel; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Anderson, Jonathan; Andreassen, Rolf; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Belogurov, Sergey; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Bird, Thomas; Bizzeti, Andrea; Bjørnstad, Pål Marius; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borgia, Alessandra; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Brambach, Tobias; van den Brand, Johannes; Bressieux, Joël; Brett, David; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Brook, Nicholas; Brown, Henry; Bursche, Albert; Busetto, Giovanni; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Campana, Pierluigi; Campora Perez, Daniel; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Ciba, Krzystof; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cojocariu, Lucian; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Counts, Ian; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dalseno, Jeremy; David, Pascal; David, Pieter; Davis, Adam; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Silva, Weeraddana; De Simone, Patrizia; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Di Canto, Angelo; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dreimanis, Karlis; Dujany, Giulio; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farinelli, Chiara; Farley, Nathanael; Farry, Stephen; Fay, Robert; Ferguson, Dianne; Fernandez Albor, Victor; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fontana, Marianna; Fontanelli, Flavio; Forty, Roger; Francisco, Oscar; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; García Pardiñas, Julián; Garofoli, Justin; Garra Tico, Jordi; Garrido, Lluis; Gaspar, Clara; Gauld, Rhorry; Gavardi, Laura; Gavrilov, Gennadii; Geraci, Angelo; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianelle, Alessio; Gianì, Sebastiana; Gibson, Valerie; Giubega, Lavinia-Helena; Gligorov, V.V.; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Hampson, Thomas; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Hunt, Philip; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jaton, Pierre; Jawahery, Abolhassan; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Karodia, Sarah; Kelsey, Matthew; Kenyon, Ian; Ketel, Tjeerd; Khanji, Basem; Khurewathanakul, Chitsanu; Klaver, Suzanne; Klimaszewski, Konrad; Kochebina, Olga; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Korolev, Mikhail; Kozlinskiy, Alexandr; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kurek, Krzysztof; Kvaratskheliya, Tengiz; La Thi, Viet Nga; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lambert, Robert W; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Leo, Sabato; Leroy, Olivier; Lesiak, Tadeusz; Lespinasse, Mickael; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Lohn, Stefan; Longstaff, Iain; Lopes, Jose; Lopez-March, Neus; Lowdon, Peter; Lu, Haiting; Lucchesi, Donatella; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Machefert, Frederic; Machikhiliyan, Irina V; Maciuc, Florin; Maev, Oleg; Malde, Sneha; Malinin, Alexander; Manca, Giulia; Mancinelli, Giampiero; Mapelli, Alessandro; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Märki, Raphael; Marks, Jörg; Martellotti, Giuseppe; Martens, Aurelien; Martín Sánchez, Alexandra; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathe, Zoltan; Matteuzzi, Clara; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; McSkelly, Ben; Meadows, Brian; Meier, Frank; Meissner, Marco; Merk, Marcel; Milanes, Diego Alejandro; Minard, Marie-Noelle; Moggi, Niccolò; Molina Rodriguez, Josue; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Müller, Katharina; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Nicol, Michelle; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Oggero, Serena; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Orlandea, Marius; Otalora Goicochea, Juan Martin; Owen, Patrick; Oyanguren, Maria Arantza; Pal, Bilas Kanti; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parkes, Christopher; Parkinson, Christopher John; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Perrin-Terrin, Mathieu; Pescatore, Luca; Pesen, Erhan; Petridis, Konstantin; Petrolini, Alessandro; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Playfer, Stephen; Plo Casasus, Maximo; Polci, Francesco; Poluektov, Anton; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Price, Eugenia; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Rachwal, Bartolomiej; Rademacker, Jonas; Rakotomiaramanana, Barinjaka; Rama, Matteo; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Roa Romero, Diego; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruiz, Hugo; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sepp, Indrek; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Silva Coutinho, Rafael; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Anthony; Smith, Edmund; Smith, Eluned; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Sparkes, Ailsa; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Steinkamp, Olaf; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Stroili, Roberto; Subbiah, Vijay Kartik; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szczypka, Paul; Szumlak, Tomasz; T'Jampens, Stephane; Teklishyn, Maksym; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ubeda Garcia, Mario; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Whitehead, Mark; Wicht, Jean; Wiedner, Dirk; Wilkinson, Guy; Williams, Matthew; Williams, Mike; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wu, Suzhi; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Wen Chao; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang; Zvyagin, Alexander

2014-10-14

The production of $\\chi_b$ mesons in proton-proton collisions is studied using a data sample collected by the LHCb detector, at centre-of-mass energies of $\\sqrt{s}=7$ and $8$ TeV and corresponding to an integrated luminosity of 3.0 fb$^{-1}$. The $\\chi_b$ mesons are identified through their decays to $\\Upsilon(1S)\\gamma$ and $\\Upsilon(2S)\\gamma$ using photons that converted to $e^+e^-$ pairs in the detector. The $\\chi_b(3P)$ meson mass, and the relative prompt production rate of $\\chi_{b1}(1P)$ and $\\chi_{b2}(1P)$ mesons as a function of the $\\Upsilon(1S)$ transverse momentum in the $\\chi_b$ rapidity range 2.0< $y$<4.5, are measured. Assuming a mass splitting between the $\\chi_{b1}(3P)$ and the $\\chi_{b2}(3P)$ states of 10.5 MeV/$c^2$, the mass of the $\\chi_{b1}(3P)$ meson is \\begin{equation*} m(\\chi_{b1}(3P))= 10515.7^{+2.2}_{-3.9}(stat) ^{+1.5}_{-2.1}(syst) MeV/c^2. \\end{equation*}

Seasonal behaviour of B0 and B1

International Nuclear Information System (INIS)

Mosert Gonzalez, M. de; Radicella, S.M.

1997-01-01

A preliminary analysis of the thickness parameter B0 and the shape parameter B1 is presented. Noon electron density profiles recorded at five ionospheric stations during different seasonal and solar activity conditions are used in the study. The results show that both parameters present a seasonal trend with minimum value for B0 during the local winter and maximum during the local summer. This behaviour is inverted for B1. Discrepancies with IRI-90 model are found. (author). 8 refs, 4 figs, 2 tabs

Novas possibilidades para o consenso sobre a Segurança Hemisférica?

Directory of Open Access Journals (Sweden)

PATRÍCIA MARA CABRAL DE VASCONCELLOS

2009-05-01

Full Text Available B; font-size: small;">B; font-size: small;">

O artigo discute as novas possibilidades para

alcançar o consenso sobre a Segurança Hemisférica,

enfatizando o novo governo de Barack Obama, os

60 anos da OEA e os 5 anos da “Declaração sobre

Segurança nas Américas”.

A expressão e educação dramática : uma área transversal no pré-escolar e no 1º ciclo do ensino básico

OpenAIRE

Pereira, Marisa

2015-01-01

Relatório final apresentado para a obtenção do grau de mestre em Educação pré-escolar e 1º ciclo do ensino básico. No seguimento de uma síntese da prática pedagógica realizada nos contextos de jardim-de-infância, de escola de 1º ciclo e de creche, respetivamente, reflito sobre as dificuldades encontradas, sobre as potencialidades detetadas e aspetos a melhorar. Também fundamento algumas das minhas aprendizagens e pontos de vista. No segundo capítulo, pretendo mostrar, com os documentos ...

Contabilidad de Costos I. - Problemas sobre el Ciclo de la Contabilidad de Costo, a través del estado de costos de producción y ventas

OpenAIRE

Morillo Moreno, Marysela C.

2008-01-01

ÍNDICE Introducción Problemas sobre terminología básica Problemas básicos sobre el Ciclo de la Contabilidad de Costos Problemas sobre contabilización de las actividades relacionadas con los materiales Problemas sobre la contabilización de las actividades relacionadas con la mano de obra Problemas sobre la contabilización de las actividades relacionadas con los costos indirectos de fabricación Problemas sobre el Ciclo de la Contabilida...

Las políticas sobre educación básica en américa latina: las perspectivas de los organismos internacionales

Directory of Open Access Journals (Sweden)

Jorge M. Gorostiaga

2017-11-01

Full Text Available RESUMEN: Este artículo busca contribuir a la comprensión de cómo se estructura actualmente la agenda de reforma educativa en América Latina. Uno de los principales instrumentos que utilizan las organizaciones internacionales en la definición de la agenda y del discurso de las políticas sobre educación es la difusión de documentos de diagnóstico y propuestas de mejoras. El artículo analiza los posicionamientos de un conjunto de documentos producidos y/o promovidos, durante el período 2012-2014, por algunos de los principales organismos que participan en la cooperación técnica y financiera en América Latina. Para ello compara las perspectivas de análisis, los balances, los desafíos y las recomendaciones que los documentos presentan sobre las políticas de educación básica implementadas en la región desde comienzos de la década de 2000.

Organic anion transporter 3- and organic anion transporting polypeptides 1B1- and 1B3-mediated transport of catalposide

Directory of Open Access Journals (Sweden)

Jeong HU

2015-01-01

Full Text Available Hyeon-Uk Jeong,1 Mihwa Kwon,2 Yongnam Lee,3 Ji Seok Yoo,3 Dae Hee Shin,3 Im-Sook Song,2 Hye Suk Lee1 1College of Pharmacy, The Catholic University of Korea, Bucheon 420-743, Korea; 2College of Pharmacy and Research Institute of Pharmaceutical Sciences, Kyungpook National University, Daegu 702-701, Korea; 3Central R&D Institute, Yungjin Pharm Co., Ltd., Suwon 443-270, Korea Abstract: We investigated the in vitro transport characteristics of catalposide in HEK293 cells overexpressing organic anion transporter 1 (OAT1, OAT3, organic anion transporting polypeptide 1B1 (OATP1B1, OATP1B3, organic cation transporter 1 (OCT1, OCT2, P-glycoprotein (P-gp, and breast cancer resistance protein (BCRP. The transport mechanism of catalposide was investigated in HEK293 and LLC-PK1 cells overexpressing the relevant transporters. The uptake of catalposide was 319-, 13.6-, and 9.3-fold greater in HEK293 cells overexpressing OAT3, OATP1B1, and OATP1B3 transporters, respectively, than in HEK293 control cells. The increased uptake of catalposide via the OAT3, OATP1B1, and OATP1B3 transporters was decreased to basal levels in the presence of representative inhibitors such as probenecid, furosemide, and cimetidine (for OAT3 and cyclosporin A, gemfibrozil, and rifampin (for OATP1B1 and OATP1B3. The concentration-dependent OAT3-mediated uptake of catalposide revealed the following kinetic parameters: Michaelis constant (Km =41.5 µM, maximum uptake rate (Vmax =46.2 pmol/minute, and intrinsic clearance (CLint =1.11 µL/minute. OATP1B1- and OATP1B3-mediated catalposide uptake also showed concentration dependency, with low CLint values of 0.035 and 0.034 µL/minute, respectively. However, the OCT1, OCT2, OAT1, P-gp, and BCRP transporters were apparently not involved in the uptake of catalposide into cells. In addition, catalposide inhibited the transport activities of OAT3, OATP1B1, and OATP1B3 with half-maximal inhibitory concentration values of 83, 200, and 235 µ

Comparison of genetic variations of the SLCO1B1, SLCO1B3, and SLCO2B1 genes among five ethnic groups.

Science.gov (United States)

Namgoong, Suhg; Cheong, Hyun Sub; Kim, Ji On; Kim, Lyoung Hyo; Na, Han Sung; Koh, In Song; Chung, Myeon Woo; Shin, Hyoung Doo

2015-11-01

Organic anion-transporting polypeptide (OATP; gene symbol, SLCO) transporters are generally involved in the uptake of multiple drugs and their metabolites at most epithelial barriers. The pattern of single-nucleotide polymorphisms (SNPs) in these transporters may be determinants of interindividual variability in drug disposition and response. The objective of this study was to define the distribution of SNPs of three SLCO genes, SLCO1B1, SLCO1B3, and SLCO2B1, in a Korean population and other ethnic groups. The study was screened using the Illumina GoldenGate assay for genomic DNA from 450 interethnic subjects, including 11 pharmacogenetic core variants and 76 HapMap tagging SNPs. The genotype distribution of the Korean population was similar to East Asian populations, but significantly different from African American and European American cohorts. These interethnic differences will be useful information for prospective studies, including genetic association and pharmacogenetic studies of drug metabolism by SLCO families. Copyright © 2015 Elsevier B.V. All rights reserved.

Jumonji/Arid1b (Jarid1b) protein modulates human esophageal cancer cell growth

Science.gov (United States)

KANO, YOSHIHIRO; KONNO, MASAMITSU; OHTA, KATSUYA; HARAGUCHI, NAOTSUGU; NISHIKAWA, SHIMPEI; KAGAWA, YOSHINORI; HAMABE, ATSUSHI; HASEGAWA, SHINICHIRO; OGAWA, HISATAKA; FUKUSUMI, TAKAHITO; NOGUCHI, YUKO; OZAKI, MIYUKI; KUDO, TOSHIHIRO; SAKAI, DAISUKE; SATOH, TAROH; ISHII, MASARU; MIZOHATA, EIICHI; INOUE, TAKESHI; MORI, MASAKI; DOKI, YUICHIRO; ISHII, HIDESHI

2013-01-01

Although esophageal cancer is highly heterogeneous and the involvement of epigenetic regulation of cancer stem cells is highly suspected, the biological significance of epigenetically modified molecules that regulate different subpopulations remains to be firmly established. Using esophageal cancer cells, we investigated the functional roles of the H3K4 demethylase Jumonji/Arid1b (Jarid1b) (Kdm5b/Plu-1/Rbp2-h1), an epigenetic factor that is required for continuous cell growth in melanoma. JARID1B knockdown resulted in the suppression of esophageal cancer cell growth, sphere formation and invasion ability and was associated with loss of epithelial marker expression. However, these inhibitory effects observed on tumor formation were reverted subsequent to subcutaneous inoculation of these cells into immune-deficient mice. These results indicated that JARID1B plays a role in maintaining cancer stem cells in the esophagus and justifies the rationale for studying the effects of continuous inhibition of this epigenetic factor in esophageal cancer. PMID:24649241

Incidencia de los fertilizantes sobre el pH del suelo

OpenAIRE

Ginés, Irantzu; Mariscal Sancho, Ignacio de Loyola

2002-01-01

El pH del suelo o del sustrato de cultivo determina la asimilabilidad de los nutrientes; los fertilizantes tienen una importante influencia sobre dicho pH. La incidencia de los fertilizantes sobre el pH del suelo depende principalmente de: a) el perfil acidificante de la composición química del fertilizante utilizado b) de su carácter descalcificante o calcificante y c) de la capacidad tamponadora del suelo. En esta monografía se recogen la incidencia de los principales fertilizantes comercia...

Data of evolutionary structure change: 1BT8B-1EN5B [Confc[Archive

Lifescience Database Archive (English)

Full Text Available e>KGLKK----GTTLQ >H ---- > ATOM ...bChain>B 1BT8B KNMAPKGSAPERPT cture>H ...DChain> LVLKG--DKLAV >EEEE -- EEEE...ence>LVWDPLGKRINT >EEEE EEEEe> AT...re> ATOM 2237 CA LYS B 80 12.251 15.102 18.409 1.00 11.94 C

Sobre el Contenido de los Marcos Conceptuales Contables

Directory of Open Access Journals (Sweden)

Leila Di Russo de Hauque

2007-12-01

Full Text Available El presente trabajo tiene como objetivo el análisis de los distintos marcos conceptuales vigentes en diferentes sistemas normativos contables. Paralelamente a las revisiones empíricas que dicho trabajo determina, incluye reflexiones a priori sobre el contenido de dichos marcos conceptuales. El trabajo discurre inicialmente sobre el problema de la naturaleza normativa o doctrinaria de sus contenidos tradicionales sin inclinarse definitivamente por una u otra vertiente. Respecto de los elementos que se incluirán en ellos, se justifica la inclusión de las listas de objetivos y requisitos de la información contable para definir el alcance del concepto de informe de uso externo. Además se define a favor de la inclusión, conjuntamente con las respuestas a las pregunas básicas sobre la labor contable, de contenidos ligados al proceso de obtención y de la exposición de la información contable de uso externo.

Efeitos da radiação ultravioleta-B sobre a morfologia foliar de Arabidopsis thaliana (L. Heynh. (Brassicaceae Effects of ultraviolet-B radiation on leaf morphology of Arabidopsis thaliana (L. Heynh. (Brassicaceae

Directory of Open Access Journals (Sweden)

Maria Regina Torres Boeger

2006-06-01

Full Text Available A redução da camada de ozônio resulta no aumento da radiação ultravioleta que atinge a superfície terrestre, especialmente a radiação ultravioletaB (UV-B. O aumento da radiação poderá induzir a mudanças estruturais e fisiológicas nas plantas, influenciando no seu crescimento e desenvolvimento. O objetivo deste trabalho foi determinar os efeitos da radiação UV-B ambiente sobre a morfologia das folhas de Arabidopsis thaliana desenvolvidas em condições controladas. As sementes de A. thaliana cresceram em câmaras de crescimento, com 300 µmol m-2s-1 de radiação fotossinteticamente ativa (PAR com ou sem 6 kJ m-2 s-1 de radiação UV-Bbe (UV-Bbe; UV-B biologicamente efetiva. Após 21 dias, 10 folhas de cada tratamento (com e sem radiação UV-B foram coletadas para avaliar área foliar, massa fresca e seca, AEF, densidades estomáticas e de tricomas de ambas as faces da folha, espessura da lâmina foliar e concentração de compostos fenólicos e de clorofila total, a e b. As folhas tratadas com radiação UV-B apresentaram menor área foliar, massa fresca e seca, densidade de tricomas na face adaxial e densidade de estômatos na face abaxial da folha. Entretanto, apresentaram os maiores valores médios de espessura total da lâmina e do mesofilo, maior concentração de clorofila total, clorofila a e clorofila b e compostos fenólicos foliares do que as folhas não tratadas com radiação UV-B. Essas diferenças morfológicas significativas (p Reduction of the ozone layer results in the increase in ultraviolet radiation reaching the earth's surface, especially the ultraviolet-B (UV-B. The increase of radiation may induce structural and physiological changes in plants, influencing their growth and development. This paper evaluates the effects of ambient UV-B radiation upon to the leaf morphology of Arabidopsis thaliana developed under controlled conditions. The seeds of A. thaliana grown in environmental chamber, with 300 µmol m-2

Variability in equatorial B0 and B1

International Nuclear Information System (INIS)

Adeniyi, J.O.; Radicella, S.M.

2002-01-01

Variability of ionospheric profile parameters B0 and B1, below the F2 peak is investigated for an equatorial station at two levels of solar activities. The whole 24 hours of the day and the four seasons of the year are covered. Absolute and relative variability indices were utilized in the study. Some evidences of correlations of variability index and profiles parameters were observed. Daytime values of relative variability in B1 at solar minimum were found to be greater than those of solar maximum. (author)

Eficácia de herbicidas aplicados em diferentes épocas sobre B. pilosa e I. quamoclit em área de cana-de-açúcar colhida mecanicamente Effectiveness of herbicides applied at different times on B. pilosa and I. quamoclit in mechanically harvested sugarcane area

Directory of Open Access Journals (Sweden)

P.A. Monquero

2009-01-01

Full Text Available O objetivo deste trabalho foi estudar a eficácia agronômica de herbicidas utilizados em áreas no sistema da colheita da cana crua, visando o controle de Ipomoea quamoclit e Bidens pilosa em lavoura comercial de cana-soca, com solo de textura argilosa, no município de Araras-SP. Os herbicidas (em g ha-1 utilizados foram trifloxysulfuron-sodium + ametryn (27,77 + 1.097 e 37 + 1.463, mesotrione (120 e 192, mesotrione + ametryn (120 + 1.500, mesotrione + trifloxysulfuron-sodium + ametryn [120 + (27,77 + 1.097], trifloxysulfuron-sodium + ametryn + diuron + hexazinone [(27,77 + 1.097 + (702 + 198] e metribuzin (1.920. Os herbicidas foram aplicados em pré-emergência das plantas daninhas sobre a palha de cana-de-açúcar; em pré-emergência das plantas daninhas sobre o solo e, em seguida, coberto com palha; e em pós-emergência das plantas daninhas, em jato dirigido nas entrelinhas da cana-de-açúcar. Eles sempre foram aplicados em pós-emergência da cultura, a qual apresentava aproximadamente 30 cm de altura. Os resultados permitiram concluir que a aplicação dos herbicidas sobre a palha de cana-de-açúcar e em pré-emergência das plantas daninhas alterou a eficácia do mesotrione a 120 g, do trifloxysulfuron-sodium + ametryn (27,77 + 1.097 e das misturas de mesotrine + ametryn e mesotrione + (trifloxysulfuron-sodium + ametryn. Os herbicidas metribuzin e (trifloxysulfuron-sodium + ametryn + (diuron + hexazinone foram eficazes no controle das espécies daninhas, independentemente da forma de aplicação. A espécie B. pilosa foi a mais suscetível aos herbicidas e ao sistema de colheita cana-crua, ou seja, a palha sobre o solo inibiu o seu estabelecimento. Os herbicidas aplicados em jato dirigido na entrelinha da cana-de-açúcar, em pós-emergência, foram seletivos para a cultura.This work aimed to study the agronomic efficacy of herbicides applied in raw sugarcane harvest areas, to control Ipomea quamoclit and Bidens pilosa, on a

Investigación de aflatoxinas en leche natural, esterilizada y en polvo

OpenAIRE

Zurera Cosano, Gonzalo; Jordano-Salinas, R.; Jodral Villarejo, M.; Pozo Lora, R.; Polo Villar, L.M.

1984-01-01

Aflatoxins of groups M and B have been investigated in 1150 samples of natural milk from Andalusian (Spain), collected during .the four sea-sons; in 330 samples of sterilized milk from 49 Spanish dairy centers, and in 77 samples of powdered milk (10 whole milk, 14 of skimmed milk and 54 of artificial mothers"milk). 15.2 p.100 of the samples of natural milk collected in winter contained M1aflatoxins; 8.5 p.100 of those collected in spring showed traces of M1 aflatoxin and only 0.17 p.100 of al...

Frecuencia de los grupos sanguíneos A1, A2, Aint, B y O en individuos normales

Directory of Open Access Journals (Sweden)

García Rosasco, Marcela

2001-01-01

Full Text Available Se definen como A intermedio (Aint los hematíes que comparten caracteres con A1 y A2. Existen diferencias cualitativas y cuantitativas en los epitopes A. Los hematíes A1 son aglutinados por la lectina de Dolichus biflorus (anti-A1, los A2 por la lectina de Ulex europaeus (anti-H, en tanto los hematíes Aint, son variablemente aglutinados por ambas de manera inesperada. El objetivo del presente trabajo fue determinar la frecuencia de fenotipos A1, Aint, A2, B y O en individuos normales de la ciudad de Rosario (Argentina.Se realizó una búsqueda de individuos Aint en estos individuos de acuerdo a la reacción con las lectinas mencionadas. Se estudiaron 1301 muestras frente a reactivos monoclonales comerciales anti-A, anti-B, anti-AB y lectinas anti-A1 y anti-H. De las muestras estudiadas resultaron 703 O (54,04%, 468 A (35,97%; 106 B (8,15%; 18 A1B (1,38% y 6 A2B (0,46%. Las muestras A se subdividieron en 346 A1 (73,93%; 82 A2 (17,52% y 40 Aint (8,55%. Nuestros resultados concuerdan con observaciones previas sobre la marcada heterogeneidad de los hematíes Aint. El reconocimiento de subgrupos débiles del grupo A reviste importancia en la práctica forense y en el estudio de la dinámica de poblaciones. El estudio de la variante Aint es relevante en Inmunogenética Poblacional, por su contribución al conocimiento del mestizaje con poblaciones negras.

Conocimientos y prácticas sobre la nueva influenza A (H1N1 en trabajadores de salud y pacientes ambulatorios, Perú (mayo 2009

Directory of Open Access Journals (Sweden)

Jeannette Ávila

2009-07-01

Full Text Available Con el objetivo de determinar el nivel de conocimientos, las actitudes y prácticas de los pacientes y del personal de salud a inicios de la pandemia de la nueva Influenza A H1N1, desarrollamos un estudio descriptivo de corte transversal en establecimientos del Ministerio de Salud del Perú (MINSA sobre 313 usuarios y 244 trabajadores de 4 ciudades del país. El 38% de los pacientes encuestados asocia la nueva Influenza A (H1N1 con los cerdos o aves, un 17% no reconoce que la transmisión es de persona a persona, asimismo, entre el 35% a 50% utiliza la mano para cubrirse nariz y boca al estornudar o toser y no tiene práctica de higiene de manos. En el caso del personal de salud, el 99% advierte la transmisión humana y el 86% conoce la definición de caso sospechoso de Influenza A (H1N1. Entre el 83% y 95% de los trabajadores encuestados reconocen las medidas de protección individual recomendadas por el MINSA. En ambos grupos la televisión es el medio más visto (60% y por dónde recibe mayor información sobre Influenza A (H1N1, además, en los trabajadores de salud, un medio frecuente de información sobre el tema también es el internet (11%.

Practical route to the left wing of CTX1B and total syntheses of CTX1B and 54-deoxyCTX1B.

Science.gov (United States)

Yamashita, Shuji; Takeuchi, Katsutoshi; Koyama, Takuya; Inoue, Masayuki; Hayashi, Yujiro; Hirama, Masahiro

2015-02-02

Ciguatoxins, the principal causative agents of ciguatera seafood poisoning, are extremely large polycyclic ethers. We report herein a reliable route for constructing the left wing of CTX1B, which possesses the acid/base/oxidant-sensitive bisallylic ether moiety, by a 6-exo radical cyclization/ring-closing metathesis strategy. This new route enabled us to achieve the second-generation total synthesis of CTX1B and the first synthesis of 54-deoxyCTX1B. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Efeito de extratos aquosos de meliáceas sobre Bemisia tabaci biótipo B em tomateiro Effect of aqueous extracts of meliaceous plants on Bemisia tabaci B biotype on tomato plants

Directory of Open Access Journals (Sweden)

ANTONIO PANCRÁCIO DE SOUZA

2000-01-01

Full Text Available Comparou-se a bioatividade de extratos aquosos a 3% (p/v de três meliáceas, Melia azedarach L. (frutos verdes, Trichilia pallida Swartz (ramos e Azadirachta indica A. Juss (sementes, em relação à mosca branca Bemisia tabaci (Gennadius biótipo B, criada em tomateiro. No primeiro experimento os extratos foram aplicados sobre ovos e sobre ninfas com três dias de idade, avaliando-se a mortalidade e a duração das fases de ovo e de ninfa. No segundo experimento os extratos foram aplicados apenas sobre as ninfas, avaliando-se a mortalidade nessa fase e a longevidade e fecundidade dos adultos. Em relação à fase de ovo, o extrato de T. pallida foi o que provocou maior mortalidade, seguindo-se os de A. indica e M. azedarach. A maior mortalidade ninfal foi constatada com o extrato de A. indica, seguindo-se os de T. pallida e M. azedarach. Nenhum dos extratos afetou a duração das fases de ovo e de ninfa, assim como a longevidade e fecundidade.The objective of this research was to compare the effect of aqueous extracts of fresh fruits of Melia azedarach L., twigs of Trichilia pallida Swartz and seeds of zadirachta indica A. Juss, on eggs and nymphs of silverleaf whitefly Bemisia tabaci (Gennadius B biotype reared on tomato plants. The extracts were tested at a concentration of 3%. In the first experiment, the extracts were applied on eggs and 3-day-old nymphs. Records were taken on mortality, duration of egg and nymphal stages. In the second experiment the extracts were applied on 3-day-old nymphs and records were taken on nymphal mortality, adult longevity and fecundity. The extracts of T. pallida were the most effective on eggs, followed by A. indica and M. azedarach. The extracts of A. indica were the most effective on nymphs followed by T. pallida and M. azedarach. In both experiments, the duration of egg and nymph stages, longevity and fecundity were not affected by the extracts.

26 CFR 1.280B-1 - Demolition of structures.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Demolition of structures. 1.280B-1 Section 1... (CONTINUED) INCOME TAXES Items Not Deductible § 1.280B-1 Demolition of structures. (a) In general. Section 280B provides that, in the case of the demolition of any structure, no deduction otherwise allowable...

Measurement of the mass splittings between the b bar bχb,J(1P) states

International Nuclear Information System (INIS)

Edwards, K.W.; Edwards, K.W.; Bellerive, A.; Bellerive, A.; Janicek, R.; Janicek, R.; MacFarlane, D.B.; MacFarlane, D.B.; Patel, P.M.; Patel, P.M.; Sadoff, A.J.; Ammar, R.; Baringer, P.; Bean, A.; Besson, D.; Coppage, D.; Darling, C.; Davis, R.; Kotov, S.; Kravchenko, I.; Kwak, N.; Zhou, L.; Anderson, S.; Kubota, Y.; Lee, S.J.; ONeill, J.J.; Poling, R.; Riehle, T.; Smith, A.; Alam, M.S.; Athar, S.B.; Ling, Z.; Mahmood, A.H.; Timm, S.; Wappler, F.; Anastassov, A.; Duboscq, J.E.; Fujino, D.; Gan, K.K.; Hart, T.; Honscheid, K.; Kagan, H.; Kass, R.; Lee, J.; Schwarthoff, H.; Spencer, M.B.; Sung, M.; Undrus, A.; Wolf, A.; Zoeller, M.M.; Richichi, S.J.; Severini, H.; Skubic, P.; Bishai, M.; Fast, J.; Hinson, J.W.; Menon, N.; Miller, D.H.; Shibata, E.I.; Shipsey, I.P.; Yurko, M.; Glenn, S.; Kwon, Y.; Lyon, A.L.; Roberts, S.; Thorndike, E.H.; Jessop, C.P.; Lingel, K.; Marsiske, H.; Perl, M.L.; Savinov, V.; Ugolini, D.; Zhou, X.; Coan, T.E.; Fadeyev, V.; Korolkov, I.; Maravin, Y.; Narsky, I.; Shelkov, V.; Staeck, J.; Stroynowski, R.; Volobouev, I.; Ye, J.; Artuso, M.; Azfar, F.; Efimov, A.; Goldberg, M.; He, D.; Kopp, S.; Moneti, G.C.; Mountain, R.; Schuh, S.; Skwarnicki, T.

1999-01-01

We present new measurements of photon energies and branching fractions for the radiative transitions Υ(2S)→γχ b(J=0,1,2) (1P). The masses of the χ b states are determined from the measured radiative photon energies. The ratio of mass splittings between the χ b substates, r≡(M J=2 -M J=1 )/(M J=1 -M J=0 ), with M the χ b mass, provides information on the nature of the b bar b confining potential. We find r(1P)=0.542±0.022±0.024. This value is somewhat lower than the previous world average, but more consistent with the theoretical expectation that r(1P) b (1P) states than for the χ b (2P) states. copyright 1999 The American Physical Society

Wind tunel tests of Risoe-B1-18 and Risoe-B1-24

Energy Technology Data Exchange (ETDEWEB)

Fuglsang, P.; Bak, C.; Gaunaa, M.; Antoniou, I.

2003-01-01

This report contains 2D measurements of the Risoe-B1-18 and Risoe-B1-24 airfoils. The aerodynamic properties were derived from pressure measurements on the airfoil surface and in the wake. The measurements were conducted in the VELUX open jet wind tunnel, which has a background turbulence intensity of 1%, and an inlet flow velocity of 42 m/s. The airfoil sections had a chord of 0.600 m giving a Reynolds number of 1.6Oe106. The span was 1.9 m and end plates were used to minimize 3D flow effects. The measurements comprised both static and dynamic inflow. Static inflow covered angles of attack from 5o to 30 deg. Dynamic inflow was obtained by pitching the airfoil in a harmonic motion around various mean angles of attack. The test matrix involved smooth flow, various kinds of leading edge roughness, stall strips, vortex generators and Gurney flaps in different combinations. The quality of the measurements was good and the agreement between measurements and numerical CFD predictions with EllipSys2D was good. For both airfoils predictions with turbulent flow captured very well the shapes of lift and drag curves as well as the magnitude of maximum lift. Measurements of Risoe-B1-18 showed that the maximum lift coefficient was 1.64 at an angle of attack of approximately 13 deg. The airfoil was not very sensitive to leading edge roughness despite its high maximum lift. Measurements with stall strips showed that stall strips could control the level of maximum lift. The Risoe-B1-24 measurements showed that the maximum lift coefficient was 1.62 at an angle of attack of approximately 14 deg. The airfoil was only little sensitive to leading edge roughness despite its high relative thickness and high maximum lift. Measurements with delta wing shaped vortex generators increased the maximum lift coefficient to 2.02 and measurements with Gurney flaps increased the maximum lift coefficient to 1.85. Measurements with combination of vortex generators and Gurney flaps showed a maximum

7 CFR 15b.1 - Purpose.

Science.gov (United States)

2010-01-01

... FEDERAL FINANCIAL ASSISTANCE General Provisions § 15b.1 Purpose. The purpose of this part is to implement... 7 Agriculture 1 2010-01-01 2010-01-01 false Purpose. 15b.1 Section 15b.1 Agriculture Office of the... receiving Federal financial assistance. ...

miR-200b mediates post-transcriptional repression of ZFHX1B

DEFF Research Database (Denmark)

Christoffersen, Nanna Rønbjerg; Silahtaroglu, Asli; Ørom, Ulf Lupo Andersson

2007-01-01

of E-cadherin. We show that Zfhx1b and miR-200b are regionally coexpressed in the adult mouse brain and that miR-200b represses the expression of Zfhx1b via multiple sequence elements present in the 3'-untranslated region. Overexpression of miR-200b leads to repression of endogenous ZFHX1B...

Isolation and Characterization of Plantaricin Produced by Lactobacillus plantarum Strains (IIA-1A5, IIA-1B1, IIA-2B2

Directory of Open Access Journals (Sweden)

I. I. Arief

2013-08-01

Full Text Available Bacteriocins produced by Indonesian lactic acid bacteria Lactobacillus plantarum IIA-1A5, IIA-1B1, IIA-2B2 were purified and characterized. Plantaricin W gene had been successfully amplified from all strains. This amplicon showed the expected 200 bp size of plantaricin W gene. This bacteriocins purified from L. plantarum IIA-1A5, IIA-1B1, and IIA-2B2 were named plantaricin IIA-1A5, IIA-1B1, and IIA-2B2. Purification by cation exchange chromatography increased the purity (fold and activity of plantaricins. Purity of plantaricin IIA-1A5 was increased by 3.13 fold with specific activity 13.40 AU/mg. Plantaricin IIA-1B1 had 2.98 fold purity with specific activity 5.12 AU/mg, while purity of plantaricin IIA-2B2 was 1.37 fold with specific activity 7.70 AU/mg. All plantaricins could inhibit the growth of pathogenic bacteria, such as Escherichia coli, Salmonella typhimurium, Bacillus cereus, and Staphylococcus aureus. Plantaricins could be digested by trypsin. Stability of plantaricins at 80 oC for 30 min and at 121 oC for 15 min were affected by type of plantaricin and species of pathogenic bacteria. Generally, plantaricin IIA-1A5 was better as antimicrobial agent than plantaricin IIA-1B1 and plantaricin IIA-2B2.

Documentos en el Archivo Histórico Nacional (Madrid sobre el terremoto del 1 de noviembre de 1755

Directory of Open Access Journals (Sweden)

Fernando de la TORRE

2009-11-01

Full Text Available RESUMEN: En el gran Archivo Histórico Nacional (AHN existen millones de documentos. Los correspondientes a la Sección de Estado no están catalogados. El autor descubrió, en 1979, diversos legajos, mejor, cajas, que contienen importantes noticias sobre los efectos del terremoto de Lisboa, que transcribió y publicó para tres provincias españolas. Más de un millar de ellos corresponden a informaciones sobre el terremoto del 1 de noviembre de 1755. Desde 1990, el autor tiene transcritos y clasificados todos los documentos relacionados (1.020 con muy importantes noticias de los efectos del gran terremoto en 1.228 localidades españolas. Este conjunto documental es el mayor del mundo sobre un terremoto histórico. El presente artículo analiza, brevemente, una amplia gama de particularidades.ABSTRACT: The large «Archivo Histórico Nacional» (the National Historical Archive, Madrid, Spain holds millions of papers, but none of the documents of the State Section are catalogued. In 1979 the author discovered several dossiers (in fact, boxes with more than a thousand important papers concerning the Lisbon earthquake of 1 November, 1755. A few of these documents heve been published previously. Since 1990 the author has classified and transcribed 1.020 documents containing very important news about the effects of the earthquake in 1.228 Spanish towns. This group of documents is the largest in the world about an historical earthquake. In the present paper the author briefly analyses many peculiarities of the documents.

Effects of prolonged oral administration of fumonisin B1 and aflatoxin B1 in rats.

