WorldWideScience

Sample records for afines poaceae pooideae

  1. Variability of Pyrrolizidine Alkaloid Occurrence in Species of the Grass Subfamily Pooideae (Poaceae)

    Science.gov (United States)

    Wesseling, Anne-Maria; Demetrowitsch, Tobias J.; Schwarz, Karin; Ober, Dietrich

    2017-01-01

    Pyrrolizidine alkaloids (PAs) are a class of secondary metabolites found in various unrelated angiosperm lineages including cool-season grasses (Poaceae, subfamily Pooideae). Thesinine conjugates, saturated forms of PA that are regarded as non-toxic, have been described to occur in the two grass species Lolium perenne and Festuca arundinacea (Poaceae, subfamily Pooideae). In a wider screen, we tested various species of the Pooideae lineage, grown under controlled conditions, for their ability to produce thesinine conjugates or related structures. Using an LC-MS based targeted metabolomics approach we were able to show that PA biosynthesis in grasses is limited to a group of very closely related Pooideae species that produce a limited diversity of PA structures. High variability in PA levels was observed even between individuals of the same species. These individual accumulation patterns are discussed with respect to a possible function and evolution of this type of alkaloid. PMID:29250094

  2. Variability of Pyrrolizidine Alkaloid Occurrence in Species of the Grass Subfamily Pooideae (Poaceae

    Directory of Open Access Journals (Sweden)

    Anne-Maria Wesseling

    2017-11-01

    Full Text Available Pyrrolizidine alkaloids (PAs are a class of secondary metabolites found in various unrelated angiosperm lineages including cool-season grasses (Poaceae, subfamily Pooideae. Thesinine conjugates, saturated forms of PA that are regarded as non-toxic, have been described to occur in the two grass species Lolium perenne and Festuca arundinacea (Poaceae, subfamily Pooideae. In a wider screen, we tested various species of the Pooideae lineage, grown under controlled conditions, for their ability to produce thesinine conjugates or related structures. Using an LC-MS based targeted metabolomics approach we were able to show that PA biosynthesis in grasses is limited to a group of very closely related Pooideae species that produce a limited diversity of PA structures. High variability in PA levels was observed even between individuals of the same species. These individual accumulation patterns are discussed with respect to a possible function and evolution of this type of alkaloid.

  3. Novedades nomenclaturales en la tribu Stipeae (Poaceae, Pooideae) para la Flora Argentina

    OpenAIRE

    Ana María Cialdella

    2010-01-01

    Durante la revisión de los géneros de Stipeae (Poaceae) para la flora argentina y de acuerdo a los últimos estudios filogenéticos en la tribu, se confirmó la necesidad de transferir algunos taxones recientemente descriptos de Stipa a Nassella, Jarava o Pappostipa. En este trabajo se presentan 12 nuevas combinaciones: Jarava ichu var. pungens, Nassella brachyglumis, N. macrotricha, Pappostipa arenicola, P. choconensis, P. colloncurensis, P. frigida var. longifolia, P. jucunda, P. kieslingii, P...

  4. Novedades nomenclaturales en la tribu Stipeae (Poaceae, Pooideae para la Flora Argentina

    Directory of Open Access Journals (Sweden)

    Ana María Cialdella

    2010-01-01

    Full Text Available Durante la revisión de los géneros de Stipeae (Poaceae para la flora argentina y de acuerdo a los últimos estudios filogenéticos en la tribu, se confirmó la necesidad de transferir algunos taxones recientemente descriptos de Stipa a Nassella, Jarava o Pappostipa. En este trabajo se presentan 12 nuevas combinaciones: Jarava ichu var. pungens, Nassella brachyglumis, N. macrotricha, Pappostipa arenicola, P. choconensis, P. colloncurensis, P. frigida var. longifolia, P. jucunda, P. kieslingii, P. mapuche, P. marqueziana y P. zulmae. Se incluye también una clave para identificar los géneros de Stipeae en la Argentina.

  5. Are diversification rates and chromosome evolution in the temperate grasses (Pooideae) associated with major environmental changes in the Oligocene-Miocene?

    Science.gov (United States)

    Pimentel, Manuel; Escudero, Marcial; Sahuquillo, Elvira; Minaya, Miguel Ángel; Catalán, Pilar

    2017-01-01

    The Pooideae are a highly diverse C3 grass subfamily that includes some of the most economically important crops, nested within the highly speciose core-pooid clade. Here, we build and explore the phylogeny of the Pooideae within a temporal framework, assessing its patterns of diversification and its chromosomal evolutionary changes in the light of past environmental transformations. We sequenced five plastid DNA loci, two coding ( ndhF , matk ) and three non-coding ( trnH-psbA , trnT-L and trnL-F ), in 163 Poaceae taxa, including representatives for all subfamilies of the grasses and all but four ingroup Pooideae tribes. Parsimony and Bayesian phylogenetic analyses were conducted and divergence times were inferred in BEAST using a relaxed molecular clock. Diversification rates were assessed using the MEDUSA approach, and chromosome evolution was analyzed using the chromEvol software. Diversification of the Pooideae started in the Late-Eocene and was especially intense during the Oligocene-Miocene. The background diversification rate increased significantly at the time of the origin of the Poodae + Triticodae clade. This shift in diversification occurred in a context of falling temperatures that potentially increased ecological opportunities for grasses adapted to open areas around the world. The base haploid chromosome number n  = 7 has remained stable throughout the phylogenetic history of the core pooids and we found no link between chromosome transitions and major diversification events in the Pooideae.

  6. Late Cretaceous origin of the rice tribe provides evidence for early diversification in Poaceae.

    Science.gov (United States)

    Prasad, V; Strömberg, C A E; Leaché, A D; Samant, B; Patnaik, R; Tang, L; Mohabey, D M; Ge, S; Sahni, A

    2011-09-20

    Rice and its relatives are a focal point in agricultural and evolutionary science, but a paucity of fossils has obscured their deep-time history. Previously described cuticles with silica bodies (phytoliths) from the Late Cretaceous period (67-65 Ma) of India indicate that, by the latest Cretaceous, the grass family (Poaceae) consisted of members of the modern subclades PACMAD (Panicoideae-Aristidoideae-Chloridoideae-Micrairoideae-Arundinoideae-Danthonioideae) and BEP (Bambusoideae-Ehrhartoideae-Pooideae), including a taxon with proposed affinities to Ehrhartoideae. Here we describe additional fossils and show that, based on phylogenetic analyses that combine molecular genetic data and epidermal and phytolith features across Poaceae, these can be assigned to the rice tribe, Oryzeae, of grass subfamily Ehrhartoideae. The new Oryzeae fossils suggest substantial diversification within Ehrhartoideae by the Late Cretaceous, pushing back the time of origin of Poaceae as a whole. These results, therefore, necessitate a re-evaluation of current models for grass evolution and palaeobiogeography.

  7. Dated historical biogeography of the temperate Loliinae (Poaceae, Pooideae) grasses in the northern and southern hemispheres.

    Science.gov (United States)

    Inda, Luis A; Segarra-Moragues, José Gabriel; Müller, Jochen; Peterson, Paul M; Catalán, Pilar

    2008-03-01

    Divergence times and biogeographical analyses have been conducted within the Loliinae, one of the largest subtribes of temperate grasses. New sequence data from representatives of the almost unexplored New World, New Zealand, and Eastern Asian centres were added to those of the panMediterranean region and used to reconstruct the phylogeny of the group and to calculate the times of lineage-splitting using Bayesian approaches. The traditional separation between broad-leaved and fine-leaved Festuca species was still maintained, though several new broad-leaved lineages fell within the fine-leaved clade or were placed in an unsupported intermediate position. A strong biogeographical signal was detected for several Asian-American, American, Neozeylandic, and Macaronesian clades with different affinities to both the broad and the fine-leaved Festuca. Bayesian estimates of divergence and dispersal-vicariance analyses indicate that the broad-leaved and fine-leaved Loliinae likely originated in the Miocene (13My) in the panMediterranean-SW Asian region and then expanded towards C and E Asia from where they colonized the New World. Further expansions in America (10-3.8My) showed a predominant migratory route from North to South (N Americathe AndesPatagonia). This late Tertiary scenario of successive colonizations and secondary polyploid radiations in the southern hemisphere from the northern hemisphere was accompanied by occasional transcontinental long-distance dispersal events between South America and New Zealand. Multiple Pliocene dispersal events (3.6-2.5My) from the near SW European and NW African continents gave rise to the Macaronesian Loliinae flora, while a more recent Pleistocene origin (2-1My) is hypothesized for the high polyploid lineages that successfully colonized newly deglaciated areas in both hemispheres.

  8. Las Poáceas del Parque Nacional Yanachaga-Chemillén (Oxapampa, Perú. Parte II: Pooideae, Centothecoideae, Arundinoideae, Chloridoideae y Panicoideae

    Directory of Open Access Journals (Sweden)

    María I. La-Torre

    2013-06-01

    Full Text Available Se presenta la segunda parte de un estudio taxonómico de la Familia Poaceae del Parque Nacional Yanachaga-Chemillén y zonas aledañas (Oxapampa, Pasco, Perú. Se presentan 63 especies de Poáceas de las subfamilias Pooideae, Centothecoideae, Arundinoideae, Chloridoideae y Panicoideae, las cuales están incluidas en 37 géneros y 12 tribus. Se incluye una breve descripción de los géneros. Se ha elaborado claves para diferenciar los géneros y especies. Para cada especie se indica su ecología, distribución y el material estudiado.

  9. Evidence for adaptive evolution of low-temperature stress response genes in a Pooideae grass ancestor

    DEFF Research Database (Denmark)

    Vigeland, Magnus D; Spannagl, Manuel; Asp, Torben

    2013-01-01

    Adaptation to temperate environments is common in the grass subfamily Pooideae, suggesting an ancestral origin of cold climate adaptation. Here, we investigated substitution rates of genes involved in low-temperature-induced (LTI) stress responses to test the hypothesis that adaptive molecular...... evolution of LTI pathway genes was important for Pooideae evolution. Substitution rates and signatures of positive selection were analyzed using 4330 gene trees including three warm climate-adapted species (maize (Zea mays), sorghum (Sorghum bicolor), and rice (Oryza sativa)) and five temperate Pooideae...... species (Brachypodium distachyon, wheat (Triticum aestivum), barley (Hordeum vulgare), Lolium perenne and Festuca pratensis). Nonsynonymous substitution rate differences between Pooideae and warm habitat-adapted species were elevated in LTI trees compared with all trees. Furthermore, signatures...

  10. Anatomia foliar como subsídio à taxonomia de espécies do Complexo Briza L. (Poaceae: Pooideae: Poeae Leaf anatomy as a taxonomic tool for Briza Complex species (Poaceae: Pooideae: Poeae

    Directory of Open Access Journals (Sweden)

    Carla Maria Garlet de Pelegrin

    2009-09-01

    Full Text Available O objetivo deste trabalho foi verificar a importância da anatomia foliar, visando a fornecer subsídios para a taxonomia do Complexo Briza, cuja circunscrição vem sendo objeto de discussão. Porções medianas da segunda folha abaixo da inflorescência de 21 táxons do Complexo Briza e um de Erianthecium Parodi foram coletadas, fixadas e processadas de acordo com a metodologia usual em microscopia óptica. Todas as espécies estudadas apresentam padrão anatômico festucóide, característico de gramíneas C3. Os resultados mostram que os caracteres da face abaxial da epiderme relativos à presença/ausência de células suberosas e à forma dos corpos silicosos são úteis para compreender as relações taxonômicas no Complexo Briza, distinguindo as espécies eurasiáticas das americanas. Da mesma forma, alguns caracteres da secção transversal da lâmina foliar como forma da lâmina, quantidade de esclerênquima e estrutura do mesofilo. Por outro lado, com relação às espécies americanas do Complexo Briza, os três agrupamentos aqui obtidos não correspondem a nenhuma proposta anterior de categorias taxonômicas genéricas ou infragenéricas.The aim of this study was to analyze leaf anatomy of selected taxa of the Briza Complex and also of a related genus, Erianthecium Parodi, to provide data for the taxonomy of the Complex, whose circumscription is being discussed. Middle portions of the second leaf below the inflorescence of 21 taxa of the Briza Complex and of Erianthecium bulbosum were collected, fixed and processed according to conventional methodology for light microscopy. All species present anatomical patterns typical of festucoid and C3 grasses. The results suggest that the characters of the abaxial surface of the epidermis such as presence/absence of cork cells and shape of silica bodies are useful for understanding the taxonomic relationships within the Briza Complex, distinguishing Eurasiatic species from American species. The same applies to several characters of the leaf blade in cross-section, e.g. blade shape, amount of sclerenchyma and structure of the mesophyll. On the other hand, in the American species of the "Briza Complex", the three groups obtained here do not agree with any previous proposal of generic or infrageneric taxonomic categories.

  11. Evolution of the miR5200-FLOWERING LOCUS T flowering time regulon in the temperate grass subfamily Pooideae.

    Science.gov (United States)

    McKeown, Meghan; Schubert, Marian; Preston, Jill C; Fjellheim, Siri

    2017-09-01

    Flowering time is a carefully regulated trait controlled primarily through the action of the central genetic regulator, FLOWERING LOCUS T (FT). Recently it was demonstrated that a microRNA, miR5200, targets the end of the second exon of FT under short-day photoperiods in the grass subfamily Pooideae, thus preventing FT transcripts from reaching threshold levels under non-inductive conditions. Pooideae are an interesting group in that they rapidly diversified from the tropics into the northern temperate region during a major global cooling event spanning the Eocene-Oligocene transition. We hypothesize that miR5200 photoperiod-sensitive regulation of Pooideae flowering time networks assisted their transition into northern seasonal environments. Here, we test predictions derived from this hypothesis that miR5200, originally found in bread wheat and later identified in Brachypodium distachyon, (1) was present in the genome of the Pooideae common ancestor, (2) is transcriptionally regulated by photoperiod, and (3) is negatively correlated with FT transcript abundance, indicative of miR5200 regulating FT. Our results demonstrate that miR5200 did evolve at or around the base of Pooideae, but only acquired photoperiod-regulated transcription within the Brachypodium lineage. Based on expression profiles and previous data, we posit that the progenitor of miR5200 was co-regulated with FT by an unknown mechanism. Copyright © 2017 The Author(s). Published by Elsevier Inc. All rights reserved.

  12. CATÁLOGO DE LA FAMILIA POACEAE EN COLOMBIA

    Directory of Open Access Journals (Sweden)

    Diego Giraldo-Cañas

    2011-01-01

    distribución asociada con la altura sobre el nivel del mar y/o con la precipitación; así tenemos que las Panicoideae son más diversas en las tierras bajas y húmedas y en áreas abiertas de zonas subandinas, las Pooideae en las tierras alto-andinas (páramos, las Chloridoideae en las áreas secas, los bambúes herbáceos en la Región Amazónica y los bambúes leñosos en la Región Andina. Las Poaceae constituyen la sexta familia más rica en la flora de Colombia, después de las Orchidaceae, las Asteraceae, las Rubiaceae, las Fabaceae y las Melastomataceae.

  13. Early inflorescence development in the grasses (Poaceae

    Directory of Open Access Journals (Sweden)

    Elizabeth A. Kellogg

    2013-07-01

    Full Text Available The shoot apical meristem of grasses produces the primary branches of the inflorescence, controlling inflorescence architecture and hence seed production. Whereas leaves are produced in a distichous pattern, with the primordia separated from each other by an angle of 180o, inflorescence branches are produced in a spiral in most species. The morphology and developmental genetics of the shift in phyllotaxis have been studied extensively in maize and rice. However, in wheat, Brachypodium, and oats, all in the grass subfamily Pooideae, the change in phyllotaxis does not occur; primary inflorescence branches are produced distichously. It is unknown whether the distichous inflorescence originated at the base of Pooideae, or whether it appeared several times independently. In this study, we show that Brachyelytrum, the genus sister to all other Pooideae has spiral phyllotaxis in the inflorescence, but that in the remaining 3000+ species of Pooideae, the phyllotaxis is two-ranked. These two-ranked inflorescences are not perfectly symmetrical, and have a clear front and back; this developmental axis has never been described in the literature and it is unclear what establishes its polarity. Strictly distichous inflorescences appear somewhat later in the evolution of the subfamily. Two-ranked inflorescences also appear in a few grass outgroups and sporadically elsewhere in the family, but unlike in Pooideae do not generally correlate with a major radiation of species. After production of branches, the inflorescence meristem may be converted to a spikelet meristem or may simply abort; this developmental decision appears to be independent of the branching pattern.

  14. IDENTIFIKASI TUMBUHAN SUKU POACEAE SEBAGAI SUPLEMEN MATAKULIAH KEANEKARAGAMAN TUMBUHAN

    Directory of Open Access Journals (Sweden)

    Desy Yanuarita Wulandari

    2017-01-01

    Full Text Available Poaceae known as plants used as food ingredients in Indonesian. One area thas has high level diversity of plants Poaceae is Tahura R. Soerjo. Morphological characterization Poaceae in that region are still rare. The Goal for this research are to identify Poaceae tribes, and make photography Poaceae data that can be used as a supplement on Diversity of Plants course. This study included descriptive exploratory study with free cruising method. The species Poaceae has identified are Bambusa multiplex, Dendrocalamus asper, Digitaria radicosa, Echinochloa sp, Eragrostis unioloides, Lophatherum gracile, Oplismenus burmanni, Paspalidium flavidum, Pennisetum alopecuroides, Phragmites karka, Setaria parviflor. Suku Poaceae dikenal sebagai tumbuhan yang dimanfaatkan sebagai bahan pangan masyarakat Indonesia. Salah satu daerah yang memiliki tingkat keanekaragaman tumbuhan Poaceae adalah di Tahura R. Soerjo. Karakterisasi morfologi terkait suku Poaceae di daerah tersebut masih sedikit. Tujuan dalam penelitian ini adalah untuk identifikasi suku Poaceae, membuat data fotografi suku Poaceae sehingga dapat digunakan sebagai suplemen keanekaragaman tumbuhan. Penelitian ini termasuk penelitian deskriptif eksploratif dengan metode jelajah bebas. Sebelas spesies suku Poaceae yang telah teridentifikasi, yaitu Bambusa multiplex, Dendrocalamus asper, Digitaria radicosa, Echinochloa sp, Eragrostis unioloides, Lophatherum gracile, Oplismenus burmanni, Paspalidium flavidum, Pennisetum alopecuroides, Phragmites karka, Setaria parviflora.

  15. Manual Control de calidad en productos textiles y afines

    OpenAIRE

    Alonso Felipe, Jose Vicente

    2015-01-01

    El campo de los materiales textiles y afines no suele estar incluido dentro de la disciplina de Conocimiento de materiales o en ocasiones suele estar mínimamente contemplado dentro del área de materiales plásticos y polímeros; por lo cual en general suele ser muy desconocido en la formación de ingenieros y técnicos. Históricamente en las escuelas de ingenieros industriales se encontraba la especialización en industrias textiles, aunque con posterioridad pasó a formar una carrera propia como t...

  16. Relevance of Allergenic Sensitization to Cynodon dactylon and Phragmites communis: Cross-reactivity With Pooideae Grasses.

    Science.gov (United States)

    López-Matas, M A; Moya, R; Cardona, V; Valero, A; Gaig, P; Malet, A; Viñas, M; García-Moral, A; Labrador, M; Alcoceba, E; Ibero, M; Carnés, J

    The homologous group of sweet grasses belongs to the Pooideae subfamily, but grass pollen species from other subfamilies can also cause allergy, such as Cynodon dactylon (Chloridoideae) and Phragmites communis (Arundinoideae). C dactylon and P communis have not been included in the sweet grasses homologous group because of their low cross-reactivity with other grasses. The aims of this study were to investigate the profile of sensitization to C dactylon and P communis in patients sensitized to grasses and to analyze cross-reactivity between these 2 species and temperate grasses. Patients were skin prick tested with a grass mixture (GM). Specific IgE to GM, C dactylon, P communis, Cyn d 1, and Phl p 1 was measured by ImmunoCAP. A pool of sera was used for the immunoblot assays. Cross-reactivity was studied by ELISA and immunoblot inhibition. Thirty patients had sIgE to GM. Twenty-four (80%) had positive results for C dactylon, 27 (90%) for P communis, 22 (73.3%) for nCyn d 1, and 92.9% for rPhl p 1. Bands were detected in the 3 extracts by immunoblot. Inhibition of GM was not observed with C dactylon or P communis by immunoblot or ELISA inhibition. When C dactylon or P communis were used in the solid phase, GM produced almost complete inhibition. Eighty percent of patients sensitized to grasses were also sensitized to C dactylon and 90% were sensitized to P communis. Sensitization to these species seems to be induced by allergens different to those in sweet grasses.

  17. Forma de crecimiento en Leptochloa Chloridiformis (Poaceae

    Directory of Open Access Journals (Sweden)

    Mariel G. Perreta

    2000-01-01

    Full Text Available Perreta, M. G., Tivano, J. C. & Vegetti, A. C. 2000. Forma de crecimiento en Leptochloachloridiformis (Poaceae. Darwiniana 38(3-4: 219-226.El objetivo de este trabajo fue analizar la forma de crecimiento de Leptochloa chloridiformis (Hack.Parodi. En esta especie perenne la ramificación ocurre principalmente a través de yemas axilarespresentes en la zona de innovación. Este sistema de ramificación genera una planta cespitosa, en la cual lasconexiones entre unidades estructurales son rizomas cortos. Dependiendo de su posición estas conexio-nes muestran diferentes tendencias en relación a la desarticulación estructural. En algunas plantas seobservó ramificación en la zona de entrenudos largos posiblemente debido a cambios ambientalesrelacionados con las distintas estaciones

  18. Linealización entrada/salida de sistemas no lineales afines utilizando un filtro

    Directory of Open Access Journals (Sweden)

    Alberto Delgado

    2000-01-01

    Full Text Available La linealización Entrada/Salida (E/S, dentro del marco teórico del control geométrico, es una técnica madura para sistemas no lineales afines. Esta técnica cancela los términos no lineales de la planta, usando una retroalimentación de estado no lineal, y produce una dinámica E/S lineal para la planta. En este artículo se muestra que un filtro D(s puede utilizarse para Iinealizar sistemas no lineales afines en lugar de aplicar una retroalimentación de estado no lineal que requiere conocer las ecuaciones exactas de la planta, su grado relativo, y la medición completa del vector de estado. En este nuevo enfoque el único requisito es conocer el grado relativo del sistema no lineal afino.