Science.gov (United States)

Pozzi, C R; Corrêa, B; Xavier, J G; Direito, G M; Orsi, R B; Matarazzo, S V

2001-01-01

The effects of prolonged oral administration (21 days) of fumonisin B1 (FB1) and aflatoxin B1 (AFB1) were evaluated on male Wistar rats. The animals were housed in individual metabolic cages and submitted to the following treatments: 1-0 microg AFB1 + 0 mg FB1/100g bw.; 2-72 microg AFB1+ 0 mg FB1/100 g bw; 3-0 microg AFB1 + 0.5 mg FB1 g bw; 4-0 microg AFB1 + 1.5 mg FB1/100 g bw; 5-72 microg AFB1 + 0.5 mg FB1/100g bw; 6-72 microgAFB1 + 1.5 mg FB1/100g bw. On day 21, the rats were sacrificed for evaluation. The results showed that treated animals presented differences in body weight and absolute/relative weights of liver and kidney as well as altered hepatic function and cholesterol blood levels. Rats fed with the greatest doses of AFB1 and FB1 gained less weight (2.79 g/day) at the end of the experimental period; their blood concentrations of liver enzymes aspartate aminotransferase (AST) and alkaline phosphatase (AP) were above control levels (130.35 micro/l and 471.00 micro/l, respectively). Blood cholesterol increased in the groups treated with the highest dose of FB1 or FB1 associated with AFB1. Histopathology revealed the occurrence of apoptosis in the liver of rats exposed to FB1. The association of aflatoxin B1 with fumonisin B1 at higher dose probably potentiated the effects of the higher dose of fumonisin B1 acting singly.

L1-mediated retrotransposition of murine B1 and B2 SINEs recapitulated in cultured cells.

Science.gov (United States)

Dewannieux, Marie; Heidmann, Thierry

2005-06-03

SINEs are short interspersed nucleotide elements with transpositional activity, present at a high copy number (up to a million) in mammalian genomes. They are 80-400 bp long, non-coding sequences which derive either from the 7SL RNA (e.g. human Alus, murine B1s) or tRNA (e.g. murine B2s) polymerase III-driven genes. We have previously demonstrated that Alus very efficiently divert the enzymatic machinery of the autonomous L1 LINE (long interspersed nucleotide element) retrotransposons to transpose at a high rate. Here we show, using an ex vivo assay for transposition, that both B1 and B2 SINEs can be mobilized by murine LINEs, with the hallmarks of a bona fide retrotransposition process, including target site duplications of varying lengths and integrations into A-rich sequences. Despite different phylogenetic origins, transposition of the tRNA-derived B2 sequences is as efficient as that of the human Alus, whereas that of B1s is 20-100-fold lower despite a similar high copy number of these elements in the mouse genome. We provide evidence, via an appropriate nucleotide substitution within the B1 sequence in a domain essential for its intracellular targeting, that the current B1 SINEs are not optimal for transposition, a feature most probably selected for the host sake in the course of evolution.

Predominant porB1A and porB1B genotypes and correlation of gene mutations with drug resistance in Neisseria gonorrhoeae isolates in Eastern China

Directory of Open Access Journals (Sweden)

Tang Renxian

2010-11-01

Full Text Available Abstract Background Variations of porB1A and porB1B genes and their serotypes exist in Neisseria gonorrhoeae isolates from different geographical areas, and some site mutations in the porB1B gene correlate with drug resistance. Methods The β-lactamase production of N. gonorrhoeae isolates was determined by paper acidometric test and nitrocefin discs. The porB1A and porB1B genes of 315 non-penicillinase-producting N. gonorrhoeae (non-PPNG strains were amplified by PCR for sequencing to determine serotypes and site mutations. A duplex PCR was designed to simultaneously detect both porB1A and porB1B genes. Penicillin and tetracycline resistance was assessed by an in vitro drug sensitivity test. Results Of the N. gonorrhoeae isolates, 31.1% tested positive for porB1A and 68.9% for porB1B genes. All the 98 porB1A+ isolates belonging to IA6 serotype with either no mutation at the 120 and 121 sites (88.8% or a D120G (11.2% mutation and were no resistance to both penicillin and tetracycline. Among the 217 porB1B+ isolates, 26.7%, 22.6% and 11.5% belonged to IB3, IB3/6 and IB4 serotypes, respectively. Particularly, two novel chimeric serotypes, IB3/6-IB2 and IB2-IB4-IB2, were found in 77 and 8 porB1B+ isolates. Two hundred and twelve (97.7% of the porB1B+ isolates were presented G120 and/or A121 mutations with 163 (76.9% at both sites. Interestingly, within the 77 porB1B+ isolates belonging to IB3/6-IB2 serotype, 15 were discovered to possess novel deletions at both A121 and N122 sites. All the replacement mutations at these sites in PorB1B were correlated with resistance and the deletion mutation showed the highest resistance. Conclusion N. gonorrhoeae isolates circulating in Eastern China include a sole PorB1A serotype (IA6 and five PorB1B serotypes. Multiple mutations in porB1B genes, including novel A121 and N122 deletions, are correlated with high levels of penicillin and tetracycline resistance.

Estrutura organizacional, capacidade dos serviços e impacto sobre o desempenho de fornecedores logísticos no contexto B2B

Directory of Open Access Journals (Sweden)

Margareth Rodrigues de Carvalho Borella

Full Text Available Resumo: O objetivo deste estudo é verificar quais aspectos associados à estrutura organizacional e à capacidade de prestação de serviços contribuem para o desempenho de fornecedores logísticos no contexto de relações B2B (business to business com empresas cliente, configuradas em cadeias de suprimentos (CS. Uma amostra, incluindo 80 empresas fornecedoras de serviços logísticos no sul do Brasil, foi obtida através de uma survey num universo de empresas que desenvolvem atividades logísticas de armazenagem, controle de estoque, transporte, entregas programadas, operações portuárias e desembaraço aduaneiro. O questionário utilizado continha escalas múltiplas para representar as variáveis dos constructos relacionados à estrutura organizacional, capacidade dos serviços e desempenho. As respostas refletiram a percepção que os fornecedores de serviços logísticos tinham de suas atividades em relação ao seu principal cliente na cadeia de suprimentos. Utilizando análise estatística multivariada baseada em modelagem de equações estruturais, LV-PLS (Latent Variable – Partial Least Squares com procedimento bootstrapping, verificou-se que o único atributo que provoca impacto sobre a obtenção de melhor desempenho do fornecedor de serviço logístico é a sua capacidade de cumprir técnica e operacionalmente o serviço contratado pelo cliente. A capacidade de fornecer serviços logísticos recebe influência positiva e significante tanto de uma estrutura organizacional dotada de autonomia quanto de formalização.

Impact of IL1B gene polymorphisms and interleukin 1B levels on susceptibility to spontaneous preterm birth.

Science.gov (United States)

Langmia, Immaculate M; Apalasamy, Yamunah D; Omar, Siti Z; Mohamed, Zahurin

2016-11-01

Genetic factors influence susceptibility to preterm birth (PTB) and the immune pathway of PTB that involves the production of cytokines such as interleukins has been implicated in PTB disease. The aim of this study is to investigate the association of interleukin 1β (IL1B) gene polymorphisms and IL1B levels with spontaneous PTB. Peripheral maternal blood from 495 women was used for extraction of DNA and genotyping was carried out using the Sequenom MassARRAY platform. Maternal plasma was used to measure IL1B levels. There was no significant association between the allelic and genotype distribution of IL1B single nucleotide polymorphism (SNP) (rs1143634, rs1143627, rs16944) and the risk of PTB among Malaysian Malay women (rs1143634, P=0.722; rs1143627, P=0.543; rs16944, P=0.615). However, IL1B levels were significantly different between women who delivered preterm compared with those who delivered at term (P=0.030); high mean levels were observed among Malay women who delivered at preterm (mean=32.52) compared with term (mean=21.68). IL1B SNPs were not associated with IL1B plasma levels. This study indicates a significant association between IL1B levels and reduced risk of PTB among the Malaysian Malay women. This study shows the impact of IL1B levels on susceptibility to PTB disease; however, the high levels of IL1B observed among women in the preterm group are not associated with IL1B SNPs investigated in this study; IL1B high levels may be because of other factors not explored in this study and therefore warrant further investigation.

Discussions about the Nature of Science in a Course on the History of Astronomy. (Spanish Title: Discusiones sobre la Naturaleza de la Ciencia en un Curso sobre Historia de la Astronomía.) Discussões sobre a Natureza da Ciência em um Curso sobre a História da Astronomia

Science.gov (United States)

Pires de Andrade, Victória Flório; L'Astorina, Bruno

2010-07-01

There are an increasing number of researches in science education that affirm the importance of discussions on the "nature of science" in basic education level as well as in teacher training. The history of science applied to education is a way to contextualize epistemological discussions, allowing both the understanding of scientific content and learning about science concepts. We present some reasonably consensual definitions on the nature of science that have been widely discussed by the academic community. We show also some episodes in the history of astronomy which can lead to discussions involving some aspects of the nature of science, and how they can do it. Hay un número creciente de investigaciones en la enseñanza de las ciencias que afirman la importancia de debates sobre la "naturaleza de la ciencia" en la educación básica y formación del profesorado. La historia de la ciencia aplicada a la educación es una manera de contextualizar los debates de la epistemología, lo que permite tanto la comprensión de los contenidos científicos como el aprendizaje de conceptos científicos. En esto trabajo, presentamos algunas definiciones bastante consensuales sobre la naturaleza de la ciencia que han sido ampliamente discutidas por la comunidad académica y mostramos cómo algunos episodios en la historia de la astronomía pueden llevar a discusiones sobre algunos aspectos de la naturaleza de la ciencia. Há um número crescente de pesquisas na área de ensino de ciências que afirmam a importância de discussões sobre a "natureza da ciência" na educação básica e na formação de professores. A história da ciência aplicada ao ensino é uma maneira de contextualizar discussões epistemológicas, permitindo tanto a compreensão de conteúdos científicos quanto o aprendizado de noções sobre as ciências. Neste trabalho apresentamos algumas definições razoavelmente consensuais sobre a natureza da ciência que foram amplamente discutidas pela

Efeito do ácido bórico sobre a velocidade da reação do 2-hidroxibenzaldéido com nucleófilos nitrogenados

OpenAIRE

Simionatto, Edesio Luiz

1997-01-01

Tese (doutorado) - Universidade Federal de Santa Catarina, Centro de Ciências Físicas e Matemáticas. Programa de Pós-Graduação em Química O ácido bórico acelera a reação de formação da oxima derivada do 2-hidroxibenzaldeído. Os resultados cinéticos e a análise por espectroscopia ultravioleta, sugerem, que o efeito do ácido bórico é sobre o estado de transição da etapa de desidratação da reação, através da formação de um complexo com o intermediário de adição formado pelo rápido equilíbrio ...

Interferon Gamma-1b Injection

Science.gov (United States)

Interferon gamma-1b injection is used to reduce the frequency and severity of serious infections in people with chronic ... severe, malignant osteopetrosis (an inherited bone disease). Interferon gamma-1b is in a class of medications called ...

34 CFR 5b.1 - Definitions.

Science.gov (United States)

2010-07-01

... maintained by the Department, including but not limited to the individual's education, financial transactions... 34 Education 1 2010-07-01 2010-07-01 false Definitions. 5b.1 Section 5b.1 Education Office of the Secretary, Department of Education PRIVACY ACT REGULATIONS § 5b.1 Definitions. As used in this part: (a...

15 CFR 8b.1 - Purpose.

Science.gov (United States)

2010-01-01

... of handicap in any program or activity receiving Federal financial assistance. The purpose of this... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Purpose. 8b.1 Section 8b.1 Commerce... HANDICAPPED IN FEDERALLY ASSISTED PROGRAMS OPERATED BY THE DEPARTMENT OF COMMERCE General Provisions § 8b.1...

RP-HPLC Determination of vitamins B1, B3, B6, folic acid and B12 in multivitamin tablets

Directory of Open Access Journals (Sweden)

SOTE VLADIMIROV

2005-10-01

Full Text Available Abstract:Asimple and sensitive reversed-phase, ion-pair HPLC method was developed and validated for the simultaneous determination of B-group vitamins, thiamine chloride hydrochloride (B1, nicotinamide (B3, pyridoxine hydrochloride (B6 and folic acid in Pentovit® coated tablets. The cyanocobalamine (B12 was determined separately, because of its low concentration in the investigated multivitamin preparation. RP-HPLC analysis was performed with a LKB 2150 HPLC system, equipped with a UV/VIS Waters M484 detector. The procedures for the determination of B1, B2, B6 and folic acid were carried out on a Supelcosil ABZ+ (15 cm 4.6 mm; 5 µm column with methanol-5mM heptanesulphonic acid sodium salt 0.1%triethylamine TEA(25:75 V/V; pH 2.8 as themobile phase. For the determination of B12 a Suplex pKb-100 (15 cm 4.6 mm; 5 µm column andmethanol–water (22:78 V/V as themobile phase were used. The column effluentsweremonitored at 290 nm for B 1, B3, B6 and folic acid, and at 550 nm for B12. The obtained results and statistical parameters for all the investigated vitamins of the B-group in Pentovit® coated tablets were satisfactory and ranged from 90.4 % to 108.5 % (RSD. from 0.5% to 4.1 %. The parameters for the validation of the methods are given.

Linkage of genes for laminin B1 and B2 subunits on chromosome 1 in mouse.

Science.gov (United States)

Elliott, R W; Barlow, D; Hogan, B L

1985-08-01

We have used cDNA clones for the B1 and B2 subunits of laminin to find restriction fragment length DNA polymorphisms for the genes encoding these polypeptides in the mouse. Three alleles were found for LamB2 and two for LamB1 among the inbred mouse strains. The segregation of these polymorphisms among recombinant inbred strains showed that these genes are tightly linked in the central region of mouse Chromosome 1 between Sas-1 and Ly-m22, 7.4 +/- 3.2 cM distal to the Pep-3 locus. There is no evidence in the mouse for pseudogenes for these proteins.

Heat shock factors HsfB1 and HsfB2b are involved in the regulation of Pdf1.2 expression and pathogen resistance in Arabidopsis.

Science.gov (United States)

Kumar, Mukesh; Busch, Wolfgang; Birke, Hannah; Kemmerling, Birgit; Nürnberger, Thorsten; Schöffl, Friedrich

2009-01-01

In order to assess the functional roles of heat stress-induced class B-heat shock factors in Arabidopsis, we investigated T-DNA knockout mutants of AtHsfB1 and AtHsfB2b. Micorarray analysis of double knockout hsfB1/hsfB2b plants revealed as strong an up-regulation of the basal mRNA-levels of the defensin genes Pdf1.2a/b in mutant plants. The Pdf expression was further enhanced by jasmonic acid treatment or infection with the necrotrophic fungus Alternaria brassicicola. The single mutant hsfB2b and the double mutant hsfB1/B2b were significantly improved in disease resistance after A. brassicicola infection. There was no indication for a direct interaction of Hsf with the promoter of Pdf1.2, which is devoid of perfect HSE consensus Hsf-binding sequences. However, changes in the formation of late HsfA2-dependent HSE binding were detected in hsfB1/B2b plants. This suggests that HsfB1/B2b may interact with class A-Hsf in regulating the shut-off of the heat shock response. The identification of Pdf genes as targets of Hsf-dependent negative regulation is the first evidence for an interconnection of Hsf in the regulation of biotic and abiotic responses.

Expression and biological activity of the cystine knot bioinsecticide PA1b (Pea Albumin 1 Subunit b.

Directory of Open Access Journals (Sweden)

Vanessa Eyraud

Full Text Available The PA1b (Pea Albumin 1, subunit b peptide is an entomotoxin extract from Legume seeds with lethal activity on several insect pests, such as mosquitoes, some aphids and cereal weevils. This 37 amino-acid cysteine-rich peptide has been, until now, obtained by biochemical purification or chemical synthesis. In this paper, we present our results for the transient production of the peptide in Nicotiana benthamiana by agro-infiltration, with a yield of about 35 µg/g of fresh leaves and maximum production 8 days after infiltration. PA1b is part of the PA1 gene which, after post-translational modifications, encodes two peptides (PA1b and PA1a. We show that transforming tobacco with the PA1b cDNA alone does not result in production of the toxin and, in fact, the entire cDNA is necessary, raising the question of the role of PA1a. We constructed a PA1-cassette, allowing for the quick "cut/paste" of different PA1b mutants within a conserved PA1 cDNA. This cassette enabled us to produce the six isoforms of PA1b which exist in pea seeds. Biological tests revealed that all the isoforms display similar activity, with the exception of one which is inactive. The lack of activity in this isoform led us to conclude that the amphiphilic nature of the peptide is necessary for activity. The possible applications of this expression system for other cysteine-rich biomolecules are discussed.

Covalent Allosteric Inactivation of Protein Tyrosine Phosphatase 1B (PTP1B) by an Inhibitor-Electrophile Conjugate.

Science.gov (United States)

Punthasee, Puminan; Laciak, Adrian R; Cummings, Andrea H; Ruddraraju, Kasi Viswanatharaju; Lewis, Sarah M; Hillebrand, Roman; Singh, Harkewal; Tanner, John J; Gates, Kent S

2017-04-11

Protein tyrosine phosphatase 1B (PTP1B) is a validated drug target, but it has proven difficult to develop medicinally useful, reversible inhibitors of this enzyme. Here we explored covalent strategies for the inactivation of PTP1B using a conjugate composed of an active site-directed 5-aryl-1,2,5-thiadiazolidin-3-one 1,1-dioxide inhibitor connected via a short linker to an electrophilic α-bromoacetamide moiety. Inhibitor-electrophile conjugate 5a caused time-dependent loss of PTP1B activity consistent with a covalent inactivation mechanism. The inactivation occurred with a second-order rate constant of (1.7 ± 0.3) × 10 2 M -1 min -1 . Mass spectrometric analysis of the inactivated enzyme indicated that the primary site of modification was C121, a residue distant from the active site. Previous work provided evidence that covalent modification of the allosteric residue C121 can cause inactivation of PTP1B [Hansen, S. K., Cancilla, M. T., Shiau, T. P., Kung, J., Chen, T., and Erlanson, D. A. (2005) Biochemistry 44, 7704-7712]. Overall, our results are consistent with an unusual enzyme inactivation process in which noncovalent binding of the inhibitor-electrophile conjugate to the active site of PTP1B protects the nucleophilic catalytic C215 residue from covalent modification, thus allowing inactivation of the enzyme via selective modification of allosteric residue C121.

Evidências empíricas das políticas de sanemaneto básico sobre indicadores de saúde para municípios brasileiros

OpenAIRE

Teixeira, Lucas Iten

2011-01-01

Este artigo propõe analisar o efeito de variáveis relacionadas ao saneamento básico sobre indicadores de saúde através de dados em painel de municípios brasileiros. Através de base de dados de DataSUS, IBGE e do SNIS, avaliamos se os indicadores de saneamento afetam indicadores de saúde como mortalidade e morbidade separados por faixa etária e tipos de doença nos municípios entre 2001 a 2008. Trabalhamos com diferentes amostras por conta do desbalanceamento do painel, dado que há dados fal...

Protein Tyrosine Phosphatase 1B (PTP1B): A Potential Target for Alzheimer's Therapy?

Science.gov (United States)

Vieira, Marcelo N N; Lyra E Silva, Natalia M; Ferreira, Sergio T; De Felice, Fernanda G

2017-01-01

Despite significant advances in current understanding of mechanisms of pathogenesis in Alzheimer's disease (AD), attempts at drug development based on those discoveries have failed to translate into effective, disease-modifying therapies. AD is a complex and multifactorial disease comprising a range of aberrant cellular/molecular processes taking part in different cell types and brain regions. As a consequence, therapeutics for AD should be able to block or compensate multiple abnormal pathological events. Here, we examine recent evidence that inhibition of protein tyrosine phosphatase 1B (PTP1B) may represent a promising strategy to combat a variety of AD-related detrimental processes. Besides its well described role as a negative regulator of insulin and leptin signaling, PTB1B recently emerged as a modulator of various other processes in the central nervous system (CNS) that are also implicated in AD. These include signaling pathways germane to learning and memory, regulation of synapse dynamics, endoplasmic reticulum (ER) stress and microglia-mediated neuroinflammation. We propose that PTP1B inhibition may represent an attractive and yet unexplored therapeutic approach to correct aberrant signaling pathways linked to AD.

Synthesis of 9H-Indeno [1, 2-b] Pyrazine and 11H-Indeno [1, 2-b ...

African Journals Online (AJOL)

NICO

Synthesis of 9H-Indeno [1, 2-b] Pyrazine and. 11H-Indeno [1, 2-b] Quinoxaline Derivatives in. One-step Reaction from 2-Bromo-4-chloro-1-indanone. S. Jasouri1,2, J. Khalafy1,*, M. Badali2 and R.H. Prager3. 1Department of Chemistry, Urmia University, Urmia 57154, Iran. 2Daana Pharmaceutical Co., P.O. Box 5181, Tabriz ...

In vitro study of vitamins B1, B2 and B6 adsorption on zeolite

Directory of Open Access Journals (Sweden)

Basić Zorica

2011-01-01

Full Text Available Background/Aim. Zeolites are the hydratised alumosilicates of alcali and earthalcali cations, which have a long three-dimensional crystal structure. Preparations on the basis of zeolites are used for adsorption of organic and nonorganic toxic substances and they, also, find more and more use in veterinary and human medicine and pharmacy. The aim of this study was to evaluate the possibilities of zeolite to adsorb vitamins B1, B2 and B6 in acid and neutral solutions, as well as the characteristics of the process (saturability, reversibility and competitivness. Methods. The specific and sensitive HPLC method with fluorescent detector was used for determination of vitamins B1, B2 and B6. Analyte separation and detection were carried out by applying the reverse-phase method on column C18. An in vitro experiment was done by testing the influence of pH value (2 and 7, concentration of vitamin solution (1, 2 and 5 mg/L, the lenght of contact with zeolite (10-180 min and cation competitiveness on the exchange capacity, which is achieved by media and zeolite contact, as well as a possible vitamins desorption through changing pH value of the solution at 37°C. Jon competitiveness was examined by adding commercial feed mixture (grower with a defined content of the examined vitamines in zeolite solutions the pH = 2 and pH = 7. Results. Vitamins B1, B2 and B6 were stable in both pH=2 and pH = 7 solutions at 37°C, in the defined time intervals. In acid solution concentrations of vitamins significantly declined in the first 10 min, with no significant decline in further 30 min for all the three concentrations testch. In neutral solution, after the addition of 1% zeolite, decrease in vitamins concentrations was slightly lower than in acid solution, but also significant in the first 10 min of the contact with zeolite. It was found that zeolite, which adsorbed vitamins in acid solution, transferred in the neutral one released a significant quantity of adsorbed

CD25+ B-1a Cells Express Aicda

Directory of Open Access Journals (Sweden)

Hiroaki Kaku

2017-06-01

Full Text Available B-1a cells are innate-like B-lymphocytes producing natural antibodies. Activation-induced cytidine deaminase (AID, a product of the Aicda gene, plays a central role in class-switch recombination and somatic hypermutation in B cells. Although a role for Aicda in B-1a cells has been suggested on the basis of experiments with knock out (KO mice, whether B-1a cells express Aicda, and if so, which B-1a cell subpopulation expresses Aicda, remains unknown. Here, we demonstrate that B-1 cells express Aicda, but at a level below that expressed by germinal center (GC B cells. We previously reported that B-1a cells can be subdivided based on CD25 expression. We show here that B-1a cell Aicda expression is concentrated in the CD25+ B-1a cell subpopulation. These results suggest the possibility that previous studies of memory B cells identified on the basis of Aicda expression may have inadvertently included an unknown number of CD25+ B-1a cells. Although B-1a cells develop normally in the absence of Aicda, a competitive reconstitution assay reveals enhanced vigor for AID KO B-1a cell bone marrow (BM progenitors, as compared with wild-type BM B-1 cell progenitors. These results suggest that AID inhibits the development of B-1a cells from BM B-1 cell progenitors in a competitive environment.

26 CFR 1.1402(b)-1 - Self-employment income.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 12 2010-04-01 2010-04-01 false Self-employment income. 1.1402(b)-1 Section 1... (CONTINUED) INCOME TAXES Tax on Self-Employment Income § 1.1402(b)-1 Self-employment income. (a) In general... this section, the term “self-employment income” means the net earnings from self-employment derived by...

Algunos elementos sobre sexualidad en pobladores de un área rural del estado Cojedes, Venezuela.

Directory of Open Access Journals (Sweden)

Everilda Artega

2012-07-01

Full Text Available   El conocimiento de temas relacionados con la salud sexual y reproductiva evidencia vacíos en los países latinoamericanos en cuanto a reproducción, especialmente en el medio rural y en personas con menor nivel educativo. Se pretende con esta investigación describir características de la sexualidad en el área rural, primer estudio en Venezuela. Estudio descriptivo, transversal y de campo, con un cuestionario como instrumento, la muestra fue de 128 individuos de la comunidad de Apamates, Cojedes. La edad promedio fue 25,3 años, resultaron solteros 76,5% de los hombres y 43,6% de las mujeres. 96,1% de las personas saben leer y escribir pero únicamente 19,5% tenían bachillerato completo. 35,9% eran obreros y 82,8% recibían sueldo básico. 82% conocen los métodos anticonceptivos. El condón y los anticonceptivos orales son los mayormente usados. Fue baja la prevalencia de ITS. La mayoría tenía entre 0 y 1 hijo. Los hombres por iniciativa propia buscan información sobre sexualidad. El conocimiento sobre sexualidad en ambos géneros es bajo.  Ambos géneros mantienen relaciones sexuales por amor y con fines reproductivos. Desconocen que es el orgasmo. Se concluye que: desconocen aspectos básicos sobre la sexualidad y reproducción; la sexualidad es un tabú; y conocen los anticonceptivos pero no los usa con frecuencia. Para el desarrollo de la sexualidad es indispensable tener educación sexual verdaderamente eficaz.      

Micotoxinas e Micotoxicoses na Avicultura Mycotoxins and Mycotoxicosis in Poultry

Directory of Open Access Journals (Sweden)

JM Santurio

2000-04-01

Full Text Available Esta revisão tem como objetivo principal mostrar, baseado em dezenas de pesquisas realizadas, os efeitos tóxicos das micotoxinas aflatoxinas, tricotecenos, zealenona e fumonisinas sobre o desempenho das aves. O descobrimento das propriedades hepatotóxicas e hepatocarcinogênicas de algumas linhagens de Aspergillus flavus e A. parasiticus em perus, na Inglaterra, no início da década de 1960, seguida pela elucidação da estrutura de seus metabólitos tóxicos, as aflatoxinas, deu novo enfoque e prioridade para a pesquisa sobre micotoxinas. Análises de aflatoxinas realizadas no Laboratório de Análises Micotoxicológicas (LAMIC da Universidade Fedaral de Santa Maria, entre os anos de 1986 e janeiro de 2000, em 15.600 amostras de alimentos destinados principalmente ao consumo animal, demonstram que no milho analisado, 41,9% das amostras estavam contaminadas por aflatoxinas. Em surtos de aflatoxicose no campo, uma das características mais marcantes é a má absorção que se manifesta como partículas de ração mal digeridas na excreta das aves. Também observa-se, em frangos e poedeiras que recebem AFL, extrema palidez das mucosas e pernas. Dietas deficientes em riboflavina ou colecalciferol (vit. D tornaram frangos sensíveis, nos índices de desenvolvimento corporal, a concentrações muito baixas de AFL. O efeito aflatoxina nos frangos é maior na fase inicial de crescimento, ou seja, quando as aves ingeriram aflatoxina nos primeiros 21 dias de vida, e quanto maior o nível de stress do lote, menor a quantidade de AFL para afetar negativamente seu desempenho, seja na produção de carne ou de ovos. As principais micotoxinas do grupo dos tricotecenos são: toxina T-2; deoxynivalenol (DON; diacetoxyscirpenol (DAS, todas produzidas através de diversas espécies de fungos do gênero Fusarium. Além dos tricotecenos, o fusarium também pode produzir zearalenona e fumonisinas. Dessas fusarium-toxinas, somente toxina T-2 gera patologias s

Protein tyrosine phosphatase 1B (PTP1B) is required for cardiac lineage differentiation of mouse embryonic stem cells.

Science.gov (United States)

Eshkiki, Zahra Shokati; Ghahremani, Mohammad Hossein; Shabani, Parisa; Firuzjaee, Sattar Gorgani; Sadeghi, Asie; Ghanbarian, Hossein; Meshkani, Reza

2017-01-01

Protein tyrosine phosphatase 1B (PTP1B) has been shown to regulate multiple cellular events such as differentiation, cell growth, and proliferation; however, the role of PTP1B in differentiation of embryonic stem (ES) cells into cardiomyocytes remains unexplored. In the present study, we investigated the effects of PTP1B inhibition on differentiation of ES cells into cardiomyocytes. PTP1B mRNA and protein levels were increased during the differentiation of ES cells into cardiomyocytes. Accordingly, a stable ES cell line expressing PTP1B shRNA was established. In vitro, the number and size of spontaneously beating embryoid bodies were significantly decreased in PTP1B-knockdown cells, compared with the control cells. Decreased expression of cardiac-specific markers Nkx2-5, MHC-α, cTnT, and CX43, as assessed by real-time PCR analysis, was further confirmed by immunocytochemistry of the markers. The results also showed that PTP1B inhibition induced apoptosis in both differentiated and undifferentiated ES cells, as presented by increasing the level of cleaved caspase-3, cytochrome C, and cleaved PARP. Further analyses revealed that PTP1B inhibition did not change proliferation and pluripotency of undifferentiated ES cells. Taken together, the data presented here suggest that PTP1B is essential for proper differentiation of ES cells into cardiomyocytes.

A P387L variant in protein tyrosine phosphatase-1B (PTP-1B) is associated with type 2 diabetes and impaired serine phosphorylation of PTP-1B in vitro

DEFF Research Database (Denmark)

Echwald, Søren M; Riis, Helle Bach; Vestergaard, Henrik

2002-01-01

In the present study, we tested the hypothesis that variability in the protein tyrosine phosphatase-1B (PTP-1B) gene is associated with type 2 diabetes. Using single-strand conformational polymorphism analysis, we examined cDNA of PTP-1B from 56 insulin-resistant patients with type 2 diabetes.......0012). In summary, a rare P387L variant of the PTP-1B gene is associated with a 3.7 (CI 1.26-10.93, P = 0.02) genotype relative risk of type 2 diabetes in the examined population of Danish Caucasian subjects and results in impaired in vitro serine phosphorylation of the PTP-1B peptide....

Effects of oral administration of aflatoxin B1 and fumonisin B1 in rabbits (Oryctolagus cuniculus).

Science.gov (United States)

Orsi, R B; Oliveira, C A F; Dilkin, P; Xavier, J G; Direito, G M; Corrêa, B

2007-12-15

The effects of prolonged oral administration (21 days) of fumonisin B(1) (FB(1)) and aflatoxin B(1) (AFB(1)) were studied in male New Zealand rabbits by clinical, pathological, biochemical and sphingolipid analyses. Twenty-four animals were randomly divided into the following four experimental groups: (A) 0 mg FB(1)+0 microg AFB(1)/(kg body weight(bw)day) (control); (B) 0 mg FB(1)+30 microg AFB(1)/(kg bw day); (C) 1.5 mg FB(1)/(kg bw day)+30 microg AFB(1)/(kg bw day); (D) 1.5 mg FB(1)/(kg bw day)+0 microg AFB(1). Animals from group B and principally from group C presented clinical signs of intoxication. Rabbits from group C presented a lower body weight gain than controls. Differences were observed between intoxicated rabbits and controls with respect to absolute and relative liver and kidney weight, hepatic function, serum urea and creatinine levels and Sa/So ratio. The most frequent hepatic and renal injuries were vacuolar degeneration of the liver and kidney as shown by the histopathological and serum biochemical results. Combined administration of AFB(1) and FB(1) resulted in synergistic toxic effects both in the liver and in the kidney, but hepatic injuries were more marked.

Deletion of SNURF/SNRPN U1B and U1B* upstream exons in a ...

Indian Academy of Sciences (India)

RESEARCH ARTICLE. Deletion of SNURF/SNRPN U1B and U1B* upstream exons in a child ... whereby genes are expressed in a parent-of-origin dependent manner. One of the ... lity, neurodevelopmental delay, features of attention deficit hyperactivity .... Received 16 December 2015; accepted 8 January 2016. Unedited ...

Measurement of the mass splittings between the b{bar b}{chi}{sub b,J}(1P) states

Energy Technology Data Exchange (ETDEWEB)

Edwards, K.W.; Edwards, K.W. [Institute of Particle Physics (Canada); Bellerive, A.; Bellerive, A.; Janicek, R.; Janicek, R.; MacFarlane, D.B.; MacFarlane, D.B.; Patel, P.M.; Patel, P.M. [Institute of Particle Physics (Canada); Sadoff, A.J. [Ithaca College, Ithaca, New York,14850 (United States); Ammar, R.; Baringer, P.; Bean, A.; Besson, D.; Coppage, D.; Darling, C.; Davis, R.; Kotov, S.; Kravchenko, I.; Kwak, N.; Zhou, L. [University of Kansas, Lawrence, Kansas, 66045 (United States); Anderson, S.; Kubota, Y.; Lee, S.J.; ONeill, J.J.; Poling, R.; Riehle, T.; Smith, A. [University of Minnesota, Minneapolis, Minnesota, 55455 (United States); Alam, M.S.; Athar, S.B.; Ling, Z.; Mahmood, A.H.; Timm, S.; Wappler, F. [State University of New York at Albany, Albany, New York, 12222 (United States); Anastassov, A.; Duboscq, J.E.; Fujino, D.; Gan, K.K.; Hart, T.; Honscheid, K.; Kagan, H.; Kass, R.; Lee, J.; Schwarthoff, H.; Spencer, M.B.; Sung, M.; Undrus, A.; Wolf, A.; Zoeller, M.M. [Ohio State University, Columbus, Ohio, 43210 (United States); Richichi, S.J.; Severini, H.; Skubic, P. [University of Oklahoma, Norman, Oklahoma, 73019 (United States); Bishai, M.; Fast, J.; Hinson, J.W.; Menon, N.; Miller, D.H.; Shibata, E.I.; Shipsey, I.P.; Yurko, M. [Purdue University, West Lafayette, Indiana, 47907 (United States); Glenn, S.; Kwon, Y.; Lyon, A.L.; Roberts, S.; Thorndike, E.H. [University of Rochester, Rochester, New York, 14627 (United States); Jessop, C.P.; Lingel, K.; Marsiske, H.; Perl, M.L.; Savinov, V.; Ugolini, D.; Zhou, X. [Stanford Linear Accelerator Center, Stanford University, Stanford, California, 94309 (United States); Coan, T.E.; Fadeyev, V.; Korolkov, I.; Maravin, Y.; Narsky, I.; Shelkov, V.; Staeck, J.; Stroynowski, R.; Volobouev, I.; Ye, J. [Southern Methodist University, Dallas, Texas, 75275 (United States); Artuso, M.; Azfar, F.; Efimov, A.; Goldberg, M.; He, D.; Kopp, S.; Moneti, G.C.; Mountain, R.; Schuh, S.; Skwarnicki, T.; and others

1999-02-01

We present new measurements of photon energies and branching fractions for the radiative transitions {Upsilon}(2S){r_arrow}{gamma}{chi}{sub b(J=0,1,2)}(1P). The masses of the {chi}{sub b} states are determined from the measured radiative photon energies. The ratio of mass splittings between the {chi}{sub b} substates, r{equivalent_to}(M{sub J=2}{minus}M{sub J=1})/(M{sub J=1}{minus}M{sub J=0}), with M the {chi}{sub b} mass, provides information on the nature of the b{bar b} confining potential. We find r(1P)=0.542{plus_minus}0.022{plus_minus}0.024. This value is somewhat lower than the previous world average, but more consistent with the theoretical expectation that r(1P){lt}r(2P); i.e., that this mass splitting ratio is smaller for the {chi}{sub b}(1P) states than for the {chi}{sub b}(2P) states. {copyright} {ital 1999} {ital The American Physical Society}

Processing TES Level-1B Data

Science.gov (United States)

DeBaca, Richard C.; Sarkissian, Edwin; Madatyan, Mariyetta; Shepard, Douglas; Gluck, Scott; Apolinski, Mark; McDuffie, James; Tremblay, Dennis

2006-01-01

TES L1B Subsystem is a computer program that performs several functions for the Tropospheric Emission Spectrometer (TES). The term "L1B" (an abbreviation of "level 1B"), refers to data, specific to the TES, on radiometric calibrated spectral radiances and their corresponding noise equivalent spectral radiances (NESRs), plus ancillary geolocation, quality, and engineering data. The functions performed by TES L1B Subsystem include shear analysis, monitoring of signal levels, detection of ice build-up, and phase correction and radiometric and spectral calibration of TES target data. Also, the program computes NESRs for target spectra, writes scientific TES level-1B data to hierarchical- data-format (HDF) files for public distribution, computes brightness temperatures, and quantifies interpixel signal variability for the purpose of first-order cloud and heterogeneous land screening by the level-2 software summarized in the immediately following article. This program uses an in-house-developed algorithm, called "NUSRT," to correct instrument line-shape factors.

Wind tunnel tests of Risø-B1-18 and Risø-B1-24

DEFF Research Database (Denmark)

Fuglsang, P.; Bak, Christian; Gaunaa, Mac

2003-01-01

This report contains 2D measurements of the Risø-B1-18 and Risø-B1-24 airfoils. The aerodynamic properties were derived from pressure measurements on the airfoil surface and in the wake. The measurements were conducted in the VELUX open jet wind tunnel,which has a background turbulence intensity...

Caracterización de ambientes sonoros en recintos universitarios: influencia del ruido sobre procesos cognitivos básicos

OpenAIRE

Tristán Hernández, Edgar

2014-01-01

El interés por el estudio de la problemática del ruido en las escuelas y sus efectos sobre los estudiantes a nivel universitarios, es un tema que no ha sido estudiado debidamente. Desgraciadamente, en el ámbito educativo universitario, no existen regulaciones específicas que permitan determinar parámetros preventivos, ni procedimientos de evaluación de ruido dentro de este tipo de instalaciones educativas. Debido a la importancia de los efectos que el ruido tiene sobre la salud y la calidad d...

Cyclophilin B enhances HIV-1 infection

Energy Technology Data Exchange (ETDEWEB)

DeBoer, Jason; Madson, Christian J. [Department of Medical Microbiology and Immunology, Creighton University, Omaha, NE (United States); Belshan, Michael, E-mail: michaelbelshan@creighton.edu [Department of Medical Microbiology and Immunology, Creighton University, Omaha, NE (United States); The Nebraska Center for Virology, University of Nebraska, Lincoln, NE (United States)

2016-02-15

Cyclophilin B (CypB) is a member of the immunophilin family and intracellular chaperone. It predominantly localizes to the ER, but also contains a nuclear localization signal and is secreted from cells. CypB has been shown to interact with the Gag protein of human immunodeficiency type 1 (HIV-1). Several proteomic and genetic studies identified it as a potential factor involved in HIV replication. Herein, we show that over-expression of CypB enhances HIV infection by increasing nuclear import of viral DNA. This enhancement was unaffected by cyclosporine treatment and requires the N-terminus of the protein. The N-terminus contains an ER leader sequence, putative nuclear localization signal, and is required for secretion. Deletion of the N-terminus resulted in mislocalization from the ER and suppression of HIV infection. Passive transfer experiments showed that secreted CypB did not impact HIV infection. Combined, these experiments show that intracellular CypB modulates a pathway of HIV nuclear import. - Highlights: • CypB has been identified in several proteomic studies of HIV-1 infection. • CypB expression is upregulated in activated and infected T-cells. • Over-expression of CypB enhances HIV nuclear import and infection. • The N-terminus of CypB is necessary for these effects.

Cyclophilin B enhances HIV-1 infection

International Nuclear Information System (INIS)

DeBoer, Jason; Madson, Christian J.; Belshan, Michael

2016-01-01

Cyclophilin B (CypB) is a member of the immunophilin family and intracellular chaperone. It predominantly localizes to the ER, but also contains a nuclear localization signal and is secreted from cells. CypB has been shown to interact with the Gag protein of human immunodeficiency type 1 (HIV-1). Several proteomic and genetic studies identified it as a potential factor involved in HIV replication. Herein, we show that over-expression of CypB enhances HIV infection by increasing nuclear import of viral DNA. This enhancement was unaffected by cyclosporine treatment and requires the N-terminus of the protein. The N-terminus contains an ER leader sequence, putative nuclear localization signal, and is required for secretion. Deletion of the N-terminus resulted in mislocalization from the ER and suppression of HIV infection. Passive transfer experiments showed that secreted CypB did not impact HIV infection. Combined, these experiments show that intracellular CypB modulates a pathway of HIV nuclear import. - Highlights: • CypB has been identified in several proteomic studies of HIV-1 infection. • CypB expression is upregulated in activated and infected T-cells. • Over-expression of CypB enhances HIV nuclear import and infection. • The N-terminus of CypB is necessary for these effects.

LA INVESTIGACIÓN SOBRE COACHING EN FORMACIÓN DEL PROFESORADO: UNA REVISIÓN DE ESTUDIOS QUE IMPACTAN EN LA CONCIENCIA SOBRE LA PRÁCTICA DOCENTE

Directory of Open Access Journals (Sweden)

Rocío Jiménez

2012-01-01

Full Text Available Este trabajo ofrece una revisión de estudios empíricos basados en el proceso de coaching como estrategia eficaz en la formación del profesorado tanto inicial como permanente. Los objetivos seconcretan en: a ofrecer la situación de la investigación actual sobre coaching en este ámbito, b establecer diferencias y similitudes entre los procesos de coaching en experiencias reales y eficaces de formación del profesorado, c delimitar los principios y constructos teórico-operativos del coaching como estrategia formativa e investigadora y d identificar líneas y retos para la investigación futura sobre la conciencia del profesorado y la transferibilidad de aprendizajes a lapráctica. El método de revisión bibliográfica se concreta en búsquedas automatizadas en bases de datos digitales especializadas en educación (ERIC o ISOC, así como, en revistas especializadas, enformación del profesorado, tanto españolas como internacionales, situadas en el primer o segundo cuartil de INRECS o indexadas en JCR con un factor de impacto superior a 0.6. Se usa un sistema de citación superior como el Science Citation Index, a partir de referencias claves. La selección de artículos científicos, siguiendo criterios específicos, reúne un total de 8 estudios. La revisión, muestra como resultado, las características del coaching como estrategia formativa y de investigación y ofrece una visión sobre el estado de la investigación, así como, una base teórica y práctica para futuras investigaciones que construyan conocimiento sobre este tema.

RSCAT_LEVEL_2B_OWV_COMP_12_V1.1:1

Data.gov (United States)

National Aeronautics and Space Administration — This dataset contains the RapidScat Level 2B 12.5km Version 1.1 science-quality ocean surface wind vectors. The Level 2B wind vectors are binned on a 12.5 km Wind...

77 FR 3284 - Comment Request for Information Collection for the H-1B Technical Skills Training (H-1B) and the...

Science.gov (United States)

2012-01-23

... concerning the collection of data about H-1B Technical Skills Training (H-1B) [SGA/DFA PY-10-13] and H-1B... DEPARTMENT OF LABOR Comment Request for Information Collection for the H-1B Technical Skills Training (H-1B) and the H-1B Jobs and Innovation Accelerator Challenge (JIAC) Grant Programs, New...

EFECTO DEL Mo APLICADO POR SUMERSION A SEMILLAS DE ALGODONERO SOBRE LA RESPIRACION DE PLANTILLAS y SU GERMINACION

Directory of Open Access Journals (Sweden)

I Mogilner

1965-01-01

Full Text Available Se trataron semillas de algodonero manteniéndolas sumergidas en: a agua destilada; b sol. de molibdato de sodio 0,05 O/C, y e sol. de molibdato de amonio 0,05 % durante 24 hs. a una temperatura de 30°C, con el objeto de determinar el efecto del elemento Mo sobre la germinación y respiración.Para el ensayo de germinación se realizaron 36 repeticiones de cada variante.Cada repetición consistió en 25 semillas dispuestas en una caja de Petri entre papel de filtro humedecido. Los resultados indican que el Mo tiene un efecto deprimente sobre la germinación, significativo al 1 %. La respiración se midió 24. hs. después de terminado el tratamiento sobre radículas y cotiledones separadamente. El Mo aumenta la respiración de las radículas en forma altamente significativa. Sobre los cotiledones el Mo, acompañado por el catión sodio, deprime la respiración, y acompañado por el catión amonio la aumenta.

26 CFR 31.3306(b)-1 - Wages.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 15 2010-04-01 2010-04-01 false Wages. 31.3306(b)-1 Section 31.3306(b)-1... Unemployment Tax Act (Chapter 23, Internal Revenue Code of 1954) § 31.3306(b)-1 Wages. (a) Applicable law and... after 1938 constitutes wages is determined under section 3306(b). Accordingly, only remuneration paid...

New 5-deoxyflavonoids and their inhibitory effects on protein tyrosine phosphatase 1B (PTP1B) activity

DEFF Research Database (Denmark)

Nguyen, Phi Hung; Dao, Trong Tuan; Kim, Jayeon

2011-01-01

.9 ± 1.6 to 19.2 ± 1.1 μM), while compounds (3, 5, and 9) with 2,2-dimethylpyrano ring showed less inhibitory effect (IC₅₀ 22.6 ± 2.3 to 72.9 ± 9.7 μM). These results suggest that prenyl and methoxy groups may be responsible for the increase on the activity of 5-deoxyflavonoids against PTP1B......, but the presence of 2,2-dimethylpyrano ring on the B ring may be induced the decrease of PTP1B inhibitory activity....

Bu-2470, a new peptide antibiotic complex. II. Structure determination of Bu-2470 A, B1, B2a and B2b.

Science.gov (United States)

Sugawara, K; Yonemoto, T; Konishi, M; Matsumoto, K; Miyaki, T; Kawaguchi, H

1983-06-01

The structures of Bu-2470 A, B1, B2a, and B2b have been determined. Bu-2470 A is a simple octapeptide having no fatty acid moiety, while Bu-2470 B1, B2a and B2b are octapeptides that have been acylated with a beta-hydroxy C11 or C10 fatty acid. The octapeptide structure of Bu-2470 components was found identical with that of octapeptin C1, hence generic names of octapeptin C0, C2, C3 and C4 are proposed for Bu-2470 A, B1, B2a and B2b, respectively.

Deletion of Protein Tyrosine Phosphatase 1B (PTP1B Enhances Endothelial Cyclooxygenase 2 Expression and Protects Mice from Type 1 Diabetes-Induced Endothelial Dysfunction.

Directory of Open Access Journals (Sweden)

David J Herren

Full Text Available Protein tyrosine phosphatase 1B (PTP1B dephosphorylates receptors tyrosine kinase and acts as a molecular brake on insulin signaling pathway. Conditions of metabolic dysfunction increase PTP1B, when deletion of PTP1B protects against metabolic disorders by increasing insulin signaling. Although vascular insulin signaling contributes to the control of glucose disposal, little is known regarding the direct role of PTP1B in the control of endothelial function. We hypothesized that metabolic dysfunctions increase PTP1B expression in endothelial cells and that PTP1B deletion prevents endothelial dysfunction in situation of diminished insulin secretion. Type I diabetes (T1DM was induced in wild-type (WT and PTP1B-deficient mice (KO with streptozotocin (STZ injection. After 28 days of T1DM, KO mice exhibited a similar reduction in body weight and plasma insulin levels and a comparable increase in glycemia (WT: 384 ± 20 vs. Ko: 432 ± 29 mg/dL, cholesterol and triglycerides, as WT mice. T1DM increased PTP1B expression and impaired endothelial NO-dependent relaxation, in mouse aorta. PTP1B deletion did not affect baseline endothelial function, but preserved endothelium-dependent relaxation, in T1DM mice. NO synthase inhibition with L-NAME abolished endothelial relaxation in control and T1DM WT mice, whereas L-NAME and the cyclooxygenases inhibitor indomethacin were required to abolish endothelium relaxation in T1DM KO mice. PTP1B deletion increased COX-2 expression and PGI2 levels, in mouse aorta and plasma respectively, in T1DM mice. In parallel, simulation of diabetic conditions increased PTP1B expression and knockdown of PTP1B increased COX-2 but not COX-1 expression, in primary human aortic endothelial cells. Taken together these data indicate that deletion of PTP1B protected endothelial function by compensating the reduction in NO bioavailability by increasing COX-2-mediated release of the vasodilator prostanoid PGI2, in T1DM mice.

LytB1 and LytB2 of Mycobacterium tuberculosis Are Not Genetically Redundant.

Directory of Open Access Journals (Sweden)

Amanda Claire Brown

Full Text Available Mycobacterium tuberculosis synthesises isoprenoid precursors via the MEP/DOXP pathway and at least five enzymes in the pathway (Dxs1, Dxr/IspC, IspD, IspF, and GcpE/IspG are required for growth in vitro. We investigated the role of LytB (IspH in M. tuberculosis; M. tuberculosis is unusual in that it has two homologs-LytB1 and LytB2. We were unable to delete the lytB2 gene unless we provided an additional copy elsewhere, demonstrating that this is the essential homolog. We expressed lytB1 from the lytB2 promoter and confirmed that this could not complement for loss of function of lytB2, despite LytB1 possessing all the previously described conserved critical residues. Interestingly the sole LytB homolog of Mycobacterium smegmatis was able to compensate for loss of LytB2 in M. tuberculosis. We tested translational fusions of LytB1 and LytB2 for functionality in M. tuberculosis, but only a fusion with 90% N-terminal LytB2 and 10% C-terminal LytB1 was functional. In order to identify the key difference between the two proteins, site directed mutagenesis was used to change LytB2 residues into their counterparts in LytB1. None of these amino acid substitutions was essential for function and all lytB2 mutant alleles were functional. In contrast, mutation of the key residues for [Fe4S4] cluster formation, as well as a catalytic residue in LytB1 did not result in functional complementation. Thus, although LytB1 and LytB2 are not genetically redundant, this is not dependent on small amino acid changes, but is likely to be a result of major overall structural differences.

26 CFR 1.50B-4 - Partnerships.

Science.gov (United States)

2010-04-01

... § 1.50A-3, or if the partnership fails to pay comparable wages and such failure is subject to the... 26 Internal Revenue 1 2010-04-01 2010-04-01 true Partnerships. 1.50B-4 Section 1.50B-4 Internal... Credit for Expenses of Work Incentive Programs § 1.50B-4 Partnerships. (a) General rule—(1) In general...

Las reflexiones de José Manuel Arango sobre la poesía

OpenAIRE

Hernando Vargas

2006-01-01

Busco la peculiaridad de la poesía de este poeta colombiano. Para ello considero en primer término sus reflexiones sobre ella, es decir, su poética. Como primer paso, daré una indicación provisional y de conjunto sobre ella, con base en los títulos de los libros publicados en vida de su autor. Enseguida, y ya que encuentro testimonios de esa búsqueda que constituye la reflexión de Arango en poemas, ensayos, prólogos y entrevistas, consideraré sus poemas, después tomaré un par de afirmaciones ...

26 CFR 1.167(b)-1 - Straight line method.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Straight line method. 1.167(b)-1 Section 1.167(b... Straight line method. (a) In general. Under the straight line method the cost or other basis of the... may be reduced to a percentage or fraction. The straight line method may be used in determining a...

Data of evolutionary structure change: 1B04B-3BAAA [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 1B04B-3BAAA 1B04 3BAA B A MDRQQAERRAAELRELLNRYGYEYYVLDRPSVPDAEYDR...NLKTIRSLPLRLKEPVSLEARGEAFMPKASFLRLNEERKAR--ELFANPRNAAAGSLRQLDPKVAASRQLDLFVYGLADAEALGIASHSEALDYLQALGFKVNPERRR...DGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTV... 353 TYR CA 427 3BAA A 3BAAA...hain>A 3BAAA EREENGQDIFAN

26 CFR 1.802(b)-1 - Tax on life insurance companies.

Science.gov (United States)

2010-04-01

.... For the definition of the term “1954 life insurance company taxable income”, see § 1.805-1. (b) The... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Tax on life insurance companies. 1.802(b)-1...) INCOME TAX (CONTINUED) INCOME TAXES Life Insurance Companies § 1.802(b)-1 Tax on life insurance companies...

CYP1B1 expression, a potential risk factor for breast cancer

Energy Technology Data Exchange (ETDEWEB)

Goth-Goldstein, Regine; Erdmann, Christine A.; Russell, Marion

2001-05-31

CYP1B1 expression in non-tumor breast tissue from breast cancer patients and cancer-free individuals was determined to test the hypothesis that high CYP1B1 expression is a risk factor for breast cancer. Large interindividual variations in CYP1B1 expression were found with CYP1B1 levels notably higher in breast cancer patients than cancer-free individuals. The results indicate that CYP1B1 might play a role in breast cancer either through increased PAH activation or through metabolism of endogenous estrogen to a carcinogenic derivative.

Asperentin B, a New Inhibitor of the Protein Tyrosine Phosphatase 1B.

Science.gov (United States)

Wiese, Jutta; Aldemir, Hülya; Schmaljohann, Rolf; Gulder, Tobias A M; Imhoff, Johannes F

2017-06-21

In the frame of studies on secondary metabolites produced by fungi from deep-sea environments we have investigated inhibitors of enzymes playing key roles in signaling cascades of biochemical pathways relevant for the treatment of diseases. Here we report on a new inhibitor of the human protein tyrosine phosphatase 1B (PTP1B), a target in the signaling pathway of insulin. A new asperentin analog is produced by an Aspergillus sydowii strain isolated from the sediment of the deep Mediterranean Sea. Asperentin B ( 1 ) contains an additional phenolic hydroxy function at C-6 and exhibits an IC 50 value against PTP1B of 2 μM in vitro, which is six times stronger than the positive control, suramin. Interestingly, asperentin ( 2 ) did not show any inhibition of this enzymatic activity. Asperentin B ( 1 ) is discussed as possible therapeutic agents for type 2 diabetes and sleeping sickness.

EphrinB1/EphB3b Coordinate Bidirectional Epithelial-Mesenchymal Interactions Controlling Liver Morphogenesis and Laterality

DEFF Research Database (Denmark)

Cayuso, Jordi; Dzementsei, Aliaksandr; Fischer, Johanna C

2016-01-01

Positioning organs in the body often requires the movement of multiple tissues, yet the molecular and cellular mechanisms coordinating such movements are largely unknown. Here, we show that bidirectional signaling between EphrinB1 and EphB3b coordinates the movements of the hepatic endoderm...... and adjacent lateral plate mesoderm (LPM), resulting in asymmetric positioning of the zebrafish liver. EphrinB1 in hepatoblasts regulates directional migration and mediates interactions with the LPM, where EphB3b controls polarity and movement of the LPM. EphB3b in the LPM concomitantly repels hepatoblasts...

45 CFR 73b.1 - Scope.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 1 2010-10-01 2010-10-01 false Scope. 73b.1 Section 73b.1 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION DEBARMENT OR SUSPENSION OF FORMER EMPLOYEES... officer or employee of the Department, including former and retired officers of the commissioned corps of...

The B(E2;4^+1->2^+1) / B(E2;2^+1->0^+1) Ratio in Even-Even Nuclei

Science.gov (United States)

Loelius, C.; Sharon, Y. Y.; Zamick, L.; G"Urdal, G.

2009-10-01

We considered 207 even-even nuclei throughout the chart of nuclides for which the NNDC Tables had data on the energies and lifetimes of the 2^+1 and 4^+1 states. Using these data we calculated for each nucleus the electric quadrupole transition strengths B(E2;4^+1->2^+1) and B(E2;2^+1->0^+1), as well as their ratio. The internal conversion coefficients were obtained by using the NNDC HSICC calculator. For each nucleus we plotted the B(E2) ratio against A, N, and Z. We found that for close to 90% of the nuclei considered the ratio had values between 0.5 and 2.5. Most of the outliers had magic numbers of protons or neutrons. Our ratio results were compared with the theoretical predictions for this ratio by different models--10/7 in the rotational model and 2 in the simplest vibrational model. In the rotational regions (for 150 220) the ratios were indeed close to 10/7. For the few nuclei thought to be vibrational the ratios were usually less than 2. Otherwise, we got a wide scatter of ratio values. Hence other models, including the NpNn scheme, must be considered in interpreting these results.

Protein tyrosine phosphatase 1B (PTP1B) is dispensable for IgE-mediated cutaneous reaction in vivo.

Science.gov (United States)

Yang, Ting; Xie, Zhongping; Li, Hua; Yue, Lei; Pang, Zheng; MacNeil, Adam J; Tremblay, Michel L; Tang, Jin-Tian; Lin, Tong-Jun

2016-01-01

Mast cells play a critical role in allergic reactions. The cross-linking of FcεRI-bound IgE with multivalent antigen initiates a cascade of signaling events leading to mast cell activation. It has been well-recognized that cross linking of FcεRI mediates tyrosine phosphorylation. However, the mechanism involved in tyrosine dephosphorylation in mast cells is less clear. Here we demonstrated that protein tyrosine phosphatase 1B (PTP1B)-deficient mast cells showed increased IgE-mediated phosphorylation of the signal transducer and activator of transcription 5 (STAT5) and enhanced production of CCL9 (MIP-1γ) and IL-6 in IgE-mediated mast cells activation in vitro. However, IgE-mediated calcium mobilization, β-hexaosaminidase release (degranulation), and phosphorylation of IκB and MAP kinases were not affected by PTP1B deficiency. Furthermore, PTP1B deficient mice showed normal IgE-dependent passive cutaneous anaphylaxis and late phase cutaneous reactions in vivo. Thus, PTP1B specifically regulates IgE-mediated STAT5 pathway, but is redundant in influencing mast cell function in vivo. Copyright © 2016 Elsevier Inc. All rights reserved.

Soybean growth and yield under cover crops Análise de crescimento e produtividade de grãos de soja sobre plantas de cobertura

Directory of Open Access Journals (Sweden)

Priscila de Oliveira

2013-04-01

Full Text Available The use of cover crops in no-tillage systems can provide better conditions for the development of soybean plants with positive effects on grain yield and growth analysis techniques allow researchers to characterize and understand the behavior of soybean plants under different straw covers. Thus, the aim of this study was to characterize, using growth analysis, yield components and agronomic performance of soybean under common bean, Brachiaria brizantha and pearl millet straws. The experiment was performed on a soil under cerrado in the municipality of Santo Antônio de Goiás, GO. The experiment was arranged in a randomized complete block design with three treatments (cover crops and five replications. Soybean grain yield was lower in the B. brizantha straw treatment (3,708 kg ha-1 than both in the pearl millet (4.772 kg ha-1 and common bean straw treatments (5,200 kg ha-1. The soybean growth analysis in B. brizantha, pearl millet and common bean allowed characterizing the variation in the production of dry matter of leaves, stems, pods and total and leaf area index that provided different grain yields. The cover crop directly affects the soybean grain yield.O uso de plantas de cobertura no sistema plantio direto pode proporcionar melhores condições para o desenvolvimento da cultura da soja com reflexos positivos na produtividade de grãos, e o uso da técnica de análise de crescimento permitirá caracterizar e entender o comportamento das plantas de soja sobre diferentes palhadas. Dessa forma, o objetivo deste trabalho foi caracterizar, por meio da análise de crescimento, os componentes e o desempenho agronômico da soja sobre as palhadas de feijão-comum, Brachiaria brizantha e milheto. O experimento foi conduzido em solo de cerrado no município de Santo Antônio de Goiás, Estado de Goiás. O delineamento experimental foi o de blocos completos casualizados, com três tratamentos (palhadas de cobertura e cinco repetições. A

ACTH Regulation of Adrenal SR-B1

Directory of Open Access Journals (Sweden)

Wen-Jun eShen

2016-05-01

Full Text Available The adrenal gland is one of the prominent sites for steroid hormone synthesis. Lipoprotein-derived cholesterol esters delivered via scavenger receptor, class B type 1 (SR-B1 constitute the dominant source of cholesterol for steroidogenesis, particularly in rodents. ACTH stimulates steroidogenesis through downstream actions on multiple components involved in steroidogenesis. Both acute and chronic ACTH treatment can modulate SR-B1 function including its transcription, its post transcriptional stability, its phosphorylation and dimerization status, as well as its interaction with other protein partners; all of which result in changes in the ability of SR-B1 to mediate HDL-cholesterol ester uptake and the supply of cholesterol for conversion to steroids. Here we provide a review of the recent findings on the regulation of adrenal SR-B1 function by ACTH.

Interferon-alpha triggers B cell effector 1 (Be1 commitment.

Directory of Open Access Journals (Sweden)

Marie-Ghislaine de Goër de Herve

Full Text Available B-cells can contribute to the pathogenesis of autoimmune diseases not only through auto-antibody secretion but also via cytokine production. Therapeutic depletion of B-cells influences the functions and maintenance of various T-cell subsets. The mechanisms governing the functional heterogeneity of B-cell subsets as cytokine-producing cells are poorly understood. B-cells can differentiate into two functionally polarized effectors, one (B-effector-1-cells producing a Th-1-like cytokine pattern and the other (Be2 producing a Th-2-like pattern. IL-12 and IFN-γ play a key role in Be1 polarization, but the initial trigger of Be1 commitment is unclear. Type-I-interferons are produced early in the immune response and prime several processes involved in innate and adaptive responses. Here, we report that IFN-α triggers a signaling cascade in resting human naive B-cells, involving STAT4 and T-bet, two key IFN-γ gene imprinting factors. IFN-α primed naive B-cells for IFN-γ production and increased IFN-γ gene responsiveness to IL-12. IFN-γ continues this polarization by re-inducing T-bet and up-regulating IL-12Rβ2 expression. IFN-α and IFN-γ therefore pave the way for the action of IL-12. These results point to a coordinated action of IFN-α, IFN-γ and IL-12 in Be1 polarization of naive B-cells, and may provide new insights into the mechanisms by which type-I-interferons favor autoimmunity.

Concepções sobre criminalidade e modelos de policiamento

Directory of Open Access Journals (Sweden)

Marco Antônio de Azevedo

Full Text Available Podem-se conceber duas perspectivas teóricas básicas para explicar a criminalidade: a culturalista e a racionalista. Da primeira derivam políticas públicas destinadas a reduzir a criminalidade através de uma atuação sobre a desorganização social. Na segunda privilegia-se uma estratégia segundo a qual o principal papel do Estado é dissuadir o criminoso da prática delituosa. Este trabalho revisa a literatura, evidenciando mitos sobre o crime e a atividade policial. São discutidos dois modelos de policiamento: um mais tradicional e reativo e outro mais preventivo, procurando-se mostrar que o racionalismo dá maior suporte teórico a políticas de segurança pública que valorizam a promoção da cidadania.

PTP1B antisense oligonucleotide lowers PTP1B protein, normalizes blood glucose, and improves insulin sensitivity in diabetic mice

Science.gov (United States)

Zinker, Bradley A.; Rondinone, Cristina M.; Trevillyan, James M.; Gum, Rebecca J.; Clampit, Jill E.; Waring, Jeffrey F.; Xie, Nancy; Wilcox, Denise; Jacobson, Peer; Frost, Leigh; Kroeger, Paul E.; Reilly, Regina M.; Koterski, Sandra; Opgenorth, Terry J.; Ulrich, Roger G.; Crosby, Seth; Butler, Madeline; Murray, Susan F.; McKay, Robert A.; Bhanot, Sanjay; Monia, Brett P.; Jirousek, Michael R.

2002-01-01

The role of protein-tyrosine phosphatase 1B (PTP1B) in diabetes was investigated using an antisense oligonucleotide in ob/ob and db/db mice. PTP1B antisense oligonucleotide treatment normalized plasma glucose levels, postprandial glucose excursion, and HbA1C. Hyperinsulinemia was also reduced with improved insulin sensitivity. PTP1B protein and mRNA were reduced in liver and fat with no effect in skeletal muscle. Insulin signaling proteins, insulin receptor substrate 2 and phosphatidylinositol 3 (PI3)-kinase regulatory subunit p50α, were increased and PI3-kinase p85α expression was decreased in liver and fat. These changes in protein expression correlated with increased insulin-stimulated protein kinase B phosphorylation. The expression of liver gluconeogenic enzymes, phosphoenolpyruvate carboxykinase, and fructose-1,6-bisphosphatase was also down-regulated. These findings suggest that PTP1B modulates insulin signaling in liver and fat, and that therapeutic modalities targeting PTP1B inhibition may have clinical benefit in type 2 diabetes. PMID:12169659

Photometric investigation of hot exoplanets: TrES-3b and Qatar-1b

Science.gov (United States)

Püsküllü, Ç.; Soydugan, F.; Erdem, A.; Budding, E.

2017-08-01

New photometric follow-up observations of transitting 'hot Jupiters' TrES-3b and Qatar-1b are presented. Weighted mean values of the solutions of light curves in R-filter for both planetary systems are reported and compared with the previous results. The transit light curves were analysed using the WINFITTER code. The physical properties of the planets were estimated. The planet radii are found to be Rp = 1.381 ± 0.033RJ for TrES-3b and Rp = 1.142 ± 0.025RJ for Qatar-1b. Transit times and their uncertainties were also determined and a new linear ephemeris was computed for both systems. Analysis of transit times showed that a significant signal could not be determined for TrES-3b, while weak evidence was found for Qatar-1b, which might be tested using more precise future transit times.

Sobre Geoestatística e mapas

Directory of Open Access Journals (Sweden)

Paulo Milton Barbosa Landim

2015-06-01

Full Text Available A Geologia, até há bem pouco tempo, era freqüentemente considerada uma ciência baseada em interpretações puramente qualitativas dos fenômenos geológicos. Nos últimos 40 anos, porém, tem sido notável a mudança da fase descritiva para a utilização de métodos quantitativos, principalmente na área da Geologia Aplicada. Entre tantos temas relacionados com a quantificação em Geologia o assunto abordado neste artigo, que pretende ser de cunho didático, diz respeito à aplicação da Geoestatística na confecção de mapas geológicos. Na primeira parte do trabalho é feita uma introdução sobre os aspectos quantitativos na interpretação dos fenômenos geológicos, em seguida conceitos básicos sobre a metodologia geoestatística e, na última parte, uma aplicação clássica da geoestatística linear, baseada nos conceitos de estacionaridade da covariância e do variograma, para a confecção de mapas.

Simultaneous high performance liquid chromatographic analysis of vitamins B1, B2 and B6 in royal jelly

Directory of Open Access Journals (Sweden)

Presoto Ana Elisa F

2004-01-01

Full Text Available Royal jelly is used as a food supplement, popularly known as rich in B vitamins. The present work has two objectives: firstly, to apply simultaneous quantitative determination by High Performance Liquid Chromatography of thiamin (vitamin B1, riboflavin (vitamin B2 and pyridoxine (vitamin B6 and secondly to compare the obtained data with the Dietary Reference Intake (DRI values. The values obtained showed no thiamin, a range from 20 to 171 ng g-1 of riboflavin and from 408 to 2 188 ng g-1 of pyridoxine in royal jelly. According to the Food and Nutrition Board (2000, the DRI of these vitamins varies from 0.2-1.4 mg for thiamin; 0.3-1.6 mg for riboflavin and 0.1-2.0 mg for pyridoxine, depending on age and sex. According to these recommendations, royal jelly is not a good source of vitamins B1, B2 or B6 as these vitamins appear only on order of ng g-1. The proposed method can be used in routine analysis for royal jelly, having the advantage of being simple, fast and reliable.

TRMM Visible and Infrared Scanner Calibrated Radiances L1B 1.5 hours V7 (TRMM_1B01) at GES DISC

Data.gov (United States)

National Aeronautics and Space Administration — This TRMM Visible and Infrared Scanner (VIRS) Level 1B Calibrated Radiance Product (1B01) contains calibrated radiances and auxiliary geolocation information from...

Preliminary investigations on B0 and B1 parameters of equatorial ionospheric profiles

International Nuclear Information System (INIS)

Adeniyi, J.O.

1997-01-01

The data used for this study are those from Ouagadougou (Lat. 12.4 deg. N, Dip 5.9 deg. N) and Ibadan (Lat. 7.4 deg. N, Dip 6.3 deg. S). Analysis were done for only daytime period. The results indicate that B0 exhibit a solar zenith angle dependent diurnal variation and some seasonal effect is presented during certain hours of the day. B1 does not show pronounced seasonal effects or solar zenith angle dependence. Daytime average value of B0 varied from 70 to 180 while B1 varied from 1.5 to 3.1. The average magnitudes of B0 at 1000,1200 and 1400 at Ibadan are greater than those of Ouagadougou during the winter season and the corresponding values of B1 are also greater in Ibadan during summer and winter seasons. In summer, average IRI B0 at 1200 hour for Ibadan is about the same as the experimental value but during winter, the IRI average is less than the experimental one. (author). 5 refs, 5 tabs

Conocimientos, practicas y habilidades sobre la búsqueda bibliográfica y percepción estudiantil sobre la capacitación universitaria en investigación, en estudiantes de obstetricia Know-how, practicals and skills concerning bibliographical searches and students' perception of university training in research, in the case of students of obstetrics

Directory of Open Access Journals (Sweden)

Mauro Huamani-Navarro

2011-12-01

Full Text Available Introducción: Se observan estudiantes del pregrado de obstetricia con insuficientes habilidades para utilizar toda la información que necesitan. Por ello, nos proponemos determinar el nivel de conocimiento, las prácticas y habilidades sobre la búsqueda de información en Internet, además de la percepción estudiantil sobre la capacitación brindada por la universidad y sobre su nivel en investigación. Sujetos y métodos: Estudio descriptivo transversal, periodo abril-julio de 2009, en 150 estudiantes de obstetricia de la Facultad de Medicina de la Universidad Nacional Mayor de San Marcos, en Perú. Por medio de un cuestionario estructurado, se realizó un análisis univariado. Resultados: El 78,7% presentó conocimientos bajos; el 55,3%, prácticas incorrectas, y el 74,7%, deficientes habilidades para realizar una búsqueda. El 60% consideraba que la preparación en búsqueda de información era regular o deficiente, con igual proporción para los procesos de publicación, redacción, lectura crítica y metodología de la investigación. Conclusiones: Identificar los conocimientos, prácticas, habilidades y percepciones sobre la investigación es importante para promover programas de capacitación extracurricular en los estudiantes durante el pregrado.Introduction: Undergraduate students of midwifery were observed with insufficient skills to use all the information they need. Therefore, we propose to determine the level of knowledge, practices and skills in finding information on the Internet, as well as student perceptions about the training provided by the university and research level. Subjects and methods: Descriptive study period April-July 2009, 150 students of midwifery of the Faculty of Medicine of the Universidad Nacional Mayor de San Marcos in Peru. Through a structured questionnaire, we conducted a univariate analysis. Results: 78.7% had low knowledge, 55.3%, malpractice, and 74.7%, impaired ability to perform a search. 60% felt

SerpinB1 Promotes Pancreatic β Cell Proliferation

Energy Technology Data Exchange (ETDEWEB)

El Ouaamari, Abdelfattah; Dirice, Ercument; Gedeon, Nicholas; Hu, Jiang; Zhou, Jian-Ying; Shirakawa, Jun; Hou, Lifei; Goodman, Jessica; Karampelias, Christos; Qiang, Guifeng; Boucher, Jeremie; Martinez, Rachael; Gritsenko, Marina A.; De Jesus, Dario F.; Kahraman, Sevim; Bhatt, Shweta; Smith, Richard D.; Beer, Hans-Dietmar; Jungtrakoon, Prapaporn; Gong, Yanping; Goldfine, Allison B.; Liew, Chong Wee; Doria, Alessandro; Andersson, Olov; Qian, Wei-Jun; Remold-O’Donnell, Eileen; Kulkarni, Rohit N.

2016-01-01

Compensatory β-cell growth in response to insulin resistance is a common feature in diabetes. We recently reported that liver-derived factors participate in this compensatory response in the liver insulin receptor knockout (LIRKO) mouse, a model of significant islet hyperplasia. Here we show that serpinB1 is a liver-derived secretory protein that controls β-cell proliferation. SerpinB1 is abundant in the hepatocyte secretome and sera derived from LIRKO mice. SerpinB1 and small molecule compounds that partially mimic serpinB1 activity enhanced proliferation of zebrafish, mouse and human β-cells. We report that serpinB1-induced β-cell replication requires protease inhibition activity and mice lacking serpinB1 exhibit attenuated β-cell replication in response to insulin resistance. Finally, SerpinB1-treatment of islets modulated signaling proteins in growth and survival pathways such as MAPK, PKA and GSK3. Together, these data implicate SerpinB1 as a protein that can potentially be harnessed to enhance functional β-cell mass in patients with diabetes.

[EFFICIENCY OF INTRODUCING CAROTENE PRODUCING STRAINS BACILLUS SP. 1.1 AND B. AMYLOLIQUEFACIENS UCM B-5113 INTO THE CHIKENS DIET].

Science.gov (United States)

Nechypurenko, O O; Kharhota M A; Avdeeva, L V

2015-01-01

It was shown the efficiency of carotene producing strains Bacillus sp. 1.1 and B. amyloliquefaciens UCM B-5113 in the diet of chickens. Also it was detected the lowering of the quantitative content of bacterial genera Enterococcus, Staphylococcus, family Enterobacteriaceae in the gut after eating by chickens cross "H&N Brown Nick" fodder with strains Bacillus sp. 1.1 and B. amyloliquefaciens UCM B-5113 alone and in composition in quantities 1 x 10(10) CFU per 1 g of feed. On the 18th day after introduction of cultures Bacillus sp. 1.1, B. amyloliquefaciens UCM B-5113 and their composition in the diet of poultry we revealed the increasing of body weight by 21.6, 7.6 and 22.0%, respectively, comparesing to controls. Also due to Bacillus sp. 1.1 it was detected the restore of intestinal villous structures, tissues of spleen, liver and heart. We found the additive effect of the composition of the investigated strains of bacteria genus Bacillus to the chickens.