  19. Nature of ergastic substances in some Poaceae seeds | Idu | African ...

    African Journals Online (AJOL)

    Seeds of 48 species of Poaceae were examined for the presence of alkaloid, protein, fats and oil, inulin, starch and tannins. All taxa investigated indicated the presence of starch, fats and oils and protein and were devoid of tannins and inulin. Only 12 seed samples indicated the presence of alkaloids. The Positively ...

  20. Nature of ergastic substances in some Poaceae seeds

    African Journals Online (AJOL)

    ajl yemi

    2011-08-29

    Aug 29, 2011 ... 2Department of Botany, Ambrose Alli University, PMB. 14, Ekpoma, Edo State, Nigeria. Accepted 6 May, 2011. Seeds of 48 species of Poaceae were examined for the presence of alkaloid, protein, fats and oil, inulin, starch and tannins. All taxa investigated indicated the presence of starch, fats and oils and ...

  1. Retórica contrastiva y enseñanza del discurso formal en lenguas afines

    Directory of Open Access Journals (Sweden)

    Pilar Robles Garrote

    2014-08-01

    Full Text Available Normal 0 21 false false false ES X-NONE X-NONE El presente artículo trata de evidenciar la utilidad de la retórica contrastiva en la enseñanza del discurso formal en lenguas afines, aportando algunos datos empíricos obtenidos en un análisis lingüístico cuyo objetivo principal es determinar los puntos en común y divergencias encontradas en algunos recursos estilísticos propios del lenguaje formal en lengua española e italiana. Es un estudio de carácter exploratorio realizado a partir de un corpus oral de conferencias dictadas en lengua española e italiana por oradores nativos. Tras analizar y comparar los recursos estilísticos utilizados por los informantes (preguntas, ejemplos, citas y reiteraciones, los resultados revelan que, si bien los recursos del discurso oral formal encontrados en las conferencias analizadas poseen características análogas, existen divergencias entre estas dos lenguas afines que pueden confluir en una percepción distinta del aspecto pragmático.

  2. Poaceae pollen as the leading aeroallergen worldwide: A review.

    Science.gov (United States)

    García-Mozo, H

    2017-12-01

    The Poaceae family comprises over 12 000 wind-pollinated species, which release large amounts of pollen into the atmosphere. Poaceae pollen is currently regarded as the leading airborne biological pollutant and the chief cause of pollen allergy worldwide. Sensitization rates vary by country, and those variations are reviewed here. Grass pollen allergens are grouped according to their protein structure and function. In Poaceae, although species belonging to different subfamilies are characterized by distinct allergen subsets, there is a considerable degree of cross-reactivity between many species. Cross-reactivity between grass pollen protein and fresh fruit pan-allergens is associated with the appearance of food allergies. The additional influence of urban pollution may prompt a more severe immunological response. The timing and the intensity of the pollen season are governed by species genetics, but plant phenology is also influenced by climate; as a result, climate changes may affect airborne pollen concentrations. This article reviews the findings of worldwide research which has highlighted the major impact of climate change on plant phenology and also on the prevalence and severity of allergic disease. © 2017 EAACI and John Wiley and Sons A/S. Published by John Wiley and Sons Ltd.

  3. Novo volume do MACA – Magazine de Arte de Coimbra & Afins

    Directory of Open Access Journals (Sweden)

    Ricardo Pinto

    2012-10-01

    Full Text Available Será lançado em final de Abril de 2010 o nono número do Magazine de Arte de Coimbra e Afins. O MACA é uma revista quadrimestral, fundada em 2008, com distribuição nacional e propriedade da Associação Cultural de Música e Teatro Arte à Parte. Tem vindo a afirmar‑se em diferentes cenas e circuitos do panorama cultural e artístico da cidade e do país, procurando impulsionar a reflexão, o ensaio e a crítica de arte e cultura – eventos, exposições, música, teatro, literatura –, nas suas expressões...

  4. O gênero Chloris (Poaceae) em Pernambuco, Brasil

    OpenAIRE

    Maciel, Jefferson Rodrigues; Silva, Wegliane Campelo da; Costa-e-Silva, Maria Bernadete

    2013-01-01

    Com o objetivo de colaborar com o conhecimento da riqueza de Poaceae em Pernambuco, foi estudado o gênero Chloris Sw. As coletas foram realizadas no estado, bem como dados foram coligidos de levantamento em herbários da região. Foram registradas sete espécies de Chloris em Pernambuco: C. barbata Sw., C. elata Desv., C. exilis Renv., C. gayana Kunth, C. orthonoton Döll, C. pycnothrix Trin. e C. virgata Sw. O gênero apresenta distribuição ampla em todas as zonas fitogeográficas do estado. Chlor...

  5. A Importância da Geomorfologia em Geociências e Áreas Afins

    Directory of Open Access Journals (Sweden)

    Kenitiro Suguio

    2000-12-01

    Full Text Available A extrema importância da geomorfologia em geociências e áreas afins é reconhecida sob vários pontos de vista, principalmente na geologia do Quaternário. Através da morfoestratigrafia é possível realizar o estudo sistemático dos registros geológicos, estabelecendo a sequência dos eventos que lhes deram origem. Através da morfotectônica é possível obter subsídios para um melhor entendimento do arcabouço estrutural de uma área em termos de neotectônica e tectônica quaternária. A morfoclimatologia auxilia na reconstituição da paleoclimatologia de uma área de pesquisa. a paleopedologia permite realizar estudos pedoestratigráficos. Além disso, as mudanças na biosfera (fauna, flora e homem, através dos tempos, serão melhor compreendidas depois das reconstruções paleogeográficas e paleoecológicas.

  6. Chemotaxonomy as a tool for interpreting the cryptic diversity of Poaceae pollen

    NARCIS (Netherlands)

    Julier, A.C.M.; Jardine, P.E.; Coe, A.L.; Gosling, W.D.; Lomax, B.H.; Fraser, W.T.

    2016-01-01

    The uniform morphology of different species of Poaceae (grass) pollen means that identification to below family level using light microscopy is extremely challenging. Poor taxonomic resolution reduces recoverable information from the grass pollen record, for example, species diversity and

  7. Révision du genre Digitaria Haller (Poaceae) au Sénégal ...

    African Journals Online (AJOL)

    Le genre Digitaria Haller (Poaceae) constitue l'un des genres les plus diversifiés des Poaceae du Sénégal avec 19 espèces. Bien qu'il y ait une monographie mondiale du genre, la détermination des espèces reste difficile et repose essentiellement sur les caractères de l'appareil reproducteur. Ce travail, qui est une ...

  8. Genome-wide distribution comparative and composition analysis of the SSRs in Poaceae.

    Science.gov (United States)

    Wang, Yi; Yang, Chao; Jin, Qiaojun; Zhou, Dongjie; Wang, Shuangshuang; Yu, Yuanjie; Yang, Long

    2015-02-15

    The Poaceae family is of great importance to human beings since it comprises the cereal grasses which are the main sources for human food and animal feed. With the rapid growth of genomic data from Poaceae members, comparative genomics becomes a convinent method to study genetics of diffierent species. The SSRs (Simple Sequence Repeats) are widely used markers in the studies of Poaceae for their high abundance and stability. In this study, using the genomic sequences of 9 Poaceae species, we detected 11,993,943 SSR loci and developed 6,799,910 SSR primer pairs. The results show that SSRs are distributed on all the genomic elements in grass. Hexamer is the most frequent motif and AT/TA is the most frequent motif in dimer. The abundance of the SSRs has a positive linear relationship with the recombination rate. SSR sequences in the coding regions involve a higher GC content in the Poaceae than that in the other species. SSRs of 70-80 bp in length showed the highest AT/GC base ratio among all of these loci. The result shows the highest polymorphism rate belongs to the SSRs ranged from 30 bp to 40 bp. Using all the SSR primers of Japonica, nineteen universal primers were selected and located on the genome of the grass family. The information of SSR loci, the SSR primers and the tools of mining and analyzing SSR are provided in the PSSRD (Poaceae SSR Database, http://biodb.sdau.edu.cn/pssrd/). Our study and the PSSRD database provide a foundation for the comparative study in the Poaceae and it will accelerate the study on markers application, gene mapping and molecular breeding.

  9. Pinturas, barnices y afines: composición, formulación y caracterización

    OpenAIRE

    Alonso Felipe, Jose Vicente

    2016-01-01

    El control de calidad en pinturas, barnices y recubrimientos afines está relacionado con su composición, formulación y caracterización. Al hablar de recubrimientos nos referimos a pinturas, temple, barnices, esmaltes, lacas, imprimaciones, e incluso recubrimientos electrolíticos. Se puede definir una pintura líquida como una mezcla heterogénea de componentes que una vez aplicada y seca se transforma en una película continua de espesor más o menos uniforme, sin pegajosidad al tacto y con las c...

  10. Planeamiento estratégico de la industria peruana del vidrio, cerámico, refractarios y afines

    OpenAIRE

    Alva Ayllón, Antonio; Ayala Abad, Jonathan; Muñoz Gálvez, Carlos; Ruiz Reynaga, Juan

    2017-01-01

    xv, 170 h. : il. ; 30 cm. El presente documento consiste en la elaboración del Planeamiento Estratégico de la Industria del Vidrio, Cerámica, Refractarios y afines. El Plan estratégico fue desarrollado tomando en cuenta información actual e histórica respecto a la industria, así como también los factores externos e internos que intervienen en su ciclo productivo. La empresa pertenece al sector manufactura, del rubro Minerales no metálicos y se tiene una amplia información re...

  11. Building supertrees: an empirical assessment using the grass family (Poaceae).

    Science.gov (United States)

    Salamin, Nicolas; Hodkinson, Trevor R; Savolainen, Vincent

    2002-02-01

    Large and comprehensive phylogenetic trees are desirable for studying macroevolutionary processes and for classification purposes. Such trees can be obtained in two different ways. Either the widest possible range of taxa can be sampled and used in a phylogenetic analysis to produce a "big tree," or preexisting topologies can be used to create a supertree. Although large multigene analyses are often favored, combinable data are not always available, and supertrees offer a suitable solution. The most commonly used method of supertree reconstruction, matrix representation with parsimony (MRP), is presented here. We used a combined data set for the Poaceae to (1) assess the differences between an approach that uses combined data and one that uses different MRP modifications based on the character partitions and (2) investigate the advantages and disadvantages of these modifications. Baum and Ragan and Purvis modifications gave similar results. Incorporating bootstrap support associated with pre-existing topologies improved Baum and Ragan modification and its similarity with a combined analysis. Finally, we used the supertree reconstruction approach on 55 published phylogenies to build one of most comprehensive phylogenetic trees published for the grass family including 403 taxa and discuss its strengths and weaknesses in relation to other published hypotheses.

  12. Anther and pollen development in some species of Poaceae (Poales

    Directory of Open Access Journals (Sweden)

    AT. Nakamura

    Full Text Available Anther and pollen development were studied in Olyra humilis Nees, Sucrea monophylla Soderstr, (Bambusoideae, Axonopus aureus P. Beauv., Paspalum polyphyllum Nees ex Trin. (Panicoideae, Eragrostis solida Nees, and Chloris elata Desv. (Chloridoideae. The objective of this study was to characterise, embryologically, these species of subfamilies which are considered basal, intermediate and derivate, respectively. The species are similar to each other and to other Poaceae. They present the following characters: tetrasporangiate anthers; monocotyledonous-type anther wall development, endothecium showing annular thickenings, secretory tapetum; successive microsporogenesis; isobilateral tetrads; spheroidal, tricellular, monoporate pollen grains with annulus and operculum. Nevertheless, the exine patterns of the species studied are distinct. Olyra humilis and Sucrea monophylla (Bambusoideae show a granulose pattern, whereas in the other species, it is insular. In addition, Axonopus aureus and Paspalum polyphyllum (Panicoideae have a compactly insular spinule pattern, while Chloris elata and Eragrostis solida (Chloridoideae show a sparsely insular spinule pattern. The exine ornamentation may be considered an important feature at the infrafamiliar level.

  13. Novedades nomenclaturales en Cenchrus s.l. (Poaceae: Panicoideae: Paniceae

    Directory of Open Access Journals (Sweden)

    Hugo F Gutiérrez

    2012-06-01

    Full Text Available Recientes estudios filogenéticos con datos morfológicos y moleculares aportaron evidencia sobre la monofilia de los géneros Cenchrus, Pennisetum y Odontelytrum y, por ello, se propuso su unificación y transferencia a Cenchrus, el cual tiene prioridad. Resultados preliminares de la revisión taxonómica del género Cenchrus s.l. para América (Gutiérrez, en preparación permitieron detectar problemas nomenclaturales. Para resolver dichos inconvenientes, en el presente trabajo se presentan nueve lectotipificaciones: Cenchrus bambusoides Caro & E.A. Sánchez, C. brevisetus E. Fourn., C. pennisetiformis Hochst. & Steud. var. intermedia Chiov., C. roseus E. Fourn., Gymnotrix mexicana E. Fourn., Hymenachne montana Griseb., Pennisetum amoenum Hochst. ex A. Rich., P. cenchroides Rich. var. hamphilahense Terracc., P. ciliare (L. Link var. anachoreticum Chiov., P. petraeum Steud., P. pringlei Leeke, P. tristachyum (Kunth Spreng. subsp. boliviense Chase, y se propone un nombre nuevo para Gymnotrix crinita Kunth.Nomenclatural novelties in Cenchrus s.l. (Poaceae: Panicoideae: Paniceae. Recent phylogenetic studies with morphological and molecular data provided evidence on the monophyly of the genera Cenchrus, Pennisetum and Odontelytrum. Therefore, these studies propose the unification and transfer of species of Pennisetum and Odontelytrum to the genus Cenchrus, which has priority. Nomenclatural problems were detected when conducting a preliminary taxonomic revision of the genus Cenchrus s.l. from America (Gutiérrez, in preparation. To resolve these inconveniences, nine lectotypifications: Cenchrus bambusoides Caro & E.A. Sánchez, C. brevisetus E. Fourn., C. pennisetiformis Hochst. & Steud. var. intermedia Chiov., C. roseus E. Fourn., Gymnotrix mexicana E. Fourn., Hymenachne montana Griseb., Pennisetum amoenum Hochst. ex A. Rich., P. cenchroides Rich. var. hamphilahense Terracc., P. ciliare (L. Link var. anachoreticum Chiov., P. petraeum Steud., P

  14. Arquivos Brasileiros de Psiquiatria, Neurologia e Ciências Afins: uma fonte com muita história Arquivos Brasileiros de Psiquiatria, Neurologia e Ciências Afins: a source rich in history

    Directory of Open Access Journals (Sweden)

    Cristiana Facchinetti

    2010-12-01

    Full Text Available Surgido em 1905, o Arquivos Brasileiros de Psiquiatria, Neurologia e Ciências Afins foi o primeiro periódico brasileiro especializado na área. Com o nome de Arquivos Brasileiros de Psiquiatria, Neurologia e Medicina Legal, tornou-se, em 1908, veículo de divulgação da Sociedade com o mesmo nome. A partir de 1919 foi publicado como Arquivos Brasileiros de Neuriatria e Psiquiatria. O periódico traz as propostas para a psiquiatria brasileira lideradas por Juliano Moreira, diretor do Hospício Nacional e da Assistência a Alienados do Distrito Federal. Por veicular trabalhos de profissionais do Hospício Nacional, é fonte fundamental para a investigação dos processos diagnósticos e das práticas clínicas e terapêuticas do período. Apresenta-se aqui uma seleção de artigos publicados na revista entre 1905 e 1930, ano da aposentadoria de Moreira.Launched in 1905, the Arquivos Brasileiros de Psiquiatria, Neurologia e Ciências Afins was the first Brazilian periodical specialized in psychiatry, neurology, and related sciences. In 1908, under the new name of Arquivos Brasileiros de Psiquiatria, Neurologia e Medicina Legal, it became the journal of the Society of Psychiatry, Neurology, and Forensic Medicine. Starting in 1919, it was published under the title Arquivos Brasileiros de Neuriatria e Psiquiatria. The periodical presents proposals put forward for this field in Brazil, under the leadership of Juliano Moreira, director of both the National Asylum and of Federal District Assistance for the Insane (Assistência a Alienados do Distrito Federal. Because the journal published articles by healthcare providers from the National Asylum, it is a vital source for researchers of the era's diagnostic processes and clinical and therapeutic practices. This selection of texts was published in its pages between 1905 and 1930, the year Moreira retired.

  15. Potential biological control agents for management of cogongrass (Cyperales: Poaceae) in the southeastern USA

    Science.gov (United States)

    Cogongrass, Imperata cylindrica (L.) Palisot de Beauvois (Cyperales: Poaceae), is a noxious invasive weed in the southeastern USA. Surveys for potential biological control agents of cogongrass were conducted in Asia and East Africa from 2013 to 2016. Several insect herbivores were found that may hav...

  16. Desenvolvimento pós-seminal de espécies de Poaceae (Poales Post-seminal development of Poaceae species (Poales

    Directory of Open Access Journals (Sweden)

    Adriana Tiemi Nakamura

    2009-03-01

    Full Text Available O presente estudo objetivou verificar a existência de um padrão do desenvolvimento pós-seminal em Poaceae. Para tanto, foram estudadas as seguintes espécies: Olyra humilis Nees (Bambusoideae; Axonopus aureus P. Beauv. e Paspalum polyphyllum Nees ex Trin. (Panicoideae; Chloris elata Nees e Eragrostis solida Desv. (Chloridoideae. Procurou-se também comparar as estruturas da plântula de Poaceae com as demais monocotiledôneas. As espécies estudadas são plantas perenes, rizomatosas, cespitosas e apresentam cariopses de tamanhos diferentes. Apresentam sementes albuminosas; embrião lateral, diferenciado, com raiz endógena (adventícia; cotilédone dividido em hiperfilo (escutelo, bainha reduzida e hipofilo (coleóptilo; coleorriza (raiz primária reduzida e mesocótilo (eixo localizado entre o escutelo e coleóptilo. A presença de epiblasto (folha embrionária foi observada em Olyra humilis, Chloris elata e Eragrostis solida. O desenvolvimento pós-seminal é semelhante nas espécies estudadas e forma um padrão em Poaceae. Primeiramente, observa-se a emissão da coleorriza, que cresce no sentido geotrópico positivo, seguida do coleóptilo e plúmula que crescem em sentido contrário, a partir do desenvolvimento do mesocótilo. As primeiras folhas são semelhantes às folhas definitivas (metafilos das espécies, exceto em Olyra humilis, que são modificadas em catafilos e podem ser interpretadas como caráter basal em Bambusoideae. Raiz primária reduzida (coleorriza e hipofilo modificado em coleóptilo são considerados caracteres derivados em Poaceae, quando comparados com as demais monocotiledôneas.This work has aimed to verify the existence of a pattern of the post-seminal development in Poaceae. Thus, Olyra humilis Nees (Bambusoideae; Axonopus aureus P. Beauv. e Paspalum polyphyllum Nees ex Trin. (Panicoideae; Chloris elata Nees e Eragrostis solida Desv. (Chloridoideae have been studied. Besides, it was compared the structures of

  17. A 250 plastome phylogeny of the grass family (Poaceae): topological support under different data partitions

    Science.gov (United States)

    Burke, Sean V.; Wysocki, William P.; Clark, Lynn G.

    2018-01-01

    The systematics of grasses has advanced through applications of plastome phylogenomics, although studies have been largely limited to subfamilies or other subgroups of Poaceae. Here we present a plastome phylogenomic analysis of 250 complete plastomes (179 genera) sampled from 44 of the 52 tribes of Poaceae. Plastome sequences were determined from high throughput sequencing libraries and the assemblies represent over 28.7 Mbases of sequence data. Phylogenetic signal was characterized in 14 partitions, including (1) complete plastomes; (2) protein coding regions; (3) noncoding regions; and (4) three loci commonly used in single and multi-gene studies of grasses. Each of the four main partitions was further refined, alternatively including or excluding positively selected codons and also the gaps introduced by the alignment. All 76 protein coding plastome loci were found to be predominantly under purifying selection, but specific codons were found to be under positive selection in 65 loci. The loci that have been widely used in multi-gene phylogenetic studies had among the highest proportions of positively selected codons, suggesting caution in the interpretation of these earlier results. Plastome phylogenomic analyses confirmed the backbone topology for Poaceae with maximum bootstrap support (BP). Among the 14 analyses, 82 clades out of 309 resolved were maximally supported in all trees. Analyses of newly sequenced plastomes were in agreement with current classifications. Five of seven partitions in which alignment gaps were removed retrieved Panicoideae as sister to the remaining PACMAD subfamilies. Alternative topologies were recovered in trees from partitions that included alignment gaps. This suggests that ambiguities in aligning these uncertain regions might introduce a false signal. Resolution of these and other critical branch points in the phylogeny of Poaceae will help to better understand the selective forces that drove the radiation of the BOP and PACMAD

  18. Two New Records from Lebanon: Chamaesyce nutans (Lag.) Small (Euphorbiaceae) and Eleusine indica (L.) Gaertner (Poaceae)

    OpenAIRE

    HABER, Ricardus M.; SEMAAN, Myrna T.