Cloning and tissue expression of cytochrome P450 1B1 and 1C1 ...

African Journals Online (AJOL)

Cytochrome P450 1 (CYP1) is widely used as an indicator of exposure to environmental contaminants. In the study, two full-length complementary DNAs encode for CYP1B1 and CYP1C1 were cloned from medaka liver exposed to 500 ppb β-naphthoflavone for 24 h. CYP1B1, having 1984 bp, contains an open reading ...

Efecto de la urea sobre la viscosidad de soluciones acuosas de aminoácidos

Directory of Open Access Journals (Sweden)

Carmen María Romero

2010-07-01

Full Text Available Se midió a 25.0° la viscosidad de soluciones de glicina, dl-alanina, norvalina, dlvalina, norleucina y 1-leucina usando como solventes soluciones acuosas de urea 0.5 y 2.0 M. Los valores obtenidos para los coeficientes B de viscosidad muestran que aún a bajas concentraciones la urea ejerce un efecto disruptor sobre la estructura del agua y sugieren que a- aminoácidos con más de 4 carbonos en el grupo apolar pueden presentar efectos de doblez de cadena por interacciones hidrofóbicas.

Efeito de ação educativa participativa no conhecimento de professores do ensino básico sobre malária

Directory of Open Access Journals (Sweden)

Martha Cecilia Suárez-Mutis

2011-10-01

Full Text Available OBJETIVO: Descrever uma estratégia educativa participativa de construção de conhecimentos relacionados à malária entre professores em um município altamente endêmico. MÉTODOS: Foi feito um estudo observacional. Um curso de 40 horas foi realizado sob enfoque multidisciplinar e problematizador para 46 professores, prioritariamente da área rural, no município de Barcelos, AM, em 2008. O processo educativo participativo incluiu oficinas e aulas práticas. Para investigar os conhecimentos, aplicou-se um questionário previamente validado, antes e após o curso, avaliado por abordagens quantitativa e qualitativa usando a análise temática para respostas abertas. RESULTADOS: Previamente ao curso, os professores tinham pouca informação sobre os mecanismos de transmissão, meios de prevenção e a associação da malária aos seus vetores, bem como conceitos restritos sobre saúde. Após o curso, não somente aumentou o conhecimento dos professores sobre a malária como também emergiram reflexões sobre o papel do professor na sociedade. CONCLUSÕES: O efeito da ação educativa na construção de um saber contextualizado sobre malária e saúde indica o potencial da estratégia desenvolvida. Processos de educação permanente são necessários à sustentabilidade dos novos saberes e práticas, orientados pela promoção da saúde.

sup 1 sup 1 B nutation NMR study of powdered borosilicates

CERN Document Server

Woo, A J; Han, D Y

1998-01-01

In this work, we applied the 1D sup 1 sup 1 B nutation NMR method for the analysis of the local structural environments in powdered borosilicates (SiO sub 2 -B sub 2 O sub 3). Spin dynamics during a rf irradiation for spin I=3/2 was analytically calculated with a density matrix formalism. Spectral simulation programs were written in MATLAB on a PC. Two borosilicates prepared by the sol-gel process at different stabilization temperature were used for the 1D sup 1 sup 1 B nutation NMR experiment. The sup 1 sup 1 B NMR parameters, quadrupole coupling constants (e sup 2 qQ/h) and asymmetry parameters (eta), for each borosilicate were extracted from the nonlinear least-squares fitting. The effects of heat treatments on the local structures of boron sites in borosilicates were discussed.

CYP7B1

DEFF Research Database (Denmark)

Roos, P; Svenstrup, K; Danielsen, E R

2014-01-01

UNLABELLED: The SPG5A subtype of Hereditary Spastic Paraplegia (HSP) is a rare autosomal recessive neurodegenerative disorder caused by mutations in the CYP7B1 gene, which encodes a steroid cytochrome P450 7α-hydroxylase. This enzyme provides the primary metabolic route for neurosteroids. Clinica......UNLABELLED: The SPG5A subtype of Hereditary Spastic Paraplegia (HSP) is a rare autosomal recessive neurodegenerative disorder caused by mutations in the CYP7B1 gene, which encodes a steroid cytochrome P450 7α-hydroxylase. This enzyme provides the primary metabolic route for neurosteroids.......945_947 dupGGC p.A316AA). CONCLUSION: SPG5A could be characterized as a predominantly pure HSP. MRS showing elevated mI/Cr ratio in the white matter may be indicative of SPG5A....

Zinc-fingers and homeoboxes 1 (ZHX1) binds DNA methyltransferase (DNMT) 3B to enhance DNMT3B-mediated transcriptional repression

International Nuclear Information System (INIS)

Kim, Sung-Hak; Park, Jinah; Choi, Moon-Chang; Kim, Hwang-Phill; Park, Jung-Hyun; Jung, Yeonjoo; Lee, Ju-Hee; Oh, Do-Youn; Im, Seock-Ah; Bang, Yung-Jue; Kim, Tae-You

2007-01-01

DNA methyltransferases (DNMT) 3B is a de novo DNMT that represses transcription independent of DNMT activity. In order to gain a better insight into DNMT3B-mediated transcriptional repression, we performed a yeast two-hybrid analysis using DNMT3B as a bait. Of the various binding candidates, ZHX1, a member of zinc-finger and homeobox protein, was found to interact with DNMT3B in vivo and in vitro. N-terminal PWWP domain of DNMT3B was required for its interaction with homeobox motifs of ZHX1. ZHX1 contains nuclear localization signal at C-terminal homeobox motif, and both ZHX1 and DNMT3B were co-localized in nucleus. Furthermore, we found that ZHX1 enhanced the transcriptional repression mediated by DNMT3B when DNMT3B is directly targeted to DNA. These results showed for First the direct linkage between DNMT and zinc-fingers homeoboxes protein, leading to enhanced gene silencing by DNMT3B

26 CFR 301.7701(b)-1 - Resident alien.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 18 2010-04-01 2010-04-01 false Resident alien. 301.7701(b)-1 Section 301.7701... ADMINISTRATION PROCEDURE AND ADMINISTRATION Definitions § 301.7701(b)-1 Resident alien. (a) Scope. Section 301.7701(b)-1(b) provides rules for determining whether an alien individual is a lawful permanent resident...

Observation of $B^0_s\\rightarrow\\chi_{c1}\\phi$ decay and study of $B^0\\rightarrow\\chi_{c1,2}K^{*0}$ decays

CERN Document Server

INSPIRE-00258707; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amerio, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Andrews, J E; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Baalouch, M; Bachmann, S; Back, J J; Baesso, C; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bauer, Th; Bay, A; Beddow, J; Bedeschi, F; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Burducea, I; Bursche, A; Busetto, G; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Castillo Garcia, L; Cattaneo, M; Cauet, Ch; Cenci, R; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Couturier, B; Cowan, G A; Craik, D C; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; Davis, A; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Del Buono, L; Déléage, N; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Di Ruscio, F; Dijkstra, H; Dogaru, M; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Elsby, D; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fiore, M; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Furfaro, E; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Giubega, L; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Griffith, P; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hamilton, B; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Hartmann, T; He, J; Head, T; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicheur, A; Hicks, E; Hill, D; Hoballah, M; Holtrop, M; Hombach, C; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jans, E; Jaton, P; Jawahery, A; Jing, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Kaballo, M; Kandybei, S; Kanso, W; Karacson, M; Karbach, T M; Kenyon, I R; Ketel, T; Keune, A; Khanji, B; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leo, S; Leroy, O; Lesiak, T; Leverington, B; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; Lohn, S; Longstaff, I; Lopes, J H; Lopez-March, N; Lu, H; Lucchesi, D; Luisier, J; Luo, H; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Manca, G; Mancinelli, G; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Maurice, E; Mazurov, A; Mc Skelly, B; McCarthy, J; McNab, A; McNulty, R; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mordà, A; Morello, M J; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neubert, S; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polyakov, I; Polycarpo, E; Popov, A; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pritchard, A; Prouve, C; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodriguez Perez, P; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruffini, F; Ruiz, H; Ruiz Valls, P; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salustino Guimaraes, V; Salzmann, C; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Sirendi, M; Skwarnicki, T; Smith, N A; Smith, E; Smith, J; Smith, M; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Sun, L; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urner, D; Ustyuzhanin, A; Uwer, U; Vagnoni, V; Valenti, G; Vallier, A; Van Dijk, M; Vazquez Gomez, R; Vazquez Regueiro, P; Vázquez Sierra, C; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, C; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiechczynski, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wimberley, J; Wishahi, J; Witek, M; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhokhov, A; Zhong, L; Zvyagin, A

2013-01-01

The first observation of the decay $B^0_s\\rightarrow\\chi_{c1}\\phi$ and a study of $B^0\\rightarrow\\chi_{c1,2}K^{*0}$ decays are presented. The analysis is performed using a dataset, corresponding to an integrated luminosity of 1.0 fb$^{-1}$, collected by the LHCb experiment in pp collisions at a centre-of-mass energy of 7 TeV. The following ratios of branching fractions are measured: \\begin{equation*} \\begin{array}{lll} \\dfrac{\\cal{B}(B^0_s\\rightarrow\\chi_{c1}\\phi)}{\\cal{B}(B^0_s\\rightarrow J/\\psi\\phi)} &=& (18.9 \\pm1.8\\,(stat)\\pm1.3\\,(syst)\\pm0.8\\,(\\cal{B})) \\times 10^{-2}, \\\\ \\dfrac{\\cal{B}(B^0\\rightarrow\\chi_{c1}K^{*0})}{\\cal{B}(B^0\\rightarrow J/\\psi K^{*0})} &=& (19.8 \\pm1.1\\,(stat)\\pm1.2\\,(syst)\\pm0.9\\,(\\cal{B})) \\times 10^{-2}, \\\\ \\dfrac{\\cal{B}(B^0\\rightarrow\\chi_{c2}K^{*0})}{\\cal{B}(B^0\\rightarrow\\chi_{c 1}K^{*0})} &=& (17.1 \\pm5.0\\,(stat)\\pm1.7\\,(syst)\\pm1.1\\,(\\cal{B})) \\times 10^{-2}, \\\\ \\end{array} \\end{equation*} where the third uncertainty is due to the limited knowledge o...

The ρ(ω)B*(B) interaction and states of J = 0, 1, 2

Energy Technology Data Exchange (ETDEWEB)

Fernandez-Soler, P.; Sun, Zhi-Feng; Oset, E. [Centro Mixto Universidad de Valencia-CSIC Institutos de Investigacion de Paterna, Departamento de Fisica Teorica and IFIC, Valencia (Spain); Nieves, J. [Centro Mixto Universidad de Valencia-CSIC Institutos de Investigacion de Paterna, IFIC, Valencia (Spain)

2016-02-15

In this work, we study systems composed of a ρ/ω and B* meson pair. We find three bound states in isospin, spin-parity channels (1/2, 0{sup +}), (1/2, 1{sup +}), and (1/2, 2{sup +}). The state with J = 2 can be a good candidate for the B{sub 2}{sup *} (5747). We also study the ρB system, and a bound state with mass 5728 MeV and width around 20 MeV is obtained, which can be identified with the B1(5721) resonance. In the case of I = 3/2, one obtains repulsion and, thus, no exotic (molecular) mesons in this sector are generated in the approach. (orig.)

La influencia del liderazgo sobre el aprendizaje. El papel mediador del contexto organizativo

Directory of Open Access Journals (Sweden)

Susana Pérez López

2012-09-01

Full Text Available En este trabajo se analiza la relación existente entre liderazgo y aprendizaje organizativo. Con apoyo en investigaciones previas, se plantea un modelo cuya premisa básica es que la relación entre ambos conceptos es directa e indirecta, en la medida en que el liderazgo influye sobre el contexto organizativo en que se desarrolla el aprendizaje. El presente modelo teórico ha sido contrastado empíricamente a partir de una muestra de 162 empresas españolas, confirmándose la influencia del liderazgo sobre la cultura organizativa y el desarrollo de las políticas de recursos humanos, factores que, a su vez, influyen sobre el aprendizaje. Sin embargo, la relación directa entre liderazgo y aprendizaje organizativo no se confirma. Las implicaciones del estudio, limitaciones y futuras líneas de investigación son discutidas en el trabajo.

26 CFR 1.167(b)-4 - Other methods.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Other methods. 1.167(b)-4 Section 1.167(b)-4...) INCOME TAXES (CONTINUED) Itemized Deductions for Individuals and Corporations § 1.167(b)-4 Other methods. (a) Under section 167(b)(4) a taxpayer may use any consistent method of computing depreciation, such...

B1 -sensitivity analysis of quantitative magnetization transfer imaging.

Science.gov (United States)

Boudreau, Mathieu; Stikov, Nikola; Pike, G Bruce

2018-01-01

To evaluate the sensitivity of quantitative magnetization transfer (qMT) fitted parameters to B 1 inaccuracies, focusing on the difference between two categories of T 1 mapping techniques: B 1 -independent and B 1 -dependent. The B 1 -sensitivity of qMT was investigated and compared using two T 1 measurement methods: inversion recovery (IR) (B 1 -independent) and variable flip angle (VFA), B 1 -dependent). The study was separated into four stages: 1) numerical simulations, 2) sensitivity analysis of the Z-spectra, 3) healthy subjects at 3T, and 4) comparison using three different B 1 imaging techniques. For typical B 1 variations in the brain at 3T (±30%), the simulations resulted in errors of the pool-size ratio (F) ranging from -3% to 7% for VFA, and -40% to > 100% for IR, agreeing with the Z-spectra sensitivity analysis. In healthy subjects, pooled whole-brain Pearson correlation coefficients for F (comparing measured double angle and nominal flip angle B 1 maps) were ρ = 0.97/0.81 for VFA/IR. This work describes the B 1 -sensitivity characteristics of qMT, demonstrating that it varies substantially on the B 1 -dependency of the T 1 mapping method. Particularly, the pool-size ratio is more robust against B 1 inaccuracies if VFA T 1 mapping is used, so much so that B 1 mapping could be omitted without substantially biasing F. Magn Reson Med 79:276-285, 2018. © 2017 International Society for Magnetic Resonance in Medicine. © 2017 International Society for Magnetic Resonance in Medicine.

Actividad inhibitoria del aceite esencial de Lippia origanoides H.B.K sobre el crecimiento de Phytophthora infestans

Directory of Open Access Journals (Sweden)

óscar Arango Bedoya

2015-04-01

Full Text Available Phytophthora infestans (Mont. de Bary es el fitopatógeno más perjudicial de la papa (Solanum tuberosum al causar la enfermedad conocida como ‘gota o tizón tardío’. El objetivo de este trabajo fue evaluar la actividad in vitro del aceite esencial obtenido de una especie de orégano silvestre (Lippia origanoides H.B.K. sobre Phytophthora infestans. Para el efecto se evaluaron diferentes concentraciones de este aceite esencial (10, 50, 100, 150, 200, 250 µg/ml y de un fungicida comercial usado como testigo. La actividad antifúngica se determinó con base en la evaluación del crecimiento del micelio mediante el método de dilución en agar tomate. A partir de una concentración de aceite de 150 µg/ml se inhibió completamente el crecimiento del patógeno, por lo que ésta fue considerada como la concentración letal. Este estudio demostró que el aceite esencial de orégano silvestre del Alto Patía, Colombia, es un potencial agente antifúngico que podría ser usado en sistemas de control integrado de P. infestans.

B1 to B2 structural phase transition in LiF under pressure

Science.gov (United States)

Jain, Aayushi; Dixit, R. C.

2018-05-01

In the last few decades the alkali halides emerged as crystals with useful applications and their high-pressure behaviour is the most intensively studied subject in high-pressure physics/chemistry, material science, and geosciences. Most alkali halides follow the B1 (NaCl-type)→B2 (CsCl-type) phase-transition route under pressure. In the present paper, we have investigated the characteristics of structural phase transition that occurred in Lithium Florid compound under high pressure. The transition pressure of B1-B2 was calculated using an effective interionic interaction potential (EIOP). The changes of the characteristics of crystals like, Gibbs free energy, cohesive energy, volume collapse, and lattice constant are calculated for the B1 and B2 structures. These data were compared with the available experimental and theoretical data.

Efecto de la fertilización sobre la calidad de la papa para procesamiento en dos suelos antioqueños con propiedades ándicas

Directory of Open Access Journals (Sweden)

Palacios B. Carlos A.

2008-12-01

Full Text Available

En este estudio se evaluó el efecto de tres niveles de NPK a la siembra (500, 1.500 y 3.000 kg•ha^-1 en combinación con Ca (0, 2, 3 y 7 meq•100g^-1 , Mg (0; 0,7; 1,4 y 3,0 meq•100g^-1, B (0; 0,5; 1,0 y 2,0 ppm y S (0, 10, 20 y 40 ppm sobre el contenido de azúcares reductores y la gravedad específica de la papa variedad Diacol Capiro, en dos tipos de suelo. Se utilizó un diseño central compuesto 3×2×3×2 para el nivel de 1.500 kg•ha^-1 y 2×2×2×2 para los niveles de 500 y 3.000 kg•ha^-1 . La fertilización con 500 kg•ha^-1 de NPK presentó en ambos suelos los mejores resultados para gravedad específica. En el suelo de Santa Rosa los niveles de 1.500 kg•ha^-1 y 3.000 kg•ha^-1 no mostraron diferencias estadísticas para los azúcares reductores con valores promedio de 0,750 y 0,631, respectivamente; el nivel de 500 kg•ha^-1 presentó un promedio de 0,918. En el suelo de La Unión esta variable no presentó diferencias estadísticas en los niveles NPK evaluados. Los niveles de Ca, Mg, B y S no tuvieron un efecto estadísticamente significativo sobre la gravedad específica ni sobre el contenido de azúcares reductores de los tubérculos.

Papel de la angiotensina-(1-7 sobre la recaptación neuronal de noradrenalina en la hipertensión

Directory of Open Access Journals (Sweden)

Mariela M. Gironacci

2010-01-01

Full Text Available RESUMENPreviamente demostramos que la angiotensina (Ang-(1-7, en contraste con la Ang II, disminuyela liberación y la síntesis de noradrenalina (NA en ratas espontáneamentehipertensas (SHR. En el presente trabajo investigamos en ratas SHR el efecto de la Ang-(1-7 sobre la recaptación neuronal y la expresión del transportador de NA (NET, principalresponsable de la eliminación de NA del espacio sináptico. Si bien la Ang-(1-7 no presentaun efecto agudo sobre la recaptación neuronal de noradrenalina, tiene un papel estimuladorsobre el contenido proteico del NET a largo plazo. Esta acción la ejerce a través de laestimulación de la síntesis proteica de novo del transportador por la activación del receptorMas. Esto sugeriría que, a través de la regulación de los niveles de NA en el espacio sináptico,la Ang-(1-7 contribuiría a la regulación de la presión arterial.REV ARGENT CARDIOL 2010;78:151-155.

Hydroxysteroid sulfotransferase SULT2B1b promotes hepatocellular carcinoma cells proliferation in vitro and in vivo.

Directory of Open Access Journals (Sweden)

Xiaoming Yang

Full Text Available Hydroxysteroid sulfotransferase 2B1b (SULT2B1b is highly selective for the addition of sulfate groups to 3β-hydroxysteroids. Although previous reports have suggested that SULT2B1b is correlated with cell proliferation of hepatocytes, the relationship between SULT2B1b and the malignant phenotype of hepatocarcinoma cells was not clear. In the present study, we found that SULT2B1 was comparatively higher in the human hepatocarcinoma tumorous tissues than their adjacent tissues. Besides, SULT2B1b overexpression promoted the growth of the mouse hepatocarcinoma cell line Hepa1-6, while Lentivirus-mediated SULT2B1b interference inhibited growth as assessed by the CCK-8 assay. Likewise, inhibition of SULT2B1b expression induced cell-cycle arrest and apoptosis in Hepa1-6 cells by upregulating the expression of FAS, downregulating the expression of cyclinB1, BCL2 and MYC in vitro and in vivo at both the transcript and protein levels. Knock-down of SULT2B1b expression significantly suppressed tumor growth in nude mouse xenografts. Moreover, proliferation rates and SULT2B1b expression were highly correlated in the human hepatocarcinoma cell lines Huh-7, Hep3B, SMMC-7721 and BEL-7402 cells. Knock-down of SULT2B1b inhibited cell growth and cyclinB1 levels in human hepatocarcinoma cells and suppressed xenograft growth in vivo. In conclusion, SULT2B1b expression promotes proliferation of hepatocellular carcinoma cells in vitro and in vivo, which may contribute to the progression of HCC.

Digital signage sobre IP

OpenAIRE

Casademont Filella, Albert

2012-01-01

Projecte que versa sobre el disseny i la implementació d'un sistema de Digital Signage (Cartelleria Digital) sobre IP, creant un gestor que permeti controlar de forma remota tot un conjunt de petits dispositius connectats a pantalles que emeten continguts multimèdia com vídeos, imatges, feeds rss...

Efeito da administração de propileno glicol e cobalto associado à vitamina B12 sobre o perfil metabólico e a atividade enzimática de ovelhas da raça Santa Inês no periparto

Directory of Open Access Journals (Sweden)

Rogério Adriano dos Santos

2012-12-01

Full Text Available O presente estudo teve por objetivo avaliar a influência da administração de propileno glicol e cobalto associado à vitamina B12 sobre o perfil metabólico e a atividade enzimática de ovelhas da raça Santa Inês no período do periparto. Foram utilizadas 18 ovelhas prenhes, pesando em torno de 40kg. Aproximadamente 30 dias antes da data prevista para o parto foram separadas de maneira aleatória em três grupos e administrados os suplementos conforme a seguir: (G1/n=6 grupo que recebeu propileno glicol (30mL por via oral diariamente; (G2/n=6 grupo que recebeu cobalto (1mg de cloreto de cobalto a 1%, via oral diariamente associado a vitamina B12 (2mg via intramuscular, semanalmente e (G3/n=6 grupo controle. As amostras de sangue das ovelhas para avaliação do perfil metabólico e enzimático (glicose, β-hidroxibutirato-BHB, NEFA, proteína total, albumina, uréia, creatinina, AST, GGT, FA e CK foram colhidas 30 dias antes da data prevista para o parto, uma semana antes (ante-parto, no parto, às 24h, 72h, 5 dias, 15 dias e 30 dias após o parto. Não foi observado cetonúria nos momentos que antecederam ao parto. A administração dos suplementos não influenciou sobre o perfil metabólico, protéico e energético, assim como não houve comprometimento hepático das ovelhas no período do periparto.

Cyclophilin B enhances HIV-1 infection.

Science.gov (United States)

DeBoer, Jason; Madson, Christian J; Belshan, Michael

2016-02-01

Cyclophilin B (CypB) is a member of the immunophilin family and intracellular chaperone. It predominantly localizes to the ER, but also contains a nuclear localization signal and is secreted from cells. CypB has been shown to interact with the Gag protein of human immunodeficiency type 1 (HIV-1). Several proteomic and genetic studies identified it as a potential factor involved in HIV replication. Herein, we show that over-expression of CypB enhances HIV infection by increasing nuclear import of viral DNA. This enhancement was unaffected by cyclosporine treatment and requires the N-terminus of the protein. The N-terminus contains an ER leader sequence, putative nuclear localization signal, and is required for secretion. Deletion of the N-terminus resulted in mislocalization from the ER and suppression of HIV infection. Passive transfer experiments showed that secreted CypB did not impact HIV infection. Combined, these experiments show that intracellular CypB modulates a pathway of HIV nuclear import. Copyright © 2015 Elsevier Inc. All rights reserved.

MR fingerprinting with simultaneous B1 estimation.

Science.gov (United States)

Buonincontri, Guido; Sawiak, Stephen J

2016-10-01

MR fingerprinting (MRF) can be used for quantitative estimation of physical parameters in MRI. Here, we extend the method to incorporate B1 estimation. The acquisition is based on steady state free precession MR fingerprinting with a Cartesian trajectory. To increase the sensitivity to the B1 profile, abrupt changes in flip angle were introduced in the sequence. Slice profile and B1 effects were included in the dictionary and the results from two- and three-dimensional (3D) acquisitions were compared. Acceleration was demonstrated using retrospective undersampling in the phase encode directions of 3D data exploiting redundancy between MRF frames at the edges of k-space. Without B1 estimation, T2 and B1 were inaccurate by more than 20%. Abrupt changes in flip angle improved B1 maps. T1 and T2 values obtained with the new MRF methods agree with classical spin echo measurements and are independent of the B1 field profile. When using view sharing reconstruction, results remained accurate (error Reson Med 76:1127-1135, 2016. © 2015 The Authors Magnetic Resonance in Medicine published by Wiley Periodicals, Inc. on behalf of International Society for Magnetic Resonance in Medicine. This is an open access article under the terms of the Creative Commons Attribution-NonCommercial-NoDerivs License, which permits use and distribution in any medium, provided the original work is properly cited, the use is non-commercial and no modifications or adaptations are made. © 2015 The Authors Magnetic Resonance in Medicine published by Wiley Periodicals, Inc. on behalf of International Society for Magnetic Resonance in Medicine.

Efeito da ingestão de fumonisina B1 no peso corporal e na histopatologia de codornas japonesas (Coturnix coturnix japonica Effect of fumonisin B1 on body weight and histopathology of Japanese quail (Coturnix coturnix japonica

Directory of Open Access Journals (Sweden)

Carlos Augusto Fernandes Oliveira

2007-02-01

Full Text Available O objetivo do presente trabalho foi estudar o efeito da fumonisina B1 (FB1 sobre o peso corpóreo e as vísceras (fígado, rim e coração de codorna poedeira japonesa (Coturnix coturnix japonica, devido ao escasso dado toxicológico nesta espécie. Quatro grupos, sendo cada um constituído de 32 codornas de linhagem comercial, receberam ração contendo FB1 nas concentrações de 0 (controle, 10, 50 e 250mg kg-1, durante 28 dias. Observou-se uma redução (P0,05, porém as aves do grupo 50 e 250mg kg-1 apresentaram aumento no peso relativo de fígado (PThis research was aimed at evaluating the effect of fumonisin B1 (FB1 on body weight and viscera (liver, kidney and heart of laying Japanese quail (Coturnix coturnix japonica, due to the little toxicological data on this species. Four experimental groups of 32 commercial quails were designed and exposed to ingestion test with feed containing 0 (controls, 10, 50 or 250mg FB1 kg-1 feed, during 28 days. Birds of group 250mg FB1 kg-1 showed lower body weight (P0.05 among treatments. However, the relative weight of liver increased (P<0.05 in quail of groups received 50 and 250mg FB1/kg. Histological changes were observed only in the liver of groups receiving 50 and 250mgFB1 kg-1, which caused moderate biliary duct hyperplasia and multiple foci of hepatic necrosis. The data indicated that AFB1 at levels above 50mg kg-1 in laying Japanese quail.

DHU1 negatively regulates UV-B signaling via its direct interaction with COP1 and RUP1.

Science.gov (United States)

Kim, Sang-Hoon; Kim, Hani; Chung, Sunglan; Lee, Jae-Hoon

2017-09-16

Although DWD HYPERSENSITIVE TO UV-B 1 (DHU1) is reported to be a negative regulator in UV-B mediated cellular responses, its detailed role in UV-B signaling is still elusive. To further understand the action mechanism of DHU1 in UV-B response, physical and genetic interactions of DHU1 with various UV-B signaling components were investigated. Yeast two hybrid assay results suggested that DHU1 directly interacts with COP1 and RUP1, implying a functional connection with both COP1 and RUP1. In spite of the physical association between DHU1 and COP1, loss of DHU1 did not affect protein stability of COP1. Epistatic analysis showed that the functional loss of both DHU1 and UVR8 leads to alleviation of UV-B hypersensitivity displayed in dhu1-1. Moreover, phenotypic studies with dhu1-1 cop1-6 and dhu1-1 hy5-215 revealed that COP1 and HY5 are epistatic to DHU1, indicating that UV-B hypersensitivity of dhu1-1 requires both COP1 and HY5. In the case of dhu1-1 rup1-1, UV-B responsiveness was similar to that of both dhu1-1 and rup1-1, implying that DHU1 and RUP1 are required for each other's function. Collectively, these results show that the role of DHU1 as a negative regulator in UV-B response may be derived from its direct interaction with COP1 by sequestering COP1 from the active UVR8-COP1 complex, resulting in a decrease in the COP1 population that positively participates in UV-B signaling together with UVR8. Furthermore, this inhibitory role of DHU1 in UV-B signaling is likely to be functionally connected to RUP1. This study will serve as a platform to further understand more detailed action mechanism of DHU1 in UV-B response and DHU1-mediated core UV-B signaling in Arabidopsis. Copyright © 2017 Elsevier Inc. All rights reserved.

Characterization of hERG1a and hERG1b potassium channels-a possible role for hERG1b in the I (Kr) current

DEFF Research Database (Denmark)

Larsen, Anders Peter; Olesen, Søren-Peter; Grunnet, Morten

2008-01-01

I (Kr) is the fast component of the delayed rectifier potassium currents responsible for the repolarization of the cardiac muscle. The molecular correlate underlying the I (Kr) current has been identified as the hERG1 channel. Recently, two splice variants of the hERG1 alpha-subunit, hERG1a and hERG......1b, have been shown to be co-expressed in human cardiomyocytes. In this paper, we present the electrophysiological characterization of hERG1a, hERG1b, and co-expressed hERG1a/b channels in a mammalian expression system using the whole-cell patch clamp technique. We also quantified the messenger RNA...... (mRNA) levels of hERG1a and hERG1b in human cardiac tissue, and based on the expressed ratios, we evaluated the resulting currents in Xenopus laevis oocytes. Compared to hERG1a channels, activation was faster for both hERG1b and hERG1a/b channels. The deactivation kinetics was greatly accelerated...

Caged xanthones displaying protein tyrosine phosphatase 1B (PTP1B) inhibition from Cratoxylum cochinchinense.

Science.gov (United States)

Li, Zuo Peng; Lee, Hyeong-Hwan; Uddin, Zia; Song, Yeong Hun; Park, Ki Hun

2018-08-01

Four new caged xanthones (1-4) and two known compounds (5, 6) were isolated from the roots of Cratoxylum cochinchinense, a polyphenol rich plant, collected in China. The structures of the isolated compounds (1-6) were characterized by obtaining their detailed spectroscopic data. In particular, compounds 1 and 6 were fully identified by X-ray crystallographic data. The isolated compounds (1-6) were evaluated against protein tyrosine phosphatase 1B (PTP1B), which plays an important role in diabetes, obesity, and cancer. Among these compounds, 3, 4, and 6 displayed significant inhibition with IC 50 values of 76.3, 43.2, and 6.6 µM, respectively. A detailed kinetic study was conducted by determining K m , V max , and the ratio of K ik and K iv , which revealed that all the compounds behaved as competitive inhibitors. Copyright © 2018 Elsevier Inc. All rights reserved.

Use of radiolabeled monoclonal anti-B1 antibody for B lymphocyte imaging in Rhesus monkeys

International Nuclear Information System (INIS)

Letvin, N.L.; Zalutsky, M.R.; Chalifoux, L.V.; Atkins, H.L.

1987-01-01

Imaging tissues rich in B lymphocytes in man using a radiolabeled monoclonal anti-B cell antibody would be extremely useful in the clinical staging of non-Hodgkins lymphomas. Studies were done in rhesus monkeys using radiolabeled monoclonal anti-B1 antibody to determine the feasibility of such an approach. Immunohistologic studies demonstrated that infused monoclonal anti-B1 binds in vivo with specificity to B cells in lymph nodes and spleen. The kinetics of clearance of 131 I-labeled anti-B1 were determined. The B lymphocyte-rich spleen could be readily visualized by gamma camera scanning without significant background and without the need for image intensification or blood background subtraction techniques. These data support the feasibility of using anti-B1 for staging B cell lymphomas in man. (author)

Reduced expression of APC-1B but not APC-1A by the deletion of promoter 1B is responsible for familial adenomatous polyposis.

Science.gov (United States)

Yamaguchi, Kiyoshi; Nagayama, Satoshi; Shimizu, Eigo; Komura, Mitsuhiro; Yamaguchi, Rui; Shibuya, Tetsuo; Arai, Masami; Hatakeyama, Seira; Ikenoue, Tsuneo; Ueno, Masashi; Miyano, Satoru; Imoto, Seiya; Furukawa, Yoichi

2016-05-24

Germline mutations in the tumor suppressor gene APC are associated with familial adenomatous polyposis (FAP). Here we applied whole-genome sequencing (WGS) to the DNA of a sporadic FAP patient in which we did not find any pathological APC mutations by direct sequencing. WGS identified a promoter deletion of approximately 10 kb encompassing promoter 1B and exon1B of APC. Additional allele-specific expression analysis by deep cDNA sequencing revealed that the deletion reduced the expression of the mutated APC allele to as low as 11.2% in the total APC transcripts, suggesting that the residual mutant transcripts were driven by other promoter(s). Furthermore, cap analysis of gene expression (CAGE) demonstrated that the deleted promoter 1B region is responsible for the great majority of APC transcription in many tissues except the brain. The deletion decreased the transcripts of APC-1B to 39-45% in the patient compared to the healthy controls, but it did not decrease those of APC-1A. Different deletions including promoter 1B have been reported in FAP patients. Taken together, our results strengthen the evidence that analysis of structural variations in promoter 1B should be considered for the FAP patients whose pathological mutations are not identified by conventional direct sequencing.

Protein tyrosine phosphatase-1B (PTP1B) helps regulate EGF-induced stimulation of S-phase entry in human corneal endothelial cells

Science.gov (United States)

Ishino, Yutaka; Zhu, Cheng; Harris, Deshea L.