    2007-01-01

    Chamaesyce nutans (Lag.) Small (Euphorbiaceae) and Eleusine indica (L.) Gaertner (Poaceae) are described as new records for the flora of Lebanon. Specimens of C. nutans collected from roadsides and rocks in a middle mountain forest confirm the occurrence of the species on the western slopes of the Mount Lebanon Range. Additionally, specimens of E. indica were collected from wasteland and roadsides in the coastal town of Kaslik. The species were observed to thrive abundantly in similar habitat...

  19. Assessing universality of DNA barcoding in geographically isolated selected desert medicinal species of Fabaceae and Poaceae

    Science.gov (United States)

    Hussain, Fatma; Ahmed, Nisar; Ghorbani, Abdolbaset

    2018-01-01

    In pursuit of developing fast and accurate species-level molecular identification methods, we tested six DNA barcodes, namely ITS2, matK, rbcLa, ITS2+matK, ITS2+rbcLa, matK+rbcLa and ITS2+matK+rbcLa, for their capacity to identify frequently consumed but geographically isolated medicinal species of Fabaceae and Poaceae indigenous to the desert of Cholistan. Data were analysed by BLASTn sequence similarity, pairwise sequence divergence in TAXONDNA, and phylogenetic (neighbour-joining and maximum-likelihood trees) methods. Comparison of six barcode regions showed that ITS2 has the highest number of variable sites (209/360) for tested Fabaceae and (106/365) Poaceae species, the highest species-level identification (40%) in BLASTn procedure, distinct DNA barcoding gap, 100% correct species identification in BM and BCM functions of TAXONDNA, and clear cladding pattern with high nodal support in phylogenetic trees in both families. ITS2+matK+rbcLa followed ITS2 in its species-level identification capacity. The study was concluded with advocating the DNA barcoding as an effective tool for species identification and ITS2 as the best barcode region in identifying medicinal species of Fabaceae and Poaceae. Current research has practical implementation potential in the fields of pharmaco-vigilance, trade of medicinal plants and biodiversity conservation. PMID:29576968

  20. New records of the Genus Festuca L. (Poaceae for Colombia and Venezuela New records of the Genus Festuca L. (Poaceae for Colombia and Venezuela

    Directory of Open Access Journals (Sweden)

    Stancik Daniel

    2001-07-01

    Full Text Available The genus Festuca L. (Poaceae includes about 350-400 herbaceous species with wide cosmopolitan distribution (Watson & Dallwitz 1992. The center of distribution ofthe genus is in the meadows and steppes of North America and Eurasia. Sorne species are present in Australia, Tasmania, New Zealand, and W and SE Africa. High species diversity is found in the pampas of Argentina and the puna of the Andes, with approximately 40 species in Peru (Tovar 1993,30 in Bolivia (Renvoize 1998, and 30 in Argentina (Türpe 1969. So far, 26 native species are known from the páramos of the northern South America; about seven new species from this region will be described soon (author's unpublished data.The genus Festuca L. (Poaceae includes about 350-400 herbaceous species with wide cosmopolitan distribution (Watson & Dallwitz 1992. The center of distribution ofthe genus is in the meadows and steppes of North America and Eurasia. Sorne species are present in Australia, Tasmania, New Zealand, and W and SE Africa. High species diversity is found in the pampas of Argentina and the puna of the Andes, with approximately 40 species in Peru (Tovar 1993,30 in Bolivia (Renvoize 1998, and 30 in Argentina (Türpe 1969. So far, 26 native species are known from the páramos of the northern South America; about seven new species from this region will be described soon (author's unpublished data.

  1. Scanning electron microscopy of the leaf epidermis of Merostachys Spreng. (Poaceae: Bambusoideae Microscopia eletrônica de varredura da epiderme foliar de Merostachys Spreng. (Poaceae: Bambusoideae

    Directory of Open Access Journals (Sweden)

    Doria Maria Saiter Gomes

    2009-06-01

    Full Text Available This study presents data on leaf micromorphology of 13 species of Merostachys Spreng. (Poaceae: Bambusoideae, a neotropical genus with numerous endemic species. Greatest species richness is found in Central and Southern Brazil, with 41 of the 46 species described. Species were collected in the field at the localities: Itatiaia National Park and Tijuca National Park, Rio de Janeiro State; Fontes do Ipiranga State Park, São Paulo state; Santa Teresa, Espírito Santo State and Rio Doce State Park, Minas Gerais State. Dried plant material came from the herbarium at the São Paulo Botany Institute. The presence of prickles, silica bodies and macro hairs may be especially useful in delimiting species.São apresentados dados relativos à micromorfologia foliar de 13 espécies de Merostachys Spreng. (Poaceae:Bambusoideae, um gênero neotropical, com numerosas espécies endêmicas, que tem sua maior diversidade nas regiões central e sul do Brasil, onde ocorrem 41 das 46 espécies descritas. O material coletado foi obtido nas seguintes localidades: Parque Nacional do Itatiaia e Parque Nacional da Tijuca (RJ; Parque Estadual das Fontes do Ipiranga (SP; Propriedade dos Irmãos Martinelli, Vargem Alta, Santa Teresa (ES e Parque Estadual do Rio Doce (MG. As espécies herborizadas são provenientes do herbário do Instituto de Botânica de São Paulo (SP. Atenção especial é dada à presença de cerdas, corpúsculos silicosos e macropêlos, características que podem ser úteis na delimitação das espécies.

  2. Poaceae vs. Abiotic Stress: Focus on Drought and Salt Stress, Recent Insights and Perspectives

    Directory of Open Access Journals (Sweden)

    Simone Landi

    2017-07-01

    Full Text Available Poaceae represent the most important group of crops susceptible to abiotic stress. This large family of monocotyledonous plants, commonly known as grasses, counts several important cultivated species, namely wheat (Triticum aestivum, rice (Oryza sativa, maize (Zea mays, and barley (Hordeum vulgare. These crops, notably, show different behaviors under abiotic stress conditions: wheat and rice are considered sensitive, showing serious yield reduction upon water scarcity and soil salinity, while barley presents a natural drought and salt tolerance. During the green revolution (1940–1960, cereal breeding was very successful in developing high-yield crops varieties; however, these cultivars were maximized for highest yield under optimal conditions, and did not present suitable traits for tolerance under unfavorable conditions. The improvement of crop abiotic stress tolerance requires a deep knowledge of the phenomena underlying tolerance, to devise novel approaches and decipher the key components of agricultural production systems. Approaches to improve food production combining both enhanced water use efficiency (WUE and acceptable yields are critical to create a sustainable agriculture in the future. This paper analyzes the latest results on abiotic stress tolerance in Poaceae. In particular, the focus will be directed toward various aspects of water deprivation and salinity response efficiency in Poaceae. Aspects related to cell wall metabolism will be covered, given the importance of the plant cell wall in sensing environmental constraints and in mediating a response; the role of silicon (Si, an important element for monocots' normal growth and development, will also be discussed, since it activates a broad-spectrum response to different exogenous stresses. Perspectives valorizing studies on landraces conclude the survey, as they help identify key traits for breeding purposes.

  3. Characterization of polymorphic microsatellites for the invasive grass Microstegium vimineum (Poaceae).

    Science.gov (United States)

    Novy, Ari; Flory, S Luke; Honig, Joshua A; Bonos, Stacy; Hartman, Jean Marie

    2012-02-01

    Microsatellite markers were developed for the invasive plant Microstegium vimineum (Poaceae) to assess its population structure and to facilitate tracking of invasion expansion. Using 454 sequencing, 11 polymorphic and six monomorphic microsatellite primer sets were developed for M. vimineum. The primer sets were tested on individuals sampled from six populations in the United States and China. The polymorphic primers amplified di-, tri-, and tetranucleotide repeats with three to 10 alleles per locus. These markers will be useful for a variety of applications including tracking of invasion dynamics and population genetics studies.

  4. Cross-species amplification of 105 Lolium perenne SSR loci in 23 species within the Poaceae

    DEFF Research Database (Denmark)

    Jensen, Louise Bach; Holm, Preben Bach; Lübberstedt, Thomas

    2007-01-01

    Amplification of 105 Lolium perenne SSR markers was studied in 23 grass species representing seven tribes from three subfamilies of Poaceae. Twelve of the SSR markers are published for the first time. Between 2% and 96% of the SSR markers could be amplified within a given species. A subset of eight...... SSR markers was evaluated for polymorphism across nine of the 23 grass species. Four to seven of the markers were polymorphic within each species, with an average detection of 2.4 alleles per species....

  5. Phalaris canariensis L. (Poaceae: A new alien plant record for Kashmir Himalaya, India

    Directory of Open Access Journals (Sweden)

    Shugufta Rasheed

    2016-03-01

    Full Text Available The correct taxonomic identification assumes first and foremost priority in the scientific documentation of biodiversity. The Kashmir Himalaya, located in the north-western side of the Himalayan biodiversity hotspot, is well-known for its diverse flora which merits immediate scientific documentation. In this context, the present study reports Phalaris canariensis L. (Poaceae as a new alien plant record to the flora of Kashmir Himalaya, India. In this paper, a detailed description, photographs, and comparison of diagnostic characters with allied species are provided to scientifically validate this alien plant record for this Himalayan region.

  6. A new species of Rhopalosiphum (Hemiptera, Aphididae) on Chusquea tomentosa (Poaceae, Bambusoideae) from Costa Rica

    Science.gov (United States)

    Hidalgo, Nicolás Pérez; Martínez-Torres, David; Collantes-Alegre, Jorge Mariano; Muller, William Villalobos; Nafría, Juan M. Nieto

    2012-01-01

    Abstract The new species Rhopalosiphum chusqueae Pérez Hidalgo & Villalobos Muller, is described from apterous viviparous females caught on Chusquea tomentosa in Cerro de la Muerte (Costa Rica). The identity of the species is supported both by the morphological features and by a molecular phylogenetic analysis based on a fragment of the mitochondrial DNA containing the 5’ region of the cytochrome c oxidase 1 (COI) and on the nuclear gene coding for the Elongation factor-1 alpha (EF1α). The taxonomic position of the new species is discussed. An identification key to the Aphidinae species living on plants of Bambusoideae (Poaceae) is presented. PMID:22328859

  7. Rapid and recent world-wide diversification of bluegrasses (Poa, Poaceae and related genera.

    Directory of Open Access Journals (Sweden)

    Matthias H Hoffmann

    Full Text Available Rapid species diversifications provide fascinating insight into the development of biodiversity in time and space. Most biological radiations studied to date, for example that of cichlid fishes or Andean lupines, are confined to isolated geographical areas like lakes, islands or island-like regions. Using DNA sequence data of the ribosomal internal transcribed spacer (ITS for many species of the Poa alliance, a group comprising about 775 C3 grass species, revealed rapid and parallel diversifications in various parts of the world. Some of these radiations are restricted to isolated areas like the Andes, whereas others are typical of the lowlands of mainly the northern hemisphere. These radiations thus are not restricted to island-like areas and are seemingly actively ongoing. The ages of the diversifying clades are estimated to be 2.5-0.23 million years (Myr. Conservative diversification rates in the Poa alliance amount to 0.89-3.14 species per Myr, thus are in the order of, or even exceeding, other instances of well-known radiations. The grass radiations of the mainly cold-adapted Poa alliance coincide with the Late Tertiary global cooling, which resulted in the retreat of forests and the subsequent formation of cold-adapted grasslands especially in the northern, but also in parts of the southern hemisphere. The cold tolerance, suggested to be one of the ecological key innovations, may have been acquired during the early diversification of the subfamily Pooideae, but became significant millions of years later during the Pliocene/Pleistocene radiation of the Poa alliance.

  8. Reconstructing the Evolutionary History of Paralogous APETALA1/FRUITFULL-Like Genes in Grasses (Poaceae)

    Science.gov (United States)

    Preston, Jill C.; Kellogg, Elizabeth A.

    2006-01-01

    Gene duplication is an important mechanism for the generation of evolutionary novelty. Paralogous genes that are not silenced may evolve new functions (neofunctionalization) that will alter the developmental outcome of preexisting genetic pathways, partition ancestral functions (subfunctionalization) into divergent developmental modules, or function redundantly. Functional divergence can occur by changes in the spatio-temporal patterns of gene expression and/or by changes in the activities of their protein products. We reconstructed the evolutionary history of two paralogous monocot MADS-box transcription factors, FUL1 and FUL2, and determined the evolution of sequence and gene expression in grass AP1/FUL-like genes. Monocot AP1/FUL-like genes duplicated at the base of Poaceae and codon substitutions occurred under relaxed selection mostly along the branch leading to FUL2. Following the duplication, FUL1 was apparently lost from early diverging taxa, a pattern consistent with major changes in grass floral morphology. Overlapping gene expression patterns in leaves and spikelets indicate that FUL1 and FUL2 probably share some redundant functions, but that FUL2 may have become temporally restricted under partial subfunctionalization to particular stages of floret development. These data have allowed us to reconstruct the history of AP1/FUL-like genes in Poaceae and to hypothesize a role for this gene duplication in the evolution of the grass spikelet. PMID:16816429

  9. Complete plastid genome sequence of goosegrass (Eleusine indica) and comparison with other Poaceae.

    Science.gov (United States)

    Zhang, Hui; Hall, Nathan; McElroy, J Scott; Lowe, Elijah K; Goertzen, Leslie R

    2017-02-05

    Eleusine indica, also known as goosegrass, is a serious weed in at least 42 countries. In this paper we report the complete plastid genome sequence of goosegrass obtained by de novo assembly of paired-end and mate-paired reads generated by Illumina sequencing of total genomic DNA. The goosegrass plastome is a circular molecule of 135,151bp in length, consisting of two single-copy regions separated by a pair of inverted repeats (IRs) of 20,919 bases. The large (LSC) and the small (SSC) single-copy regions span 80,667 bases and 12,646 bases, respectively. The plastome of goosegrass has 38.19% GC content and includes 108 unique genes, of which 76 are protein-coding, 28 are transfer RNA, and 4 are ribosomal RNA. The goosegrass plastome sequence was compared to eight other species of Poaceae. Although generally conserved with respect to Poaceae, this genomic resource will be useful for evolutionary studies within this weed species and the genus Eleusine. Copyright © 2016. Published by Elsevier B.V.

  10. Bailini, Sonia (2016. La interlengua de lenguas afines. El español de los italianos, el italiano de los españoles. Milano: LED.

    Directory of Open Access Journals (Sweden)

    Floriana di Gesù

    2017-07-01

    Full Text Available El volumen del que se ofrece una reseña analiza el fenómeno de la interlengua de lenguas afines: el español de los aprendientes italianos y el italiano de los aprendientes españoles. El objetivo principal del volumen es el análisis cuantitativo y cualitativo de la interlengua de estas dos tipologías de aprendientes, a través del estudio de dos corpus paralelos y longitudinales.

  11. In silico characterization of boron transporter (BOR1 protein sequences in Poaceae species

    Directory of Open Access Journals (Sweden)

    Ertuğrul Filiz

    2013-01-01

    Full Text Available Boron (B is essential for the plant growth and development, and its primary function is connected with formation of the cell wall. Moreover, boron toxicity is a shared problem in semiarid and arid regions. In this study, boron transporter protein (BOR1 sequences from some Poaceae species (Hordeum vulgare subsp. vulgare, Zea mays, Brachypodium distachyon, Oryza sativa subsp. japonica, Oryza sativa subsp. indica, Sorghum bicolor, Triticum aestivum were evaluated by bioinformatics tools. Physicochemical analyses revealed that most of BOR1 proteins were basic character and had generally aliphatic amino acids. Analysis of the domains showed that transmembrane domains were identified constantly and three motifs were detected with 50 amino acids length. Also, the motif SPNPWEPGSYDHWTVAKDMFNVPPAYIFGAFIPATMVAGLYYFDHSVASQ was found most frequently with 25 repeats. The phylogenetic tree showed divergence into two main clusters. B. distachyon species were clustered separately. Finally, this study contributes to the new BOR1 protein characterization in grasses and create scientific base for in silico analysis in future.

  12. La familia Poaceae del distrito de Arahuay (Canta, Lima, Perú

    Directory of Open Access Journals (Sweden)

    Paúl Gonzáles

    2011-08-01

    Full Text Available Se reportan para el distrito de Arahuay (Canta, Lima, Perú (zona baja y media un total de 49 especies de la familia Poaceae agrupadas en 28 géneros, 14 tribus y 4 subfamilias. El género Poa es el más diverso con cinco especies, seguido por Eragrostis y Nassella con cuatro especies cada una. Las especies Calamagrostis spiciformis Hack. ex Stuck., Chloris halophila Parodi, Lamprothyrsus peruvianus Hitchc., Festuca glyceriantha Pilg., Lolium multiflorum Lam. y Poa supina Schrad. son nuevos reportes para el departamento de Lima. Se presentan claves dicotómicas para la determinación de los géneros y para las especies en los casos pertinentes. Para cada especie se incluye datos sobre su hábitat, distribución y el material estudiado.

  13. Poaceae: Triticeae

    Indian Academy of Sciences (India)

    Department of Bioengineering and Biotechnology, Qingdao University of Science and Technology, Qingdao, Shandong ... entire chloroplast DNA sequence of common wheat (T. aes- ... a CTAB method as previously described by Liu et al.

  14. Poaceae: Paniceae

    Indian Academy of Sciences (India)

    1987; Bernini and Marin-Morales. 2001; Mendes-Bonato et al. 2002, 2006; Utsunomiya et al. 2005). More recently, a new number, x = 6, was determined for several accessions of B. dictyoneura (Risso-Pascotto et al. 2006), a species suggested to belong to the same agamic complex as B. humidicola (Renvoize et al. 1996).

  15. Integrated Formative Actions (AFIN: results and challenges of preparatory course for admission to higher education at the Federal University of Uberlândia

    Directory of Open Access Journals (Sweden)

    Adevailton Bernardo dos Santos

    2017-12-01

    Full Text Available The Integrated Formative Actions Program (AFIN is part of an extension context of formation and aims to support and assist the entry of high school students in situations of economic vulnerability in higher education and to contribute to the formation of major students through teaching practices. The program has the characteristics of a popular preparatory course and began its activities in the second semester of 2015, with 115 students, and its continuity in 2016 expanded to 367 students, achieving significant results in the goals set. This text aims to describe the results of this Program and analyze it considering other similar initiatives and popular education references. The analysis presents elements of this contribution, but also points to the possibility of improving the action with a view to achieving its objective.

  16. Development of Simple Sequence Repeats (SSR) markers in Setaria italica (Poaceae) and cross-amplification in related species.

    Science.gov (United States)

    Lin, Heng-Sheng; Chiang, Chih-Yun; Chang, Song-Bin; Kuoh, Chang-Sheng

    2011-01-01

    Foxtail millet is one of the world's oldest cultivated crops. It has been adopted as a model organism for providing a deeper understanding of plant biology. In this study, 45 simple sequence repeats (SSR) markers of Setaria italica were developed. These markers showing polymorphism were screened in 223 samples from 12 foxtail millet populations around Taiwan. The most common dinucleotide and trinucleotide repeat motifs are AC/TG (84.21%) and CAT (46.15%). The average number of alleles (N(a)), the average heterozygosities observed (H(o)) and expected (H(e)) are 3.73, 0.714, 0.587, respectively. In addition, 24 SSR markers had shown transferability to six related Poaceae species. These new markers provide tools for examining genetic relatedness among foxtail millet populations and other related species. It is suitable for germplasm management and protection in Poaceae.

  17. Development of Simple Sequence Repeats (SSR Markers in Setaria italica (Poaceae and Cross-Amplification in Related Species

    Directory of Open Access Journals (Sweden)

    Chih-Yun Chiang

    2011-11-01

    Full Text Available Foxtail millet is one of the world’s oldest cultivated crops. It has been adopted as a model organism for providing a deeper understanding of plant biology. In this study, 45 simple sequence repeats (SSR markers of Setaria italica were developed. These markers showing polymorphism were screened in 223 samples from 12 foxtail millet populations around Taiwan. The most common dinucleotide and trinucleotide repeat motifs are AC/TG (84.21% and CAT (46.15%. The average number of alleles (Na, the average heterozygosities observed (Ho and expected (He are 3.73, 0.714, 0.587, respectively. In addition, 24 SSR markers had shown transferability to six related Poaceae species. These new markers provide tools for examining genetic relatedness among foxtail millet populations and other related species. It is suitable for germplasm management and protection in Poaceae.

  18. Molecular, phylogenetic and comparative genomic analysis of the cytokinin oxidase/dehydrogenase gene family in the Poaceae.

    Science.gov (United States)

    Mameaux, Sabine; Cockram, James; Thiel, Thomas; Steuernagel, Burkhard; Stein, Nils; Taudien, Stefan; Jack, Peter; Werner, Peter; Gray, John C; Greenland, Andy J; Powell, Wayne

    2012-01-01

    The genomes of cereals such as wheat (Triticum aestivum) and barley (Hordeum vulgare) are large and therefore problematic for the map-based cloning of agronomicaly important traits. However, comparative approaches within the Poaceae permit transfer of molecular knowledge between species, despite their divergence from a common ancestor sixty million years ago. The finding that null variants of the rice gene cytokinin oxidase/dehydrogenase 2 (OsCKX2) result in large yield increases provides an opportunity to explore whether similar gains could be achieved in other Poaceae members. Here, phylogenetic, molecular and comparative analyses of CKX families in the sequenced grass species rice, brachypodium, sorghum, maize and foxtail millet, as well as members identified from the transcriptomes/genomes of wheat and barley, are presented. Phylogenetic analyses define four Poaceae CKX clades. Comparative analyses showed that CKX phylogenetic groupings can largely be explained by a combination of local gene duplication, and the whole-genome duplication event that predates their speciation. Full-length OsCKX2 homologues in barley (HvCKX2.1, HvCKX2.2) and wheat (TaCKX2.3, TaCKX2.4, TaCKX2.5) are characterized, with comparative analysis at the DNA, protein and genetic/physical map levels suggesting that true CKX2 orthologs have been identified. Furthermore, our analysis shows CKX2 genes in barley and wheat have undergone a Triticeae-specific gene-duplication event. Finally, by identifying ten of the eleven CKX genes predicted to be present in barley by comparative analyses, we show that next-generation sequencing approaches can efficiently determine the gene space of large-genome crops. Together, this work provides the foundation for future functional investigation of CKX family members within the Poaceae. © 2011 National Institute of Agricultural Botany (NIAB). Plant Biotechnology Journal © 2011 Society for Experimental Biology, Association of Applied Biologists and Blackwell

  19. Complete chloroplast genome sequence of common bermudagrass (Cynodon dactylon (L.) Pers.) and comparative analysis within the family Poaceae.

    Science.gov (United States)

    Huang, Ya-Yi; Cho, Shu-Ting; Haryono, Mindia; Kuo, Chih-Horng

    2017-01-01

    Common bermudagrass (Cynodon dactylon (L.) Pers.) belongs to the subfamily Chloridoideae of the Poaceae family, one of the most important plant families ecologically and economically. This grass has a long connection with human culture but its systematics is relatively understudied. In this study, we sequenced and investigated the chloroplast genome of common bermudagrass, which is 134,297 bp in length with two single copy regions (LSC: 79,732 bp; SSC: 12,521 bp) and a pair of inverted repeat (IR) regions (21,022 bp). The annotation contains a total of 128 predicted genes, including 82 protein-coding, 38 tRNA, and 8 rRNA genes. Additionally, our in silico analyses identified 10 sets of repeats longer than 20 bp and predicted the presence of 36 RNA editing sites. Overall, the chloroplast genome of common bermudagrass resembles those from other Poaceae lineages. Compared to most angiosperms, the accD gene and the introns of both clpP and rpoC1 genes are missing. Additionally, the ycf1, ycf2, ycf15, and ycf68 genes are pseudogenized and two genome rearrangements exist. Our phylogenetic analysis based on 47 chloroplast protein-coding genes supported the placement of common bermudagrass within Chloridoideae. Our phylogenetic character mapping based on the parsimony principle further indicated that the loss of the accD gene and clpP introns, the pseudogenization of four ycf genes, and the two rearrangements occurred only once after the most recent common ancestor of the Poaceae diverged from other monocots, which could explain the unusual long branch leading to the Poaceae when phylogeny is inferred based on chloroplast sequences.

  20. Inclusion of Visually Impaired in the School Programme Scheduled Visit of the Museu de Astronomia e Ciências Afins (MAST). (Breton Title: Inclusão de Deficientes Visuais no Programa de Visita Escolar Programada do Museu de Astronomia e Ciências Afins (MAST).) Inclusión de Discapacitados Visuales en el Programa Escolar Programado del Museo de Astronomía y Ciencias Afines (MAST)

    Science.gov (United States)

    de Oliveira Gonçalves, Carla; da Conceição Barbosa-Lima, Maria

    2013-07-01

    Inclusive Education in Brazil, contemplated in the 1988 Constitution and in the Law of Guidelines and Bases of National Education (9.394/96) highlights the importance and urgency of promoting inclusive education as a formative element of nationality. Inclusive Education refers to all people who are struggling in school. Inclusion should be in all educational institutions (formal and informal). Our goal in the graduation final task was to report the experience of mediation to visually impaired students of the Instituto Benjamin Constant (IBC) at the Museu de Astronomia e Ciências Afins (MAST), and also suggest some modifications and present new proposals for the School Visit Program (VEP) through a specially constructed apparatus, where the sky can be sensed near the latitude of Rio de Janeiro. A educação inclusiva no Brasil, contemplada na Constituição de 1988 e a Lei de Diretrizes e Bases da Educação Nacional (9.394/96), destaca a importância e urgência de se promover a inclusão escolar como elemento formador da nacionalidade. A educação inclusiva diz respeito a todas as pessoas que enfrentam dificuldades na escola. A inclusão deve estar em todas as instituições educacionais (formais e não formais). Nosso objetivo, no trabalho de final de curso de licenciatura, foi apresentar o relato de experiência de mediação aos alunos deficientes visuais do Instituto Benjamin Constant (IBC) no Museu de Astronomia e Ciências Afins (MAST), as modificações e novas propostas para o Programa de Visita Escolar Programada (VEP) através de um aparelho especialmente construído onde se pode perceber o céu na latitude próxima a do Rio de Janeiro. La educación inclusiva en el Brasil, contemplada en la Constitución de 1988 y en la Ley de Directrices y Bases de la Educación Nacional (9.394/96), destaca la importancia y la urgencia de promover la inclusión escolar como elemento formador de la nacionalidad. La educación inclusiva se refiere a todas las personas

  1. Seed storage protein gene promoters contain conserved DNA motifs in Brassicaceae, Fabaceae and Poaceae

    Science.gov (United States)

    Fauteux, François; Strömvik, Martina V

    2009-01-01

    Background Accurate computational identification of cis-regulatory motifs is difficult, particularly in eukaryotic promoters, which typically contain multiple short and degenerate DNA sequences bound by several interacting factors. Enrichment in combinations of rare motifs in the promoter sequence of functionally or evolutionarily related genes among several species is an indicator of conserved transcriptional regulatory mechanisms. This provides a basis for the computational identification of cis-regulatory motifs. Results We have used a discriminative seeding DNA motif discovery algorithm for an in-depth analysis of 54 seed storage protein (SSP) gene promoters from three plant families, namely Brassicaceae (mustards), Fabaceae (legumes) and Poaceae (grasses) using backgrounds based on complete sets of promoters from a representative species in each family, namely Arabidopsis (Arabidopsis thaliana (L.) Heynh.), soybean (Glycine max (L.) Merr.) and rice (Oryza sativa L.) respectively. We have identified three conserved motifs (two RY-like and one ACGT-like) in Brassicaceae and Fabaceae SSP gene promoters that are similar to experimentally characterized seed-specific cis-regulatory elements. Fabaceae SSP gene promoter sequences are also enriched in a novel, seed-specific E2Fb-like motif. Conserved motifs identified in Poaceae SSP gene promoters include a GCN4-like motif, two prolamin-box-like motifs and an Skn-1-like motif. Evidence of the presence of a variant of the TATA-box is found in the SSP gene promoters from the three plant families. Motifs discovered in SSP gene promoters were used to score whole-genome sets of promoters from Arabidopsis, soybean and rice. The highest-scoring promoters are associated with genes coding for different subunits or precursors of seed storage proteins. Conclusion Seed storage protein gene promoter motifs are conserved in diverse species, and different plant families are characterized by a distinct combination of conserved motifs

  2. Seed storage protein gene promoters contain conserved DNA motifs in Brassicaceae, Fabaceae and Poaceae

    Directory of Open Access Journals (Sweden)

    Fauteux François

    2009-10-01

    Full Text Available Abstract Background Accurate computational identification of cis-regulatory motifs is difficult, particularly in eukaryotic promoters, which typically contain multiple short and degenerate DNA sequences bound by several interacting factors. Enrichment in combinations of rare motifs in the promoter sequence of functionally or evolutionarily related genes among several species is an indicator of conserved transcriptional regulatory mechanisms. This provides a basis for the computational identification of cis-regulatory motifs. Results We have used a discriminative seeding DNA motif discovery algorithm for an in-depth analysis of 54 seed storage protein (SSP gene promoters from three plant families, namely Brassicaceae (mustards, Fabaceae (legumes and Poaceae (grasses using backgrounds based on complete sets of promoters from a representative species in each family, namely Arabidopsis (Arabidopsis thaliana (L. Heynh., soybean (Glycine max (L. Merr. and rice (Oryza sativa L. respectively. We have identified three conserved motifs (two RY-like and one ACGT-like in Brassicaceae and Fabaceae SSP gene promoters that are similar to experimentally characterized seed-specific cis-regulatory elements. Fabaceae SSP gene promoter sequences are also enriched in a novel, seed-specific E2Fb-like motif. Conserved motifs identified in Poaceae SSP gene promoters include a GCN4-like motif, two prolamin-box-like motifs and an Skn-1-like motif. Evidence of the presence of a variant of the TATA-box is found in the SSP gene promoters from the three plant families. Motifs discovered in SSP gene promoters were used to score whole-genome sets of promoters from Arabidopsis, soybean and rice. The highest-scoring promoters are associated with genes coding for different subunits or precursors of seed storage proteins. Conclusion Seed storage protein gene promoter motifs are conserved in diverse species, and different plant families are characterized by a distinct combination

  3. Chemical composition and spasmolytic activity of Cymbopogon schoenanthus (L. Spreng. (Poaceae essential oil from Sudan

    Directory of Open Access Journals (Sweden)

    Pavlović Ivan

    2017-01-01

    Full Text Available The plants of genus Cymbopogon are well known for their use in traditional medicine and for their high content of essential oils that are widely used as flavoring agents, fragrances, cosmetics, and pharmaceuticals. Essential oils isolated from the dried stems and inflorescence of cultivated Cymbopogon schoenanthus (L. Spreng. (Poaceae collected from Khartoum state (Sudan in two periods were studied. The results of chemical analysis of C. schoenanthus revealed that this plant is rich in essential oil which is a valuable source of the commercially important monoterpene, piperitone (47.7-71.5%. Other abundant constituents of the oils were intermedeol (6.1-17.3%, δ-2-carene (4.5-10.0% and elemol (2.7-9.0%. The essential oil from the inflorescence was tested for spasmolytic activity using three different experimental models: against spontaneous contractions, contractions induced with acetylcholine and contractions induced with potassium chloride. The oil exhibited strong, significant and dose-dependent spasmolytic activity, indicating the possibility for further investigations of this essential oil for its medicinal purposes or application in food industry. [Project of the Serbian Ministry of Education, Science and Technological Development, Grant no.173021 and Grant no. III41018

  4. Intergenomic rearrangements after polyploidization of Kengyilia thoroldiana (Poaceae: Triticeae) affected by environmental factors.

    Science.gov (United States)

    Wang, Qiuxia; Liu, Huitao; Gao, Ainong; Yang, Xinming; Liu, Weihua; Li, Xiuquan; Li, Lihui

    2012-01-01

    Polyploidization is a major evolutionary process. Approximately 70-75% species of Triticeae (Poaceae) are polyploids, involving 23 genomes. To investigate intergenomic rearrangements after polyploidization of Triticeae species and to determine the effects of environmental factors on them, nine populations of a typical polyploid Triticeae species, Kengyilia thoroldiana (Keng) J.L.Yang et al. (2n = 6x = 42, StStPPYY), collected from different environments, were studied using genome in situ hybridization (GISH). We found that intergenomic rearrangements occurred between the relatively large P genome and the small genomes, St (8.15%) and Y (22.22%), in polyploid species via various types of translocations compared to their diploid progenitors. However, no translocation was found between the relatively small St and Y chromosomes. Environmental factors may affect rearrangements among the three genomes. Chromosome translocations were significantly more frequent in populations from cold alpine and grassland environments than in populations from valley and lake-basin habitats (P<0.05). The relationship between types of chromosome translocations and altitude was significant (r = 0.809, P<0.01). Intergenomic rearrangements associated with environmental factors and genetic differentiation of a single basic genome should be considered as equally important genetic processes during species' ecotype evolution.

  5. Morphology and anatomy of the diaspores and seedling of Paspalum (Poaceae, Poales

    Directory of Open Access Journals (Sweden)

    MAYRA T. EICHEMBERG

    2013-09-01

    Full Text Available ABSTRACT The knowledge regarding of the diaspore and post-seminal development of Paspalum L. is important for grassland biodiversity conservation, based on their representativeness and genetic improvement of forage. The morphology of the diaspore and the post-seminal development of Paspalum dilatatum Poir. (rhizomatous, P. mandiocanum Trin. var. subaequiglume Barreto (stoloniferous, P. pumilum Nees. (decumbent caespitose and P. urvillei Steud. (erect caespitose was described to distinguish species with different growth forms and to survey the characters useful for taxonomy. P. dilatatum differs by presenting oval diaspores larger than the others, with five prominent nerves and trichomes; P. urvillei presents diaspores with one central nerve that is more developed than the two lateral nerves and trichomes; P. mandiocanum var. subaequiglume presents diaspores with trichomes only in the margin; and P. pumilum differs by presenting glabrous diaspores. The caryopsis involves the seed that presents the differentiated embryo and disposed laterally, an elliptical hilum in all of the studied species and a rostellum in P. dilatatum and P. mandiocanum var. subaequiglume. The post-seminal development is similar in the four species and begins with germination that is marked by the emergence of the coleorhiza, followed by the coleoptile. These characteristics are common to other Poaceae previously studied, indicating a pattern to the family and do not distinguish the growth forms.

  6. Intergenomic rearrangements after polyploidization of Kengyilia thoroldiana (Poaceae: Triticeae affected by environmental factors.

    Directory of Open Access Journals (Sweden)

    Qiuxia Wang

    Full Text Available Polyploidization is a major evolutionary process. Approximately 70-75% species of Triticeae (Poaceae are polyploids, involving 23 genomes. To investigate intergenomic rearrangements after polyploidization of Triticeae species and to determine the effects of environmental factors on them, nine populations of a typical polyploid Triticeae species, Kengyilia thoroldiana (Keng J.L.Yang et al. (2n = 6x = 42, StStPPYY, collected from different environments, were studied using genome in situ hybridization (GISH. We found that intergenomic rearrangements occurred between the relatively large P genome and the small genomes, St (8.15% and Y (22.22%, in polyploid species via various types of translocations compared to their diploid progenitors. However, no translocation was found between the relatively small St and Y chromosomes. Environmental factors may affect rearrangements among the three genomes. Chromosome translocations were significantly more frequent in populations from cold alpine and grassland environments than in populations from valley and lake-basin habitats (P<0.05. The relationship between types of chromosome translocations and altitude was significant (r = 0.809, P<0.01. Intergenomic rearrangements associated with environmental factors and genetic differentiation of a single basic genome should be considered as equally important genetic processes during species' ecotype evolution.

  7. Transcriptomic analysis, genic SSR development, and genetic diversity of proso millet (Panicum miliaceum; Poaceae).

    Science.gov (United States)

    Hou, Siyu; Sun, Zhaoxia; Li, Yaoshen; Wang, Yijie; Ling, Hubin; Xing, Guofang; Han, Yuanhuai; Li, Hongying

    2017-07-01

    Proso millet ( Panicum miliaceum ; Poaceae) is a minor crop with good nutritional qualities and strong tolerance to drought stress and soil infertility. However, studies on genetic diversity have been limited due to a lack of efficient genetic markers. Illumina sequencing technology was used to generate short read sequences of proso millet, and de novo transcriptome assemblies were used to develop a de novo assembly of proso millet. Genic simple sequence repeat (SSR) markers were identified and used to detect polymorphism among 56 accessions. Population structure and genetic similarity coefficient were estimated. In total, 25,341 unique gene sequences and 4724 SSR loci were obtained from the transcriptome, of which 229 pairs of SSR primers were validated, which resulted in 14 polymorphic genic SSR primers exhibiting 43 total alleles. According to the ratio of polymorphic markers (6.1%, 14/229), there are potentially 288 polymorphic genic SSR markers available for genetic assay development in the future. Bayesian population analyses showed that the 56 accessions comprised two distinct groups. A genetic structure and cluster assay indicated that the accessions from the Loess Plateau of China shared a high genetic similarity coefficient with those from other regions and that there was no correlation between genetic diversity and geographic origin. The transcriptome sequencing data and millet-specific SSR markers developed in this study establish an excellent resource for gene discovery and may improve the development of breeding programs in proso millet in the future.

  8. Transcriptomic analysis, genic SSR development, and genetic diversity of proso millet (Panicum miliaceum; Poaceae)1

    Science.gov (United States)

    Hou, Siyu; Sun, Zhaoxia; Li, Yaoshen; Wang, Yijie; Ling, Hubin; Xing, Guofang; Han, Yuanhuai; Li, Hongying

    2017-01-01

    Premise of the study: Proso millet (Panicum miliaceum; Poaceae) is a minor crop with good nutritional qualities and strong tolerance to drought stress and soil infertility. However, studies on genetic diversity have been limited due to a lack of efficient genetic markers. Methods: Illumina sequencing technology was used to generate short read sequences of proso millet, and de novo transcriptome assemblies were used to develop a de novo assembly of proso millet. Genic simple sequence repeat (SSR) markers were identified and used to detect polymorphism among 56 accessions. Population structure and genetic similarity coefficient were estimated. Results: In total, 25,341 unique gene sequences and 4724 SSR loci were obtained from the transcriptome, of which 229 pairs of SSR primers were validated, which resulted in 14 polymorphic genic SSR primers exhibiting 43 total alleles. According to the ratio of polymorphic markers (6.1%, 14/229), there are potentially 288 polymorphic genic SSR markers available for genetic assay development in the future. Bayesian population analyses showed that the 56 accessions comprised two distinct groups. Discussion: A genetic structure and cluster assay indicated that the accessions from the Loess Plateau of China shared a high genetic similarity coefficient with those from other regions and that there was no correlation between genetic diversity and geographic origin. The transcriptome sequencing data and millet-specific SSR markers developed in this study establish an excellent resource for gene discovery and may improve the development of breeding programs in proso millet in the future. PMID:28791202

  9. Una nueva especie de Axonopus (Poaceae: Panicoideae: Paniceae de la Guyana de Colombia y Venezuela

    Directory of Open Access Journals (Sweden)

    Giraldo Cañas Diego

    1999-11-01

    Full Text Available Axonopus piccae, a new species of the series Barbigeri G. A. Black, is described and illustrated. The new species is known only from two areas of Guayana Region: Guainía (Colombia and Bolívar (Venezuela. Its inflorescence is polytelic and truncate.Based on SEM microphotographs, the characters of its upper anthecium are presented. Its morphological and anatomical relationships are discussed, and a key to the nearest species is provided.Se describe e ilustra Axonopus piccae, una nueva especie perteneciente a la serie Barbigeri G. A. Black, conocida únicamente de dos áreas de la región Guayana en Guainía (Colombia y Bolívar (Venezuela. Su inflorescencia es politélica y truncada. Se comentan las características de su antecio superior sobre la base de microfotografías al microscopio electrónico de barrido. Se discuten sus relaciones morfológicas y anatómicas. Se presenta una clave para separar las especies afines.

  10. Radiomodulatory potential of hydroalcoholic extract of a medicinal plant Cynodon dactylon (Family: Poaceae), against radiation-induced cytogenetic damage

    International Nuclear Information System (INIS)

    Satish Rao, B.S.; Upadhya, D.; Adiga, S.K.

    2007-01-01

    The exposure of humans to ionizing radiations may be advertently by routine diagnostic and therapeutic purposes or inadvertently during natural, occupational and nuclear accident situations. Therefore, in order to overcome the deleterious biological effects of radiation several chemical agents have been studied for their radioprotective potential. The medicinal plants being one of the resources for such clinically important natural agents, used extensively in several drug discovery related research. Here the radiomodulatory potential of hydroalcoholic extract of a medicinal plant Cynodon dactylon (Family: Poaceae), against radiation-induced cytogenetic damage was analyzed using Chinese hamster fibroblast cells (V79) and human peripheral blood lymphocytes (HPBLs) growing in vitro is reported

  11. Study of the chemical composition of essential oils and floral waters of Cymbopogon citratus (DC.) Stapf (Poaceae) from Senegal

    OpenAIRE

    Diop, Serigne Mbacké; Guèye, Momar Talla; Ndiaye, Ibrahima; Diop, Michel Bakar; Ndiaye, El Hadji Barka; Thiam, Abdoulaye; Fauconnier, Marie-Laure; Lognay, Georges

    2017-01-01

    This work aimed to study the chemical composition of essential oils and floral waters of Cymbopogon citratus (DC.) Stapf (Poaceae) from Senegal. The plants were collected in two different localities, Dakar and Kaolack. The extracts were obtained by steam distillation from both fresh and dried plants and analyses carried out by GC/FID and GC/MS. Oils from Dakar were dominated by geranial which represented 46.0-43.9%, neral 31.8-31.0%, myrcene 10.8-11.7% and geraniol 2.7-4.2% in the fresh and d...

  12. Phylogenomics and taxonomy of Lecomtelleae (Poaceae), an isolated panicoid lineage from Madagascar.

    Science.gov (United States)

    Besnard, Guillaume; Christin, Pascal-Antoine; Malé, Pierre-Jean G; Coissac, Eric; Ralimanana, Hélène; Vorontsova, Maria S

    2013-10-01

    An accurate characterization of biodiversity requires analyses of DNA sequences in addition to classical morphological descriptions. New methods based on high-throughput sequencing may allow investigation of specimens with a large set of genetic markers to infer their evolutionary history. In the grass family, the phylogenetic position of the monotypic genus Lecomtella, a rare bamboo-like endemic from Madagascar, has never been appropriately evaluated. Until now its taxonomic treatment has remained controversial, indicating the need for re-evaluation based on a combination of molecular and morphological data. The phylogenetic position of Lecomtella in Poaceae was evaluated based on sequences from the nuclear and plastid genomes generated by next-generation sequencing (NGS). In addition, a detailed morphological description of L. madagascariensis was produced, and its distribution and habit were investigated in order to assess its conservation status. The complete plastid sequence, a ribosomal DNA unit and fragments of low-copy nuclear genes (phyB and ppc) were obtained. All phylogenetic analyses place Lecomtella as an isolated member of the core panicoids, which last shared a common ancestor with other species >20 million years ago. Although Lecomtella exhibits morphological characters typical of Panicoideae, an unusual combination of traits supports its treatment as a separate group. The study showed that NGS can be used to generate abundant phylogenetic information rapidly, opening new avenues for grass phylogenetics. These data clearly showed that Lecomtella forms an isolated lineage, which, in combination with its morphological peculiarities, justifies its treatment as a separate tribe: Lecomtelleae. New descriptions of the tribe, genus and species are presented with a typification, a distribution map and an IUCN conservation assessment.