2008-01-01

Purpose Human corneal endothelial cells (HCEC), particularly from older donors, only proliferate weakly in response to EGF. The protein tyrosine phosphatase, PTP1B, is known to negatively regulate EGF-induced signaling in several cell types by dephosphorylating the epidermal growth factor receptor (EGFR). The current studies were conducted to determine whether PTP1B plays a role in regulating cell cycle entry in HCEC in response to EGF stimulation. Methods Donor corneas were obtained from the National Disease Research Interchange and accepted for study based on established exclusion criteria. PTP1B was localized in the endothelium of ex vivo corneas and in cultured cells by immunocytochemistry. Western blot analysis verified PTP1B protein expression in HCEC and then compared the relative expression of EGFR and PTP1B in HCEC from young (60 years old). The effect of inhibiting the activity of PTP1B on S-phase entry was tested by comparing time-dependent BrdU incorporation in subconfluent HCEC incubated in the presence or absence of the PTP1B inhibitor, CinnGEL 2Me, before EGF stimulation. Results PTP1B was localized in a punctate pattern mainly within the cytoplasm of HCEC in ex vivo corneas and cultured cells. Western blots revealed the presence of three PTP1B-positive bands in HCEC and the control. Further western blot analysis showed no significant age-related difference in expression of EGFR (p=0.444>0.05); however, PTP1B expression was significantly higher in HCEC from older donors (p=0.024<0.05). Pre-incubation of HCEC with the PTP1B inhibitor significantly increased (p=0.019<0.05) the number of BrdU positive cells by 48 h after EGF stimulation. Conclusions Both immunolocalization and western blot studies confirmed that PTP1B is expressed in HCEC. Staining patterns strongly suggest that at least a subset of PTP1B is localized to the cytoplasm and most likely to the endoplasmic reticulum, the known site of EGFR/PTP1B interaction following EGF stimulation. PTP1B

Nutritional changes in powdered red pepper upon in vitro infection of Aspergillus flavus Alterações nutricionais em pimenta vermelha em pó após infecção in vitro com Aspergillus flavus

Directory of Open Access Journals (Sweden)

Smita Tripathi

2009-03-01

Full Text Available Quantitative losses in various biochemical constituents like capsaicin, carotenes, ascorbic acid, polyphenols, mineral matter, sugars (soluble and insoluble, protein and fat were estimated after the successful growth of Aspergillus flavus for 30 days on powdered red pepper. The fungal biomass was measured by ergosterol content and Aflatoxin B1 by HPLC. Amongst the various nutritional constituents evaluated for nutritional losses and changes the highest nutritional loss was reported in total carotenoids (88.55% followed by total sugars (85.5%. The protein content of the infected sample increased from 18.01% to 23%. The nutritional profile of chilli powder (Capsicum annum var. sannam L. shows highest share of total soluble sugars (32.89% and fiber content (21.05%, followed by protein (18.01% and fat (13.32% making it an ideal solid - substrate for mould growth. At the end of incubation the fungal biomass was 192. 25 mg / 100 gram powder, total plate count 17.5 X 10 4 CFU/g and Aflatoxin B1 content was 30.06 µg / kg.Foram avaliadas as perdas de vários constituintes bioquímicos como capsaicina, carotenos, acido ascórbico, polifenóis, matéria orgânica, açucares (solúveis e insolúveis, proteína e gordura em pimenta vermelha em pó após a multiplicação de Aspergillus flavus por 30 dias. A biomassa fúngica foi mensurada pelo conteúdo de ergosterol e aflatoxina por HPLC. Entre os vários constituintes avaliados, a maior perda foi a de carotenóides totais (88,55%, seguido de açucares totais (85,5%. O conteúdo protéico da amostra infectada aumentou de 18,01% para 23%. O perfil nutricional da pimenta em pó (Capsicum annum var. sannam L. indica alto teor de açucares totais (32,89% e fibras (21,05%, seguido de proteína (18,01% e gordura (13,32%, tornando-a um substrato ideal para crescimento de fungos. Ao final dos 30 dias, a biomassa fúngica foi 192,25 mg/100g, a contagem total em placas foi 17,5 x 10(4 CFU/g e o conteúdo de

Human kidney anion exchanger 1 interacts with kinesin family member 3B (KIF3B)

Energy Technology Data Exchange (ETDEWEB)

Duangtum, Natapol [Medical Molecular Biology Unit, Office for Research and Development Faculty of Medicine Siriraj Hospital, Mahidol University, Bangkok 10700 (Thailand); Department of Anatomy, Faculty of Medicine Siriraj Hospital, Mahidol University, Bangkok 10700 (Thailand); Junking, Mutita; Sawasdee, Nunghathai [Medical Molecular Biology Unit, Office for Research and Development Faculty of Medicine Siriraj Hospital, Mahidol University, Bangkok 10700 (Thailand); Cheunsuchon, Boonyarit [Department of Pathology, Faculty of Medicine Siriraj Hospital, Mahidol University, Bangkok 10700 (Thailand); Limjindaporn, Thawornchai, E-mail: limjindaporn@yahoo.com [Department of Anatomy, Faculty of Medicine Siriraj Hospital, Mahidol University, Bangkok 10700 (Thailand); Yenchitsomanus, Pa-thai, E-mail: grpye@mahidol.ac.th [Medical Molecular Biology Unit, Office for Research and Development Faculty of Medicine Siriraj Hospital, Mahidol University, Bangkok 10700 (Thailand)

2011-09-16

Highlights: {yields} Impaired trafficking of kAE1 causes distal renal tubular acidosis (dRTA). {yields} The interaction between kAE1 and kinesin family member 3B (KIF3B) is reported. {yields} The co-localization between kAE and KIF3B was detected in human kidney tissues. {yields} A marked reduction of kAE1 on the cell membrane was observed when KIF3B was knockdown. {yields} KFI3B plays an important role in trafficking of kAE1 to the plasma membrane. -- Abstract: Impaired trafficking of human kidney anion exchanger 1 (kAE1) to the basolateral membrane of {alpha}-intercalated cells of the kidney collecting duct leads to the defect of the Cl{sup -}/HCO{sub 3}{sup -} exchange and the failure of proton (H{sup +}) secretion at the apical membrane of these cells, causing distal renal tubular acidosis (dRTA). In the sorting process, kAE1 interacts with AP-1 mu1A, a subunit of AP-1A adaptor complex. However, it is not known whether kAE1 interacts with motor proteins in its trafficking process to the plasma membrane or not. We report here that kAE1 interacts with kinesin family member 3B (KIF3B) in kidney cells and a dileucine motif at the carboxyl terminus of kAE1 contributes to this interaction. We have also demonstrated that kAE1 co-localizes with KIF3B in human kidney tissues and the suppression of endogenous KIF3B in HEK293T cells by small interfering RNA (siRNA) decreases membrane localization of kAE1 but increases its intracellular accumulation. All results suggest that KIF3B is involved in the trafficking of kAE1 to the plasma membrane of human kidney {alpha}-intercalated cells.

Human kidney anion exchanger 1 interacts with kinesin family member 3B (KIF3B)

International Nuclear Information System (INIS)

Duangtum, Natapol; Junking, Mutita; Sawasdee, Nunghathai; Cheunsuchon, Boonyarit; Limjindaporn, Thawornchai; Yenchitsomanus, Pa-thai

2011-01-01

Highlights: → Impaired trafficking of kAE1 causes distal renal tubular acidosis (dRTA). → The interaction between kAE1 and kinesin family member 3B (KIF3B) is reported. → The co-localization between kAE and KIF3B was detected in human kidney tissues. → A marked reduction of kAE1 on the cell membrane was observed when KIF3B was knockdown. → KFI3B plays an important role in trafficking of kAE1 to the plasma membrane. -- Abstract: Impaired trafficking of human kidney anion exchanger 1 (kAE1) to the basolateral membrane of α-intercalated cells of the kidney collecting duct leads to the defect of the Cl - /HCO 3 - exchange and the failure of proton (H + ) secretion at the apical membrane of these cells, causing distal renal tubular acidosis (dRTA). In the sorting process, kAE1 interacts with AP-1 mu1A, a subunit of AP-1A adaptor complex. However, it is not known whether kAE1 interacts with motor proteins in its trafficking process to the plasma membrane or not. We report here that kAE1 interacts with kinesin family member 3B (KIF3B) in kidney cells and a dileucine motif at the carboxyl terminus of kAE1 contributes to this interaction. We have also demonstrated that kAE1 co-localizes with KIF3B in human kidney tissues and the suppression of endogenous KIF3B in HEK293T cells by small interfering RNA (siRNA) decreases membrane localization of kAE1 but increases its intracellular accumulation. All results suggest that KIF3B is involved in the trafficking of kAE1 to the plasma membrane of human kidney α-intercalated cells.

Results on B physics from UA1

CERN Document Server

Tuominiemi, J

1991-01-01

New result s o n B-physic s fro m th e UA 1 experimen t a t th e CER N proto n -antiproto n collide r ar e reported . The y ar e base d o n th e dat a collecte d i n 1988-89 , correspondin g t o a tota l o f 4. 7 pfcr 1 integrate d luminosity . Th e B°B ° mixin g paramete r X ha s bee n measure d t o b e 0.144±0.037 . Uppe r limit s fo r th e branchin g ratio s o f th e rar e decay s B - » u+u" , B- » u+u"X s an d B d u+u " K* ° hav e bee n determined . Som e result s o n th e searc h fo r th e exclusiv e decay channel s B~>Jyy+K* ° an d B->JA |/-Hj > ar e presented .

Theoretical study of B3-to-B1 phase transition in ZnS

International Nuclear Information System (INIS)

Li, Qiang; Zhang, Rui; Lv, Tianquan; Cao, Qilong

2016-01-01

The pressure-induced phase transformation from B3 to B1 structures in ZnS using first-principle projector-augmented wave method is studied. To understand the nature and driving force behind the transition, the interesting properties in both phases, including enthalpy, phonon dispersion curves and elastic constants, are systematically investigated. The results show that the calculated transition pressure is within the range of 16.33 GPa to 19.04 GPa, which is in good agreement with the available experimental and theoretical data. The transition process can be viewed as the appearance and disappearance of very slight lattice distortion accompanied by the movement of Zn and S atoms along the [111] crystallographic axis. The physical driving force of the B3–B1 phase transition is confirmed to be a coupling effect between the mechanical instability of B3 phase under pressure and the softening acoustic phonon mode resulting from the pressure-induced lattice deformation. For B1 phase, it is further predicted that a new phase transition takes place at about 59.9 GPa. - Highlights: • The phase transformation from B3 to B1 structures in ZnS is studied using first-principle method. • The predicted transition pressure is within the range of 16.33 to 19.04 GPa. • The transition process can be viewed as the appearance and disappearance of very slight lattice distortion. • Physical driving force of the transition is a coupling effect between the mechanical instability and softening phonon. • For B1 phase, it is further predicted that a new phase transition takes place at about 59.9 GPa.

ENDF/B-VII.1 versus ENDF/B-VII.0: What's Different?

International Nuclear Information System (INIS)

Cullen, D.E.

2012-01-01

Recently the new ENDF/B-VII.1 library was released; this completely replaces the earlier ENDF/B-VII.0 library. One of the first questions we ask about a new library is: What's Different? Here I attempt to at least partially answer this question. I present results in both tabulated form (so you can quickly determine if any evaluations of interest to you have changed), and graphic form (so that you can see how much evaluations have changed and in what energy ranges). For the table I have compared what I refer to as the ENDF neutron data, namely MF=1 through 6. Here I did a character-by-character comparison of the same sections (MF/MT) that appear I both ENDF/B-VII.0 and VII.1; here I found differences in 170 evaluations. For the plots I have only compared the total cross sections for all evaluations that are common to both libraries, and I found that of the 423 evaluations in ENDF/B-VII.1, 120 of these have total cross sections that differ by 1% or more from the evaluation of the same isotope in ENDF/B-VII.0. This should be considered only a preliminary comparison; obviously there can be more subtle important differences that do not effect of total cross sections. Here I present plots comparing the total cross section of these 120 isotopes. The plots are only broad overviews of the total cross sections over their entire energy range. If you have interest in more detailed plots for specific evaluations, you can download the evaluations (1,2) and the PREPRO (3) codes I used to prepare and view the data. This is all I needed to do my comparisons, and is all you should need to do any more detailed comparisons to meet your individual needs.

18 CFR 1b.21 - Enforcement hotline.

Science.gov (United States)

2010-04-01

... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Enforcement hotline. 1b.21 Section 1b.21 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION... shall be treated as non-public by the Commission and its staff, consistent with the provisions of...

Assessment of human exposure to fumonisin B1

NARCIS (Netherlands)

Nijs, M. de; Egmond, H.P. van; Nauta, M.; Rombouts, F.M.; Notermans, S.H.W.

1998-01-01

Fumonisin B1 is currently regarded as the most significant mycotoxin produced by Fusarium spp. It has carcinogenic properties and may play a role in the etiology of human esophageal cancer. The human population is exposed to fumonisin B1 primarily by intake of fumonisin B1-contaminated maize. Maize

Characteristics of stably expressed human dopamine D1a and D1b receptors: atypical behavior of the dopamine D1b receptor

DEFF Research Database (Denmark)

Pedersen, U B; Norby, B; Jensen, Anders A.

1994-01-01

Human dopamine D1a and D1b receptors were stably expressed in Baby Hamster Kidney (BHK) or Chinese Hamster Ovary (CHO) cells. [3H]SCH23390 saturation experiments indicated the presence of only a single binding site in the D1a expressing cell line with a Kd of 0.5 nM. In D1b expressing cell lines...

Inferencias sobre Grafos

OpenAIRE

Sira M. Allende; Carlos N. Bouza

2002-01-01

El estudio de un juego puede ser modelado asumiendo que solo algunas partidas son observadas. Entonces el árbol del juego debe ser estimado utilizando información muestral. Similarmente ocurre al obtener información sobre el comportamiento de las decisiones tomadas por individuos muestreados sobre un árbol de decisión teórico. Al considerar una medida de probabilidad que caracterice el comportamiento de redes aleatorias se puede obtener un estimado del árbol asociado. Este problema es el anal...

Algumas anedotas sobre Demóstenes: uma releitura

Directory of Open Access Journals (Sweden)

Maddalena Vallozza

2013-06-01

Full Text Available Muitas das anedotas sobre Demóstenes estão relacionados a seus problemas de voz e a suas dificuldades no momento da hypokrisis. Eu proponho uma reinterpretação das páginas em que eles nos são transmitidos: de Quintiliano (11, 3, a principal testemunha, a Cícero (Orator 26 e 56-58, Brutus 142, De Oratore I 261 e III 213, do autor da seção sobre Demóstenes nas Vidas dos Dez Oradores (844 d-845 b à Vida de Demóstene, de Plutarco. Com base nisso, particularmente graças a Plutarco, que cita Hermipo e Demétrio de Fáleros, é possível formular a hipótese de que a tradição nasceu no Perípato, na área de interesses pela hypokrisis que demonstram o perdido Perì hypokríseos de Teofrasto e os fragmentos da Retórica de Demétrio de Fáleros.

Clinical Trial Assessing the Efficacy of Gabapentin Plus B Complex (B1/B12 versus Pregabalin for Treating Painful Diabetic Neuropathy

Directory of Open Access Journals (Sweden)

Alberto Mimenza Alvarado

2016-01-01

Full Text Available Introduction. Painful diabetic neuropathy (PDN is a prevalent and impairing disorder. The objective of this study was to show the efficacy and safety of gabapentin (GBP plus complex B vitamins: thiamine (B1 and cyanocobalamine (B12 compared to pregabalin in patients with moderate to severe intensity PDN. Method. Multicenter, randomized, blind study. Two hundred and seventy patients were evaluated, 147 with GBP/B1/B12 and 123 with PGB, with a 7/10 pain intensity on the Visual Analog Scale (VAS. Five visits (12 weeks were scheduled. The GBP/B1 (100 mg/B12 (20 mg group started with 300 mg at visit 1 to 3600 mg at visit 5. The PGB group started with 75 mg/d at visit 1 to 600 mg/d at visit 5. Different safety and efficacy scales were applied, as well as adverse event assessment. Results. Both drugs showed reduction of pain intensity, without significant statistical difference (P=0.900. In the GBP/B1/B12 group, an improvement of at least 30% on VAS correlated to a 900 mg/d dose, compared with PGB 300 mg/d. Likewise, occurrence of vertigo was lower in the GBP/B1-B12 group, with a significant statistical difference, P=0.014. Conclusions. Our study shows that GPB/B1-B12 combination is as effective as PGB. Nonetheless, pain intensity reduction is achieved with 50% of the minimum required gabapentin dose alone (800 to 1600 mg/d in classic NDD trials. Less vertigo and dizziness occurrence was also observed in the GBP/B1/B12 group. This trial is registered with ClinicalTrials.gov NCT01364298.

EBI2 overexpression in mice leads to B1 B-cell expansion and chronic lymphocytic leukemia-like B-cell malignancies.

Science.gov (United States)

Niss Arfelt, Kristine; Barington, Line; Benned-Jensen, Tau; Kubale, Valentina; Kovalchuk, Alexander L; Daugvilaite, Viktorija; Christensen, Jan Pravsgaard; Thomsen, Allan Randrup; Egerod, Kristoffer L; Bassi, Maria R; Spiess, Katja; Schwartz, Thue W; Wang, Hongsheng; Morse, Herbert C; Holst, Peter J; Rosenkilde, Mette M

2017-02-16

Human and mouse chronic lymphocytic leukemia (CLL) develops from CD5 + B cells that in mice and macaques are known to define the distinct B1a B-cell lineage. B1a cells are characterized by lack of germinal center (GC) development, and the B1a cell population is increased in mice with reduced GC formation. As a major mediator of follicular B-cell migration, the G protein-coupled receptor Epstein-Barr virus-induced gene 2 ( EBI2 or GPR183 ) directs B-cell migration in the lymphoid follicles in response to its endogenous ligands, oxysterols. Thus, upregulation of EBI2 drives the B cells toward the extrafollicular area, whereas downregulation is essential for GC formation. We therefore speculated whether increased expression of EBI2 would lead to an expanded B1 cell subset and, ultimately, progression to CLL. Here, we demonstrate that B-cell-targeted expression of human EBI2 (hEBI2) in mice reduces GC-dependent immune responses, reduces total immunoglobulin M (IgM) and IgG levels, and leads to increased proliferation and upregulation of cellular oncogenes. Furthermore, hEBI2 overexpression leads to an abnormally expanded CD5 + B1a B-cell subset (present as early as 4 days after birth), late-onset lymphoid cancer development, and premature death. These findings are highly similar to those observed in CLL patients and identify EBI2 as a promoter of B-cell malignancies.

Sampling plan for the analysis of aflatoxin in peanuts and corn: an update Sistema de amostragem para análise de aflatoxinas em amendoim e milho: uma atualização

Directory of Open Access Journals (Sweden)

Homero Fonseca

2002-06-01

Full Text Available The aim of this paper was to update the sampling plan for analysis of mycotoxins in grains, formerly published by the author. The proposed alterations were based on the acquired experience on its application and on FAO recommendations. This update restricts the scope of the former plan and establishes a sampling plan for analysis of aflatoxin in peanuts and corn, by means of modified formulas, the minimum number of sacks or points (when in bulk from which incremental samples should be drawn to make a bulk sample. Fractional exponents (square roots of the formulas proportionally decrease the number of sacks/points to be sampled as the lot size increases. Operating Characteristic (OC curves developed for in-shell and shelled peanuts and corn as well as trend curves of the coefficient variation for different sample sizes (weights are presented.O objetivo deste trabalho foi atualizar a metodologia de amostragem para análise de micotoxinas em grãos, anteriormente publicada pelo autor. As alterações propostas tiveram por base a experiência adquirida na sua utilização e em recomendações da FAO. Esta atualização restringe a aplicação do método anterior e estabelece um plano de amostragem para análise de aflatoxina em amendoim e em milho por meio de fórmulas modificadas, o mínimo de sacos ou pontos (quando a granel dos quais devem ser retiradas amostras incrementais para constituir uma amostra. Expoentes fracionários (raiz quadrada das fórmulas diminuem proporcionalmente o número de sacos/pontos a serem amostrados, à medida que o lote aumenta de tamanho. Curvas de operação característica (OC desenvolvidas para amendoim em casca e descascado e milho, bem como curvas de tendência dos coeficientes de variação, para diferentes tamanhos de amostra (peso, são apresentadas.

Sobre a presença de Sócrates na psicanálise

Directory of Open Access Journals (Sweden)

Anna Carolina Lo Bianco

2001-01-01

Full Text Available Não tendo deixado uma obra escrita, podemos dizer que o pensamento de Sócrates que chega até nós é fundado sobre um ponto básico, central e caro também à experiência psicanalítica: o da presença diante do outro. O artigo examina as características que cercam o exercício do procedimento socrático, ressaltando o impacto que ele tem sobre o interlocutor. Procura, em seguida, tomar a sua riqueza de princípios para ver, com as lentes da própria psicanálise, em que estes oferecem algumas condições de possibilidade para o melhor desenvolvimento de suas formulações.

Sobre software libre

OpenAIRE

Matellán Olivera, Vicente; González Barahona, Jesús; Heras Quirós, Pedro de las; Robles Martínez, Gregorio

2004-01-01

220 p. "Sobre software libre" reune casi una treintena de ensayos sobre temas de candente actualidad relacionados con el software libre (del cual Linux es su ex- ponente más conocido). Los ensayos que el lector encontrará están divididos en bloques temáticos que van desde la propiedad intelectual o las cuestiones económicas y sociales de este modelo hasta su uso en la educación y las administraciones publicas, pasando por alguno que repasa la historia del software libre en l...

Amino methylation of 2-R-6-R_1-imidazo-[2.1-B]-1.3.4-thiadiazole

International Nuclear Information System (INIS)

Saidov, D.K.; Rakhmonov, R.O.; Khodzhiboev, Yu.; Kukaniev, M.A.; Bandaev, S.

2015-01-01

Present article is devoted to amino methylation of 2-R-6-R_1-imidazo-[2.1-B]-1.3.4-thiadiazole. The reaction of new modifications of derivatives of imidazo-[2.1-B]-1.3.4-thiadiazoles-2-bromine-6-p-bromophenyl and 2-alkyl alkylene sulfonyl-6-phenyl imidazo--[2.1-B]-1.3.4-thiadiazole on Mannich with secondary and heterocyclic amines was studied.

PTP1B targets the endosomal sorting machinery

DEFF Research Database (Denmark)

Stuible, Matthew; Abella, Jasmine V; Feldhammer, Matthew

2010-01-01

Dephosphorylation and endocytic down-regulation are distinct processes that together control the signaling output of a variety of receptor tyrosine kinases (RTKs). PTP1B can directly dephosphorylate several RTKs, but it can also promote activation of downstream pathways through largely unknown...... mechanisms. These positive signaling functions likely contribute to the tumor-promoting effect of PTP1B in mouse cancer models. Here, we have identified STAM2, an endosomal protein involved in sorting activated RTKs for lysosomal degradation, as a substrate of PTP1B. PTP1B interacts with STAM2 at defined...... phosphotyrosine sites, and knockdown of PTP1B expression augments STAM2 phosphorylation. Intriguingly, manipulating the expression and phosphorylation state of STAM2 did not have a general effect on epidermal growth factor (EGF)-induced EGF receptor trafficking, degradation, or signaling. Instead, phosphorylated...

Efecto de la temperatura sobre películas de un aislado proteico del suero bovino (WPI adsorbidas sobre la interfase aceite-agua

Directory of Open Access Journals (Sweden)

Rodríguez Patino, Juan M.

2002-09-01

ómetro dinámico de gota, en unión de la observación microscópica y posterior análisis de la imagen de una gota que tiene adsorbida a la proteína sobre su superficie. Las variables estudiadas fueron la temperatura (en el intervalo comprendido entre 20 y 80 ºC y la concentración de proteína en el seno de la fase acuosa (en el intervalo comprendido entre 1.10-1 y 1.10-5% en peso. Durante el tratamiento térmico, (a la película de WPI presenta un comportamiento viscoelástico, con un ángulo de fase distinto de cero, (b se incrementa el carácter elástico de la interfase, (c se produce un incremento del módulo dilatacional superficial (E y (d una disminución de la tensión interfacial. La variación de E con el tiempo puede cuantificarse mediante ecuaciones de primer orden que pueden relacionarse con dos mecanismos cinéticos, asociados con la gelificación de WPI sobre la interfase aceite-agua. El tratamiento térmico produce cambios irreversibles en la película de WPI adsorbida sobre la interfase. Se han observado cambios significativos en las características interfaciales y en la imagen de la gota a concentraciones de proteína tan bajas como 1.10-5% en peso.

ARID1B is a specific vulnerability in ARID1A-mutant cancers.

Science.gov (United States)

Helming, Katherine C; Wang, Xiaofeng; Wilson, Boris G; Vazquez, Francisca; Haswell, Jeffrey R; Manchester, Haley E; Kim, Youngha; Kryukov, Gregory V; Ghandi, Mahmoud; Aguirre, Andrew J; Jagani, Zainab; Wang, Zhong; Garraway, Levi A; Hahn, William C; Roberts, Charles W M

2014-03-01

Recent studies have revealed that ARID1A, encoding AT-rich interactive domain 1A (SWI-like), is frequently mutated across a variety of human cancers and also has bona fide tumor suppressor properties. Consequently, identification of vulnerabilities conferred by ARID1A mutation would have major relevance for human cancer. Here, using a broad screening approach, we identify ARID1B, an ARID1A homolog whose gene product is mutually exclusive with ARID1A in SWI/SNF complexes, as the number 1 gene preferentially required for the survival of ARID1A-mutant cancer cell lines. We show that loss of ARID1B in ARID1A-deficient backgrounds destabilizes SWI/SNF and impairs proliferation in both cancer cells and primary cells. We also find that ARID1A and ARID1B are frequently co-mutated in cancer but that ARID1A-deficient cancers retain at least one functional ARID1B allele. These results suggest that loss of ARID1A and ARID1B alleles cooperatively promotes cancer formation but also results in a unique functional dependence. The results further identify ARID1B as a potential therapeutic target for ARID1A-mutant cancers.

EBI2 overexpression in mice leads to B1 B cell expansion and chronic lymphocytic leukemia-(CLL)-like B cell malignancies

DEFF Research Database (Denmark)

Niss Arfelt, Kristine; Barington, Line; Benned-Jensen, Tau

2017-01-01

-targeted expression of human EBI2 in mice reduces germinal center-dependent immune responses, reduces total IgM and IgG levels, and leads to increased proliferation and upregulation of cellular oncogenes. Furthermore, hEBI2 overexpression leads to an abnormally expanded CD5+ B1a B cell subset present as early as 4......Human and mouse chronic lymphocytic leukemia (CLL) develop from CD5+ B cells that in mice and macaques are known to define the distinct B1a B cell lineage. B1a cells are characterized by lack of germinal center development and the B1a cell population is increased in mice with reduced germinal...... cells towards the extrafollicular area, whereas downregulation is essential for germinal center formation. We therefore speculated whether increased expression of EBI2 would lead to an expanded B1 cell subset and, ultimately, progression to chronic lymphocytic leukemia. Here we demonstrate that B cell...

Attenuated stress response to acute restraint and forced swimming stress in arginine vasopressin 1b receptor subtype (Avpr1b) receptor knockout mice and wild-type mice treated with a novel Avpr1b receptor antagonist.

Science.gov (United States)

Roper, J A; Craighead, M; O'Carroll, A-M; Lolait, S J

2010-11-01

Arginine vasopressin (AVP) synthesised in the parvocellular region of the hypothalamic paraventricular nucleus and released into the pituitary portal vessels acts on the 1b receptor subtype (Avpr1b) present in anterior pituitary corticotrophs to modulate the release of adrenocorticotrophic hormone (ACTH). Corticotrophin-releasing hormone is considered the major drive behind ACTH release; however, its action is augmented synergistically by AVP. To determine the extent of vasopressinergic influence in the hypothalamic-pituitary-adrenal axis response to restraint and forced swimming stress, we compared the stress hormone levels [plasma ACTH in both stressors and corticosterone (CORT) in restraint stress only] following acute stress in mutant Avpr1b knockout (KO) mice compared to their wild-type controls following the administration of a novel Avpr1b antagonist. Restraint and forced swimming stress-induced increases in plasma ACTH were significantly diminished in mice lacking a functional Avpr1b and in wild-type mice that had been pre-treated with Avpr1b antagonist. A corresponding decrease in plasma CORT levels was also observed in acute restraint-stressed knockout male mice, and in Avpr1b-antagonist-treated male wild-type mice. By contrast, plasma CORT levels were not reduced in acutely restraint-stressed female knockout animals, or in female wild-type animals pre-treated with Avpr1b antagonist. These results demonstrate that pharmacological antagonism or inactivation of Avpr1b causes a reduction in the hypothalamic-pituitary-adrenal (HPA) axis response, particularly ACTH, to acute restraint and forced swimming stress, and show that Avpr1b knockout mice constitute a model by which to study the contribution of Avpr1b to the HPA axis response to acute stressors. © 2010 The Authors. Journal of Neuroendocrinology © 2010 Blackwell Publishing Ltd.

Data of evolutionary structure change: 1EP8B-1FAAA [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 1EP8B-1FAAA 1EP8 1FAA B A -------------GGSVIVIDSKAAWDAQLAKGKEEHKP...IVVAFTATWCGPCKMIAPLFETLSNDYAGKVIFLKVDVD-AVAAVAEAAGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAAA LELALGT.../pdbChain> 1FAAA KLDCNQENKTL EEE HHH 1 1FAA A 1FAAA

Tributos sobre a folha ou sobre o faturamento? Efeitos quantitativos para o Brasil

Directory of Open Access Journals (Sweden)

Tiago V Cavalcanti

2008-09-01

Full Text Available Este artigo estuda os impactos alocativos e de bem-estar de uma reforma tributária que substitui os impostos sobre a folha de salários por outro que incide sobre a receita. Para isso, desenvolve-se um modelo neoclássico de crescimento econômico com impostos sobre a receita e sobre a folha de salários. As simulações com parâmetros da economia brasileira mostram que tal reforma tributária tem um efeito negativo no bem-estar, no estoque de capital de longo prazo e consequentemente no produto per capita de longo prazo. Contudo, o emprego aumenta.This paper studies the impacts of a tax reform which substitutes taxes on labor income by taxes on total revenue. In order to accomplish that, we construct and solve a general equilibrium neoclassical growth model with taxes on labor income and total revenue. The numerical simulations with Brazilian parameters show that such tax reforms would negatively affect welfare, the capital stock, and consequently per capita output. However, employment would increase. Such effects are quantitatively important.

Data of evolutionary structure change: 1EP7B-1FAAA [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 1EP7B-1FAAA 1EP7 1FAA B A -------------GGSVIVIDSKAAWDAQLAKGKEEHKP...IVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKVD-VDAVAAVAEAAGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAAA LELALGT...AA A 1FAAA FLKLDCNQENK A 1FAAA VTEVN-KDTFW

Independent System Calibration of Sentinel-1B

Directory of Open Access Journals (Sweden)

Marco Schwerdt

2017-05-01

Full Text Available Sentinel-1B is the second of two C-Band Synthetic Aperture Radar (SAR satellites of the Sentinel-1 mission, launched in April 2016—two years after the launch of the first satellite, Sentinel-1A. In addition to the commissioning of Sentinel-1B executed by the European Space Agency (ESA, an independent system calibration was performed by the German Aerospace Center (DLR on behalf of ESA. Based on an efficient calibration strategy and the different calibration procedures already developed and applied for Sentinel-1A, extensive measurement campaigns were executed by initializing and aligning DLR’s reference targets deployed on the ground. This paper describes the different activities performed by DLR during the Sentinel-1B commissioning phase and presents the results derived from the analysis and the evaluation of a multitude of data takes and measurements.

Uma Nota Sobre o Papel da Credibilidade da Política Monetária e Fiscal: Evidências para o Brasil

Directory of Open Access Journals (Sweden)

Gabriel Caldas Montes

2014-12-01

Full Text Available Este estudo analisa: (i a influência das reputações do Banco Central do Brasil e do governo e da credibilidade de suas políticas sobre o comportamento da taxa básica de juros, e o impacto das medidas de gerenciamento da dívida pública e do cenário macroeconômico sobre a taxa de juros; (ii a influência da política monetária e do ambiente macroeconômico sobre o comportamento do consumo das famílias pelo canal do crédito. Os resultados sugerem que os ganhos de credibilidade e reputação monetária e fiscal foram importantes para explicar a trajetória da taxa básica de juros e o spread de crédito, influenciando o comportamento do consumo das famílias.

TIM-1 signaling in B cells regulates antibody production

International Nuclear Information System (INIS)

Ma, Juan; Usui, Yoshihiko; Takeda, Kazuyoshi; Harada, Norihiro; Yagita, Hideo; Okumura, Ko; Akiba, Hisaya

2011-01-01

Highlights: → TIM-1 is highly expressed on anti-IgM + anti-CD40-stimulated B cells. → Anti-TIM-1 mAb enhanced proliferation and Ig production on activated B cell in vitro. → TIM-1 signaling regulates Ab production by response to TI-2 and TD antigens in vivo. -- Abstract: Members of the T cell Ig and mucin (TIM) family have recently been implicated in the control of T cell-mediated immune responses. In this study, we found TIM-1 expression on anti-IgM- or anti-CD40-stimulated splenic B cells, which was further up-regulated by the combination of anti-IgM and anti-CD40 Abs. On the other hand, TIM-1 ligand was constitutively expressed on B cells and inducible on anti-CD3 + anti-CD28-stimulated CD4 + T cells. In vitro stimulation of activated B cells by anti-TIM-1 mAb enhanced proliferation and expression of a plasma cell marker syndecan-1 (CD138). We further examined the effect of TIM-1 signaling on antibody production in vitro and in vivo. Higher levels of IgG2b and IgG3 secretion were detected in the culture supernatants of the anti-TIM-1-stimulated B cells as compared with the control IgG-stimulated B cells. When immunized with T-independent antigen TNP-Ficoll, TNP-specific IgG1, IgG2b, and IgG3 Abs were slightly increased in the anti-TIM-1-treated mice. When immunized with T-dependent antigen OVA, serum levels of OVA-specific IgG2b, IgG3, and IgE Abs were significantly increased in the anti-TIM-1-treated mice as compared with the control IgG-treated mice. These results suggest that TIM-1 signaling in B cells augments antibody production by enhancing B cell proliferation and differentiation.

TIM-1 signaling in B cells regulates antibody production

Energy Technology Data Exchange (ETDEWEB)

Ma, Juan [Department of Immunology, Juntendo University, 2-1-1 Hongo, Bunkyo-ku, Tokyo 113-8421 (Japan); Usui, Yoshihiko [Department of Immunology, Juntendo University, 2-1-1 Hongo, Bunkyo-ku, Tokyo 113-8421 (Japan); Department of Ophthalmology, Tokyo Medical University, 6-7-1 Nishi-shinjuku-ku, Tokyo 160-0023 (Japan); Takeda, Kazuyoshi [Department of Immunology, Juntendo University, 2-1-1 Hongo, Bunkyo-ku, Tokyo 113-8421 (Japan); Harada, Norihiro [Department of Immunology, Juntendo University, 2-1-1 Hongo, Bunkyo-ku, Tokyo 113-8421 (Japan); Department of Respiratory Medicine, Juntendo University, 2-1-1 Hongo, Bunkyo-ku, Tokyo 113-8421 (Japan); Research Institute for Diseases of Old Ages, Juntendo University, 2-1-1 Hongo, Bunkyo-ku, Tokyo 113-8421 (Japan); Yagita, Hideo; Okumura, Ko [Department of Immunology, Juntendo University, 2-1-1 Hongo, Bunkyo-ku, Tokyo 113-8421 (Japan); Akiba, Hisaya, E-mail: hisaya@juntendo.ac.jp [Department of Immunology, Juntendo University, 2-1-1 Hongo, Bunkyo-ku, Tokyo 113-8421 (Japan)

2011-03-11

Highlights: {yields} TIM-1 is highly expressed on anti-IgM + anti-CD40-stimulated B cells. {yields} Anti-TIM-1 mAb enhanced proliferation and Ig production on activated B cell in vitro. {yields} TIM-1 signaling regulates Ab production by response to TI-2 and TD antigens in vivo. -- Abstract: Members of the T cell Ig and mucin (TIM) family have recently been implicated in the control of T cell-mediated immune responses. In this study, we found TIM-1 expression on anti-IgM- or anti-CD40-stimulated splenic B cells, which was further up-regulated by the combination of anti-IgM and anti-CD40 Abs. On the other hand, TIM-1 ligand was constitutively expressed on B cells and inducible on anti-CD3{sup +} anti-CD28-stimulated CD4{sup +} T cells. In vitro stimulation of activated B cells by anti-TIM-1 mAb enhanced proliferation and expression of a plasma cell marker syndecan-1 (CD138). We further examined the effect of TIM-1 signaling on antibody production in vitro and in vivo. Higher levels of IgG2b and IgG3 secretion were detected in the culture supernatants of the anti-TIM-1-stimulated B cells as compared with the control IgG-stimulated B cells. When immunized with T-independent antigen TNP-Ficoll, TNP-specific IgG1, IgG2b, and IgG3 Abs were slightly increased in the anti-TIM-1-treated mice. When immunized with T-dependent antigen OVA, serum levels of OVA-specific IgG2b, IgG3, and IgE Abs were significantly increased in the anti-TIM-1-treated mice as compared with the control IgG-treated mice. These results suggest that TIM-1 signaling in B cells augments antibody production by enhancing B cell proliferation and differentiation.

Conocimientos y prácticas sobre la nueva influenza A (H1N1) en trabajadores de salud y pacientes ambulatorios, Perú (mayo 2009)

OpenAIRE

Jeannette Ávila; César V. Munayco; Jorge Gomez; Juan Nunura; Jerónimo Canahuiri

2009-01-01

Con el objetivo de determinar el nivel de conocimientos, las actitudes y prácticas de los pacientes y del personal de salud a inicios de la pandemia de la nueva Influenza A H1N1, desarrollamos un estudio descriptivo de corte transversal en establecimientos del Ministerio de Salud del Perú (MINSA) sobre 313 usuarios y 244 trabajadores de 4 ciudades del país. El 38% de los pacientes encuestados asocia la nueva Influenza A (H1N1) con los cerdos o aves, un 17% no reconoce que la transmisión es de...

Compare the Difference of B-cell Epitopes of EgAgB1 and EgAgB3 Proteins Selected through Bioinformatic Analysis

Science.gov (United States)

An, Mengting; Zhang, Fengbo; Zhu, Yuejie; Zhao, Xiao; Ding, Jianbing

2018-01-01

Cystic echinococcosis, as a zoonosis, seriously endangers humans and animals, so early diagnosis of this disease is particularly important. Therefore, this study is to predict B-cell epitopes of EgAgB1 and EgAgB3 proteins by bioinformatics software. B-cell epitopes of EgAgB1 and EgAgB3 proteins are predicted using DNAStar and IEDB software. The results suggest that there are two potential B-cell epitopes in EgAgB1, which located in the 8-15 and 31-37 amino acid residue segments. And two potential B-cell epitopes in EgAgB2, located in the 20∼27 and 47∼53 amino acid residue segments. This study predicted the B-cell epitopes of EgAgB1 and EgAgB3 proteins, which laid the foundation for the early diagnosis of Cystic echinococcosis.