  13. Cercosporoid fungi (Mycosphaerellaceae) 2. Species on monocots (Acoraceae to Xyridaceae, excluding Poaceae).

    Science.gov (United States)

    Braun, Uwe; Crous, Pedro W; Nakashima, Chiharu

    2014-12-01

    Cercosporoid fungi (formerly Cercospora s. lat.) represent one of the largest groups of hyphomycetes belonging to the Mycosphaerellaceae (Ascomycota). They include asexual morphs, asexual holomorphs, or species with mycosphaerella-like sexual morphs. Most of them are leaf-spotting plant pathogens with special phytopathological relevance. In the first part of a new monographic work, cercosporoid hyphomycetes occurring on other fungi (fungicolous species), on ferns (pteridophytes) and gymnosperms were treated. This second part deals with cercosporoid fungi on monocots (Liliopsida; Equisetopsida, Magnoliidae, Lilianae), which covers species occurring on host plants belonging to families arranged in alphabetical order from Acoraceae to Xyridaceae, excluding Poaceae (cereals and grasses) which requires a separate treatment. The species are described and illustrated in alphabetical order under the particular cercosporoid genera, supplemented by keys to the species concerned. A detailed introduction, a survey of currently recognised cercosporoid genera, a key to the genera concerned, and a discussion of taxonomically relevant characters were published in the first part of this series. Neopseudocercospora, an additional recently introduced cercosporoid genus, is briefly discussed. The following taxonomic novelties are introduced: Cercospora alpiniigena sp. nov., C. neomaricae sp. nov., Corynespora palmicola comb. nov., Exosporium miyakei comb. nov., E. petersii comb. nov., Neopseudocercospora zambiensis comb. nov., Passalora caladiicola comb. nov., P. streptopi comb. nov., P. togashiana comb. nov., P. tranzschelii var. chinensis var. nov., Pseudocercospora beaucarneae comb. nov., P. constrictoflexuosa comb. et stat. nov., P. curcumicola sp. nov., P. dispori comb. nov., P. smilacicola sp. nov., P. urariigena nom. nov., Zasmidium agavicola comb. nov., Z. cercestidis-afzelii comb. nov., Z. citri-griseum comb. nov., Z. cyrtopodii comb. nov., Z. gahnae comb. nov., Z. indicum

  14. Acrapex azumai Sugi (Lepidoptera, Noctuidae) as a possible biological control agent of the invasive weed Imperata cylindrica (L.) Beauv. (Poaceae) in the United States

    Science.gov (United States)

    Lepidopteran larvae were discovered boring in the basal stems of Imperata cylindrica (L.) Beauv. (Poaceae) in Itoshima city, Fukuoka Prefecture, Kyushu, Japan. Adults reared from these larvae were identified as Acrapex azumai Sugi (Lepidoptera: Noctuidae). Sequencing of the CO1 (cytochrome oxidase 1...

  15. Chloroplast phylogenomic analyses resolve deep-level relationships of an intractable bamboo tribe Arundinarieae (poaceae).

    Science.gov (United States)

    Ma, Peng-Fei; Zhang, Yu-Xiao; Zeng, Chun-Xia; Guo, Zhen-Hua; Li, De-Zhu

    2014-11-01

    The temperate woody bamboos constitute a distinct tribe Arundinarieae (Poaceae: Bambusoideae) with high species diversity. Estimating phylogenetic relationships among the 11 major lineages of Arundinarieae has been particularly difficult, owing to a possible rapid radiation and the extremely low rate of sequence divergence. Here, we explore the use of chloroplast genome sequencing for phylogenetic inference. We sampled 25 species (22 temperate bamboos and 3 outgroups) for the complete genome representing eight major lineages of Arundinarieae in an attempt to resolve backbone relationships. Phylogenetic analyses of coding versus noncoding sequences, and of different regions of the genome (large single copy and small single copy, and inverted repeat regions) yielded no well-supported contradicting topologies but potential incongruence was found between the coding and noncoding sequences. The use of various data partitioning schemes in analysis of the complete sequences resulted in nearly identical topologies and node support values, although the partitioning schemes were decisively different from each other as to the fit to the data. Our full genomic data set substantially increased resolution along the backbone and provided strong support for most relationships despite the very short internodes and long branches in the tree. The inferred relationships were also robust to potential confounding factors (e.g., long-branch attraction) and received support from independent indels in the genome. We then added taxa from the three Arundinarieae lineages that were not included in the full-genome data set; each of these were sampled for more than 50% genome sequences. The resulting trees not only corroborated the reconstructed deep-level relationships but also largely resolved the phylogenetic placements of these three additional lineages. Furthermore, adding 129 additional taxa sampled for only eight chloroplast loci to the combined data set yielded almost identical

  16. Disentangling the effects of feedback structure and climate on Poaceae annual airborne pollen fluctuations and the possible consequences of climate change.

    Science.gov (United States)

    García de León, David; García-Mozo, Herminia; Galán, Carmen; Alcázar, Purificación; Lima, Mauricio; González-Andújar, José L

    2015-10-15

    Pollen allergies are the most common form of respiratory allergic disease in Europe. Most studies have emphasized the role of environmental processes, as the drivers of airborne pollen fluctuations, implicitly considering pollen production as a random walk. This work shows that internal self-regulating processes of the plants (negative feedback) should be included in pollen dynamic systems in order to give a better explanation of the observed pollen temporal patterns. This article proposes a novel methodological approach based on dynamic systems to investigate the interaction between feedback structure of plant populations and climate in shaping long-term airborne Poaceae pollen fluctuations and to quantify the effects of climate change on future airborne pollen concentrations. Long-term historical airborne Poaceae pollen data (30 years) from Cordoba city (Southern Spain) were analyzed. A set of models, combining feedback structure, temperature and actual evapotranspiration effects on airborne Poaceae pollen were built and compared, using a model selection approach. Our results highlight the importance of first-order negative feedback and mean annual maximum temperature in driving airborne Poaceae pollen dynamics. The best model was used to predict the effects of climate change under two standardized scenarios representing contrasting temporal patterns of economic development and CO2 emissions. Our results predict an increase in pollen levels in southern Spain by 2070 ranging from 28.5% to 44.3%. The findings from this study provide a greater understanding of airborne pollen dynamics and how climate change might impact the future evolution of airborne Poaceae pollen concentrations and thus the future evolution of related pollen allergies. Copyright © 2015 Elsevier B.V. All rights reserved.

  17. Simple Web-based interactive key development software (WEBiKEY) and an example key for Kuruna (Poaceae: Bambusoideae).

    Science.gov (United States)

    Attigala, Lakshmi; De Silva, Nuwan I; Clark, Lynn G

    2016-04-01

    Programs that are user-friendly and freely available for developing Web-based interactive keys are scarce and most of the well-structured applications are relatively expensive. WEBiKEY was developed to enable researchers to easily develop their own Web-based interactive keys with fewer resources. A Web-based multiaccess identification tool (WEBiKEY) was developed that uses freely available Microsoft ASP.NET technologies and an SQL Server database for Windows-based hosting environments. WEBiKEY was tested for its usability with a sample data set, the temperate woody bamboo genus Kuruna (Poaceae). WEBiKEY is freely available to the public and can be used to develop Web-based interactive keys for any group of species. The interactive key we developed for Kuruna using WEBiKEY enables users to visually inspect characteristics of Kuruna and identify an unknown specimen as one of seven possible species in the genus.

  18. Plant Responses to Climate Change: The Case Study of Betulaceae and Poaceae Pollen Seasons (Northern Italy, Vignola, Emilia-Romagna

    Directory of Open Access Journals (Sweden)

    Anna Maria Mercuri

    2016-12-01

    Full Text Available Aerobiological data have especially demonstrated that there is correlation between climate warming and the pollination season of plants. This paper focuses on airborne pollen monitoring of Betulaceae and Poaceae, two of the main plant groups with anemophilous pollen and allergenic proprieties in Northern Italy. The aim is to investigate plant responses to temperature variations by considering long-term pollen series. The 15-year aerobiological analysis is reported from the monitoring station of Vignola (located near Modena, in the Emilia-Romagna region that had operated in the years 1990–2004 with a Hirst spore trap. The Yearly Pollen Index calculated for these two botanical families has shown contrasting trends in pollen production and release. These trends were well identifiable but fairly variable, depending on both meteorological variables and anthropogenic causes. Based on recent reference literature, we considered that some oscillations in pollen concentration could have been a main effect of temperature variability reflecting global warming. The duration of pollen seasons of Betulaceae and Poaceae, depending on the different species included in each family, has not unequivocally been determined. Phenological responses were particularly evident in Alnus and especially in Corylus as a general moving up of the end of pollination. The study shows that these trees can be affected by global warming more than other, more tolerant, plants. The research can be a contribution to the understanding of phenological plant responses to climate change and suggests that alder and hazelnut trees have to be taken into high consideration as sensible markers of plant responses to climate change.

  19. Plant Responses to Climate Change: The Case Study of Betulaceae and Poaceae Pollen Seasons (Northern Italy, Vignola, Emilia-Romagna)

    Science.gov (United States)

    Mercuri, Anna Maria; Torri, Paola; Fornaciari, Rita; Florenzano, Assunta

    2016-01-01

    Aerobiological data have especially demonstrated that there is correlation between climate warming and the pollination season of plants. This paper focuses on airborne pollen monitoring of Betulaceae and Poaceae, two of the main plant groups with anemophilous pollen and allergenic proprieties in Northern Italy. The aim is to investigate plant responses to temperature variations by considering long-term pollen series. The 15-year aerobiological analysis is reported from the monitoring station of Vignola (located near Modena, in the Emilia-Romagna region) that had operated in the years 1990–2004 with a Hirst spore trap. The Yearly Pollen Index calculated for these two botanical families has shown contrasting trends in pollen production and release. These trends were well identifiable but fairly variable, depending on both meteorological variables and anthropogenic causes. Based on recent reference literature, we considered that some oscillations in pollen concentration could have been a main effect of temperature variability reflecting global warming. The duration of pollen seasons of Betulaceae and Poaceae, depending on the different species included in each family, has not unequivocally been determined. Phenological responses were particularly evident in Alnus and especially in Corylus as a general moving up of the end of pollination. The study shows that these trees can be affected by global warming more than other, more tolerant, plants. The research can be a contribution to the understanding of phenological plant responses to climate change and suggests that alder and hazelnut trees have to be taken into high consideration as sensible markers of plant responses to climate change. PMID:27929423

  20. Global grass (Poaceae) success underpinned by traits facilitating colonization, persistence and habitat transformation.

    Science.gov (United States)

    Linder, H P; Lehmann, Caroline E R; Archibald, Sally; Osborne, Colin P; Richardson, David M

    2018-05-01

    Poaceae (the grasses) is arguably the most successful plant family, in terms of its global occurrence in (almost) all ecosystems with angiosperms, its ecological dominance in many ecosystems, and high species richness. We suggest that the success of grasses is best understood in context of their capacity to colonize, persist, and transform environments (the "Viking syndrome"). This results from combining effective long-distance dispersal, efficacious establishment biology, ecological flexibility, resilience to disturbance and the capacity to modify environments by changing the nature of fire and mammalian herbivory. We identify a diverse set of functional traits linked to dispersal, establishment and competitive abilities. Enhanced long-distance dispersal is determined by anemochory, epizoochory and endozoochory and is facilitated via the spikelet (and especially the awned lemma) which functions as the dispersal unit. Establishment success could be a consequence of the precocious embryo and large starch reserves, which may underpin the extremely short generation times in grasses. Post-establishment genetic bottlenecks may be mitigated by wind pollination and the widespread occurrence of polyploidy, in combination with gametic self-incompatibility. The ecological competitiveness of grasses is corroborated by their dominance across the range of environmental extremes tolerated by angiosperms, facilitated by both C 3 and C 4 photosynthesis, well-developed frost tolerance in several clades, and a sympodial growth form that enabled the evolution of both annual and long-lived life forms. Finally, absence of investment in wood (except in bamboos), and the presence of persistent buds at or below ground level, provides tolerance of repeated defoliation (whether by fire, frost, drought or herbivores). Biotic modification of environments via feedbacks with herbivory or fire reinforce grass dominance leading to open ecosystems. Grasses can be both palatable and productive

  1. LES STRATEGIES D’APPRENTISSAGE DU FRANÇAIS LANGUE ÉTRANGÈRE MISES EN PRATIQUE PAR LES APPRENANTS AFIN DE PROMOUVOIR LEURS AUTONOMIES

    Directory of Open Access Journals (Sweden)

    Yasmine ADIB

    2016-12-01

    Full Text Available Ce travail de recherche présente les stratégies d’apprentissage du français langue étrangère et examine les liens entre stratégies et acquisition d’une compétence générale. Cette étude met en relief l’apport majeur des données issues de la psychologie cognitive qui nous renseigne sur les mécanismes qui permettent à l’apprenant d’acquérir, d’intégrer et de réutiliser des connaissances. Aussi, nous expliquons comment les données de la psychologie cognitive nous éclairent sur la nature de l’apprentissage. Le but fondamental de la mise en pratique des stratégies d’apprentissage et de promouvoir l’autonomie de l’apprenant. Il convient de signaler que les stratégies d’apprentissage désignent un ensemble d’opérations mises en œuvre par l’apprenant pour acquérir, intégrer et réutiliser la langue cible. L’apprentissage du français langue étrangère peut être vu comme tout autre processus de traitement de l’information: d’abord, l’apprenant sélectionne et saisit les éléments nouveaux d’information qui lui sont présentés, ensuite, il traite et emmagasine cette information dans sa mémoire. Enfin, il la récupère afin de la réutiliser.LEARNING STRATEGIES OF THE FRENCH FOREIGN LANGUAGE PRACTICED BY LEARNERS TO PROMOTE THEIR AUTONOMYThis research work presents the learning strategies of French foreign language and examines the links between strategies and acquisition of general jurisdiction. We present some definitions and we describe and classify the different learning strategies. We underline the major contribution of data from cognitive psychology that informs us about the mechanisms that allow the learner to acquire, integrate and reuse knowledge. Also, we explain how data from cognitive psychology shed light on the nature of learning. The fundamental purpose of the implementation of learning strategies and promote learner autonomy. It should be noted that learning strategies

  2. Herencia del número de vainas por nudo y su relación con características afines en arveja (Pisum sativum L.

    Directory of Open Access Journals (Sweden)

    Castillo Edgar

    2014-11-01

    Full Text Available En el año 2010-2011 en el Centro de Investigaciones Fitoecogenéticas de Pairumani (CIFP en Cochabamba-Bolivia, se cruzaron ocho líneas parentales de arveja bajo el diseño dialélico Griffing IV, con el objetivo de determinar las bases genéticas que condicionan el número de vainas por nudo, la relaciones genéticas con caracteres afines y las líneas que posean genes favorables para incrementar el número de vainas por nudo. Las progenies F1 evaluadas de acuerdo al diseño experimental de filas y columnas incompletas con cuatro repeticiones, indican que el número de vainas/nudo está condicionado por efectos aditivos y de dominancia; sin embargo, los efectos aditivos fueron de mayor importancia con una heredabilidad en sentido estrecho moderado (0.49. Por otro lado, el número de vainas/nudo está alta y positivamente correlacionada con el número de vainas/planta y densidad de grano, en las cuales los efectos aditivos fueron de mayor importancia y heredabilidades en sentido estrecho de 0.72 y 0.36, respectivamente. El número de vainas/nudo está alta y negativamente correlacionada con días a floración, días a madurez en verde, largo de vaina, ancho de vaina, peso de grano, altura de planta y altura a la primera vaina, en las cuales excepto en altura de planta y altura a la primera vaina, los efectos aditivos fueron de mayor importancia, con una heredabilidad en sentido estrecho entre 0.19 y 0.81. Para desarrollar variedades con mayor número de vainas por nudo se puede optar por desarrollar variedades con vainas a menor altura, de granos más pequeños y con vainas más delgadas; o variedades con más días a madurez en verde, de granos menos densos, pedúnculo corto y vainas cortas. Las líneas M-2, calle-calle, Pairumani-1, PH-91-3 poseen genes favorables para desarrollar variedades con mayor número de vainas por nudo y por ende mayor cantidad de vainas por planta, pero con vainas pequeñas y delgadas, y de ciclo corto, además de

  3. Anti-methicillin-resistant Staphylococcus aureus (MRSA) activity of Rubiaceae, Fabaceae and Poaceae plants: A search for new sources of useful alternative antibacterials against MRSA infections.

    Science.gov (United States)

    Sharifi-Rad, M; Iriti, M; Sharifi-Rad, M; Gibbons, S; Sharifi-Rad, J

    2016-08-29

    In this study, we evaluated the effects of the extracts of the leaves of species from the Rubiaceae (Galium aparine L. and Asperula arvensis L.), Fabaceae (Lathyrus aphaca L. and Vicia narbonensis L.) and Poaceae (Digitaria sanguinalis (L.) Scop. and Hordeum murinum L.) plant families on a wide and extensive panel of isolated methicillin-resistant Staphylococcus aureus strains (MRSA). The effects of the methanolic leaf extracts of Rubiaceae, Fabaceae and Poaceae plants on MRSA were evaluated by the disc diffusion assay and the broth dilution method. Among a total of 177 S. aureus isolates, 92 (51.97%) were found to be methicillin-resistant in an antibiogram and this was confirmed by the presence of the mecA gene in polymerase chain reaction method. All MRSA isolates were sensitive to all extracts. There were dose-dependent inhibitions on tested microorganisms for all plant extracts which showed maximum inhibition zones at a concentration of 300 mg/L. L. aphaca, G. aparine and H. murinum exhibited the highest antibacterial activity on the MRSA strains compared to the positive control (P Fabaceae), G. aparine (Rubiaceae), and H. murinum (Poaceae) proved to have high antibacterial activity on MRSA isolates, thus representing promising antimicrobial agents in clinical settings.

  4. Evaluating sampling strategy for DNA barcoding study of coastal and inland halo-tolerant Poaceae and Chenopodiaceae: A case study for increased sample size.

    Science.gov (United States)

    Yao, Peng-Cheng; Gao, Hai-Yan; Wei, Ya-Nan; Zhang, Jian-Hang; Chen, Xiao-Yong; Li, Hong-Qing

    2017-01-01

    Environmental conditions in coastal salt marsh habitats have led to the development of specialist genetic adaptations. We evaluated six DNA barcode loci of the 53 species of Poaceae and 15 species of Chenopodiaceae from China's coastal salt marsh area and inland area. Our results indicate that the optimum DNA barcode was ITS for coastal salt-tolerant Poaceae and matK for the Chenopodiaceae. Sampling strategies for ten common species of Poaceae and Chenopodiaceae were analyzed according to optimum barcode. We found that by increasing the number of samples collected from the coastal salt marsh area on the basis of inland samples, the number of haplotypes of Arundinella hirta, Digitaria ciliaris, Eleusine indica, Imperata cylindrica, Setaria viridis, and Chenopodium glaucum increased, with a principal coordinate plot clearly showing increased distribution points. The results of a Mann-Whitney test showed that for Digitaria ciliaris, Eleusine indica, Imperata cylindrica, and Setaria viridis, the distribution of intraspecific genetic distances was significantly different when samples from the coastal salt marsh area were included (P Imperata cylindrica and Chenopodium album, average intraspecific distance tended to reach stability. These results indicate that the sample size for DNA barcode of globally distributed species should be increased to 11-15.

  5. Anther and pollen development in some species of Poaceae (Poales Desenvolvimento da antera e do grão de pólen em espécies de Poaceae (Poales

    Directory of Open Access Journals (Sweden)

    AT. Nakamura

    2010-05-01

    Full Text Available Anther and pollen development were studied in Olyra humilis Nees, Sucrea monophylla Soderstr, (Bambusoideae, Axonopus aureus P. Beauv., Paspalum polyphyllum Nees ex Trin. (Panicoideae, Eragrostis solida Nees, and Chloris elata Desv. (Chloridoideae. The objective of this study was to characterise, embryologically, these species of subfamilies which are considered basal, intermediate and derivate, respectively. The species are similar to each other and to other Poaceae. They present the following characters: tetrasporangiate anthers; monocotyledonous-type anther wall development, endothecium showing annular thickenings, secretory tapetum; successive microsporogenesis; isobilateral tetrads; spheroidal, tricellular, monoporate pollen grains with annulus and operculum. Nevertheless, the exine patterns of the species studied are distinct. Olyra humilis and Sucrea monophylla (Bambusoideae show a granulose pattern, whereas in the other species, it is insular. In addition, Axonopus aureus and Paspalum polyphyllum (Panicoideae have a compactly insular spinule pattern, while Chloris elata and Eragrostis solida (Chloridoideae show a sparsely insular spinule pattern. The exine ornamentation may be considered an important feature at the infrafamiliar level.O desenvolvimento da antera e do grão de pólen de Olyra humilis Nees, Sucrea monophylla Soderstr. (Bambusoideae, Axonopus aureus P. Beauv., Paspalum polyphyllum Nees ex Trin. (Panicoideae, Eragrostis solida Nees and Chloris elata Desv. (Chloridoideae foi estudado visando caracterizar embriologicamente essas espécies de subfamílias consideradas basal, intermediária e derivada, respectivamente. As espécies são similares entre si e entre as demais Poaceae. Apresentam os seguintes caracteres: anteras tetrasporangiadas; desenvolvimento da parede da antera do tipo monocotiledôneo, endotécio com espessamento de parede anelar, tapete secretor; microsporogênese sucessiva; tétrades isobilaterais; grãos de

  6. Anatomía ecológica de algunas especies del género Paspalum (Poaceae, Panicoideae, Paniceae

    Directory of Open Access Journals (Sweden)

    Sandra S. Aliscioni

    2000-01-01

    Full Text Available Aliscioni, S. S. 2000. Anatomía ecológica de algunas especies del género Paspalum(Poaceae, Panicoideae, Paniceae. Darwiniana 38(3-4: 187-207.El género Paspalum L. presenta un elevado número de especies, con una amplia variabilidadmorfológica y una extensa distribución geográfica. Sus especies crecen en hábitats sumamente diversos,desde ambientes muy húmedos o acuáticos, a lugares secos de suelos arcillosos o arenosos, muchas vecessalinos. Dada la diversidad de ambientes en los que puede hallarse Paspalum, se estudiaron lascaracterísticas anatómico-foliares presentes en el género con la finalidad de interpretar diferentesestrategias adaptativas en distintas especies. Se presenta una descripción general de la anatomía foliar delgénero y se discuten ciertos caracteres anatómicos, interpretando su posible relación con las condicionesdel hábitat

  7. Black Rice (Oryza sativa L., Poaceae) Extract Reduces Hippocampal Neuronal Cell Death Induced by Transient Global Cerebral Ischemia in Mice.