Estudio del Efecto de la Altitud sobre el Comportamiento de Motores de Combustión Interna. Parte 1: Funcionamiento

OpenAIRE

Lapuerta, Magín; Armas, Octavio; Agudelo, John R; Sánchez, Carlos A

2006-01-01

En este trabajo se estudia el efecto de la altitud sobre la potencia en motores de aspiración natural y turbosobrealimentados sin sistemas correctores, en función de la presión ambiental. La altitud sobre el nivel del mar tiene un notable efecto sobre la densidad del aire y su composición. Dado que los motores de combustión interna tienen sistemas de admisión y de inyección de combustible volumétricos, la altitud modifica el ciclo termodinámico de operación, y en consecuencia las prestaciones...

Protein Phosphotyrosine Phosphatase 1B (PTP1B) in Calpain-dependent Feedback Regulation of Vascular Endothelial Growth Factor Receptor (VEGFR2) in Endothelial Cells

Science.gov (United States)

Zhang, Yixuan; Li, Qiang; Youn, Ji Youn; Cai, Hua

2017-01-01

The VEGF/VEGFR2/Akt/eNOS/NO pathway is essential to VEGF-induced angiogenesis. We have previously discovered a novel role of calpain in mediating VEGF-induced PI3K/AMPK/Akt/eNOS activation through Ezrin. Here, we sought to identify possible feedback regulation of VEGFR2 by calpain via its substrate protein phosphotyrosine phosphatase 1B (PTP1B), and the relevance of this pathway to VEGF-induced angiogenesis, especially in diabetic wound healing. Overexpression of PTP1B inhibited VEGF-induced VEGFR2 and Akt phosphorylation in bovine aortic endothelial cells, while PTP1B siRNA increased both, implicating negative regulation of VEGFR2 by PTP1B. Calpain inhibitor ALLN induced VEGFR2 activation, which can be completely blocked by PTP1B overexpression. Calpain activation induced by overexpression or Ca/A23187 resulted in PTP1B cleavage, which can be blocked by ALLN. Moreover, calpain activation inhibited VEGF-induced VEGFR2 phosphorylation, which can be restored by PTP1B siRNA. These data implicate calpain/PTP1B negative feedback regulation of VEGFR2, in addition to the primary signaling pathway of VEGF/VEGFR2/calpain/PI3K/AMPK/Akt/eNOS. We next examined a potential role of PTP1B in VEGF-induced angiogenesis. Endothelial cells transfected with PTP1B siRNA showed faster wound closure in response to VEGF. Aortic discs isolated from PTP1B siRNA-transfected mice also had augmented endothelial outgrowth. Importantly, PTP1B inhibition and/or calpain overexpression significantly accelerated wound healing in STZ-induced diabetic mice. In conclusion, our data for the first time demonstrate a calpain/PTP1B/VEGFR2 negative feedback loop in the regulation of VEGF-induced angiogenesis. Modulation of local PTP1B and/or calpain activities may prove beneficial in the treatment of impaired wound healing in diabetes. PMID:27872190

Data of evolutionary structure change: 1AY4B-1YAAA [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 1AY4B-1YAAA 1AY4 1YAA B A ---MLGNLKPQ-----LALMGEFRADPRQGKIDLGVGVY...LPVQTYRYFDAETRGVDFEGMKADLAAAKKGDMVLLHGCCHNPTGANLTLDQWAEIASILEKTGALPLIDLAYQGFGD-GLEEDAAGTRLIASRIP---EVLIAASCS...ntryChain> 1YAA A 1YAAA...ID> A 1YAAA QGFATGDLDKD

In vitro study of vitamins B1, B2 and B6 adsorption on zeolite

OpenAIRE

Basić Zorica; Kilibarda Vesna; Dobrić Silva; Resanović Radmila

2011-01-01

Background/Aim. Zeolites are the hydratised alumosilicates of alcali and earthalcali cations, which have a long three-dimensional crystal structure. Preparations on the basis of zeolites are used for adsorption of organic and nonorganic toxic substances and they, also, find more and more use in veterinary and human medicine and pharmacy. The aim of this study was to evaluate the possibilities of zeolite to adsorb vitamins B1, B2 and B6 in acid and neutral solutions, as well as the chara...

Identificación molecular y actividad sobre sustratos cromogénicos de la venombina A del veneno de la serpiente peruana Bothrops atrox

Directory of Open Access Journals (Sweden)

Gustavo A. Sandoval

2011-05-01

Full Text Available En el presente trabajo se ha realizado la identificación molecular de la enzima similar a trombina (EST del veneno de Bothrops atrox y se ha evaluado su actividad enzimática sobre diversos sustratos sintéticos. La enzima fue purificada utilizando tres pasos cromatrográficos, sobre Sephadex G-75, CM-Sephadex C-50 y Agarosa-PAB, determinándose su peso molecular por PAGE-SDS. La identificación molecular de la enzima aislada se realizó por la técnica de peptide mass fingerprinting basada en espectrometría de masas MALDI-TOF y posterior análisis in silico. Las actividades fibrinocoagulante y amidolítica fueron ensayadas sobre fibrinó- geno bovino y BApNA, respectivamente, así como la hidrólisis sobre los sustratos cromogénicos específicos S-2238, S-2251 y S-2266. Como resultado de los ensayos bioquímicos y estructurales, la EST del veneno de B. atrox, presentó un peso molecular de 29,6 kDa. El análisis mediante espectrometría de masas de los péptidos obtenidos, permitió identificar a esta enzima como una venombina A, presentando una identidad del 75%. Del análisis de actividad enzimática, se obtuvo que la EST de B. atrox produjo coagulación del fibrinógeno bovino y presentó actividad sobre BApNA, S-2238 y S-2266, siendo incapaz de hidrolizar el sustrato S-2251. El empleo de estas aproximaciones estructurales y funcionales ha permitido lograr la identificación molecular del principal componente del veneno de B. atrox relacionado con su acción coagulante, así como evaluar en detalle la naturaleza de su actividad enzimática sobre diversos sustratos.

Hepatic protein phosphatase 1 regulatory subunit 3B (Ppp1r3b) promotes hepatic glycogen synthesis and thereby regulates fasting energy homeostasis.

Science.gov (United States)

Mehta, Minal B; Shewale, Swapnil V; Sequeira, Raymond N; Millar, John S; Hand, Nicholas J; Rader, Daniel J

2017-06-23

Maintenance of whole-body glucose homeostasis is critical to glycemic function. Genetic variants mapping to chromosome 8p23.1 in genome-wide association studies have been linked to glycemic traits in humans. The gene of known function closest to the mapped region, PPP1R3B (protein phosphatase 1 regulatory subunit 3B), encodes a protein (G L ) that regulates glycogen metabolism in the liver. We therefore sought to test the hypothesis that hepatic PPP1R3B is associated with glycemic traits. We generated mice with either liver-specific deletion ( Ppp1r3b Δ hep ) or liver-specific overexpression of Ppp1r3b The Ppp1r3b deletion significantly reduced glycogen synthase protein abundance, and the remaining protein was predominantly phosphorylated and inactive. As a consequence, glucose incorporation into hepatic glycogen was significantly impaired, total hepatic glycogen content was substantially decreased, and mice lacking hepatic Ppp1r3b had lower fasting plasma glucose than controls. The concomitant loss of liver glycogen impaired whole-body glucose homeostasis and increased hepatic expression of glycolytic enzymes in Ppp1r3b Δ hep mice relative to controls in the postprandial state. Eight hours of fasting significantly increased the expression of two critical gluconeogenic enzymes, phosphoenolpyruvate carboxykinase and glucose-6-phosphatase, above the levels in control livers. Conversely, the liver-specific overexpression of Ppp1r3b enhanced hepatic glycogen storage above that of controls and, as a result, delayed the onset of fasting-induced hypoglycemia. Moreover, mice overexpressing hepatic Ppp1r3b upon long-term fasting (12-36 h) were protected from blood ketone-body accumulation, unlike control and Ppp1r3b Δ hep mice. These findings indicate a major role for Ppp1r3b in regulating hepatic glycogen stores and whole-body glucose/energy homeostasis. © 2017 by The American Society for Biochemistry and Molecular Biology, Inc.

Data of evolutionary structure change: 1CF5B-1RTCA [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 1CF5B-1RTCA 1CF5 1RTC B A --------DVNFDLSTATAKTYTKFIEDFRATL-PFSHK...A 211 1RTC A 1RTCA...ain> 1RTC A 1RTCA SALYYYSTGGTQLPT...pdbChain> 1RTCA MRTRIRYNRRSA HHHHHH 1RTCA AYFFH-PDNQE

Data of evolutionary structure change: 1A96B-1VDMG [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 1A96B-1VDMG 1A96 1VDM B G -EKYIVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGL...VPGALLARELGIRHVDTVCISSYDHD--NQRELKVLKRAEGDGEG--FIVIDDLVDTGGTAVAIREMYP-----KAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMG...7 LEU CA 198 1VDM G 1VDMG.../n14> 1VDM G 1VDMG2 1VDM G 1VDMG

Competitive protein tyrosine phosphatase 1B (PTP1B) inhibitors, prenylated caged xanthones from Garcinia hanburyi and their inhibitory mechanism.

Science.gov (United States)

Tan, Xue Fei; Uddin, Zia; Park, Chanin; Song, Yeong Hun; Son, Minky; Lee, Keun Woo; Park, Ki Hun

2017-04-15

Protein tyrosine phosphatase 1B (PTP1B) plays important role in diabetes, obesity and cancer. The methanol extract of the gum resin of Garcinia hanburyi (G. hanburyi) showed potent PTP1B inhibition at 10µg/ml. The active compounds were identified as prenylated caged xanthones (1-9) which inhibited PTP1B in dose-dependent manner. Carboxybutenyl group within caged motif (A ring) was found to play a critical role in enzyme inhibition such as 1-6 (IC 50 s=0.47-4.69µM), whereas compounds having hydroxymethylbutenyl 7 (IC 50 =70.25µM) and methylbutenyl 8 (IC 50 >200µM) showed less activity. The most potent inhibitor, gambogic acid 1 (IC 50 =0.47µM) showed 30-fold more potency than ursolic acid (IC 50 =15.5µM), a positive control. In kinetic study, all isolated xanthones behaved as competitive inhibitors which were fully demonstrated with K m , V max and K ik /K iv ratio. It was also proved that inhibitor 1 operated under the enzyme isomerization model having k 5 =0.0751µM - 1 S - 1 , k 6 =0.0249µM - 1 S - 1 and K i app =0.499µM. To develop a pharmacophore model, we explored the binding sites of compound 1 and 7 in PTP1B. These modeling results were in agreement with our findings, which revealed that the inhibitory activities are tightly related to caged motif and prenyl group in A ring. Copyright © 2017 Elsevier Ltd. All rights reserved.

Data of evolutionary structure change: 1ADEA-1DJ3B [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 1ADEA-1DJ3B 1ADE 1DJ3 A B -------GNNVVVLGTQWGDEGKGKIVDLLTERAKYVVR.../pdbID> A 1ADEA LVING...pdbChain>A 1ADEA ALDNA-REKAR A 1ADEA RGAKAIGTTGR A 1ADEA HNFQLVNYYKA

miR-193b Regulates Mcl-1 in Melanoma.

Science.gov (United States)

Chen, Jiamin; Zhang, Xiao; Lentz, Cindy; Abi-Daoud, Marie; Paré, Geneviève C; Yang, Xiaolong; Feilotter, Harriet E; Tron, Victor A

2011-11-01

MicroRNAs play important roles in gene regulation, and their expression is frequently dysregulated in cancer cells. In a previous study, we reported that miR-193b represses cell proliferation and regulates cyclin D1 in melanoma cells, suggesting that miR-193b could act as a tumor suppressor. Herein, we demonstrate that miR-193b also down-regulates myeloid cell leukemia sequence 1 (Mcl-1) in melanoma cells. MicroRNA microarray profiling revealed that miR-193b is expressed at a significantly lower level in malignant melanoma than in benign nevi. Consistent with this, Mcl-1 is detected at a higher level in malignant melanoma than in benign nevi. In a survey of melanoma samples, the level of Mcl-1 is inversely correlated with the level of miR-193b. Overexpression of miR-193b in melanoma cells represses Mcl-1 expression. Previous studies showed that Mcl-1 knockdown cells are hypersensitive to ABT-737, a small-molecule inhibitor of Bcl-2, Bcl-X(L), and Bcl-w. Similarly, overexpression of miR-193b restores ABT-737 sensitivity to ABT-737-resistant cells. Furthermore, the effect of miR-193b on the expression of Mcl-1 seems to be mediated by direct interaction between miR-193b and seed and seedless pairing sequences in the 3' untranslated region of Mcl-1 mRNA. Thus, this study provides evidence that miR-193b directly regulates Mcl-1 and that down-regulation of miR-193b in vivo could be an early event in melanoma progression. Copyright © 2011 American Society for Investigative Pathology. Published by Elsevier Inc. All rights reserved.

Investigación educativa reciente sobre México

OpenAIRE

Núñez-DelaPeña, Francisco J.; Mejía-Arauz, Rebeca

1985-01-01

Se presenta una muestra de la investigación educativa sobre México: 22 disertaciones doctorales aceptadas en universidades norteamericanas entre 1982 y 1984. Dos estudios conciernen a la teoría del capital humano; cinco tratan diversos aspectos relacionados con la administración educativa; uno es sobre la televisión; otro sobre las habilidades fonéticas de los niños; uno más es sobre profesionalización de los médicos; cuatro tocan aspectos de política educativa; tres tratan sobre los maestros...

Data of evolutionary structure change: 1B9OA-1LAAA [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 1B9OA-1LAAA 1B9O 1LAA A A KQFTKCELSQLLKDI--DGYGGIALPELICTMFHTSGYD...pdbChain> 1LAAA TLKRLGMDGYRG HHHH GGG...Chain>A 1LAAA TNYNAGDRSTEY1LAA A 1LAAA RVVRDPQGIRA ...>A 1LAAA NRCQNRDVRQY H GGG

The small FOXP1 isoform predominantly expressed in activated B cell-like diffuse large B-cell lymphoma and full-length FOXP1 exert similar oncogenic and transcriptional activity in human B cells.

Science.gov (United States)

van Keimpema, Martine; Grüneberg, Leonie J; Schilder-Tol, Esther J M; Oud, Monique E C M; Beuling, Esther A; Hensbergen, Paul J; de Jong, Johann; Pals, Steven T; Spaargaren, Marcel

2017-03-01

The forkhead transcription factor FOXP1 is generally regarded as an oncogene in activated B cell-like diffuse large B-cell lymphoma. Previous studies have suggested that a small isoform of FOXP1 rather than full-length FOXP1, may possess this oncogenic activity. Corroborating those studies, we herein show that activated B cell-like diffuse large B-cell lymphoma cell lines and primary activated B cell-like diffuse large B-cell lymphoma cells predominantly express a small FOXP1 isoform, and that the 5'-end of the Foxp1 gene is a common insertion site in murine lymphomas in leukemia virus- and transposon-mediated insertional mutagenesis screens. By combined mass spectrometry, (quantative) reverse transcription polymerase chain reaction/sequencing, and small interfering ribonucleic acid-mediated gene silencing, we determined that the small FOXP1 isoform predominantly expressed in activated B cell-like diffuse large B-cell lymphoma lacks the N-terminal 100 amino acids of full-length FOXP1. Aberrant overexpression of this FOXP1 isoform (ΔN100) in primary human B cells revealed its oncogenic capacity; it repressed apoptosis and plasma cell differentiation. However, no difference in potency was found between this small FOXP1 isoform and full-length FOXP1. Furthermore, overexpression of full-length FOXP1 or this small FOXP1 isoform in primary B cells and diffuse large B-cell lymphoma cell lines resulted in similar gene regulation. Taken together, our data indicate that this small FOXP1 isoform and full-length FOXP1 have comparable oncogenic and transcriptional activity in human B cells, suggesting that aberrant expression or overexpression of FOXP1, irrespective of the specific isoform, contributes to lymphomagenesis. These novel insights further enhance the value of FOXP1 for the diagnostics, prognostics, and treatment of diffuse large B-cell lymphoma patients. Copyright© Ferrata Storti Foundation.

Optimization of chromatographic conditions for determination of aflatoxin B1, B2, G1 and G2 by using liquid chromatography-mass Spectrometry

Science.gov (United States)

Ramadhaningtyas, Dillani Putri; Aryana, Nurhani; Aristiawan, Yosi; Styarini, Dyah

2017-11-01

The optimization of instrument condition and chromatographic separation for analysis of aflatoxin B1, B2, G1 and G2 using liquid chromatography tandem with mass spectrometer detector was conducted in the aim to provide more accurate and reliable analysis results. The aflatoxin known to be serious threat for human health as it is classified as the carcinogenic compounds. The aflatoxin B1, B2, G1 and G2 were selected due to its extensive contamination in various agricultural commodities. The best chromatographic separation was obtained using C-18 column with gradient elution of solvent 5 mM ammonium acetate and 0.1% formic acid in methanol at 7 minutes runtime analysis. The linearity of the detector showed satisfied results as the coefficient determination found to be 0.9994, 0.9996, 0.9998 and 0.9987 for aflatoxin B1, G1, B2, and G2 respectively in the range concentration from 1 to 20 ng/g. The quantifier ion selected for the aflatoxin B1, B2, G1 and G2 was m/z 285.1, 259, 243 and 313 respectively. The instrument precision at these quantifier ions also showed satisfied result with %RSD was around 3.4 to 6.8%. The optimized method present in this study can be used for further sample analysis.

b → s+γ and b → s+g in N=1 supergravity theories

International Nuclear Information System (INIS)

Masiero, A.; Ridolfi, G.

1988-01-01

We compute the b → s+γ and b → s+g decay rates in a spontaneously broken N=1 supergravity theory with radiative electroweak breaking. We find that the ARGUS result BR (B 0 → K 0* +γ) -4 implies lower bounds on the masses of the gluinos and the lightest down squark which are in the same region as those provided by the direct (unsuccessful) searches of UA1. An improvement on the existing limit of BR (b → s+γ) by an order of magnitude can certainly rule out values of squark and gluino masses which are still allowed by the UA1 bounds. (orig.)

Data of evolutionary structure change: 1AJ8B-1IOMA [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 1AJ8B-1IOMA 1AJ8 1IOM B A LAKGLEDVYIDQTNICYIDGKEGKLYYRGYSVEELAELS...>GLY CA 362 ASP CA 307 LYS CA 257 1IOM... A 1IOMA EKLARLVAEKHGHS ARG CA 182 1IOM A 1IOM... 2.0784668922424316 2 1IOM

Evaluation of FlaB1, FlaB2, FlaB3, and Tp0463 of Treponema pallidum for serodiagnosis of syphilis.

Science.gov (United States)

Jiang, Chuanhao; Xiao, Jinhong; Xie, Yafeng; Xiao, Yongjian; Wang, Chuan; Kuang, Xingxing; Xu, Man; Li, Ranhui; Zeng, Tiebing; Liu, Shuanquan; Yu, Jian; Zhao, Feijun; Wu, Yimou

2016-02-01

Syphilis is a multistage disease caused by the invasive spirochete Treponema pallidum subsp. pallidum, and accurate diagnosis is important for the prevention and treatment of syphilis. Here, to identify appropriate diagnostic antigens for serodiagnosis of syphilis, 6 recombinant proteins were expressed in Escherichia coli and purified, including flagellins (FlaB1 [Tp0868], FlaB2 [Tp0792], and FlaB3 [Tp0870]), Tp0463, Tp0751, and Tp1038. The sensitivities were determined by screening sera from individuals with primary (n=82), secondary (n=115), latent (n=105), and congenital (n=65) syphilis. The specificities were determined by screening sera from uninfected controls (n=30) and potentially cross-reactive infections including Lyme disease (n=30), leptospirosis (n=5), and hepatitis B (n=30). Our data showed that FlaB1, FlaB2, FlaB3, Tp0463, and Tp1038 exhibited higher overall sensitivities and specificities for detecting IgG antibody, with 95.4% and 98.9%, 92.6% and 95.8%, 95.1% and 95.8%, 92.6% and 97.9%, and 95.9% and 98.9%, respectively. In contrast, Tp0751 demonstrated only an overall sensitivity of 39.2%. For comparison, the sensitivity and specificity of Architect Syphilis TP were determined to be 98.1% and 93.7%, respectively. In addition, FlaB1, FlaB2, FlaB3, and Tp0463 demonstrated excellent performance for detecting IgM antibody in primary and congenital syphilis, with sensitivities of 76.8% and 83.1%, 72.0% and 87.7%, 74.4% and 89.2%, and 64.6% and 75.3%, respectively. These results indicate that FlaB1, FlaB2, FlaB3, and Tp0463 could be as novel diagnostic candidates for serodiagnosis of syphilis. Copyright © 2016 Elsevier Inc. All rights reserved.

Identification of Toxigenic Fungi And its Respective Toxins in Dark Raisins Commercialized in Votuporanga- SP

Directory of Open Access Journals (Sweden)

Ana Fernandes Santos

2015-06-01

presence of A. niger and Penicillium spp were detected, the first ones being producers of ocratoxina and A. flavus, the producer of aflatoxina. Therefore the research showed the contamination by toxigenic fungi in the collected samples in 82% of the evaluated establishments.

Establecimiento de los conocimientos, actitudes y opiniones de la población sobre el uso racional de medicamentos

Directory of Open Access Journals (Sweden)

Rita Puig Soler

2015-08-01

Conclusiones: Los conocimientos, actitudes y opiniones de los ciudadanos sobre medicamentos son bajos. Es necesario implicar a los ciudadanos y mejorar sus conocimientos básicos para avanzar en el uso racional.

Data of evolutionary structure change: 1B26D-1AUPA [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 1B26D-1AUPA 1B26 1AUP D A ------------------SLYEMAVEQFN----RA----...ine> GLU CA 284 LEU CA 369 1AUP A 1AUPA DPEGITTEEKINY ALA CA 419 ALA CA 500 1AUP... A 1AUPA RYGLGYNLVAGA

Seminario C++, parte 1

OpenAIRE

Cachero Castro, Cristina; Ponce de León Amador, Pedro José

2007-01-01

Este seminario trata sobre principios de orientación a objetos con C++. Para comprender mejor sus contenidos, se debe tener un conocimiento básico sobre programación estructurada con C++ o C. Clases en C++. Operaciones set/get/is. Tipo Referencia (&). El puntero 'this'. Los constructores. El destructor.

Down-regulated expression of the protein-tyrosine phosphatase 1B (PTP1B) is associated with aggressive clinicopathologic features and poor prognosis in hepatocellular carcinoma

International Nuclear Information System (INIS)

Zheng, Long-Yi; Zhou, Dong-Xun; Lu, Jin; Zhang, Wen-Jun; Zou, Da-Jin

2012-01-01

Highlights: ► PTP1B protein showed decreased expression in 67.79% of the HCC patients. ► Low PTP1B expression predicts poor prognosis of HCC. ► Low PTP1B expression is correlated with expansion of OV6 + tumor-initiating cells. ► Down-regulation of PTP1B is associated with activation of Wnt/β-Catenin signaling. -- Abstract: The protein-tyrosine phosphatase 1B (PTP1B) is a classical non-transmembrane protein tyrosine phosphatase that plays a key role in metabolic signaling and can exert both tumor suppressing and tumor promoting effects in different cancers depending on the substrate involved and the cellular context. However, the expression level and function of PTP1B in hepatocellular carcinoma (HCC) remain unclear. In this study, PTP1B expression was detected by immunohistochemistry in normal liver tissue (n = 16) and hepatocellular carcinoma (n = 169). The correlations between PTP1B expression level and clinicopathologic features and patient survival were also analyzed. One hundred and eleven of 169 HCC patients (65.7%) had negative or low PTP1B expression in tumorous tissues, whereas normal tissues always expressed strong PTP1B. Decreased PTP1B expression was significantly associated with aggressive clinicopathologic features and poor prognosis. Immunohistochemistry also showed that low PTP1B expression level was correlated with high percentage of OV6 + tumor-initiating cells (T-ICs) and high frequency of nuclear β-Catenin expression in HCC specimens. Our findings demonstrate for the first time that the loss of inhibitory effect of PTP1B may contribute to progression and invasion of HCC through activation of Wnt/β-Catenin signaling and expansion of liver T-ICs. PTP1B may serve as a valuable prognostic biomarker and potential therapeutic target in HCC.

Down-regulated expression of the protein-tyrosine phosphatase 1B (PTP1B) is associated with aggressive clinicopathologic features and poor prognosis in hepatocellular carcinoma

Energy Technology Data Exchange (ETDEWEB)

Zheng, Long-Yi [Department of Endocrinology, Changhai Hospital, 168 Changhai Road, Shanghai 200433 (China); Zhou, Dong-Xun [Department of Comprehensive Treatment II, Eastern Hepatobiliary Surgery Hospital, 225 Changhai Road, Shanghai 200438 (China); Lu, Jin [Department of Endocrinology, Changhai Hospital, 168 Changhai Road, Shanghai 200433 (China); Zhang, Wen-Jun [Department of Emergency, Changhai Hospital, 168 Changhai Road, Shanghai 200433 (China); Zou, Da-Jin, E-mail: dajinzou@hotmail.com [Department of Endocrinology, Changhai Hospital, 168 Changhai Road, Shanghai 200433 (China)

2012-04-13

Highlights: Black-Right-Pointing-Pointer PTP1B protein showed decreased expression in 67.79% of the HCC patients. Black-Right-Pointing-Pointer Low PTP1B expression predicts poor prognosis of HCC. Black-Right-Pointing-Pointer Low PTP1B expression is correlated with expansion of OV6{sup +} tumor-initiating cells. Black-Right-Pointing-Pointer Down-regulation of PTP1B is associated with activation of Wnt/{beta}-Catenin signaling. -- Abstract: The protein-tyrosine phosphatase 1B (PTP1B) is a classical non-transmembrane protein tyrosine phosphatase that plays a key role in metabolic signaling and can exert both tumor suppressing and tumor promoting effects in different cancers depending on the substrate involved and the cellular context. However, the expression level and function of PTP1B in hepatocellular carcinoma (HCC) remain unclear. In this study, PTP1B expression was detected by immunohistochemistry in normal liver tissue (n = 16) and hepatocellular carcinoma (n = 169). The correlations between PTP1B expression level and clinicopathologic features and patient survival were also analyzed. One hundred and eleven of 169 HCC patients (65.7%) had negative or low PTP1B expression in tumorous tissues, whereas normal tissues always expressed strong PTP1B. Decreased PTP1B expression was significantly associated with aggressive clinicopathologic features and poor prognosis. Immunohistochemistry also showed that low PTP1B expression level was correlated with high percentage of OV6{sup +} tumor-initiating cells (T-ICs) and high frequency of nuclear {beta}-Catenin expression in HCC specimens. Our findings demonstrate for the first time that the loss of inhibitory effect of PTP1B may contribute to progression and invasion of HCC through activation of Wnt/{beta}-Catenin signaling and expansion of liver T-ICs. PTP1B may serve as a valuable prognostic biomarker and potential therapeutic target in HCC.

26 CFR 1.403(b)-11 - Applicable dates.

Science.gov (United States)

2010-04-01

... certain types of employees from elective deferrals. (1) If, on July 26, 2007, a plan excludes any of the... whom section 403(b) contributions are being made at a rate no greater than the rate each such professor.... (g) Special rule for contracts received in an exchange. Section 1.403(b)-10(b)(2) does not apply to a...

26 CFR 301.6223(b)-1 - Notice group.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 18 2010-04-01 2010-04-01 false Notice group. 301.6223(b)-1 Section 301.6223(b... ADMINISTRATION PROCEDURE AND ADMINISTRATION Assessment In General § 301.6223(b)-1 Notice group. (a) In general. If a group of partners having in the aggregate a 5 percent or more interest in the profits of a...

B physics on the Lattice $\\overline{\\Lambda}$, $\\lambda_{1}$, $\\overline{m}_{b}(\\overline{m}_{b})$, $\\lambda_2$, $B^{0}-\\overline{B}^{0}$ mixing, $f_{B}$ and all that

CERN Document Server

Gimenez, V.; Sachrajda, Christopher T.

1996-01-01

We present a short review of our most recent high statistics lattice determinations in the HQET of the following important parameters in B physics: the B--meson binding energy, $\\overline{\\Lambda}$ and the kinetic energy of the b quark in the B meson, $\\lambda_1$, which due to the presence of power divergences require a non--perturbative renormalization to be defined; the value in the HQET is determined by the matrix element of the chromo--magnetic operator between B meson states, $\\lambda_2$; the B parameter of the $B^{0}$--$\\bar{B}^{0}$ mixing, $B_{B}$, and the decay constant of the B meson, $f_{B}$. All these quantities have been computed using a sample of $600$ gauge field configurations on a $24^{3}\\times 40$ lattice at $\\beta=6.0$. For estimates by combining results from three independent lattice simulations at

HTLV-1 Tax upregulates early growth response protein 1 through nuclear factor-κB signaling.

Science.gov (United States)

Huang, Qingsong; Niu, Zhiguo; Han, Jingxian; Liu, Xihong; Lv, Zhuangwei; Li, Huanhuan; Yuan, Lixiang; Li, Xiangping; Sun, Shuming; Wang, Hui; Huang, Xinxiang

2017-08-01

Human T cell leukemia virus type 1 (HTLV-1) is a complex retrovirus that causes adult T cell leukemia (ATL) in susceptible individuals. The HTLV-1-encoded oncoprotein Tax induces persistent activation of the nuclear factor-κB (NF-κB) pathway. Early growth response protein 1 (EGR1) is overexpressed in HTLV-1-infected T cell lines and ATL cells. Here, we showed that both Tax expression and HTLV-1 infection promoted EGR1 overexpression. Loss of the NF-κB binding site in the EGR1 promotor or inhibition of NF-κB activation reduced Tax-induced EGR1 upregulation. Tax mutants unable to activate NF-κB induced only slight EGR1 upregulation as compared with wild-type Tax, confirming NF-κB pathway involvement in EGR1 regulation. Tax also directly interacted with the EGR1 protein and increased endogenous EGR1 stability. Elevated EGR1 in turn promoted p65 nuclear translocation and increased NF-κB activation. These results demonstrate a positive feedback loop between EGR1 expression and NF-κB activation in HTLV-1-infected and Tax-expressing cells. Both NF-κB activation and Tax-induced EGR1 stability upregulated EGR1, which in turn enhanced constitutive NF-κB activation and facilitated ATL progression in HTLV-1-infected cells. These findings suggest EGR1 may be an effective anti-ATL therapeutic target.

Hepatitis B en el Perú: Revisión 1970-2002

Directory of Open Access Journals (Sweden)

Julio Mayca P

2004-10-01

Full Text Available La infección por hepatitis B es un problema de salud pública a nivel mundial. El Perú, ubicado en una zona de endemicidad intermedia, no es ajeno a esta realidad. El propósito del presente artículo es presentar la evolución de las investigaciones sobre dicha enfermedad, se revisaron 60 referencias (1970-2002, no se observó una secuencia en las investigaciones sobre prevalencia, además se usaron distintos marcadores. Los resultados sobre la presencia del HBsAg variaron entre costa (0-4,8%, sierra (13,8-16% y selva (3-17,1%, sin tener investigaciones globales. Sobre los estudios en grupos de riesgo, las guarniciones militares en zona de selva han reportado brotes e identificado al HbsAg hasta en 43,2% de su población. En trabajadoras sexuales, los estudios muestran prevalencia en los marcadores de 51,5 a 89,3%. En personal de salud, se reportó el HBsAg entre 0 y 7,8%, teniendo los servicios de banco de sangre, nefrología, odontología y gastroenterología, mayor número de casos. Las investigaciones sobre respuesta serológica a la aplicación de vacunas se iniciaron en 1987, en comunidades nativas selváticas; posteriormente se aplicó un programa piloto apoyado por OPS/OMS en Abancay. Desde 1996, el MINSA estableció inmunizaciones a menores de un año en zonas de alta y mediana endemicidad, ampliando el 2003 la vacunación de este grupo a todo el país. Se concluye que a pesar de los avances en el control de la hepatitis B, se requiere una visión conjunta de todos los sectores involucrados para establecer acciones concretas y continuas tanto en análisis de costos, epidemiología y educación.

IceBridge Atmospheric Chemistry L1B Data

Data.gov (United States)

National Aeronautics and Space Administration — The IceBridge Atmospheric Chemistry L1B Data set (ICHEM1B) contains measurements acquired over Antarctica using the AVOCET differential Non-Dispersive Infrared...

Supply with the vitamins B1, B2 and B6 in carcinomas before and after radiotherapy

International Nuclear Information System (INIS)

Grimm, U.; Wulff, K.; Schmidt, W.

1983-01-01

In 108 breast cancer, 63 cervix carcinoma, 35 corpus carcinoma and 15 ovarial cancer patients the erythrocyte transketolase, gluthathione reductase and aspartate aminotransferase activity were determined as parameters for the supply with vitamin B 1 , B 2 and B 6 before and after radiotherapy. The effects of thiamine pyrophosphate determined in cancer patients were normal but the effects of flavin adenine dinucleotide and pyridoxal-5-phosphate were significantly increased compared to the controls. These results revealed radiation-induced disorders in the B 2 metabolism and tumor-induced disorders in the B 6 metabolism. Both disorders can be avoided by treatment with vitamin B complex. (author)

Comentarios sobre el artículo de Héctor Sauret: “El proyecto Puiggrós de Ley sobre Regulación del ejercicio de la docencia de la Educación Superior, entre viejos y nuevos paradigmas sobre las universidades privadas”

Directory of Open Access Journals (Sweden)

Juan Carlos Pugliese

2013-05-01

Full Text Available En el número 1 de DEBATE UNIVERSITARIO se debatió los proyectos de ley alternativos y diversas opiniones sobre la modificación del ejercicio de la docencia de la Educación Superior. Entre dichas opiniones se incluyó un artículo del Dr. Sauret : " El proyecto Puiggrós de Ley sobre Regulación del ejercicio de la docencia de la Educación Superior: entre viejos y nuevos paradigmas sobre las universidades privadas”. En referencia a este material (que puede consultarse en http://ppct.caicyt.gov.ar/index.php/debate-universitario/article/view/1606/pdf se desarrolla el siguiente comentario.

17 CFR 240.15b1-1 - Application for registration of brokers or dealers.

Science.gov (United States)

2010-04-01

... of brokers or dealers. 240.15b1-1 Section 240.15b1-1 Commodity and Securities Exchanges SECURITIES... Rules and Regulations Under the Securities Exchange Act of 1934 Registration of Brokers and Dealers § 240.15b1-1 Application for registration of brokers or dealers. (a) An application for registration of...

26 CFR 31.3401(b)-1 - Payroll period.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 15 2010-04-01 2010-04-01 false Payroll period. 31.3401(b)-1 Section 31.3401(b... Collection of Income Tax at Source § 31.3401(b)-1 Payroll period. (a) The term payroll period means the... elapsed and receives the remainder at the end of the week, the payroll period is still the calendar week...

RAC1b overexpression stimulates proliferation and NF-kB-mediated anti-apoptotic signaling in thyroid cancer cells.

Science.gov (United States)

Faria, Márcia; Matos, Paulo; Pereira, Teresa; Cabrera, Rafael; Cardoso, Bruno A; Bugalho, Maria João; Silva, Ana Luísa

2017-01-01

Overexpression of tumor-associated RAC1b has been recently highlighted as one of the most promising targets for therapeutic intervention in colon, breast, lung and pancreatic cancer. RAC1b is a hyperactive variant of the small GTPase RAC1 and has been recently shown to be overexpressed in a subset of papillary thyroid carcinomas associated with unfavorable outcome. Using the K1 PTC derived cell line as an in vitro model, we observed that both RAC1 and RAC1b were able to induce a significant increase on NF-kB and cyclin D1 reporter activity. A clear p65 nuclear localization was found in cells transfected with RAC1b-WT, confirming NF-kB canonical pathway activation. Consistently, we observed a RAC1b-mediated decrease in IκBα (NF-kB inhibitor) protein levels. Moreover, we show that RAC1b overexpression stimulates G1/S progression and protects thyroid cells against induced apoptosis, the latter through a process involving the NF-kB pathway. Present data support previous findings suggesting an important role for RAC1b in the development of follicular cell-derived thyroid malignancies and point out NF-kB activation as one of the molecular mechanisms associated with the pro-tumorigenic advantage of RAC1b overexpression in thyroid carcinomas.

ADSORCIÓN DE ALDEHÍDOS INSATURADOS SOBRE TiO2

Directory of Open Access Journals (Sweden)

Natalia Ortega

2012-01-01

Full Text Available En el presente trabajo se estudió la adsorción de aldehídos insaturados sobre la superficie del TiO2. Para evaluar su eficiencia como catalizador, se realizaron experimentos de fotocatálisis heterogénea de p-nitrofenol (PNF y una muestra proveniente de efluentes industriales. Se empleó un simulador solar y cuatro sistemas de TiO2: el TiO2-sólo (sin modificar y los sistemas TiO2-dienal constituidos por la adsorción química de 2,4 hexadienal, 2,4 heptadienal y el trans-cinamaldehído sobre la superficie del TiO2. La adsorción de los aldehídos insaturados sobre el TiO2 se cuantificó empleando los modelos de adsorción de Langmuir y Freundlich. Se evaluó la influencia del pH en los sistemas TiO2-dienal y su efecto en la degradación fotocatalítica del PNF. En condiciones básicas, la constante de velocidad del PNF es mayor al emplear los sistemas TiO2-dienal en comparación con el TiO2-sólo, mientras que en condiciones ácidas se encontró la tendencia opuesta. El sistema TiO2-cina resultó ser el fotocatalizador de mayor eficiencia.

Data of evolutionary structure change: 1JJ4B-1R8HE [Confc[Archive

Lifescience Database Archive (English)

Full Text Available in>B 1JJ4B RLRKH-SDHYR >HGGGG-GGG ...n> RLNDKHRHLFD ture>HHHHH GGG .../pdbID> B 1JJ4B WHWTE-----KTGIL ...> ----- EEE> ATOM 1523 CA TRP B 320 11.497 15.32...1R8HE WHWASPKAPHKHAIV > EEE>

Risk assessment of fumonisin B1 in the Netherlands

NARCIS (Netherlands)

Bakker MI; Speijers GJA; Paulsch WE; van Egmond HP; SIR; ARO

2004-01-01

Fumonisine B1 is een mycotoxine, dat kan worden gevormd door bepaalde Fusarium schimmels. Het toxine wordt vooral in mais (-producten) aangetroffen, maar het kan ook voorkomen in tarwe (-producten). De inname van fumonisine B1 in de Nederlandse populatie is geschat door fumonisine B1 concentraties

Cambios Financieros Globales y su Impacto sobre el Sistema Monetario Internacional

Directory of Open Access Journals (Sweden)

René Arenas Rosales

1999-01-01

Full Text Available El rompimiento definitivo del régimen de Bretton Woods, en marzo de 1973, representó un cambio fun da men tal de tasas pegableajustable a uno de mayor flexibilidad en la administración de las tasas de cambio. Adicionalmente, la turbulencia de las vari ables económicas y la promoción de los flujos globales de cap i tal privado ha sido excesiva; por lo tanto, el estado ac tual de los acuerdos monetarios requiere de algunas modificaciones básicas para promover una mayor estabilidad. En este sentido, el ganador del Premio No bel, James Tobin, ha argumentado qué controles o desincentivos sobre los movimientos de cap i tal deberían de ser impuestos –en la forma de un impuesto igualitario sobre la tasa de interés– así como “echar algo de arena sobre las ruedas” del sistema y estabilizar su respuesta hacia los disturbios. En ese tenor, el FMI únicamente ha realizado algunos pasos para fortalecer la supervisión bancaria, pero nunca pasos para reformas fundamentales. Por lo tanto, argumento que la emergencia de los mercados financieros globales ha alterado sustancialmente la realidad, que el FMI había intentado administrar.

Tetrahedral 1B4Sb nanoclusters in GaP:(B, Sb)

Energy Technology Data Exchange (ETDEWEB)

Elyukhin, V A, E-mail: elyukhin@cinvestav.m [Departamento de Ingenieria Electrica-SEES, CINVESTAV-IPN, Avenida IPN 2508, Col. San Pedro Zacatenco, C. P. 07360, Mexico, D. F. (Mexico)

2009-05-01

Self-assembling conditions of 1B4Sb tetrahedral nanoclusters in GaP doped with boron and Sb isoelectronic impurities are represented in the ultradilute and dilute limits of the boron and Sb contents, respectively. The fulfilled estimates demonstrated the preferential complete or almost complete allocation of boron atoms in 1B4Sb nanoclusters at temperatures of 500 {sup 0}C and 900 {sup 0}C, respectively. The significant decrease of the sum of the free energies of the constituent compounds is the main origin of self-assembling. The reduction of the strain energy is the additional cause of this phenomenon.

Análisis sobre la factibilidad de implementar un producto de derivados sobre gas natural en Colombia

OpenAIRE

Dowd Aguirre, Jessica Alexandra; Tirado Naranjo, Lina María

2012-01-01

El objetivo de este trabajo es realizar un análisis sobre la factibilidad de implementar un producto de derivados sobre gas natural en Colombia dado el desarrollo del sector y la importancia de este hidrocarburo como fuente alternativa de generación eléctrica. 73 p. Contenido parcial: Situación actual del mercado de gas natural colombiano -- Expectativas del mercado de gas natural colombiano -- Mercados de derivados sobre gas natural en Europa y Estados Unidos -- Mercado de gas natural ...

Association between the IL1B (-511), IL1B (+3954), IL1RN (VNTR) polymorphisms and Graves' disease risk: a meta-analysis of 11 case-control studies.

Science.gov (United States)

Chen, Min-Li; Liao, Ning; Zhao, Hua; Huang, Jian; Xie, Zheng-Fu

2014-01-01

Data on the association between the interleukin-1 (IL-1) gene polymorphisms and Graves' disease (GD) risk were conflicting. A meta-analysis was undertaken to assess this association. We searched for case-control studies investigating the association between the IL1B (-511), IL1B (+3954), IL1RN (VNTR) polymorphisms and GD risk. We extracted data using standardized forms and calculated odds ratios (OR) with 95% confidence intervals (CI). A total of 11 case-control studies were included in this meta-analysis. Available data indicated that the IL1B (-511) polymorphism was associated with GD risk in the overall populations (Caucasians and Asians) in homozygote model (TT vs. CC, OR = 0.86, 95% CI: 0.76-0.97, Pz  = 0.015), but not in dominant and recessive models (TT+TC vs. CC: OR = 0.95, 95% CI: 0.81-1.12, Pz  =  0.553 and TT vs. TC+CC: OR = 0.82, 95% CI: 0.60-1.12, Pz  =  0.205, respectively). No association between the IL1B (+3954), IL1RN (VNTR) polymorphisms and GD risk was found in the overall populations in any of the genetic models. In subgroup analyses according to ethnicity, the IL1B (-511) polymorphism was associated with GD risk in Asians in recessive and homozygote models (TT vs. TC+CC: OR =  0.68, 95% CI: 0.55-0.84, Pz VNTR) polymorphisms and GD risk was indicated in Asians, and we found no association between the IL1B (-511), IL1B (+3954), IL1RN (VNTR) polymorphisms and GD risk in Caucasians in any of the genetic models. The IL1B (-511) polymorphism, but not the IL1B (+3954) and IL1RN (VNTR) polymorphisms was associated with GD risk in Asians. There was no association between these polymorphisms and GD risk in Caucasians.

Characterization of the natural kaolinite KGa-1b

International Nuclear Information System (INIS)

Puukko, E.; Hakanen, M.

2003-05-01

Kaolinite is a common mineral on the surfaces of fractures in the rock. The sorption of europium and americium on kaolinite has been studied in a previous study (Puukko and Hakanen, 2001) using a natural kaolinite, KGa-1b (from the Clay Mineral Society, USA). Before experiments the kaolinite was washed with acid (HCl). The washing with acid removed iron but not TiO 2 . Surface complexation model has been applied to model the acid base reactions of kaolinite and the sorption of americium and europium on the kaolinite. In the present work the sorption of europium on the natural kaolinite KGa-1b was studied. The characterization of the natural kaolinite KGa- 1b is needed in the modelling of the sorption experiments. The iron impurities in the kaolinite were extracted with phase selective solutions to determine if the iron was amorphous and crystalline. The dissociation constants of kaolinite KGa-1b were determined by acid base titration in 0.05 M, 0.1 M and 0.5 M NaNO 3 solutions by two methods: a continuous titration and a batch titration. The solutions of the batch titrations were analysed for dissolved cations and silica and lanthanides at the laboratory of the Geological Survey of Finland (GSF). The loss in ignition of the KGa-1b was 14.3 w-% according to the Clay Mineral Society. The possible presence of humic acids was investigated at the GSF using thermogravimetry, X-ray diffraction and IR spectrometry and in the Laboratory of Physical Chemistry by measuring IR-absorption of gases released from a heated sample. The kaolinite KGa-1b contains a small quantity of iron. The phase selective extraction of amorphous iron gave almost same results as crystalline iron. The quantities of pure iron oxide phases of the total iron content was very low. The thermogravimetry and XRD analysis of the kaolinite KGa-1b indicated no presence of organic impurities, especially humic acids. The sensitivity of the IR analysis was not high enough to detect humic acids in the kaolinite

Estudio sobre los procedimientos de identificación del trastorno específico del lenguaje

Directory of Open Access Journals (Sweden)

Jesús Vera

2012-12-01

Full Text Available Los procedimientos de estudio y tratamiento de los Trastornos Específicos del Lenguaje (TEL son aspectos que son poco conocidos debido fundamentalmente a una serie de factores entre los que se encuentran un todavía no alcanzado consenso sobre la naturaleza del TEL, un amplio abanico de diferentes profesionales tratando de analizarlo desde posiciones marcadamente distantes como son la perspectiva clínica e investigadora y una abundante y en ocasiones contradictoria literatura relativa al mismo. Los objetivos perseguidos en este estudio han sido: a caracterizar el tipo de profesionales que en nuestro entorno identifican y tratan el TEL; b conocer la conceptualización del TEL que realizan dichos profesionales; c averiguar los tipos de procedimientos de identificación del TEL en relación a los modelos teóricos declarados. Mediante una encuesta elaborada al efecto se han obtenido resultados que permiten constatar la gran diversidad de profesionales que abordan el TEL en nuestro entorno cultural; que no existe un grado de consenso suficiente entre ellos ni sobre la caracterización del trastorno ni sobre los procedimientos diagnósticos utilizados y que los diagnósticos de dichos profesionales no responden a los tres criterios básicos que en la actualidad se utilizan en la identificación del TEL: discrepancia, especificidad y marcadores de riesgo.

Awareness, attitudes and perceptions on epilepsy in Southern Brazil Conhecimento, atitudes e percepções sobre epilepsia no Sul do Brasil

Directory of Open Access Journals (Sweden)

Asdrubal Falavigna

2007-12-01

Full Text Available OBJECTIVE: To verify awareness and attitudes toward epilepsy in Southern Brazil. METHOD: A questionnaire about familiarity with the disease, awareness and attitudes toward epileptics was applied to 832 inhabitants of Caxias do Sul. The answers were analyzed in three different groups: G1, non-university students; G2, university students up to the second year; and G3, university students with more than two years education and university graduates. RESULTS: University students and graduates are better informed regarding causes and treatment of epilepsy. Moreover, those interviewees present less negative attitudes toward epileptics. However, a large part of that group lacks some basic information on the disease. CONCLUSION: There is lack of information on epilepsy among Brazilians. Education campaigns should be carried out in order to clarify some aspects concerning epilepsy.OBJETIVO: Verificar o conhecimento e as atitudes sobre epilepsia na população de Caxias do Sul. MÉTODO: Foi aplicado um questionário sobre familiaridade com a doença, conhecimentos e atitudes diante de um portador de epilepsia a 832 moradores da cidade. As respostas foram analisadas em três grupos distintos: G1, não-universitários; G2, universitários até o segundo ano; e G3, universitários com mais de dois anos e graduados. RESULTADOS: Os universitários e graduados possuem melhor conhecimento sobre causas e tratamento da epilepsia. Além disso, esses entrevistados apresentam menos atitudes negativas para com o portador de epilepsia. Entretanto, uma boa parte desse grupo apresenta falta de alguns conhecimentos básicos sobre a doença. CONCLUSÃO: Há falta de informação à população brasileira sobre epilepsia. Campanhas educacionais devem ser realizadas no intuito de desmistificar alguns aspectos concernentes à epilepsia.

Conocimientos sobre derechos y deberes en salud en profesionales de medicina y enfermería, Bucaramanga, Colombia: Conocimientos sobre derechos-deberes en salud

Directory of Open Access Journals (Sweden)

Ludivia Esther Montaño Villalba

2013-04-01

Full Text Available Objetivo: Describir el nivel de conocimientos que profesionales en medicina y enfermería, que laboran en instituciones de salud públicas y privadas de la ciudad de Bucaramanga (Santander-Colombia, tienen sobre derechos y deberes en salud establecidos en la Constitución Política y en el Sistema General de Seguridad Social en Salud, 2010. Método: Estudio descriptivo, exploratorio, transversal. Se seleccionaron aleatoriamente instituciones, servicios y profesionales participantes. Se indagaron los conocimientos en cinco componentes que cobijaron temas sobre derechos y deberes en salud inscritos en la Constitución Política, en el Sistema General de Seguridad Social colombiano y en la jurisprudencia constitucional; igualmente, se indagó sobre el conocimiento de mecanismos jurídicos para acceder al derecho a la salud en el territorio nacional. Se construyeron promedios en términos de porcentaje total y por componente. Resultados: El promedio global de conocimientos fue 57,7 %, el de conocimientos generales sobre Constitución Política 39,4 % y el de conocimientos sobre el SGSSS 55,1 %. Los profesionales que reportaron mayores niveles de conocimientos fueron: hombres, especialistas administrativos, médicos, personas con mayor experiencia laboral y trabajadores del sector privado. Los egresados menores a cinco años obtuvieron menores promedios de conocimientos. Conclusiones: El nivel de conocimientos en derechos y deberes en salud entre los profesionales de medicina y enfermería en Bucaramanga fue deficiente.A pesar de que el conocimiento de estos temas es central en el desempeño de los profesionales del sector salud, se evidencia a partir de estos resultados, carencia de procesos de formación o educación continuada en el tema de derechos. Salud UIS 2013; 45 (1: 15-22

26 CFR 1.403(b)-2 - Definitions.

Science.gov (United States)

2010-04-01

...) INCOME TAXES Pension, Profit-Sharing, Stock Bonus Plans, Etc. § 1.403(b)-2 Definitions. (a) Application... 1450(b) of the Small Business Job Protection Act of 1996 (110 Stat. 1755, 1814) for special rules...

Comparative analysis between P1 and B1 equations for neutron moderation

International Nuclear Information System (INIS)

Martinez, Aquilino Senra; Silva, Fernando Carvalho da; Cardoso, Carlos Eduardo Santos

2000-01-01

In order to calculate the neutron flux in nuclear reactors, B1 or P1 equations are solved by numerical methods for several groups of energy. The neutron fluxes obtained from the solutions of the B1 and P1 equations are similar when they are applied to large nuclear power reactors. However, an important difference between the two fluxes is that the system of P1 equations uses one more approximation than the B1 system and then, its flux is less precise. The present work shows the relations between both equations and analyzes for what conditions the two equations systems are equivalent. Furthermore, this equations are numerically solved in 54 groups of energy for a quadrangular arrange. (author)

IRE1α links Nck1 deficiency to attenuated PTP1B expression in HepG2 cells.

Science.gov (United States)

Li, Hui; Li, Bing; Larose, Louise

2017-08-01

PTP1B, a prototype of the non-receptor subfamily of the protein tyrosine phosphatase superfamily, plays a key role in regulating intracellular signaling from various receptor and non-receptor protein tyrosine kinases. Previously, we reported that silencing Nck1 in human hepatocellular carcinoma HepG2 cells enhances basal and growth factor-induced activation of the PI3K-Akt pathway through attenuating PTP1B expression. However, the underlying mechanism by which Nck1 depletion represses PTP1B expression remains unclear. In this study, we found that silencing Nck1 attenuates PTP1B expression in HepG2 cells through down-regulation of IRE1α. Indeed, we show that silencing Nck1 in HepG2 cells leads to decreased IRE1α expression and signaling. Accordingly, IRE1α depletion using siRNA in HepG2 cells enhances PI3K-dependent basal and growth factor-induced Akt activation, reproducing the effects of silencing Nck1 on activation of this pathway. In addition, depletion of IRE1α also leads to reduced PTP1B expression, which was rescued by ectopic expression of IRE1α in Nck1-depleted cells. Mechanistically, we found that silencing either Nck1 or IRE1α in HepG2 cells decreases PTP1B mRNA levels and stability. However, despite miR-122 levels, a miRNA targeting PTP1B 3' UTR and inducing PTP1B mRNA degradation in HepG2 cells, are increased in both Nck1- and IRE1α-depleted HepG2 cells, a miR-122 antagomir did not rescue PTP1B expression in these cells. Overall, this study highlights an important role for Nck1 in fine-tuning IRE1α expression and signaling that regulate PTP1B expression and subsequent activation of the PI3K-Akt pathway in HepG2 cells. Copyright © 2017 Elsevier Inc. All rights reserved.

Measurement of sigma Lambda b0/sigma B0 x B(Lambda b0-->Lambda c+pi-)/B(B0-->D+pi-) in pp collisions at square root s=1.96 TeV.

Science.gov (United States)

Abulencia, A; Adelman, J; Affolder, T; Akimoto, T; Albrow, M G; Ambrose, D; Amerio, S; Amidei, D; Anastassov, A; Anikeev, K; Annovi, A; Antos, J; Aoki, M; Apollinari, G; Arguin, J-F; Arisawa, T; Artikov, A; Ashmanskas, W; Attal, A; Azfar, F; Azzi-Bacchetta, P; Azzurri, P; Bacchetta, N; Badgett, W; Barbaro-Galtieri, A; Barnes, V E; Barnett, B A; Baroiant, S; Bartsch, V; Bauer, G; Bedeschi, F; Behari, S; Belforte, S; Bellettini, G; Bellinger, J; Belloni, A; Benjamin, D; Beretvas, A; Beringer, J; Berry, T; Bhatti, A; Binkley, M; Bisello, D; Blair, R E; Blocker, C; Blumenfeld, B; Bocci, A; Bodek, A; Boisvert, V; Bolla, G; Bolshov, A; Bortoletto, D; Boudreau, J; Boveia, A; Brau, B; Brigliadori, L; Bromberg, C; Brubaker, E; Budagov, J; Budd, H S; Budd, S; Budroni, S; Burkett, K; Busetto, G; Bussey, P; Byrum, K L; Cabrera, S; Campanelli, M; Campbell, M; Canelli, F; Canepa, A; Carillo, S; Carlsmith, D; Carosi, R; Casarsa, M; Castro, A; Catastini, P; Cauz, D; Cavalli-Sforza, M; Cerri, A; Cerrito, L; Chang, S H; Chen, Y C; Chertok, M; Chiarelli, G; Chlachidze, G; Chlebana, F; Cho, I; Cho, K; Chokheli, D; Chou, J P; Choudalakis, G; Chuang, S H; Chung, K; Chung, W H; Chung, Y S; Ciljak, M; Ciobanu, C I; Ciocci, M A; Clark, A; Clark, D; Coca, M; Compostella, G; Convery, M E; Conway, J; Cooper, B; Copic, K; Cordelli, M; Cortiana, G; Crescioli, F; Cuenca Almenar, C; Cuevas, J; Culbertson, R; Cully, J C; Cyr, D; DaRonco, S; D'Auria, S; Davies, T; D'Onofrio, M; Dagenhart, D; de Barbaro, P; De Cecco, S; Deisher, A; De Lentdecker, G; Dell'Orso, M; Delli Paoli, F; Demortier, L; Deng, J; Deninno, M; De Pedis, D; Derwent, P F; Di Giovanni, G P; Dionisi, C; Di Ruzza, B; Dittmann, J R; DiTuro, P; Dörr, C; Donati, S; Donega, M; Dong, P; Donini, J; Dorigo, T; Dube, S; Efron, J; Erbacher, R; Errede, D; Errede, S; Eusebi, R; Fang, H C; Farrington, S; Fedorko, I; Fedorko, W T; Feild, R G; Feindt, M; Fernandez, J P; Field, R; Flanagan, G; Foland, A; Forrester, S; Foster, G W; Franklin, M; Freeman, J C; Furic, I; Gallinaro, M; Galyardt, J; Garcia, J E; Garberson, F; Garfinkel, A F; Gay, C; Gerberich, H; Gerdes, D; Giagu, S; Giannetti, P; Gibson, A; Gibson, K; Gimmell, J L; Ginsburg, C; Giokaris, N; Giordani, M; Giromini, P; Giunta, M; Giurgiu, G; Glagolev, V; Glenzinski, D; Gold, M; Goldschmidt, N; Goldstein, J; Gomez, G; Gomez-Ceballos, G; Goncharov, M; González, O; Gorelov, I; Goshaw, A T; Goulianos, K; Gresele, A; Griffiths, M; Grinstein, S; Grosso-Pilcher, C; Group, R C; Grundler, U; Guimaraes da Costa, J; Gunay-Unalan, Z; Haber, C; Hahn, K; Hahn, S R; Halkiadakis, E; Hamilton, A; Han, B-Y; Han, J Y; Handler, R; Happacher, F; Hara, K; Hare, M; Harper, S; Harr, R F; Harris, R M; Hartz, M; Hatakeyama, K; Hauser, J; Heijboer, A; Heinemann, B; Heinrich, J; Henderson, C; Herndon, M; Heuser, J; Hidas, D; Hill, C S; Hirschbuehl, D; Hocker, A; Holloway, A; Hou, S; Houlden, M; Hsu, S-C; Huffman, B T; Hughes, R E; Husemann, U; Huston, J; Incandela, J; Introzzi, G; Iori, M; Ishizawa, Y; Ivanov, A; Iyutin, B; James, E; Jang, D; Jayatilaka, B; Jeans, D; Jensen, H; Jeon, E J; Jindariani, S; Jones, M; Joo, K K; Jun, S Y; Jung, J E; Junk, T R; Kamon, T; Karchin, P E; Kato, Y; Kemp, Y; Kephart, R; Kerzel, U; Khotilovich, V; Kilminster, B; Kim, D H; Kim, H S; Kim, J E; Kim, M J; Kim, S B; Kim, S H; Kim, Y K; Kimura, N; Kirsch, L; Klimenko, S; Klute, M; Knuteson, B; Ko, B R; Kondo, K; Kong, D J; Konigsberg, J; Korytov, A; Kotwal, A V; Kovalev, A; Kraan, A C; Kraus, J; Kravchenko, I; Kreps, M; Kroll, J; Krumnack, N; Kruse, M; Krutelyov, V; Kubo, T; Kuhlmann, S E; Kuhr, T; Kusakabe, Y; Kwang, S; Laasanen, A T; Lai, S; Lami, S; Lammel, S; Lancaster, M; Lander, R L; Lannon, K; Lath, A; Latino, G; Lazzizzera, I; Le, Y; LeCompte, T; Lee, J; Lee, J; Lee, Y J; Lee, S W; Lefèvre, R; Leonardo, N; Leone, S; Levy, S; Lewis, J D; Lin, C; Lin, C S; Lindgren, M; Lipeles, E; Lister, A; Litvintsev, D O; Liu, T; Lockyer, N S; Loginov, A; Loreti, M; Loverre, P; Lu, R-S; Lucchesi, D; Lujan, P; Lukens, P; Lungu, G; Lyons, L; Lys, J; Lysak, R; Lytken, E; Mack, P; MacQueen, D; Madrak, R; Maeshima, K; Makhoul, K; Maki, T; Maksimovic, P; Malde, S; Manca, G; Margaroli, F; Marginean, R; Marino, C; Marino, C P; Martin, A; Martin, M; Martin, V; Martínez, M; Maruyama, T; Mastrandrea, P; Masubuchi, T; Matsunaga, H; Mattson, M E; Mazini, R; Mazzanti, P; McFarland, K S; McIntyre, P; McNulty, R; Mehta, A; Mehtala, P; Menzemer, S; Menzione, A; Merkel, P; Mesropian, C; Messina, A; Miao, T; Miladinovic, N; Miles, J; Miller, R; Mills, C; Milnik, M; Mitra, A; Mitselmakher, G; Miyamoto, A; Moed, S; Moggi, N; Mohr, B; Moore, R; Morello, M; Movilla Fernandez, P; Mülmenstädt, J; Mukherjee, A; Muller, Th; Mumford, R; Murat, P; Nachtman, J; Nagano, A; Naganoma, J; Nakano, I; Napier, A; Necula, V; Neu, C; Neubauer, M S; Nielsen, J; Nigmanov, T; Nodulman, L; Norniella, O; Nurse, E; Oh, S H; Oh, Y D; Oksuzian, I; Okusawa, T; Oldeman, R; Orava, R; Osterberg, K; Pagliarone, C; Palencia, E; Papadimitriou, V; Paramonov, A A; Parks, B; Pashapour, S; Patrick, J; Pauletta, G; Paulini, M; Paus, C; Pellett, D E; Penzo, A; Phillips, T J; Piacentino, G; Piedra, J; Pinera, L; Pitts, K; Plager, C; Pondrom, L; Portell, X; Poukhov, O; Pounder, N; Prakoshyn, F; Pronko, A; Proudfoot, J; Ptohos, F; Punzi, G; Pursley, J; Rademacker, J; Rahaman, A; Ranjan, N; Rappoccio, S; Reisert, B; Rekovic, V; Renton, P; Rescigno, M; Richter, S; Rimondi, F; Ristori, L; Robson, A; Rodrigo, T; Rogers, E; Rolli, S; Roser, R; Rossi, M; Rossin, R; Ruiz, A; Russ, J; Rusu, V; Saarikko, H; Sabik, S; Safonov, A; Sakumoto, W K; Salamanna, G; Saltó, O; Saltzberg, D; Sánchez, C; Santi, L; Sarkar, S; Sartori, L; Sato, K; Savard, P; Savoy-Navarro, A; Scheidle, T; Schlabach, P; Schmidt, E E; Schmidt, M P; Schmitt, M; Schwarz, T; Scodellaro, L; Scott, A L; Scribano, A; Scuri, F; Sedov, A; Seidel, S; Seiya, Y; Semenov, A; Sexton-Kennedy, L; Sfyrla, A; Shapiro, M D; Shears, T; Shepard, P F; Sherman, D; Shimojima, M; Shochet, M; Shon, Y; Shreyber, I; Sidoti, A; Sinervo, P; Sisakyan, A; Sjolin, J; Slaughter, A J; Slaunwhite, J; Sliwa, K; Smith, J R; Snider, F D; Snihur, R; Soderberg, M; Soha, A; Somalwar, S; Sorin, V; Spalding, J; Spinella, F; Spreitzer, T; Squillacioti, P; Stanitzki, M; Staveris-Polykalas, A; St Denis, R; Stelzer, B; Stelzer-Chilton, O; Stentz, D; Strologas, J; Stuart, D; Suh, J S; Sukhanov, A; Sun, H; Suzuki, T; Taffard, A; Takashima, R; Takeuchi, Y; Takikawa, K; Tanaka, M; Tanaka, R; Tecchio, M; Teng, P K; Terashi, K; Thom, J; Thompson, A S; Thomson, E; Tipton, P; Tiwari, V; Tkaczyk, S; Toback, D; Tokar, S; Tollefson, K; Tomura, T; Tonelli, D; Torre, S; Torretta, D; Tourneur, S; Trischuk, W; Tseng, J; Tsuchiya, R; Tsuno, S; Turini, N; Ukegawa, F; Unverhau, T; Uozumi, S; Usynin, D; Vallecorsa, S; van Remortel, N; Varganov, A; Vataga, E; Vázquez, F; Velev, G; Veramendi, G; Veszpremi, V; Vidal, R; Vila, I; Vilar, R; Vine, T; Vollrath, I; Volobouev, I; Volpi, G; Würthwein, F; Wagner, P; Wagner, R G; Wagner, R L; Wagner, J; Wagner, W; Wallny, R; Wang, S M; Warburton, A; Waschke, S; Waters, D; Wester, W C; Whitehouse, B; Whiteson, D; Wicklund, A B; Wicklund, E; Williams, G; Williams, H H; Wilson, P; Winer, B L; Wittich, P; Wolbers, S; Wolfe, C; Wright, T; Wu, X; Wynne, S M; Yagil, A; Yamamoto, K; Yamaoka, J; Yamashita, T; Yang, C; Yang, U K; Yang, Y C; Yao, W M; Yeh, G P; Yoh, J; Yorita, K; Yoshida, T; Yu, G B; Yu, I; Yu, S S; Yun, J C; Zanello, L; Zanetti, A; Zaw, I; Zhang, X; Zhou, J; Zucchelli, S

2007-03-23

We present the first observation of the baryon decay Lambda b0-->Lambda c+pi- followed by Lambda c+-->pK-pi+ in 106 pb-1 pp collisions at square root s=1.96 TeV in the CDF experiment. In order to reduce systematic error, the measured rate for Lambda b0 decay is normalized to the kinematically similar meson decay B0-->D+pi- followed by D+-->pi+K-pi+. We report the ratio of production cross sections (sigma) times the ratio of branching fractions (B) for the momentum region integrated above pT>6 GeV/c and pseudorapidity range |eta|Lambda b0X)/sigma(pp-->B0X)xB(Lambda b0-->Lambda c+pi-)/B(B0-->D+pi-)=0.82+/-0.08(stat)+/-0.11(syst)+/-0.22[B(Lambda c+-->pK-pi+)].

B1 gradient coherence selection using a tapered stripline.

Science.gov (United States)

van Meerten, S G J; Tijssen, K C H; van Bentum, P J M; Kentgens, A P M

2018-01-01

Pulsed-field gradients are common in modern liquid state NMR pulse sequences. They are often used instead of phase cycles for the selection of coherence pathways, thereby decreasing the time required for the NMR experiment. Soft off-resonance pulses with a B 1 gradient result in a spatial encoding similar to that created by pulsed-field (B 0 ) gradients. In this manuscript we show that pulse sequences with pulsed-field gradients can easily be converted to one which uses off-resonance B 1 field gradient (OFFBEAT) pulses. The advantage of B 1 gradient pulses for coherence selection is that the chemical shift evolution during the pulses is (partially) suppressed. Therefore no refocusing echos are required to correct for evolution during the gradient pulses. A tapered stripline is shown to be a convenient tool for creating a well-defined gradient in the B 1 field strength. B 1 gradient coherence selection using a tapered stripline is a simple and cheap alternative to B 0 pulsed-field gradients. Copyright © 2017 The Authors. Published by Elsevier Inc. All rights reserved.

Human Parvovirus B19 NS1 Protein Aggravates Liver Injury in NZB/W F1 Mice

Science.gov (United States)

Tsai, Chun-Chou; Chiu, Chun-Ching; Hsu, Jeng-Dong; Hsu, Huai-Sheng; Tzang, Bor-Show; Hsu, Tsai-Ching

2013-01-01

Human parvovirus B19 (B19) has been associated with a variety of diseases. However, the influence of B19 viral proteins on hepatic injury in SLE is still obscure. To elucidate the effects of B19 viral proteins on livers in SLE, recombinant B19 NS1, VP1u or VP2 proteins were injected subcutaneously into NZB/W F1 mice, respectively. Significant expressions of inducible nitric oxide synthase (iNOS) and cyclooxygenase-2 (COX-2) were detected in NZB/W F1 mice receiving B19 NS1 as compared to those mice receiving PBS. Markedly hepatocyte disarray and lymphocyte infiltration were observed in livers from NZB/WF 1 mice receiving B19 NS1 as compared to those mice receiving PBS. Additionally, significant increases of Tumor Necrosis Factor –α (TNF-α), TNF-α receptor, IκB kinase –α (IKK-α), nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor (IκB) and nuclear factor-kappa B (NF-κB) were detected in livers from NZB/W F1 mice receiving B19 NS1 as compared to those mice receiving PBS. Accordingly, significant increases of matrix metalloproteinase-9 (MMP9) and U-plasminogen activator (uPA) were also detected in livers from NZB/W F1 mice receiving B19 NS1 as compared to those mice receiving PBS. Contrarily, no significant variation on livers from NZB/W F1 mice receiving B19 VP1u or VP2 was observed as compared to those mice receiving PBS. These findings firstly demonstrated the aggravated effects of B19 NS1 but not VP1u or VP2 protein on hepatic injury and provide a clue in understanding the role of B19 NS1 on hepatic injury in SLE. PMID:23555760

18 CFR 1b.9 - Confidentiality of investigations.

Science.gov (United States)

2010-04-01

... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Confidentiality of investigations. 1b.9 Section 1b.9 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION... pursuant to subpoena, and all investigative proceedings shall be treated as nonpublic by the Commission and...

Interaction of the B cell-specific transcriptional coactivator OCA-B and galectin-1 and a possible role in regulating BCR-mediated B cell proliferation.

Science.gov (United States)

Yu, Xin; Siegel, Rachael; Roeder, Robert G

2006-06-02

OCA-B is a B cell-specific transcriptional coactivator for OCT factors during the activation of immunoglobulin genes. In addition, OCA-B is crucial for B cell activation and germinal center formation. However, the molecular mechanisms for OCA-B function in these processes are not clear. Our previous studies documented two OCA-B isoforms and suggested a novel mechanism for the function of the myristoylated, membrane-bound form of OCA-B/p35 as a signaling molecule. Here, we report the identification of galectin-1, and related galectins, as a novel OCA-B-interacting protein. The interaction of OCA-B and galectin-1 can be detected both in vivo and in vitro. The galectin-1 binding domain in OCA-B has been localized to the N terminus of OCA-B. In B cells lacking OCA-B expression, increased galectin-1 expression, secretion, and cell surface association are observed. Consistent with these observations, and a reported inhibitory interaction of galectin-1 with CD45, the phosphatase activity of CD45 is reduced modestly, but significantly, in OCA-B-deficient B cells. Finally, galectin-1 is shown to negatively regulate B cell proliferation and tyrosine phosphorylation upon BCR stimulation. Together, these results raise the possibility that OCA-B may regulate BCR signaling through an association with galectin-1.

Synthesis of 9H-indeno [1, 2-b] pyrazine and 11H-indeno [1, 2-b] quinoxaline derivatives in one-step reaction from 2-bromo-4-chloro-1-indanone

OpenAIRE

Jasouri, S.; Khalafy, J.; Badali, M.; Prager, R.H.

2011-01-01

The reaction of 2-bromo-4-chloro-1-indanone with 2,3-diaminomaleonitrile, benzene-1,2-diamine and 4-methylbenzene-1,2-diamine in glacial acetic acid gave 8-chloro-9H-indeno[1,2-b]pyrazine-2,3-dicarbonitrile, 1-chloro-11H-indeno[1,2-b]quinoxa-line and 1-chloro-7-methyl-11H-indeno[1,2-b]quinoxaline, respectively, in good yield.

Espina bífida /

OpenAIRE

Lucas Santos, Alma María

2013-01-01

El tema se centra en la espina bífida, se expone su definición, etiología, incidencia, los tipos bien diferenciados y sus consecuencias, cómo evoluciona el niño en el desarrollo cognitivo, emocional, social, en el funcionamiento sexual y en la autonomía personal. Se trata también la influencia que tiene esta enfermedad sobre la familia, así como el comienzo de la vida escolar en los niños con espina bífida, las dificultades que tienen en las diversas áreas de matemáticas, lenguaje y conocimie...

Mudança e Possibilidade: sobre o resultado das eleições nos Estados Unidos

Directory of Open Access Journals (Sweden)

Cristina Soreanu Pecequilo

2008-11-01

Full Text Available B; font-size: small;">B; font-size: small;">

O artigo versa sobre a vitória de Barack

Obama nas eleição norte-americana. Assim, resume

a herança do governo Bush e trata das dificuldades a

serem enfrentadas pelo Presidente Obama.

20 CFR 655.705 - What Federal agencies are involved in the H-1B and H-1B1 programs, and what are the...

Science.gov (United States)

2010-04-01

... Employers Seeking To Employ Nonimmigrants on H-1b Visas in Specialty Occupations and as Fashion Models, and... whether the individual is a fashion model of distinguished merit and ability, and whether the... § 655.700(d)(4). Each employer seeking an H-1B nonimmigrant in a specialty occupation or as a fashion...

Effect of an esterified glucomannan on laying hens exposed to combined mycotoxins (aflatoxin B1, zearalenone and fumonisin B1)

OpenAIRE

A. Zaghini; A. Altafini; M. Simioli; L. Rizzi

2011-01-01

Mycotoxin toxicity depends on species, exposure time, age, sex, health and possible synergistic effects of other mycotoxins present in feed. In poultry, aflatoxin B1 (AFB1) and fumonisin B1 (FB1) are associated with poor growth performance, lowered feed utilization efficiency, liver damage and immunosuppression; metabolites may persist in tissues and eggs. Exposure of mature hens to zearalenone (ZEN) apparently does not cause adverse effects, but ZEN residues and α and β zearalenol...

7 CFR 301.85-2b - Exempted articles. 1

Science.gov (United States)

2010-01-01

... 7 Agriculture 5 2010-01-01 2010-01-01 false Exempted articles. 1 301.85-2b Section 301.85-2b... § 301.85-2b Exempted articles. 1 1 The articles hereby exempted remain subject to applicable restrictions under other quarantines and other provisions of this subpart. (a) The following articles are...

Observations and light curve solutions of the eclipsing binaries USNO-B1.0 1395-0370184 and USNO-B1.0 1395-0370731

Directory of Open Access Journals (Sweden)

Kjurkchieva D.