    Science.gov (United States)

    Hwang, Sun-Nyoung; Kim, Jae-Cheon; Bhuiyan, Mohammad Iqbal Hossain; Kim, Joo Youn; Yang, Ji Seon; Yoon, Shin Hee; Yoon, Kee Dong; Kim, Seong Yun

    2018-04-01

    Rice is the most commonly consumed grain in the world. Black rice has been suggested to contain various bioactive compounds including anthocyanin antioxidants. There is currently little information about the nutritional benefits of black rice on brain pathology. Here, we investigated the effects of black rice ( Oryza sativa L ., Poaceae) extract (BRE) on the hippocampal neuronal damage induced by ischemic insult. BRE (300 mg/kg) was orally administered to adult male C57BL/6 mice once a day for 21 days. Bilateral common carotid artery occlusion (BCCAO) was performed for 23 min on the 8th day of BRE or vehicle administration. Histological analyses conducted on the 22nd day of BRE or vehicle administration revealed that administering BRE profoundly attenuated neuronal cell death, inhibited reactive astrogliosis, and prevented loss of glutathione peroxidase expression in the hippocampus when compared to vehicle treatment. In addition, BRE considerably ameliorated BCCAO-induced memory impairment on the Morris water maze test from the 15th day to the 22nd day of BRE or vehicle administration. These results indicate that chronic administration of BRE is potentially beneficial in cerebral ischemia.

  8. Cytomorphological studies in some members of tribe Paniceae (Poaceae) from district Kangra of Himachal Pradesh (Western Himalayas).

    Science.gov (United States)

    Kaur, H; Kumari, S; Gupta, R C

    2013-01-01

    The present paper deals with cytological studies on the population basis of 21 species belonging to 9 genera of tribe Paniceae of family Poaceae from cytologically unexplored area of Western Himalayas i.e. district Kangra of Himachal Pradesh for the assessment of genetic diversity of grass flora. On world-wide basis, the chromosome counts have been made for the first time for three species such as Brachiaria remota (n = 16), Digitaria granularis (n = 36) and Isachne albens (n = 5). Similarly, on India basis, altogether new records are made for two species such as Echinochloa cruspavonis (n = 27) and Paspalum distichum (2n = 50). A comparison of the different euploid cytotypes studied at present for Digitaria adscendens, D. setigera and Oplismenus compositus revealed significant variations in their morphology, depicting increase in some of the characters of polyploid cytotypes. The course of meiosis has been observed to be normal in all the studied populations with high pollen fertility except for two species such as Paspalum dilatatum and P. distichum marked with abnormal meiosis and reduced pollen fertility.

  9. Molecular analysis of the genera eremopyrum (ledeb). jaub. and spach and agropyron gaertner (poaceae) by pcr methods

    International Nuclear Information System (INIS)

    Yilmaz, R.; Cabi, E.; Dogan, M.

    2014-01-01

    RAPD-PCR (Random Amplified Polymorphic DNA Polymerase Chain Reaction) and Post PCR (Polymerase Chain Reaction) Melting Curve Analysis (MCA) have been used to investigate the pattern of genetic variation among some species in the genera Eremopyrum (Ledeb.) Jaub. and Spach and Agropyron Gaertner (Poaceae). Thirteen primers have been used in the study based on the RAPD-PCR and MCA analyses. Each species produced a distinct pattern of DNA fragments which have been used as a measure of the degree of relationship between species by means of using the RAPD-PCR results with three primers selected for identifying the genetic similarities. Polymorphic melting profiles have been obtained with Post PCR MCA method using three primers. Genetic similarities are calculated for all the species studied with RAPD-PCR and MCA methods, the dendrograms are obtained with the MVSP (Multi Variate Statistical Package) software using UPGMA (Unweighted Pair Group Method with Arithmetic Averages) and Jaccard's Coefficient. Polymorphism between 18 populations of Eremopyrum and 6 Agropyron populations and within the species are determined by using RAPD-PCR and Post PCR melting curve analysis (MCA) respectively. (author)

  10. Phylogeny of Eleusine (Poaceae: Chloridoideae) based on nuclear ITS and plastid trnT-trnF sequences.

    Science.gov (United States)

    Neves, Susana S; Swire-Clark, Ginger; Hilu, Khidir W; Baird, Wm Vance

    2005-05-01

    Phylogenetic relationships in the genus Eleusine (Poaceae: Chloridoideae) were investigated using nuclear ITS and plastid trnT-trnF sequences. Separate and combined data sets were analyzed using parsimony, distance, and likelihood based methods, including Bayesian. Data congruence was examined using character and topological measures. Significant data heterogeneity was detected, but there was little conflict in the topological substructure measures for triplets and quartets, and resolution and clade support increased in the combined analysis. Data incongruence may be a result of noise and insufficient information in the slower evolving trnT-trnF. Monophyly of Eleusine is strongly supported in all analyses, but basal relationships in the genus remain uncertain. There is good support for a CAIK clade (E. coracana subsp. coracana and africana, E. indica, and E. kigeziensis), with E. tristachya as its sister group. Two putative ITS homeologues (A and B loci) were identified in the allotetraploid E. coracana; the 'B' locus sequence type was not found in the remaining species. Eleusine coracana and its putative 'A' genome donor, the diploid E. indica, are confirmed close allies, but sequence data contradicts the hypothesis that E. floccifolia is its second genome donor. The 'B' genome donor remains unidentified and may be extinct.

  11. Chemical composition and cardiovascular effects induced by the essential oil of Cymbopogon citratus DC. Stapf, Poaceae, in rats

    Directory of Open Access Journals (Sweden)

    Flávia V. Moreira

    2010-08-01

    Full Text Available Cymbopogon citratus DC. Stapf, Poaceae, is used in the folk medicine for hypertension treatment. This work investigated the chemical composition and cardiovascular effects in rats of C. citratus essential oil (EOCC. A phytochemical screening demonstrated the presence of eight constituents, being geranial the major compound (43.08%. In rats, EOCC (1, 5, 10, and 20 mg/kg, i.v. induced transient hypotension and bradycardia that were attenuated by atropine and sodium thiopental, but not by L-NAME or indomethacin. In rings of rat superior mesenteric artery pre-contracted with phenylephrine, EOCC (1 to 3000 µg/mL induced relaxation that was not affected after removal of the endothelium, after TEA or in rings pre-contracted with KCl (80 mM. Furthermore, EOCC (1000 µg/mL was not able to induce additional effect on maximal relaxation of nifedipine (10 µM. In conclusions, EOCC induces hypotension, possibly by reduction in vascular resistance caused by inhibition of the Ca2+ influx, and bradycardia probably due to an activation of cardiac muscarinic receptors.

  12. Utilisation des données d’insémination artificielle afin d’identifier l’impact d’un évènement abortif dans les élevages de bovins laitiers

    OpenAIRE

    Bronner , A.; Morignat, E.; Madouasse, Aurélien; Gasqui, Patrick; Gay, E.; Calavas, D.

    2015-01-01

    Le présent article a pour objectif de discuter de la faisabilité et de l’intérêt que représenterait le suivi d’un indicateur indirect de survenue des avortements élaboré à partir des données d’insémination artificielle, le taux d’avortements précoces, afin d’identifier l’impact d’un évènement abortif, de manière rétrospective ou prospective. Deux études sont présentées pour illustrer le propos, ayant eu pour objet d’estimer, par l’analyse des variations du taux d’avortements précoces, l’impac...

  13. VARIABILIDAD MORFOLÓGICA DE LAS ESPECIES DEL COMPLEJO POA RESINULOSA (POACEAE Y SU RELACIÓN CON LAS ESPECIES DE LA SECCIÓN DIOICOPOA

    Directory of Open Access Journals (Sweden)

    M. Gabriela Fernández Pepi

    2008-01-01

    Full Text Available El complejo Poa resinulosa incluye un grupo de especies conformado por P. calchaquiensis, P. pedersenii y P. resinulosa, de difícil delimitación debido a que las entidades son afines en cuanto a su morfología, aunque presentan distribución disyunta. Para evaluar y analizar a las especies del complejo Poa resinulosa y especies afines al mismo complejo, se midieron 40 caracteres morfológicos y anatómicos en ejemplares de Poa calchaquiensis, P. lanigera, P. pilcomayensis y P. resinulosa. Esos datos se incorporaron a la matriz del conjunto de especies de Poa sección Dioicopoa confeccionada por Giussani (2000, incluyendo también a P. nubensis una nueva especie afín a P. calchaquiensis. Mediante el análisis de componentes principales y pruebas estadísticas, se circunscribió a las especies del complejo Poa resinulosa. Se describió a P. resinulosa como una variedad de P. ligularis, de la que se diferencia por poseer lígula corta, hojas y cañas de menor longitud, menor ancho de la lámina y estomas de menor tamaño. Se presenta una clave para la identificación de Poa ligularis var. resinulosa y taxones afines, y un mapa con la distribución geográfica de ambas variedades de P. ligularis.

  14. Evaluating sampling strategy for DNA barcoding study of coastal and inland halo-tolerant Poaceae and Chenopodiaceae: A case study for increased sample size.

    Directory of Open Access Journals (Sweden)

    Peng-Cheng Yao

    Full Text Available Environmental conditions in coastal salt marsh habitats have led to the development of specialist genetic adaptations. We evaluated six DNA barcode loci of the 53 species of Poaceae and 15 species of Chenopodiaceae from China's coastal salt marsh area and inland area. Our results indicate that the optimum DNA barcode was ITS for coastal salt-tolerant Poaceae and matK for the Chenopodiaceae. Sampling strategies for ten common species of Poaceae and Chenopodiaceae were analyzed according to optimum barcode. We found that by increasing the number of samples collected from the coastal salt marsh area on the basis of inland samples, the number of haplotypes of Arundinella hirta, Digitaria ciliaris, Eleusine indica, Imperata cylindrica, Setaria viridis, and Chenopodium glaucum increased, with a principal coordinate plot clearly showing increased distribution points. The results of a Mann-Whitney test showed that for Digitaria ciliaris, Eleusine indica, Imperata cylindrica, and Setaria viridis, the distribution of intraspecific genetic distances was significantly different when samples from the coastal salt marsh area were included (P < 0.01. These results suggest that increasing the sample size in specialist habitats can improve measurements of intraspecific genetic diversity, and will have a positive effect on the application of the DNA barcodes in widely distributed species. The results of random sampling showed that when sample size reached 11 for Chloris virgata, Chenopodium glaucum, and Dysphania ambrosioides, 13 for Setaria viridis, and 15 for Eleusine indica, Imperata cylindrica and Chenopodium album, average intraspecific distance tended to reach stability. These results indicate that the sample size for DNA barcode of globally distributed species should be increased to 11-15.

  15. Helicoverpa zea (Lepidoptera: Noctuidae) and Spodoptera frugiperda (Lepidoptera: Noctuidae) Responses to Sorghum bicolor (Poales: Poaceae) Tissues From Lowered Lignin Lines.

    Science.gov (United States)

    Dowd, Patrick F; Sattler, Scott E

    2015-01-01

    The presence of lignin within biomass impedes the production of liquid fuels. Plants with altered lignin content and composition are more amenable to lignocellulosic conversion to ethanol and other biofuels but may be more susceptible to insect damage where lignin is an important resistance factor. However, reduced lignin lines of switchgrasses still retained insect resistance in prior studies. Therefore, we hypothesized that sorghum lines with lowered lignin content will also retain insect resistance. Sorghum excised leaves and stalk pith Sorghum bicolor (L.) Moench (Poales: Poaceae) from near isogenic brown midrib (bmr) 6 and 12 mutants lines, which have lowered lignin content and increased lignocellulosic ethanol conversion efficiency, were examined for insect resistance relative to wild-type (normal BTx623). Greenhouse and growth chamber grown plant tissues were fed to first-instar larvae of corn earworms, Helicoverpa zea (Boddie) and fall armyworms Spodoptera frugiperda (J.E. Smith) (Lepidoptera: Noctuidae), two sorghum major pests. Younger bmr leaves had significantly greater feeding damage in some assays than wild-type leaves, but older bmr6 leaves generally had significantly less damage than wild-type leaves. Caterpillars feeding on the bmr6 leaves often weighed significantly less than those feeding on wild-type leaves, especially in the S. frugiperda assays. Larvae fed the pith from bmr stalks had significantly higher mortality compared with those larvae fed on wild-type pith, which suggested that bmr pith was more toxic. Thus, reducing lignin content or changing subunit composition of bioenergy grasses does not necessarily increase their susceptibility to insects and may result in increased resistance, which would contribute to sustainable production. Published by Oxford University Press on behalf of the Entomological Society of America 2015. This work is written by US Government employees and is in the public domain in the US.

  16. Linkage Maps of a Mediterranean × Continental Tall Fescue Population and their Comparative Analysis with Other Poaceae Species

    Directory of Open Access Journals (Sweden)

    Ryan Dierking

    2015-03-01

    Full Text Available Temperate grasses belonging to the complex are important throughout the world in pasture and grassland agriculture. Tall fescue ( Schreb. is the predominant species in the United States, covering approximately 15 million ha. Tall fescue has distinctive morphotypes, two of which are Continental (summer active and Mediterranean (summer semidormant. This is the first report of a linkage map created for Mediterranean tall fescue, while updating the Continental map with additional simple sequence repeat and sequence-tagged site markers. Additionally, this is the first time that diversity arrays technology (DArT markers were used in the construction of a tall fescue map. The male parent (Continental, R43-64, map consisted of 594 markers arranged in 22 linkage groups (LGs and covered a total of 1577 cM. The female parent (Mediterranean, 103-2, map was shorter (1258 cM and consisted of only 208 markers arranged in 29 LGs. Marker densities for R43-64 and 103-2 were 2.65 and 6.08 cM per marker, respectively. When compared with the other Poaceae species, meadow fescue ( Huds., annual ryegrass ( Lam., perennial ryegrass ( L., (L. Beauv., and barley ( L., a total of 171 and 98 orthologous or homologous sequences, identified by DArT analysis, were identified in R43-64 and 103-2, respectively. By using genomic in situ hybridization, we aimed to identify potential progenitors of both morphotypes. However, no clear conclusion on genomic constitution was reached. These maps will aid in the search for quantitative trait loci of various traits as well as help define and distinguish genetic differences between the two morphotypes.

  17. Les facteurs de motivation infirmière assurant la pérennité d'un soin de qualité afin de prévenir les infections nosocomiales en mileur hospitalier: une revue de littérature étoffée

    OpenAIRE

    Repond, Tracy; Rossier, Jean-Michel; Scrima, Katia

    2013-01-01

    Le but de cette revue de littérature est de relever les facteurs de motivation infirmière qui garantissent la pérennisation d’un comportement d’observance en ce qui concerne les mesures d’hygiène hospitalière afin de diminuer le taux d’infections nosocomiales.

  18. Testing efficacy of distance and tree-based methods for DNA barcoding of grasses (Poaceae tribe Poeae) in Australia.

    Science.gov (United States)

    Birch, Joanne L; Walsh, Neville G; Cantrill, David J; Holmes, Gareth D; Murphy, Daniel J

    2017-01-01

    In Australia, Poaceae tribe Poeae are represented by 19 genera and 99 species, including economically and environmentally important native and introduced pasture grasses [e.g. Poa (Tussock-grasses) and Lolium (Ryegrasses)]. We used this tribe, which are well characterised in regards to morphological diversity and evolutionary relationships, to test the efficacy of DNA barcoding methods. A reference library was generated that included 93.9% of species in Australia (408 individuals, [Formula: see text] = 3.7 individuals per species). Molecular data were generated for official plant barcoding markers (rbcL, matK) and the nuclear ribosomal internal transcribed spacer (ITS) region. We investigated accuracy of specimen identifications using distance- (nearest neighbour, best-close match, and threshold identification) and tree-based (maximum likelihood, Bayesian inference) methods and applied species discovery methods (automatic barcode gap discovery, Poisson tree processes) based on molecular data to assess congruence with recognised species. Across all methods, success rate for specimen identification of genera was high (87.5-99.5%) and of species was low (25.6-44.6%). Distance- and tree-based methods were equally ineffective in providing accurate identifications for specimens to species rank (26.1-44.6% and 25.6-31.3%, respectively). The ITS marker achieved the highest success rate for specimen identification at both generic and species ranks across the majority of methods. For distance-based analyses the best-close match method provided the greatest accuracy for identification of individuals with a high percentage of "correct" (97.6%) and a low percentage of "incorrect" (0.3%) generic identifications, based on the ITS marker. For tribe Poeae, and likely for other grass lineages, sequence data in the standard DNA barcode markers are not variable enough for accurate identification of specimens to species rank. For recently diverged grass species similar challenges are

  19. e Ciências Afins (MAST

    Directory of Open Access Journals (Sweden)

    Marcus Granato

    2005-01-01

    Full Text Available MAST is a science and technology museum located in the grounds and architectural complex belonging to the former Observatório Nacional in Rio de Janeiro. This complex, concluded in 1921, comprises of 16 buildings, and was listed by the Artistic and Historic National (1986 and State (1987 Heritage. This complex features three pavilions sheltering the equatorial telescopes, typical examples of Architecture and Engineering buildings for Astronomic purposes. Two of these pavilions, all of which are under the care of MAST, shelter the 21 cm and 32 cm telescopes, plus a third, part of the National Observatory, which houses the 46 cm equatorial telescope. The present study is the result of the work undertaken by MAST to preserve and restore the historical buildings under its responsibility. Thanks to a partnership set up with the Vitae Foundation, it has been possible to develop restoration work covering all aspects of the pavilions (moving metal dome, building, scientific instrument, as well as the area’s museography, with a view to informing visitors about the restoration work undertaken. The project, based on the historical research on the complex, was carried out by a multidisciplinary team over two years. Each stage of the work was comprehensively photographed, including the intervention project design, which was based on architectural surveys and the diagnosis of the complex’s state of repair, plus the restoration per se. This is a groundbreaking initiative in Latin America and will serve as an example for future actions to be taken on historical buildings, especially those built for scientific and technological purposes.

  20. Afinal, quem foi Sacher-Masoch?

    Directory of Open Access Journals (Sweden)

    Cassandra Pereira França

    2012-06-01

    Full Text Available O artigo pretende aprofundar o conhecimento a respeito do masoquismo, resgatando dados da biografia e da obra de Sacher-Masoch, com base na leitura de Gilles Deleuze. Lendo A Vênus das peles, constata-se que Sacher-Masoch explicita os aspectos formal, estético e contratual do masoquismo, propostos por Deleuze. Justifica-se a importância de se ler diretamente a obra de Masoch para se ter acesso a aspectos da lógica do masoquismo que não têm sido levados em conta nos estudos sobre o tema.

  1. Facilitation of a native pest of rice, Stenotus rubrovittatus (Hemiptera: Miridae), by the non-native Lolium multiflorum (Cyperales: Poaceae) in an agricultural landscape.

    Science.gov (United States)

    Yoshioka, Akira; Takada, Mayura; Washitani, Izumi

    2011-10-01

    Source populations of polyphagous pests often occur on host plants other than the economically damaged crop. We evaluated the contribution of patches of a non-native meadow grass, Lolium multiflorum Lam. (Poaceae), and other weeds growing in fallow fields or meadows as source hosts of an important native pest of rice, Stenotus rubrovittatus (Matsumura) (Hemiptera: Miridae), in an agricultural landscape of northern Japan. Periodical censuses of this mirid bug by using the sweeping method, vegetation surveys, and statistical analysis revealed that L. multiflorum was the only plant species that was positively correlated with the density of adult S. rubrovittatus through two generations and thus may be the most stable and important host of the mirid bug early in the season before the colonization of rice paddies. The risk and cost of such an indirect negative effect on a crop plant through facilitation of a native pest by a non-native plant in the agricultural landscape should not be overlooked.

  2. Dataset on the structural characterization of organosolv lignin obtained from ensiled Poaceae grass and load-dependent molecular weight changes during thermoplastic processing

    Directory of Open Access Journals (Sweden)

    Jörg Dörrstein

    2018-04-01

    Full Text Available This article presents experimental data of organosolv lignin from Poacea grass and structural changes after compounding and injection molding as presented in the research article “Effects of high-lignin-loading on thermal, mechanical, and morphological properties of bioplastic composites” [1]. It supplements the article with morphological (SEM, spectroscopic (31P NMR, FT-IR and chromatographic (GPC, EA data of the starting lignin as well as molar mass characteristics (mass average molar mass (Mw and Polydispersity (D of the extracted lignin. Refer to Schwarz et al. [2] for a detailed description of the production of the organosolv residue and for further information on the raw material used for lignin extraction. The dataset is made publicly available and can be useful for extended lignin research and critical analyzes.

  3. A plastome primer set for comprehensive quantitative real time RT-PCR analysis of Zea mays: a starter primer set for other Poaceae species

    Directory of Open Access Journals (Sweden)

    Dunn Sade N

    2008-06-01

    Full Text Available Abstract Background Quantitative Real Time RT-PCR (q2(RTPCR is a maturing technique which gives researchers the ability to quantify and compare very small amounts of nucleic acids. Primer design and optimization is an essential yet time consuming aspect of using q2(RTPCR. In this paper we describe the design and empirical optimization of primers to amplify and quantify plastid RNAs from Zea mays that are robust enough to use with other closely related species. Results Primers were designed and successfully optimized for 57 of the 104 reported genes in the maize plastome plus two nuclear genes. All 59 primer pairs produced single amplicons after end-point reverse transcriptase polymerase chain reactions (RT-PCR as visualized on agarose gels and subsequently verified by q2(RTPCR. Primer pairs were divided into several categories based on the optimization requirements or the uniqueness of the target gene. An in silico test suggested the majority of the primer sets should work with other members of the Poaceae family. An in vitro test of the primer set on two unsequenced species (Panicum virgatum and Miscanthus sinensis supported this assumption by successfully producing single amplicons for each primer pair. Conclusion Due to the highly conserved chloroplast genome in plant families it is possible to utilize primer pairs designed against one genomic sequence to detect the presence and abundance of plastid genes or transcripts from genomes that have yet to be sequenced. Analysis of steady state transcription of vital system genes is a necessary requirement to comprehensively elucidate gene expression in any organism. The primer pairs reported in this paper were designed for q2(RTPCR of maize chloroplast genes but should be useful for other members of the Poaceae family. Both in silico and in vitro data are presented to support this assumption.

  4. Sinopse das espécies nativas e subespontâneas de Andropogoneae Dumort. (Poaceae na Ilha de Santa Catarina, Brasil A synopsis of the Andropogoneae Dumort. (Poaceae native and subspontaneous to the Island of Santa Catarina, Florianópolis, SC, Brazil

    Directory of Open Access Journals (Sweden)

    Bárbara Toncic Neves

    2011-12-01

    Full Text Available O presente trabalho consiste no levantamento dos táxons da tribo Andropogoneae (Panicoideae - Poaceae ocorrentes na Ilha de Santa Catarina, Florianópolis, Brasil. A partir da revisão de materiais de herbários e coletas a campo foi confirmada a ocorrência de 10 gêneros e 20 espécies, 17 nativas e duas subespontâneas: Andropogon L. (7 spp., Bothriochloa Kuntze (2, Eriochrysis P. Beauv. (1, Hyparrhenia Andersson ex E. Fourn. (1, Imperata Cirillo (1, Ischaemum L. (1, Rhytachne Desv. (1, Saccharum L. (3, Schizachyrium Nees (2 e Sorghum Moench (1. Os gêneros Bothriochloa e Rhytachne são registrados pela primeira vez para a Ilha de Santa Catarina. São apresentadas chaves de identificação para gêneros e espécies, ilustrações, informações sobre distribuição geográfica, habitat, período de floração e comentários para cada táxon.The present work is a survey of the taxa in the tribe Andropogoneae (Panicoideae - Poaceae that occur on the Island of Santa Catarina, Florianópolis, Brazil. Based on a review of herbarium specimens and fieldwork, 20 species were recorded in the following 10 genera: Andropogon L. (7 spp., Bothriochloa Kuntze (2, Eriochrysis P. Beauv. (1, Hyparrhenia Andersson ex E. Fourn. (1, Imperata Cirillo (1, Ischaemum L. (1, Rhytachne Desv. (1, Saccharum L. (3, Schizachyrium Nees (2 and Sorghum Moench (1. Seventeen of the species are native, and two species are subspontaneous. Bothriochloa and Rhytachne are recorded here, for the first time, for the Island of Santa Catarina. This work provides key to the genera and species, as well as illustrations, information about geographic distribution, habitat, phenology, and comments about each taxon presented in the study.

  5. Atividade de glutationa S-transferase na metabolização de acetochlor, atrazine e oxyfluorfen em milho (Zea mays L., sorgo (Sorghum bicolor L. e trigo (Triticum aestivum L. (Poaceae Glutathione S-transferase activity in acetochlor, atrazine and oxyfluorfen metabolization in maize (Zea mays L., sorghum (Sorghum bicolor L. and wheat (Triticum aestivumL. (Poaceae

    Directory of Open Access Journals (Sweden)

    Ethel Lourenzi Barbosa Novelli

    2002-05-01

    Full Text Available Este experimento foi conduzido para avaliar a seletividade em plantas dos herbicidas acetochlor, atrazine e oxyfluorfen em relação à atividade da glutationa S-transferase (GST em plantas de milho (Zea mays L., sorgo (Sorghum bicolor L. e trigo (Triticum aestivum L. (Poaceae. A atividade da GST foi detectada às 24, 48 e 72 horas após as aplicaç��es dos tratamentos. Os tratamentos do experimento consistiram de aplicação com água (controle, acetochlor (3 L.ha-1, atrazine (4 L.ha-1 e oxyfluorfen (1 L.ha-1. As maiores atividades de GST foram observadas na presença de acetochlor, principalmente às 48 horas após o tratamento. Esses aumentos foram 105, 148 e 118% em relação ao controle para milho, sorgo e trigo, respectivamente. É sugerido que a GST pode ter papel na degradação de acetochlor e pode ser uma das razões para a seletividade desse herbicida para essas culturas.This experiment was conducted to evaluate the acetochlor, atrazine and oxyfluorfen herbicides plant selectivity, in relation to glutathione S-transferase activity (GST in maize (Zea mays L., sorghum (Sorghum bicolor L. and wheat (Triticum aestivum L (Poaceae plants. GST activity was detected 24, 48 and 72 hours after treatment applications. The experiment's treatments consisted of spraying plants with water (control, acetochlor (3 L.ha-1`, atrazine (4 L.ha-1 and oxyfluorfen (1 L.ha-1. The highest GST activities were observed in presence of acetochlor, mainly at 48 hours after treatment. These increments were 105, 148 and 118% when compared to maize, sorghum and wheat control groups, respectively. It is suggested that the GST may have a role in acetochlor degradation and it may be a reason for this herbicide's selectivity in these crops.

  6. Effects of livestock exclusion on density, survival and biomass of the perennial sagebrush grass Hymenachne pernambucense (Poaceae) from a temperate fluvial wetland

    Science.gov (United States)

    Magnano, Andrea L.; Nanni, Analía S.; Krug, Pamela; Astrada, Elizabeth; Vicari, Ricardo; Quintana, Rubén D.

    2018-01-01

    In Argentina, the intensification of soybean production has displaced a substantial proportion of cattle ranching to fluvial wetlands such as those in the Delta of the Paraná River. Cattle grazing affects structure and dynamics of native forage plants but there is little information on this impact in populations from fluvial wetlands. This study addresses the effect of cattle ranching on density, survival, mean life-span and aerial biomass of Hymenachne pernambucense (Poaceae), an important forage species in the region. The study was carried out monthly for one year in permanents plots subject to continuous grazing and plots excluded from grazing in the Middle Delta of the Paraná River. In plots excluded from grazing, tillers showed significantly higher population density and survival, and a two-fold increase in mean life-span, while continuous grazing decreased survival of cohorts. The largest contribution to tiller density in ungrazed and grazed populations was made by spring and summer cohorts, respectively. Total and green biomass were significantly higher in the ungrazed population, with highest differences in late spring-early summer. Cattle grazing affected the relationship between tiller density and green biomass suggesting that cattle prefer sprouts because they are more palatable and nutritious than older tissue.

  7. Diseño de un sistema de control de gestión aplicando una reingeniería de procesos al área de abastecimiento (compras e importaciones) en una empresa que se dedica al desarrollo, producción y comercialización de vinos, licores y demás productos afines

    OpenAIRE

    Albán Del Salto, Shirley Juliana; Eugenio Gonzalez, Melissa Tamara

    2013-01-01

    Este proyecto fue aplicado a una compañía dedicada al desarrollo, producción y comercialización de vinos, licores y demás productos afines. En vista de su constante crecimiento, esta empresa decidió realizar un cambio sustancial en el sistema de compras que utilizaba para una mejora en el uso de los recursos materiales y financieros. Motivo por el cual optó valerse de un Sistema de Control de Gestión basado en indicadores de Gestión y desempeño para el proceso de compras, el mismo que básicam...

  8. Karyotype evolution in Phalaris (Poaceae): The role of reductional dysploidy, polyploidy and chromosome alteration in a wide-spread and diverse genus.

    Science.gov (United States)

    Winterfeld, Grit; Becher, Hannes; Voshell, Stephanie; Hilu, Khidir; Röser, Martin

    2018-01-01

    Karyotype characteristics can provide valuable information on genome evolution and speciation, in particular in taxa with varying basic chromosome numbers and ploidy levels. Due to its worldwide distribution, remarkable variability in morphological traits and the fact that ploidy change plays a key role in its evolution, the canary grass genus Phalaris (Poaceae) is an excellent study system to investigate the role of chromosomal changes in species diversification and expansion. Phalaris comprises diploid species with two basic chromosome numbers of x = 6 and 7 as well as polyploids based on x = 7. To identify distinct karyotype structures and to trace chromosome evolution within the genus, we apply fluorescence in situ hybridisation (FISH) of 5S and 45S rDNA probes in four diploid and four tetraploid Phalaris species of both basic numbers. The data agree with a dysploid reduction from x = 7 to x = 6 as the result of reciprocal translocations between three chromosomes of an ancestor with a diploid chromosome complement of 2n = 14. We recognize three different genomes in the genus: (1) the exclusively Mediterranean genome A based on x = 6, (2) the cosmopolitan genome B based on x = 7 and (3) a genome C based on x = 7 and with a distribution in the Mediterranean and the Middle East. Both auto- and allopolyploidy of genomes B and C are suggested for the formation of tetraploids. The chromosomal divergence observed in Phalaris can be explained by the occurrence of dysploidy, the emergence of three different genomes, and the chromosome rearrangements accompanied by karyotype change and polyploidization. Mapping the recognized karyotypes on the existing phylogenetic tree suggests that genomes A and C are restricted to sections Phalaris and Bulbophalaris, respectively, while genome B occurs across all taxa with x = 7.

  9. Karyotype evolution in Phalaris (Poaceae: The role of reductional dysploidy, polyploidy and chromosome alteration in a wide-spread and diverse genus.

    Directory of Open Access Journals (Sweden)

    Grit Winterfeld

    Full Text Available Karyotype characteristics can provide valuable information on genome evolution and speciation, in particular in taxa with varying basic chromosome numbers and ploidy levels. Due to its worldwide distribution, remarkable variability in morphological traits and the fact that ploidy change plays a key role in its evolution, the canary grass genus Phalaris (Poaceae is an excellent study system to investigate the role of chromosomal changes in species diversification and expansion. Phalaris comprises diploid species with two basic chromosome numbers of x = 6 and 7 as well as polyploids based on x = 7. To identify distinct karyotype structures and to trace chromosome evolution within the genus, we apply fluorescence in situ hybridisation (FISH of 5S and 45S rDNA probes in four diploid and four tetraploid Phalaris species of both basic numbers. The data agree with a dysploid reduction from x = 7 to x = 6 as the result of reciprocal translocations between three chromosomes of an ancestor with a diploid chromosome complement of 2n = 14. We recognize three different genomes in the genus: (1 the exclusively Mediterranean genome A based on x = 6, (2 the cosmopolitan genome B based on x = 7 and (3 a genome C based on x = 7 and with a distribution in the Mediterranean and the Middle East. Both auto- and allopolyploidy of genomes B and C are suggested for the formation of tetraploids. The chromosomal divergence observed in Phalaris can be explained by the occurrence of dysploidy, the emergence of three different genomes, and the chromosome rearrangements accompanied by karyotype change and polyploidization. Mapping the recognized karyotypes on the existing phylogenetic tree suggests that genomes A and C are restricted to sections Phalaris and Bulbophalaris, respectively, while genome B occurs across all taxa with x = 7.

  10. Allotetraploid origin and divergence in Eleusine (Chloridoideae, Poaceae): evidence from low-copy nuclear gene phylogenies and a plastid gene chronogram.

    Science.gov (United States)

    Liu, Qing; Triplett, Jimmy K; Wen, Jun; Peterson, Paul M

    2011-11-01

    Eleusine (Poaceae) is a small genus of the subfamily Chloridoideae exhibiting considerable morphological and ecological diversity in East Africa and the Americas. The interspecific phylogenetic relationships of Eleusine are investigated in order to identify its allotetraploid origin, and a chronogram is estimated to infer temporal relationships between palaeoenvironment changes and divergence of Eleusine in East Africa. Two low-copy nuclear (LCN) markers, Pepc4 and EF-1α, were analysed using parsimony, likelihood and Bayesian approaches. A chronogram of Eleusine was inferred from a combined data set of six plastid DNA markers (ndhA intron, ndhF, rps16-trnK, rps16 intron, rps3, and rpl32-trnL) using the Bayesian dating method. The monophyly of Eleusine is strongly supported by sequence data from two LCN markers. In the cpDNA phylogeny, three tetraploid species (E. africana, E. coracana and E. kigeziensis) share a common ancestor with the E. indica-E. tristachya clade, which is considered a source of maternal parents for allotetraploids. Two homoeologous loci are isolated from three tetraploid species in the Pepc4 phylogeny, and the maternal parents receive further support. The A-type EF-1α sequences possess three characters, i.e. a large number of variations of intron 2; clade E-A distantly diverged from clade E-B and other diploid species; and seven deletions in intron 2, implying a possible derivation through a gene duplication event. The crown age of Eleusine and the allotetraploid lineage are 3·89 million years ago (mya) and 1·40 mya, respectively. The molecular data support independent allotetraploid origins for E. kigeziensis and the E. africana-E. coracana clade. Both events may have involved diploids E. indica and E. tristachya as the maternal parents, but the paternal parents remain unidentified. The habitat-specific hypothesis is proposed to explain the divergence of Eleusine and its allotetraploid lineage.

  11. Variação dos teores de constituintes voláteis de Cymbopogon citratus (DC Staf, Poaceae, coletados em diferentes regiões do Estado de São Paulo Variation in the amounts of volatile constituents of Cymbopogon citratus (DC Staf, Poaceae, collected in different regions of São Paulo State

    Directory of Open Access Journals (Sweden)

    Marcos R. Furlan

    2010-11-01

    Full Text Available O óleo essencial extraído de Cymbopogon citratus (DC Staf, Poaceae, é rico em citral sendo amplamente empregado na indústria química e farmacêutica. Os objetivos desse estudo foram avaliar o conteúdo de citral entre populações de C. citratus coletados em duas regiões diferentes (Ibiúna e Pindamonhangaba, Estado de São Paulo. O óleo essencial extraído de uma população cultivada em Pindamonhangaba-SP apresentou uma concentração alta de citral (aproximadamente 96,0%, enquanto que o óleo extraído da população de Ibiúna-SP apresentou, além de citral, proporções elevadas de outro monoterpeno, o geraniol. Adicionalmente, os óleos essenciais obtidos desta população de C. citratus foram extraídos e analisados ao longo de 24 h (a cada 3 h, sendo que o teor de citral foi maior no período da noite, o que mostra a importância de estudos que avaliam as diferenças químicas associadas às mudanças circadianas. Os componentes dos óleos essenciais foram identificados por RMN de 13C, CG/EM e CG através do índice de Kovats.The essential oil extracted from Cymbopogon citratus (DC Staf, Poaceae, is rich in citral and has many applications in chemical and pharmaceutical industry. The aims of this study were evaluate the amount of citral in populations of C. citratus collected in two different regions (Ibiúna and Pindamonhangaba, São Paulo State. The essential oil extracted of a cultivated population in Pidamonhangaba-SP, showed a high content of citral (approximately 96.0%, while the essential oil from Ibiuna-SP, showed citral and high amounts of another monoterpene, geraniol. Additionally, the essential oils from this population of C. citratus were extracted and analyzed during 24 h (each 3 h, being the major concentration of citral in the night period, indicating that studies which evaluated the chemical differences associated to circadian changes. The components of essential oils were identified through 13C NMR, GC/MS, GC and

  12. Padrão de resposta de Mimosa pudica e Senna obtusifolia à atividade potencialmente alelopática de espécies de Poaceae Response pattern of Mimosa pudica e Senna obtusifolia to potentially allelopathic activity of Poaceae species

    Directory of Open Access Journals (Sweden)

    A.P.S. Souza Filho

    2010-01-01

    Full Text Available A alelopatia é um importante mediador de interferências que alteram a dinâmica de espécies de plantas em sistemas agrícolas. Neste trabalho, procurou-se determinar a existência de padrão de respostas das plantas daninhas Mimosa pudica e Senna obtusifolia a espécies da família Poaceae, via interação entre espécies e frações e ordenamento dos efeitos. Bioensaios de germinação de sementes e alongamento da radícula e do hipocótilo foram desenvolvidos, em condições controladas. Os testes foram realizados utilizando-se extratos hidroalcoólicos na concentração de 1,0% das frações folha, raiz e sementes de quatro espécies de Poaceae. Diferenças na intensidade dos efeitos para os fatores espécie e fração foram verificadas. O padrão de atividade observado foi de Paspalum maritimum apresentar as inibições mais intensas. Entre as espécies de Brachiaria, as inibições mais intensas foram produzidas por B. brizantha. Houve resposta efetiva para a especificidade entre espécies e fração para a germinação e alongamento da radícula, especialmente na espécie Mimosa pudica. Apenas para os extratos de P. maritimum foram observadas especificidade e efetividade em relação à germinação de sementes e alongamento da radícula da espécie Senna obtusifolia. A fração folha foi mais efetiva nas inibições, sobretudo na espécie P. maritimum. Comparativamente, a espécie Mimosa pudica foi mais sensível aos efeitos dos extratos, especialmente em relação ao desenvolvimento da radícula e do hipocótilo. A intensidade dos efeitos alelopáticos variou na seguinte ordem: alongamento da radícula > germinação de sementes > alongamento do hipocótilo. A ordenação dos resultados, para os indicadores de inibição, indicou discriminação no padrão para as espécies receptoras, o que sugere especificidade dos extratos.Allelopathy is an important device to measure interferences affecting the dynamics of plant species in

  13. Chemical composition and cardiovascular effects induced by the essential oil of Cymbopogon citratus DC. Stapf, Poaceae, in rats Composição química e efeitos cardiovasculares do óleo essencial de Cymbopogon citratus DC. Stapf, Poaceae, em ratos

    Directory of Open Access Journals (Sweden)

    Flávia V. Moreira

    2010-12-01

    Full Text Available Cymbopogon citratus DC. Stapf, Poaceae, is used in the folk medicine for hypertension treatment. This work investigated the chemical composition and cardiovascular effects in rats of C. citratus essential oil (EOCC. A phytochemical screening demonstrated the presence of eight constituents, being geranial the major compound (43.08%. In rats, EOCC (1, 5, 10, and 20 mg/kg, i.v. induced transient hypotension and bradycardia that were attenuated by atropine and sodium thiopental, but not by L-NAME or indomethacin. In rings of rat superior mesenteric artery pre-contracted with phenylephrine, EOCC (1 to 3000 µg/mL induced relaxation that was not affected after removal of the endothelium, after TEA or in rings pre-contracted with KCl (80 mM. Furthermore, EOCC (1000 µg/mL was not able to induce additional effect on maximal relaxation of nifedipine (10 µM. In conclusions, EOCC induces hypotension, possibly by reduction in vascular resistance caused by inhibition of the Ca2+ influx, and bradycardia probably due to an activation of cardiac muscarinic receptors.C. citratus é utilizada na medicina popular para tratar hipertensão. Este trabalho investigou a composição química e os efeitos cardiovasculares do óleo essencial do C. citratus (OECC. Foram identificados oito constituintes no OECC, sendo geranial o majoritário (43,08%. Em ratos, o OECC (1, 5, 10 e 20 mg/kg, i.v. induziu hipotensão e bradicardia que foram atenuadas pela atropina e tiopental sódico, mas não por L-NAME ou indometacina. Em anéis de artéria mesentérica de ratos pré-contraídos com fenilefrina, o OECC (1 a 3000 µg/mL induziu relaxamento que não foi afetado após remoção do endotélio, após TEA ou em anéis pré-contraídos com KCl (80 mM. Além disso, o OECC (1000 µg/mL não induziu efeito adicional sobre o relaxamento máximo da nifedipina (10 µM. Em conclusão, o OECC induz hipotensão possivelmente devido à redução da resistência vascular que pode ser causada

  14. Communications Received from Certain Member States Regarding Guidelines for the Export of Nuclear Material, Equipment and Technology. Nuclear Transfers and Nuclear-Related Dual-Use Transfers; Comunicaciones Recibidas De Diversos Estados Miembros Relativas A Las Directrices Para La Exportacion De Tecnologia, Equipo Y Materiales Nucleares. Transferencias Nucleares Y Transferencias De Equipo, Materiales V Tecnologia Afin Al Doble Uso En Materia Nuclear

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1993-04-15

    The Director General has received a Note Verbale dated 5 March 1993 from the Ministry of Foreign Affairs of the Slovak Republic. The purpose of the Note Verbale is to provide information on that Governments' guidelines for Nuclear Transfers and for Transfers of of Nuclear-related Dual-use Equipment, Material and Related Technology. In the light of the wish expressed at the end of each Note Verbale, the text of the Note Verbale is annexed hereto [Spanish] El Director General ha recibido una nota verbal de fecha 5 de marzo de 1993 del Ministerio de Relaciones Exteriores de la RepUblica Eslovaca. El objetivo de la nota verbal es proporcionar informaciOn sobre las Directrices para las transferencias nucleares y las Directrices para la transferencia de equipo, materiales y tecnologia afin al doble uso en materia nuclear, de dicho Gobierno. Atendiendo a los deseos expresados al final de la nota verbal, se adjunta al presente documento el texto de la nota verbal.