2016-01-01

Full Text Available We present follow-up photometric observations in Sloan filters g', i' of the newly discovered eclipsing stars USNO-B1.0 1395-0370184 and USNO-B1.0 1395-0370731. Our data revealed that their orbital periods are considerably bigger than the previous values. This result changed the classification of USNO-B1.0 1395-0370184 from ultrashort-period binary (P=0.197 d to short-period system (P=0.251 d. The light curve solutions of our observations revealed that USNOB1.0 1395-0370184 and USNO-B1.0 1395-0370731 are overcontact binaries in which components are K dwarfs, close in masses and radii. The light curve distortions were reproduced by cool spots with angular radius of around 20°.

Human T-cell leukemia virus type 1 (HTLV-1 tax requires CADM1/TSLC1 for inactivation of the NF-κB inhibitor A20 and constitutive NF-κB signaling.

Directory of Open Access Journals (Sweden)

Rajeshree Pujari

2015-03-01

Full Text Available Persistent activation of NF-κB by the Human T-cell leukemia virus type 1 (HTLV-1 oncoprotein, Tax, is vital for the development and pathogenesis of adult T-cell leukemia (ATL and HTLV-1-associated myelopathy/tropical spastic paraparesis (HAM/TSP. K63-linked polyubiquitinated Tax activates the IKK complex in the plasma membrane-associated lipid raft microdomain. Tax also interacts with TAX1BP1 to inactivate the NF-κB negative regulatory ubiquitin-editing A20 enzyme complex. However, the molecular mechanisms of Tax-mediated IKK activation and A20 protein complex inactivation are poorly understood. Here, we demonstrated that membrane associated CADM1 (Cell adhesion molecule1 recruits Ubc13 to Tax, causing K63-linked polyubiquitination of Tax, and IKK complex activation in the membrane lipid raft. The c-terminal cytoplasmic tail containing PDZ binding motif of CADM1 is critical for Tax to maintain persistent NF-κB activation. Finally, Tax failed to inactivate the NF-κB negative regulator ubiquitin-editing enzyme A20 complex, and activate the IKK complex in the lipid raft in absence of CADM1. Our results thus indicate that CADM1 functions as a critical scaffold molecule for Tax and Ubc13 to form a cellular complex with NEMO, TAX1BP1 and NRP, to activate the IKK complex in the plasma membrane-associated lipid rafts, to inactivate NF-κB negative regulators, and maintain persistent NF-κB activation in HTLV-1 infected cells.

Immunodiagnostic Value of Echinococcus Granulosus Recombinant B8/1 Subunit of Antigen B.

Science.gov (United States)

Savardashtaki, Amir; Sarkari, Bahador; Arianfar, Farzane; Mostafavi-Pour, Zohreh

2017-06-01

Cystic echinococcosis (CE), as a chronic parasitic disease, is a major health problem in many countries. The performance of the currently available serodiagnostic tests for the diagnosis of CE is unsatisfactory. The current study aimed at sub-cloning a gene, encoding the B8/1 subunit of antigen B (AgB) from Echinococcus granulosus, using gene optimization for the immunodiagnosis of human CE. The coding sequence for AgB8/1 subunit of Echinococcus granulosus was selected from GenBank and was gene-optimized. The sequence was synthesized and inserted into pGEX-4T-1 vector. Purification was performed with GST tag affinity column. Diagnostic performance of the produced recombinant antigen, native antigen B and a commercial ELISA kit were further evaluated in an ELISA system, using a panel of sera from CE patients and controls. SDS-PAGE demonstrated that the protein of interest had a high expression level and purity after GST tag affinity purification. Western blotting verified the immunoreactivity of the produced recombinant antigen with the sera of CE patients. In an ELISA system, the sensitivity and specificity (for human CE diagnosis) of the recombinant antigen, native antigen B and commercial kit were respectively 93% and 92%, 87% and 90% and 97% and 95%. The produced recombinant antigen showed a high diagnostic value which can be recommended for serodiagnosis of CE in Iran and other CE-endemic areas. Utilizing the combination of other subunits of AgB8 would improve the performance value of the introduced ELISA system.

ARID1B alterations identify aggressive tumors in neuroblastoma.

Science.gov (United States)

Lee, Soo Hyun; Kim, Jung-Sun; Zheng, Siyuan; Huse, Jason T; Bae, Joon Seol; Lee, Ji Won; Yoo, Keon Hee; Koo, Hong Hoe; Kyung, Sungkyu; Park, Woong-Yang; Sung, Ki W

2017-07-11

Targeted panel sequencing was performed to determine molecular targets and biomarkers in 72 children with neuroblastoma. Frequent genetic alterations were detected in ALK (16.7%), BRCA1 (13.9%), ATM (12.5%), and PTCH1 (11.1%) in an 83-gene panel. Molecular targets for targeted therapy were identified in 16 of 72 patients (22.2%). Two-thirds of ALK mutations were known to increase sensitivity to ALK inhibitors. Sequence alterations in ARID1B were identified in 5 of 72 patients (6.9%). Four of five ARID1B alterations were detected in tumors of high-risk patients. Two of five patients with ARID1B alterations died of disease progression. Relapse-free survival was lower in patients with ARID1B alterations than in those without (p = 0.01). In analysis confined to high-risk patients, 3-year overall survival was lower in patients with an ARID1B alteration (33.3 ± 27.2%) or MYCN amplification (30.0 ± 23.9%) than in those with neither ARID1B alteration nor MYCN amplification (90.5 ± 6.4%, p = 0.05). These results provide possibilities for targeted therapy and a new biomarker identifying a subgroup of neuroblastoma patients with poor prognosis.

Conocimientos sobre riesgo de embarazo y autoeficacia en hombres adolescentes:apoyo parental y factores escolares

Directory of Open Access Journals (Sweden)

Fátima Estrada

2017-08-01

Full Text Available Objetivo. Identificar la asociación entre conocimiento sobre riesgo de embarazo y autoeficacia en el uso del condón, con el apoyo parental y factores escolares, en hom­bres. Material y métodos. Estudio transversal con 448 estudiantes en Puebla y Morelos. Se ajustaron dos modelos logísticos. Resultados. Los conocimientos sobre riesgo de embarazo se asocian con el que los padres hablen sobre sexualidad (RM=2.45, IC95% 1.35-4.47, con el agrado por asistir a la escuela (RM=2.18, IC95% 1.15-4.13, con el que los profesores hablen frecuentemente/muy frecuentemente sobre equidad de género (RM=1.69, IC95% 1.06-2.67 y con la edad (RM=1.77, IC95%1.26-2.50. La autoeficacia en el uso de condón se relaciona con el que los padres hablen sobre sexualidad (RM=1.80, IC95% 1.01-3.20, con el agrado por asistir a la escuela (RM=2.60, IC95% 1.42-4.77, con el nivel socioeconómico medio (RM=1.82, IC95% 1.07-3.11 y con alto grado de marginación (RM=0.47, IC95% 0.30-0.73. Con­clusiones. Estudiar el apoyo familiar y escolar, considerando la influencia del entorno social, permite mayor entendimiento de la adquisición de habilidades para una conducta sexual preventiva en hombres durante la adolescencia temprana

Liver-Specific Deletion of Protein-Tyrosine Phosphatase 1B (PTP1B) Improves Metabolic Syndrome and Attenuates Diet-Induced Endoplasmic Reticulum Stress

Science.gov (United States)

Delibegovic, Mirela; Zimmer, Derek; Kauffman, Caitlin; Rak, Kimberly; Hong, Eun-Gyoung; Cho, You-Ree; Kim, Jason K.; Kahn, Barbara B.; Neel, Benjamin G.; Bence, Kendra K.

2009-01-01

OBJECTIVE—The protein tyrosine phosphatase PTP1B is a negative regulator of insulin signaling; consequently, mice deficient in PTP1B are hypersensitive to insulin. Because PTP1B−/− mice have diminished fat stores, the extent to which PTP1B directly regulates glucose homeostasis is unclear. Previously, we showed that brain-specific PTP1B−/− mice are protected against high-fat diet–induced obesity and glucose intolerance, whereas muscle-specific PTP1B−/− mice have increased insulin sensitivity independent of changes in adiposity. Here we studied the role of liver PTP1B in glucose homeostasis and lipid metabolism. RESEARCH DESIGN AND METHODS—We analyzed body mass/adiposity, insulin sensitivity, glucose tolerance, and lipid metabolism in liver-specific PTP1B−/− and PTP1Bfl/fl control mice, fed a chow or high-fat diet. RESULTS—Compared with normal littermates, liver-specific PTP1B−/− mice exhibit improved glucose homeostasis and lipid profiles, independent of changes in adiposity. Liver-specific PTP1B−/− mice have increased hepatic insulin signaling, decreased expression of gluconeogenic genes PEPCK and G-6-Pase, enhanced insulin-induced suppression of hepatic glucose production, and improved glucose tolerance. Liver-specific PTP1B−/− mice exhibit decreased triglyceride and cholesterol levels and diminished expression of lipogenic genes SREBPs, FAS, and ACC. Liver-specific PTP1B deletion also protects against high-fat diet–induced endoplasmic reticulum stress response in vivo, as evidenced by decreased phosphorylation of p38MAPK, JNK, PERK, and eIF2α and lower expression of the transcription factors C/EBP homologous protein and spliced X box-binding protein 1. CONCLUSIONS—Liver PTP1B plays an important role in glucose and lipid metabolism, independent of alterations in adiposity. Inhibition of PTP1B in peripheral tissues may be useful for the treatment of metabolic syndrome and reduction of cardiovascular risk in addition to

Expanding the phenotypic spectrum of ARID1B-mediated disorders and identification of altered cell-cycle dynamics due to ARID1B haploinsufficiency.

Science.gov (United States)

Sim, Joe C H; White, Susan M; Fitzpatrick, Elizabeth; Wilson, Gabrielle R; Gillies, Greta; Pope, Kate; Mountford, Hayley S; Torring, Pernille M; McKee, Shane; Vulto-van Silfhout, Anneke T; Jhangiani, Shalini N; Muzny, Donna M; Leventer, Richard J; Delatycki, Martin B; Amor, David J; Lockhart, Paul J

2014-03-27

Mutations in genes encoding components of the Brahma-associated factor (BAF) chromatin remodeling complex have recently been shown to contribute to multiple syndromes characterised by developmental delay and intellectual disability. ARID1B mutations have been identified as the predominant cause of Coffin-Siris syndrome and have also been shown to be a frequent cause of nonsyndromic intellectual disability. Here, we investigate the molecular basis of a patient with an overlapping but distinctive phenotype of intellectual disability, plantar fat pads and facial dysmorphism. High density microarray analysis of the patient demonstrated a heterozygous deletion at 6q25.3, which resulted in the loss of four genes including AT Rich Interactive Domain 1B (ARID1B). Subsequent quantitative real-time PCR analysis revealed ARID1B haploinsufficiency in the patient. Analysis of both patient-derived and ARID1B knockdown fibroblasts after serum starvation demonstrated delayed cell cycle re-entry associated with reduced cell number in the S1 phase. Based on the patient's distinctive phenotype, we ascertained four additional patients and identified heterozygous de novo ARID1B frameshift or nonsense mutations in all of them. This study broadens the spectrum of ARID1B associated phenotypes by describing a distinctive phenotype including plantar fat pads but lacking the hypertrichosis or fifth nail hypoplasia associated with Coffin-Siris syndrome. We present the first direct evidence in patient-derived cells that alterations in cell cycle contribute to the underlying pathogenesis of syndromes associated with ARID1B haploinsufficiency.

Facile synthesis of cyclopentenone B1- and L1-type Phytoprostanes

Directory of Open Access Journals (Sweden)

Alexandre eGuy

2015-07-01

Full Text Available Phytoprostanes (PhytoPs represent non-enzymatic metabolites of α-linolenic acid (ALA, the essential omega-3 polyunsaturated fatty acid (PUFA derived from plants. PhytoPs are present in the plant kingdom and represent endogenous mediators capable of protecting cells from oxidative stress damages in plants. Recently, it was found that such metabolites are present in cooking oil in high quantities, and also that B1-PhytoPs protect immature neurons from oxidant injury and promote differentiation of oligodendrocyte progenitors through PPAR-γ activation. We report a novel and facile synthesis of natural 2,3-substituted cyclopentenone PhytoPs, 16-B1-PhytoP and 9-L1-PhytoP. Our strategy is based on reductive alkylation at the 2-position of 1,3-cyclopentanedione using a recent protocol developed by Ramachary et al., and on a cross-coupling metathesis to access conjugate dienone system. In conclusion, this strategy permitted access to B1- and L1-PhytoPs in a relative short sequence process, and afford the possibility to easily develop analogs of PhytoPs.

Inferencias sobre Grafos

Directory of Open Access Journals (Sweden)

Sira M. Allende

2002-05-01

Full Text Available El estudio de un juego puede ser modelado asumiendo que solo algunas partidas son observadas. Entonces el árbol del juego debe ser estimado utilizando información muestral. Similarmente ocurre al obtener información sobre el comportamiento de las decisiones tomadas por individuos muestreados sobre un árbol de decisión teórico. Al considerar una medida de probabilidad que caracterice el comportamiento de redes aleatorias se puede obtener un estimado del árbol asociado. Este problema es el analizado en este trabajo. Algunos resultados experimentales obtenidos usando Recocido Simulado ilustran el procedimiento. Su papel en el estudio de modelos económicos y de mercadeo es discutido.

Aspirin hydrolysis in plasma is a variable function of butyrylcholinesterase and platelet-activating factor acetylhydrolase 1b2 (PAFAH1b2).

Science.gov (United States)

Zhou, Gang; Marathe, Gopal K; Hartiala, Jaana; Hazen, Stanley L; Allayee, Hooman; Tang, W H Wilson; McIntyre, Thomas M

2013-04-26

Aspirin is rapidly hydrolyzed within erythrocytes by a heterodimer of PAFAH1b2/PAFAH1b3 but also in plasma by an unidentified activity. Hydrolysis in both compartments was variable, with a 12-fold variation in plasma among 2226 Cleveland Clinic GeneBank patients. Platelet inhibition by aspirin was suppressed in plasma that rapidly hydrolyzed aspirin. Plasma aspirin hydrolysis was significantly higher in patients with coronary artery disease compared with control subjects (16.5 ± 4.4 versus 15.1 ± 3.7 nmol/ml/min; p = 3.4 × 10(-8)). A genome-wide association study of 2054 GeneBank subjects identified a single locus immediately adjacent to the BCHE (butyrylcholinesterase) gene associated with plasma aspirin hydrolytic activity (lead SNP, rs6445035; p = 9.1 × 10(-17)). However, its penetrance was low, and plasma from an individual with an inactivating mutation in BCHE still effectively hydrolyzed aspirin. A second aspirin hydrolase was identified in plasma, the purification of which showed it to be homomeric PAFAH1b2. This is distinct from the erythrocyte PAFAH1b2/PAFAH1b3 heterodimer. Inhibitors showed that both butyrylcholinesterase (BChE) and PAFAH1b2 contribute to aspirin hydrolysis in plasma, with variation primarily reflecting non-genetic variation of BChE activity. Therefore, aspirin is hydrolyzed in plasma by two enzymes, BChE and a new extracellular form of platelet-activating factor acetylhydrolase, PAFAH1b2. Hydrolytic effectiveness varies widely primarily from non-genetic variation of BChE activity that affects aspirin bioavailability in blood and the ability of aspirin to inhibit platelet aggregation.

Aspirin Hydrolysis in Plasma Is a Variable Function of Butyrylcholinesterase and Platelet-activating Factor Acetylhydrolase 1b2 (PAFAH1b2)*

Science.gov (United States)

Zhou, Gang; Marathe, Gopal K.; Hartiala, Jaana; Hazen, Stanley L.; Allayee, Hooman; Tang, W. H. Wilson; McIntyre, Thomas M.

2013-01-01

Aspirin is rapidly hydrolyzed within erythrocytes by a heterodimer of PAFAH1b2/PAFAH1b3 but also in plasma by an unidentified activity. Hydrolysis in both compartments was variable, with a 12-fold variation in plasma among 2226 Cleveland Clinic GeneBank patients. Platelet inhibition by aspirin was suppressed in plasma that rapidly hydrolyzed aspirin. Plasma aspirin hydrolysis was significantly higher in patients with coronary artery disease compared with control subjects (16.5 ± 4.4 versus 15.1 ± 3.7 nmol/ml/min; p = 3.4 × 10−8). A genome-wide association study of 2054 GeneBank subjects identified a single locus immediately adjacent to the BCHE (butyrylcholinesterase) gene associated with plasma aspirin hydrolytic activity (lead SNP, rs6445035; p = 9.1 × 10−17). However, its penetrance was low, and plasma from an individual with an inactivating mutation in BCHE still effectively hydrolyzed aspirin. A second aspirin hydrolase was identified in plasma, the purification of which showed it to be homomeric PAFAH1b2. This is distinct from the erythrocyte PAFAH1b2/PAFAH1b3 heterodimer. Inhibitors showed that both butyrylcholinesterase (BChE) and PAFAH1b2 contribute to aspirin hydrolysis in plasma, with variation primarily reflecting non-genetic variation of BChE activity. Therefore, aspirin is hydrolyzed in plasma by two enzymes, BChE and a new extracellular form of platelet-activating factor acetylhydrolase, PAFAH1b2. Hydrolytic effectiveness varies widely primarily from non-genetic variation of BChE activity that affects aspirin bioavailability in blood and the ability of aspirin to inhibit platelet aggregation. PMID:23508960

DISC1, PDE4B, and NDE1 at the centrosome and synapse

International Nuclear Information System (INIS)

Bradshaw, Nicholas J.; Ogawa, Fumiaki; Antolin-Fontes, Beatriz; Chubb, Jennifer E.; Carlyle, Becky C.; Christie, Sheila; Claessens, Antoine; Porteous, David J.; Millar, J. Kirsty

2008-01-01

Disrupted-In-Schizophrenia 1 (DISC1) is a risk factor for schizophrenia and other major mental illnesses. Its protein binding partners include the Nuclear Distribution Factor E Homologs (NDE1 and NDEL1), LIS1, and phosphodiesterases 4B and 4D (PDE4B and PDE4D). We demonstrate that NDE1, NDEL1 and LIS1, together with their binding partner dynein, associate with DISC1, PDE4B and PDE4D within the cell, and provide evidence that this complex is present at the centrosome. LIS1 and NDEL1 have been previously suggested to be synaptic, and we now demonstrate localisation of DISC1, NDE1, and PDE4B at synapses in cultured neurons. NDE1 is phosphorylated by cAMP-dependant Protein Kinase A (PKA), whose activity is, in turn, regulated by the cAMP hydrolysis activity of phosphodiesterases, including PDE4. We propose that DISC1 acts as an assembly scaffold for all of these proteins and that the NDE1/NDEL1/LIS1/dynein complex is modulated by cAMP levels via PKA and PDE4.

Four new neolignans isolated from Eleutherococcus senticosus and their protein tyrosine phosphatase 1B inhibitory activity (PTP1B).

Science.gov (United States)

Zhang, Le; Li, Ban-Ban; Li, Hao-Ze; Meng, Xiao; Lin, Xin; Jiang, Yi-Yu; Ahn, Jong-Seog; Cui, Long

2017-09-01

Four new compounds, erythro-7'E-4-hydroxy-3,3'-dimethoxy-8,5'-oxyneoligna-7'-ene-7,9-diol-9'-al (1), (7S,8S)-4-hydroxy-3,1',3'-trimethoxy-4',7-epoxy-8,5'-neolign-9-ol (5), (7S,8S,7'E)-5-hydroxy-3,3'-dimethoxy-4',7-epoxy-8,5'-neolign-7'-ene-9,9'-diol (6) and (7S,8S,7'E)-5-hydroxy-3,3',9'-trimethoxy-4'-7-epoxy-8,5'-neolign-7'-ene-9-ol (7). Along with four known compounds (2-4, 8) were isolated from the EtOAc-soluble extract of Eleutherococcus senticosus. Their structures were elucidated on the basis of spectroscopic and physicochemical analyses. All the compounds were evaluated for in vitro inhibitory activity against PTP1B, VHR and PP1. Among them, compounds 1-4 and 6-8 were found to exhibit selective inhibitory activity on PTP1B with IC 50 values ranging from 17.2±1.6 to 32.7±1.2μM. Copyright © 2017 Elsevier B.V. All rights reserved.

Estudio etnográfico del portero de hockey sobre patines: una vida entre paradojas

Directory of Open Access Journals (Sweden)

Guillem Trabal Tañá

2016-12-01

Full Text Available Este estudio es la primera investigación en las ciencias de la actividad física y el deporte que ha analizado desde una perspectiva etnográfica el portero de hockey sobre patines. El objetivo principal es conocer cuáles son las valoraciones y los juicios que la comunidad del hockey sobre patines ha otorgado a esta figura y poder comprender cuál es la lógica externa existente a su alrededor. La metodología utilizada en este estudio ha sido la observación, la observación participante y 8 entrevistas en profundidad a porteros, jugadores y entrenadores de la máxima categoría del hockey sobre patines nacional. Los principales resultados muestran que: a el portero es considerado el jugador más determinante del equipo; b los juicios que se hacen de las actuaciones del portero tienen en cuenta variables cuantitativas: los goles encajados y el resultado final de un partido y/o competición; c dentro de la comunidad del hockey sobre patines se ha enquistado una definición de la identidad del portero que lo asocia a la locura, la soledad, la extravagancia y la rareza; d los porteros comparten una forma particular de comprender este deporte que fundamenta su asociación y su cooperación, y e la existencia del portero dentro del hockey sobre patines está llena de paradojas que se contraponen a la alta importancia atribuida a esta figura.

RCSD1-ABL1 Translocation Associated with IKZF1 Gene Deletion in B-Cell Acute Lymphoblastic Leukemia

Directory of Open Access Journals (Sweden)

Shawana Kamran

2015-01-01

Full Text Available The RCSD1 gene has recently been identified as a novel gene fusion partner of the ABL1 gene in cases of B-cell Acute Lymphoblastic Leukemia (B-ALL. The RCSD1 gene is located at 1q23 and ABL1 is located at 9q34, so that the RCSD1-ABL1 fusion typically arises through a rare reciprocal translocation t(1;9(q23;q34. Only a small number of RCSD1-ABL1 positive cases of B-ALL have been described in the literature, and the full spectrum of clinical, morphological, immunophenotypic, and molecular features associated with this genetic abnormality has not been defined. We describe extensive genetic characterization of a case of B-ALL with RCSD1-ABL1 fusion, by using conventional cytogenetic analysis, Fluorescence In Situ Hybridization (FISH studies, and Chromosomal Microarray Analysis (CMA. The use of CMA resulted in detection of an approximately 70 kb deletion at 7p12.2, which caused a disruption of the IKZF1 gene. Deletions and mutations of IKZF1 are recurring abnormalities in B-ALL and are associated with a poor prognosis. Our findings highlight the association of the deletion of IKZF1 gene with the t(1;9(q24;q34 and illustrate the importance of comprehensive cytogenetic and molecular evaluation for accurate prediction of prognosis in patients with B-cell ALL.

Environmental sensing by mature B cells is controlled by the transcription factors PU.1 and SpiB.

Science.gov (United States)

Willis, Simon N; Tellier, Julie; Liao, Yang; Trezise, Stephanie; Light, Amanda; O'Donnell, Kristy; Garrett-Sinha, Lee Ann; Shi, Wei; Tarlinton, David M; Nutt, Stephen L

2017-11-10

Humoral immunity requires B cells to respond to multiple stimuli, including antigen, membrane and soluble ligands, and microbial products. Ets family transcription factors regulate many aspects of haematopoiesis, although their functions in humoral immunity are difficult to decipher as a result of redundancy between the family members. Here we show that mice lacking both PU.1 and SpiB in mature B cells do not generate germinal centers and high-affinity antibody after protein immunization. PU.1 and SpiB double-deficient B cells have a survival defect after engagement of CD40 or Toll-like receptors (TLR), despite paradoxically enhanced plasma cell differentiation. PU.1 and SpiB regulate the expression of many components of the B cell receptor signaling pathway and the receptors for CD40L, BAFF and TLR ligands. Thus, PU.1 and SpiB enable B cells to appropriately respond to environmental cues.

Labelling aflatoxine-B1 by radioactive iodine

International Nuclear Information System (INIS)

Kim, Y.S.; Park, K.B.; Sung, H.K.; Ryu, Y.W.

1977-01-01

Labelling aflatoxines, the potential carcinogenic compounds, by radioactive iodine has been studied. The auflatoxine-B 1 , which is known to be the most abundant components of auflatoxines in the nature, was labelled by radioactive iodine-125 through an acid catalyst chloroamine-T procedure. The radiochemical yield was amounted to 63.6%. The chemical structure of the labelled product was proved to be 6-iodo 5-methoxy coumarine structure of auflatoxine-B 1 molecule by means of I.R. and N.M.R. spectroscopy. The labelled product was orally administered in a test animal (rat) and examined the accumulation of radioactivity in the body at the definite time interval. The accumulation of the radioactivity was pronounced at the blood and the liver. There was no indication of the decomposition of auflatoxine-B 1 - 125 I in the organs of the test animal. (author)

Clinical efficacy of raltegravir against B and non-B subtype HIV-1 in phase III clinical studies.

Science.gov (United States)

Rockstroh, Jürgen K; Teppler, Hedy; Zhao, Jing; Sklar, Peter; Miller, Michael D; Harvey, Charlotte M; Strohmaier, Kim M; Leavitt, Randi Y; Nguyen, Bach-Yen T

2011-07-17

We evaluated the long-term efficacy of raltegravir according to HIV-1 subtype (B and non-B) using data from three phase III studies in treatment-experienced (BENCHMRK-1 and 2) and treatment-naive (STARTMRK) HIV-infected patients. HIV-1 subtypes were identified from baseline plasma specimens using genotypic data of the PhenoSense GT test (Monogram Biosciences, South San Francisco, California, USA). Non-B subtypes were combined for the current analyses due to small numbers of each specific subtype. An observed failure approach was used (only discontinuations due to lack of efficacy were treated as failures). Resistance evaluation was performed in patients with documented virologic failure. Seven hundred and forty-three patients received raltegravir and 519 received comparator (efavirenz in STARTMRK; optimized background therapy in BENCHMRK). Non-B subtype virus (A, A/C, A/D, A/G, A1, AE, AG, B/G, BF, C, D, D/F, F, F1, G, and complex) was isolated at baseline in 98 (13%) raltegravir recipients and 62 (12%) comparator recipients. Subtypes AE and C were most common, isolated in 41 and 43 patients, respectively. The proportion of raltegravir recipients achieving HIV RNA less than 50 copies/ml was similar between non-B and B subtypes (STARTMRK: 94.5 vs. 88.7%; BENCHMRK-1 and 2: 66.7 vs. 60.7%); change in CD4 cell count also was similar between non-B and B subtypes (STARTMRK: 243 vs. 221 cells/μl; BENCHMRK-1 and 2: 121 vs. 144 cells/μl). Phenotypic resistance to raltegravir in non-B virus was associated with integrase mutations observed previously in subtype B virus. In phase III studies in treatment-naive and treatment-experienced patients, raltegravir showed comparable and potent clinical efficacy against B and non-B HIV-1 subtypes.

Skinner e Feyerabend sobre o Método e o Papel da Ciência em uma Sociedade Livre

OpenAIRE

Rocha, César Antonio Alves da

2017-01-01

Resumo Da obra de B. F. Skinner fazem parte preocupações de ordem epistemológica, encerrando discussões sobre metodologia e critérios de verdade, e outras de ordem política e social, concernentes à relação entre ciência e sociedade. De um discurso, em alguns aspectos, coincidentes com uma forma de positivismo, Skinner passou a crítico de tendências puramente formalistas sobre o método científico, e de uma defesa do gerenciamento da sociedade por especialistas, passou a uma crítica à centraliz...

Mycotoxin research in Brazil: the last decade in review Pesquisa em micotoxinas no Brasil: a última década em foco

Directory of Open Access Journals (Sweden)

Delia B. Rodríguez-Amaya

2002-01-01

Full Text Available The number of research papers (128 papers on mycotoxins published by Brazilian researchers in 1991-2000 surpassed the total number (85 papers published in the preceding three decades (1961-1990. Thirty percent of the papers surveyed mycotoxins in foods and feeds. AFs in peanut and peanut products continued to be alarming, and high incidence and levels of FBs in corn and corn products also appeared as a serious problem. Contamination with other toxins, such as ZEA, OTA and trichothecenes, was low. Occurrence of AFM1 in milk and dairy products and patulin in apple juice needs to be verified as the results are somewhat diverging. Work on analytical methods, mycological examination and toxic effects constituted 16, 13 and 13%, respectively, of the published papers in the decade assessed. Attempts to find means of preventing/controlling fungal growth and mycotoxin production notably increased, making up 27% of the papers, including investigations on influencing factors (e.g. genotype resistance, water content/a w, relative humidity, temperature, presence of metals, type of soil, mite infestation and antagonistic potential of other microorganisms against mycotoxin-producing fungi. Effects of plant extract, flavonoids, fungicides and other chemicals, storage bag material, adsorbents, cooking and processing of food were also studied. Thus, notwithstanding constraints on resources, Brazilian research responds to the needs of the country, reflects international concerns and recent developments in the area.O número de artigos de pesquisa (128 artigos sobre micotoxinas publicados por pesquisadores brasileiros em 1991-2000 superou a soma de artigos (85 artigos publicados nas três décadas anteriores (1961-1990. Trinta por cento das publicações foi levantamento da ocorrência de micotoxinas em alimentos e rações. Aflatoxinas em amendoim e produtos de amendoim continua sendo um problema alarmante, e a alta incidência e níveis elevados de fumonisinas em

Effect of vitamin B1 and mixtures of B1 with other vitamins on cytostatic efficiency of sanazole under irradiation. A study in vitro

International Nuclear Information System (INIS)

Heinrich, Edith; Getoff, Nikola

2003-01-01

Experiments in vitro, using bacteria Escherichia coli (AB 1157) as a biological model, showed that the cytostatic efficiency of sanazole (AK-2123, a nitrotriazole-type radiosensitizer) in radiation treatment can be strongly influenced by the presence of various vitamins. In airfree media the sanazole action is increased by a factor of 2.5 in the presence of vitamin (vit.) B1, vit. C E-acetate and β-carotene, whereas vit. B1 used individually possesses a 2.7-times higher cytostatic activity than sanazole itself. In media containing air the highest increase of sanazole action is observed in the presence of vit. B1 and C, whereas the individual use of vit. B1 shows a radiation protection effect. In media saturated with N 2 O the addition of the vit. B1 and C causes a 1.8-times larger sanazole activity, but the application of vit. B1 alone brings about a very high radiation protection. >From studies of vit. B1-radiolysis it can be concluded that OH radicals are the major primary transients leading to substrate degradation. The results are of interest for the radiation therapy of cancer

Effect of vitamin B1 and mixtures of B1 with other vitamins on cytostatic efficiency of sanazole under irradiation. A study in vitro

Science.gov (United States)

Heinrich, Edith; Getoff, Nikola

2003-06-01

Experiments in vitro, using bacteria Escherichia coli (AB 1157) as a biological model, showed that the cytostatic efficiency of sanazole (AK-2123, a nitrotriazole-type radiosensitizer) in radiation treatment can be strongly influenced by the presence of various vitamins. In airfree media the sanazole action is increased by a factor of 2.5 in the presence of vitamin (vit.) B1, vit. C E-acetate and β-carotene, whereas vit. B1 used individually possesses a 2.7-times higher cytostatic activity than sanazole itself. In media containing air the highest increase of sanazole action is observed in the presence of vit. B1 and C, whereas the individual use of vit. B1 shows a radiation protection effect. In media saturated with N 2O the addition of the vit. B1 and C causes a 1.8-times larger sanazole activity, but the application of vit. B1 alone brings about a very high radiation protection. From studies of vit. B1-radiolysis it can be concluded that OH radicals are the major primary transients leading to substrate degradation. The results are of interest for the radiation therapy of cancer.

Effect of vitamin B1 and mixtures of B1 with other vitamins on cytostatic efficiency of sanazole under irradiation. A study in vitro

Energy Technology Data Exchange (ETDEWEB)

Heinrich, Edith; Getoff, Nikola E-mail: nikola.getoff@univie.ac.at

2003-06-01

Experiments in vitro, using bacteria Escherichia coli (AB 1157) as a biological model, showed that the cytostatic efficiency of sanazole (AK-2123, a nitrotriazole-type radiosensitizer) in radiation treatment can be strongly influenced by the presence of various vitamins. In airfree media the sanazole action is increased by a factor of 2.5 in the presence of vitamin (vit.) B1, vit. C E-acetate and {beta}-carotene, whereas vit. B1 used individually possesses a 2.7-times higher cytostatic activity than sanazole itself. In media containing air the highest increase of sanazole action is observed in the presence of vit. B1 and C, whereas the individual use of vit. B1 shows a radiation protection effect. In media saturated with N{sub 2}O the addition of the vit. B1 and C causes a 1.8-times larger sanazole activity, but the application of vit. B1 alone brings about a very high radiation protection. >From studies of vit. B1-radiolysis it can be concluded that OH radicals are the major primary transients leading to substrate degradation. The results are of interest for the radiation therapy of cancer.

Measurement of B(t ---> Wb)/B(t ---> Wq) at s**(1/2) = 1.96-TeV

Energy Technology Data Exchange (ETDEWEB)

Abazov, V.M.; Abbott, B.; Abolins, M.; Acharya, B.S.; Adams, M.; Adams, T.; Agelou, M.; Agram, J.-L.; Ahn, S.H.; Ahsan, M.; Alexeev, G.D.; /Buenos Aires U. /Rio de

2006-03-01

The authors present the measurement of R = {Beta}(t {yields} Wb)/{Beta}(t {yields} Wq) in p{bar p} collisions at {radical}s = 1.96 TeV, using 230 pb{sup -1} of data collected by the D0 experiment at the Fermilab Tevatron Collider. They fit simultaneously R and the number (N{sub t{bar t}}) of selected top quark pairs (t{bar t}), to the number of identified b-quark jets in events with one electron or one muon, three or more jets, and high transverse energy imbalance. To improve sensitivity, kinematical properties of events with no identified b-quark jets are included in the fit. They measure R = 1.03{sub -0.17}{sup +0.19}(stat+syst), in good agreement with the standard model. They set lower limits of R > 0.61 and |V{sub tb}| > 0.78 at 95% confidence level.

Conocimientos sobre incontinencia urinaria en pacientes hospitalizados

Directory of Open Access Journals (Sweden)

Otto Guillen Lopez

2003-10-01

Full Text Available Objetivo: Determinar el nivel de conocimientos sobre incontinencia urinaria (IU en pacientes hospitalizados. Material y métodos: Estudio transversal, descriptivo; se entrevistó una muestra por saturación de 325 pacientes hospitalizados de 30 años a más del Hospital Nacional Cayetano Heredia (HNCH, Lima - Perú, utilizando un cuestionario de conocimientos sobre incontinencia, considerándose como adecuado conocimiento cuando había más de 50% de aciertos en él. Resultados: Solamente 35.7% tuvieron conocimiento adecuado sobre IU. Hasta 90% conocía acerca del éxito del tratamiento y posibilidad de curación de los pacientes incontinentes. Sin embargo, 75% consideraron erróneamente que la IU era consecuencia inevitable del envejecimiento, mientras menos de 50% de pacientes conocía el papel de ciertos medicamentos y ejercicios en la IU. Conclusiones: Se demostró un pobre conocimiento general sobre la IU, siendo necesaria una intervención de los profesionales de la salud en la educación de la población, sobre todo hospitalizada y con factores predisponentes para desarrollar IU, para así poder modificar las ideas erróneas que existen sobre el tema. (Rev Med Hered 2003; 14: 186-194.

A naturally occurring mutation in ropB suppresses SpeB expression and reduces M1T1 group A streptococcal systemic virulence.

Directory of Open Access Journals (Sweden)

Andrew Hollands

Full Text Available Epidemiological studies of group A streptococcus (GAS have noted an inverse relationship between SpeB expression and invasive disease. However, the role of SpeB in the course of infection is still unclear. In this study we utilize a SpeB-negative M1T1 clinical isolate, 5628, with a naturally occurring mutation in the gene encoding the regulator RopB, to elucidate the role of RopB and SpeB in systemic virulence. Allelic exchange mutagenesis was used to replace the mutated ropB allele in 5628 with the intact allele from the well characterized isolate 5448. The inverse allelic exchange was also performed to replace the intact ropB in 5448 with the mutated allele from 5628. An intact ropB was found to be essential for SpeB expression. While the ropB mutation was shown to have no effect on hemolysis of RBC's, extracellular DNase activity or survival in the presence of neutrophils, strains with the mutated ropB allele were less virulent in murine systemic models of infection. An isogenic SpeB knockout strain containing an intact RopB showed similarly reduced virulence. Microarray analysis found genes of the SpeB operon to be the primary target of RopB regulation. These data show that an intact RopB and efficient SpeB production are necessary for systemic infection with GAS.