  15. Catalyser une science ouverte et collaborative afin de relever les ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Una Hakika : Porter à grande échelle les solutions numériques pour la gestion des conflits au Kenya et en Birmanie. L'information erronée, qu'elle soit le fruit de rumeurs ou d'une désinformation intentionnelle, peut alimenter le conflit et exercer de profondes répercussions sur la paix, la... Voir davantageUna Hakika : Porter ...

  16. AFINAL, COMO SE FORMAM AS ESTRATÃGIAS?

    Directory of Open Access Journals (Sweden)

    Maurício Fernandes Pereira

    2007-12-01

    Full Text Available Tem havido recentemente um grande interesse por parte dos autores em entender como se desenvolve a prática da estratégia organizacional. Partindo desta tendência, o presente trabalho descreve como ocorre o processo de formação estratégica em uma organização pertencente ao terceiro setor â o SESC/SC (Serviço Social do Comércio em Santa Catarina. A criação da estratégia na organização em estudo é analisada tomando-se como base os referenciais propostos por Whittington (2002, analisando duas dimensões principais: os resultados pretendidos com as estratégias e os processos pelos quais ela acontece. Com base nos dados coletados observou-se que, na prática da organização pesquisada, as razões que levam ao estabelecimento da estratégia não estão unicamente voltadas aos aspectos econômicos. Quanto à formação das estratégias, no caso estudado, predominou a formação da estratégia da visão clássica de Whittington (2002, por meio da utilização do planejamento estratégico.

  17. AFINAL, COMO SE FORMAM AS ESTRATÉGIAS?

    Directory of Open Access Journals (Sweden)

    Maurício Fernandes Pereira

    2007-12-01

    Full Text Available Tem havido recentemente um grande interesse por parte dos autores em entender como se desenvolve a prática da estratégia organizacional. Partindo desta tendência, o presente trabalho descreve como ocorre o processo de formação estratégica em uma organização pertencente ao terceiro setor – o SESC/SC (Serviço Social do Comércio em Santa Catarina. A criação da estratégia na organização em estudo é analisada tomando-se como base os referenciais propostos por Whittington (2002, analisando duas dimensões principais: os resultados pretendidos com as estratégias e os processos pelos quais ela acontece. Com base nos dados coletados observou-se que, na prática da organização pesquisada, as razões que levam ao estabelecimento da estratégia não estão unicamente voltadas aos aspectos econômicos. Quanto à formação das estratégias, no caso estudado, predominou a formação da estratégia da visão clássica de Whittington (2002, por meio da utilização do planejamento estratégico.

  18. Renforcement de la collaboration nationale et internationale afin d ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'appui du CRDI au Conseil canadien pour la coopération internationale (CCCI) se poursuit grâce à cette subvention de deux ans visant à renforcer les capacités des membres du conseil en matière d'apprentissage, d'innovation, de recherche sur les politiques et d'élaboration de politiques, en partenariat avec des ...

  19. Teaching Cases in Management - Afinal, Quantas Empresas tem esta Cidade?

    Directory of Open Access Journals (Sweden)

    Rosane Rivera Torres

    2010-05-01

    Full Text Available Barueri is a small country town, located to the west of São Paulo City. The town offers tax exemptions to companies that set up business there, becoming an important industrial area and cluster. As a consequence, Barueri has filled up with paper companies, that is, companies that exist only for formal burocratic purposes, but which do not really conduct their operations there. The task of identifying which companies really conduct their operations in the town is difficult. Frequently, a contact with a company with headquarters in Barueri results in dealing with a professional accounting office professional which represents it, with the organization effectively being located outside the town. The Presbyterian Mackenzie University intended to establish relationships with companies of the region, considering the plans of development for the Tamboré Campus, located in Barueri. Consequently, it was essential to define a universe and a sample of companies whose operations occurred in the surrounding area of the Campus in order to establish partnership programs. It was therefore faced with the challenge of finding which companies were effectively located in Barueri, since paper companies have no interest in the development of the campus. How to find them?

  20. La apicultura sevillana afines de la Edad Media

    Directory of Open Access Journals (Sweden)

    Carmona Ruiz, María Antonia

    2000-06-01

    Full Text Available The purpose of this article is to present the apiculture industry in Seville in the Late Middle Ages. Due to the importance of this economic activity, "ordenanzas" (bylaws, which regulated the exploitation of the apiaries, were passed shortly after the conquest of Seville. By means of these "ordenanzas" and other documents which made reference to beekeeping, I have tried to reconstruct the map of the areas dedicated to apiculture in Seville, by indicating where the beehives were located and how they were exploited. I will deal especially with the existence of institutions relating to beekeeping, for example the "alcaldes de los colmeneros" (municipal officials who supervised and controlled the activities of the beekeepers. I will also deal with the owners of the beehives and the conflicts they had with other economic activities carried out in the same place. I will pay special attention to the problems the beekeepers had with the farmers and stockbreeders, and to the problems existing among the beekeepers themselves. These problems forced the creation of boundaries and regulated distances between the different exploitations.[fr] Cet article traite sur l'activité apicole à Seville pendant le Bas Moyen Âge. L'importance de cette activité économique entraîne la promulgation -peu de temps après la conquête de la ville- d'ordonnances sur l'exploitation des ruches. En partant de ces ordonnances et d'autres documents relatifs à la même activité, nous tentons de déterminer les espaces apicoles du territoire communal de Seville et de préciser l'emplacement et le mode d'exploitation des ruches. Nous soulignons l'existence d'institutions propres à cette activité—celle des alcaldes de los colmeneros (juges des apiculteurs, par exemple— et consacrons une partie de notre travail aux propriétaires de ruches et aux conflits surgis, soit entre eux, soit entre l'apiculture et d'autres activités économiques profitant des mêmes espaces, tout spécialement l'agriculture et l'élevage; ces conflits ont obligé à bien établir les limites et les distances entre les différentes exploitations.

  1. Restaurando a Governabilidade: O Brasil (afinal se Acertou?

    Directory of Open Access Journals (Sweden)

    Faucher Philippe

    1998-01-01

    Full Text Available The article aims to link recent changes in Brazil's political and economic situation with the question of governance in a democratic setting. It shows that a set of policies are only as good as the political support which enables their implementation. As memories of the economic nightmare of the past decade fade and the costs of sustaining price stability through needed budget cuts continue to be felt, popular dissatisfaction with reform is bound to increase. The Cardoso Administration's incremental strategy of state reform and its step-by-step approach to crucial human rights issues reflect the conflicting pressures the government must balance in order to make policy advances. As democratization increases the autonomous representation of societal interests and the structure of Brazilian politics continues to erect legislative obstacles, incrementalism seems the most appropriate pace for producing real, long-lasting reform.

  2. Como se posicionam os professores perante a existência e utilização de jardins zoológicos e parques afins? Resultados de uma investigação How do teachers stand with respect to the existence and use of zoological gardens and similar parks? Results of an investigation

    Directory of Open Access Journals (Sweden)

    António Almeida

    2008-08-01

    Full Text Available O presente estudo insere-se numa investigação mais ampla que pretendeu verificar a incidência de concepções ambientalistas de teor antropocêntrico, biocêntrico e ecocêntrico em docentes dos diferentes ciclos de escolaridade não superior e que se envolvem em projectos de Educação Ambiental (EA. Para tal, foram entrevistados 60 docentes sobre vários assuntos relacionados com a temática ambiental, entre os quais o dos jardins zoológicos e parques afins. No tratamento dos dados, os docentes entrevistados foram divididos em dois grupos em função da proveniência de ciclos com e sem monodocência (o 1º grupo foi constituído por 15 educadores de infância e 15 professores do 1º Ciclo; o 2º grupo, por 15 professores do 2º Ciclo e 15 do 3º Ciclo e Secundário. Essa divisão foi considerada especialmente pertinente para o tema em análise uma vez que os jardins zoológicos e parques afins tradicionalmente pretendem captar um público mais jovem. Assim, nos professores do 1º grupo, poderia eventualmente acentuar-se mais uma conflitualidade entre o seu interesse didáctico e eventuais valores trabalhados em EA. No entanto, não se verificaram diferenças estatisticamente significativas entre os grupos em termos da incidência das diferentes perspectivas ambientalistas, tendo-se a maioria dos docentes posicionado de um ponto de vista biocêntrico, embora com uma maior frequência para o 1º grupo. Perante a surpresa manifestada pelo teor da entrevista, tivemos a percepção de que os professores raramente abordam temas polémicos com os seus alunos no âmbito dos projectos de EA.This study is part of a wider investigation that seeks to observe the presence of environmentalist conceptions of anthropocentric, bio-centric and eco-centric characters among teachers from the various levels of schooling below higher education involved in projects of Environmental Education (EE. Sixty teachers were interviewed on various subjects associated to

  3. Variação dos teores de constituintes voláteis de Cymbopogon citratus (DC Staf, Poaceae, coletados em diferentes regiões do Estado de São Paulo

    Directory of Open Access Journals (Sweden)

    Marcos R. Furlan

    2010-10-01

    Full Text Available O óleo essencial extraído de Cymbopogon citratus (DC Staf, Poaceae, é rico em citral sendo amplamente empregado na indústria química e farmacêutica. Os objetivos desse estudo foram avaliar o conteúdo de citral entre populações de C. citratus coletados em duas regiões diferentes (Ibiúna e Pindamonhangaba, Estado de São Paulo. O óleo essencial extraído de uma população cultivada em Pindamonhangaba-SP apresentou uma concentração alta de citral (aproximadamente 96,0%, enquanto que o óleo extraído da população de Ibiúna-SP apresentou, além de citral, proporções elevadas de outro monoterpeno, o geraniol. Adicionalmente, os óleos essenciais obtidos desta população de C. citratus foram extraídos e analisados ao longo de 24 h (a cada 3 h, sendo que o teor de citral foi maior no período da noite, o que mostra a importância de estudos que avaliam as diferenças químicas associadas às mudanças circadianas. Os componentes dos óleos essenciais foram identificados por RMN de 13C, CG/EM e CG através do índice de Kovats.

  4. Use of Ethanol/Diesel Blend and Advanced Calibration Methods to Satisfy Euro 5 Emission Standards without DPF Utilisation d’un carburant Diesel éthanolé à l’aide de méthodes de calibration avancées afin de satisfaire les normes Euro 5 sans filtre à particules

    Directory of Open Access Journals (Sweden)

    Magand S.

    2011-11-01

    innovative calibration methods, based on the simultaneous optimisation of engine basic settings and cold correction maps, are introduced in order to better suit to the new formulation impact on combustion and catalyst light-off and to drop off engine-out unburned hydrocarbons and carbon monoxide emissions. This stage allows pushing forward the work on test bed facilities in order to reduce the amount of vehicle tests. Tests on a chassis dynamometer are only used to validate the engine test bed results and to perform final tuning of cold correction maps. This alternative blend shows potential to achieve Euro 5 standard with Euro 4 Diesel vehicle configuration, without any hardware modification and without a Diesel particulate filter in the exhaust line. Such an innovative fuel formulation seems to be an interesting answer to the trade-off in the forthcoming years between cost and emissions reduction to achieve sustainable mobility. The presented calibration methods and tools allow to fully take advantage of this alternative fuel in a reduced time scale. L’utilisation des biocarburants s’est développée durant ces dernières années de façon importante afin de diversifier les sources d’énergies et de limiter la hausse des émissions de gaz à effet de serre du secteur des transports. L’un des carburants renouvelables les plus adaptés à une production de masse est l’éthanol. Celui-ci est aujourd’hui principalement utilisé dans les moteurs à allumage commandé, alors que la part des véhicules Diesel sur le marché européen est de l’ordre de 60 %. Ce constat nous a incité à proposer une formulation innovante utilisant de l’éthanol pour les applications Diesel. Les principaux verrous technologiques pour cette utilisation sont la miscibilité, la température d’éclair, la lubrification ou encore l’indice de cétane. Des travaux ont été réalisés pour optimiser la formulation contenant de l’éthanol, des biodiesels de première et seconde g

  5. Genome Evolution in the Genus Sorghum (Poaceae)

    OpenAIRE

    PRICE, H. JAMES; DILLON, SALLY L.; HODNETT, GEORGE; ROONEY, WILLIAM L.; ROSS, LARRY; JOHNSTON, J. SPENCER

    2005-01-01

    • Background and Aims The roles of variation in DNA content in plant evolution and adaptation remain a major biological enigma. Chromosome number and 2C DNA content were determined for 21 of the 25 species of the genus Sorghum and analysed from a phylogenetic perspective.

  6. Bromus interruptus (Hack.) Druce (Poaceae) in Nederland

    NARCIS (Netherlands)

    Rich, Tim C.G.

    2001-01-01

    Bromus interruptus is a grass which was endemic to England but is now extinct in the wild. Attention is drawn to the two historic records from the Netherlands, where it was probably introduced with agricultural seed, in case it still survives in the wild. It is readily recognised from the contracted

  7. Monograph of Diplachne (Poaceae, Chloridoideae, Cynodonteae).

    Science.gov (United States)

    Snow, Neil; Peterson, Paul M; Romaschenko, Konstantin; Simon, Bryan K

    2018-01-01

    Diplachne P. Beauv. comprises two species with C 4 (NAD-ME) photosynthesis. Diplachne fusca has a nearly pantropical-pantemperate distribution with four subspecies: D. fusca subsp. fusca is Paleotropical with native distributions in Africa, southern Asia and Australia; the widespread Australian endemic D. f. subsp. muelleri; and D. f. subsp. fascicularis and D. f. subsp. uninervia occurring in the New World. Diplachne gigantea is known from a few widely scattered, older collections in east-central and southern Africa, and although Data Deficient clearly is of conservation concern. A discussion of previous taxonomic treatments is provided, including molecular data supporting Diplachne in its newer, restricted sense. Many populations of Diplachne fusca are highly tolerant of saline substrates and most prefer seasonally moist to saturated soils, often in disturbed areas. Some populations of Diplachne fusca in southern Asia combine nitrogen-fixation, high salinity tolerance and palatibilty to livestock, which should be pursued with further research for purposes of soil reclamation. Diplachne fusca subsp. uninervia is the most invasive of the subspecies and is becoming weedy in some non-native areas, including in the Old World. This monograph provides detailed descriptions of all taxa, a key to the species and subspecies, geographic distributions and information on the anatomy of leaves, stems, lemmatal micromorphology and discussions of the chromosome numbers. Lectotypes are designated for: Atropis carinata Grisb.; Diplachne acuminata Nash; Diplachne capensis (Nees) Nees var. concinna Nees; Diplachne capensis (Nees) Nees var. obscura Nees, Diplachne capensis (Nees) Nees var. prolifera subvar. minor Nees, Diplachne halei Nash, Diplachne maritima E.P. Bicknel, Diplachne muelleri Benth., Diplachne reverchonii Vasey, Diplachne tectoneticola Backer, Leptochloa imbricata Thurb., Leptochloa neuroglossa Peter, Leptochloa uninervia var. typica fo. abbreviata Parodi, Triodia ambigua R. Br. and Triodia parviflora R. Br.

  8. Two New American Species of Hordeum (Poaceae)

    DEFF Research Database (Denmark)

    Bothmer, Roland Von; Jacobsen, Niels; Bagger Jørgensen, Rikke

    1985-01-01

    Two new species of Hordeum are described, viz. the diploid H. erectifolium, native to Argentina, and H. guatemalense, native to Guatemala.......Two new species of Hordeum are described, viz. the diploid H. erectifolium, native to Argentina, and H. guatemalense, native to Guatemala....

  9. Distribution of Vulpia species (Poaceae in Poland

    Directory of Open Access Journals (Sweden)

    Ludwik Frey

    2011-01-01

    Full Text Available The distribution of four species of the genus Vulpia [V. myuros (L. C.C. Gmel., V. bromoides (L. S.F. Gray, V. ciliata Dumort. and V. geniculata (L. Link] reported in Poland has been studied. Currently, V. myuros and especially V. bromoides are very rare species, and their greatest concentration can be found only in the Lower Silesia region. The number of their localities decreased after 1950 and it seems resonable to include both species in the "red list" of threatened plants in Poland: V. myuros in the EN category, V. bromoides in the CR category. V. ciliata and V. geniculata are very rare ephemerophytes and their localities not confirmed during ca 60 years are of historical interest only.

  10. Karyotype asymmetry in Cynodon Rich. (Poaceae) accessions.

    Science.gov (United States)

    Chiavegatto, R B; Paula, C M P; Souza Sobrinho, F; Benites, F R G; Techio, V H

    2016-12-02

    Cynodon is a genus of plants with forage potential that has attracted the interest of breeders. These species have high morphological variability in a large number of varieties and cytotypes, hampering identification. This study aimed to determine the karyotype asymmetry index among accessions of Cynodon to discriminate between them. Karyotype symmetry was based on three estimates, which were compared. The basic number for the genus is x = 9. The results of the chromosome count and DNA quantification, respectively, were as follows: two diploid accessions (2n = 2x = 18 and 1.08 ± 0.094 to 1.17 ± 0.036 pg DNA and ± standard deviation), one triploid accession (2n = 3x = 27 and 1.63 ± 0.017 pg DNA), four tetraploid accessions (2n = 4x = 36 and 1.88 ± 0.069 to 2.10 ± 0.07 pg DNA), and one pentaploid accession (2n = 5x = 45 and 2.55 ± 0.098 pg DNA). C. incompletus var. hirsutus had the longest total length of the haploid lot (29.05 µm), with chromosomes that ranged from 1.7 to 6.2 µm in length. On the basis of the karyotype asymmetry indices, the accessions were divided into two groups: 1) C. dactylon var. dactylon, C. transvaalensis, C. dactylon var. polevansii, three accessions of Cynodon sp, and C. nlemfuensis; and 2) C. incompletus var. hirsutus. This is the first description of tetraploidy in C. transvaalensis. The karyotypic data facilitated a determination of the degree of proximity between the accessions.

  11. Comparison of foliar anatomy of ten bread wheat (triticum, poaceae) and ten barley (hordeum, poaceae) cultivars

    International Nuclear Information System (INIS)

    Ardic, M.; Sezer, O.; Ozgdsd, K.; Yaylaci, O. K.; Koyuncu, O.; Olgun, M.; Bascdftcd, Z. B.; Ayter, N. G.

    2015-01-01

    The aim of this study is to determine anatomical differences and classification of leaf and leaf cell characteristics (cuticle thickness, upper epidermis thickness, lower epidermis thickness, mesophyll thickness, parenchyma thickness and leaf thickness) between 10 bread wheat cultivars (Triticum aestivum L.) and 10 barley cultivars (Hordeum vulgare L.). Classification of leaf characteristics in bread wheat and barley cultivars and relationship between leaf characteristics are made by principal component and correlation analyses. Highest thickness belongs to W8 Mufitbey cultivar in mesophyll and lower epidermis and W1 Sonmez 01 cultivar have the lowest thickness of upper epidermis in bread wheat. In Barley, B1 Ince cultivar has highest leaf thickness mesophyll and parenchyma; lowest thickness of cuticle is included B7 Cumhuriyet 50 cultivar. All other cultivars have homogenous contents of leaf characteristics. (author)

  12. Complete chloroplast genome sequence of a major allogamous forage species, perennial ryegrass (Lolium perenne L.).

    Science.gov (United States)

    Diekmann, Kerstin; Hodkinson, Trevor R; Wolfe, Kenneth H; van den Bekerom, Rob; Dix, Philip J; Barth, Susanne

    2009-06-01

    Lolium perenne L. (perennial ryegrass) is globally one of the most important forage and grassland crops. We sequenced the chloroplast (cp) genome of Lolium perenne cultivar Cashel. The L. perenne cp genome is 135 282 bp with a typical quadripartite structure. It contains genes for 76 unique proteins, 30 tRNAs and four rRNAs. As in other grasses, the genes accD, ycf1 and ycf2 are absent. The genome is of average size within its subfamily Pooideae and of medium size within the Poaceae. Genome size differences are mainly due to length variations in non-coding regions. However, considerable length differences of 1-27 codons in comparison of L. perenne to other Poaceae and 1-68 codons among all Poaceae were also detected. Within the cp genome of this outcrossing cultivar, 10 insertion/deletion polymorphisms and 40 single nucleotide polymorphisms were detected. Two of the polymorphisms involve tiny inversions within hairpin structures. By comparing the genome sequence with RT-PCR products of transcripts for 33 genes, 31 mRNA editing sites were identified, five of them unique to Lolium. The cp genome sequence of L. perenne is available under Accession number AM777385 at the European Molecular Biology Laboratory, National Center for Biotechnology Information and DNA DataBank of Japan.

  13. Plastid phylogenomics of the cool-season grass subfamily: clarification of relationships among early-diverging tribes.

    Science.gov (United States)

    Saarela, Jeffery M; Wysocki, William P; Barrett, Craig F; Soreng, Robert J; Davis, Jerrold I; Clark, Lynn G; Kelchner, Scot A; Pires, J Chris; Edger, Patrick P; Mayfield, Dustin R; Duvall, Melvin R

    2015-05-04

    Whole plastid genomes are being sequenced rapidly from across the green plant tree of life, and phylogenetic analyses of these are increasing resolution and support for relationships that have varied among or been unresolved in earlier single- and multi-gene studies. Pooideae, the cool-season grass lineage, is the largest of the 12 grass subfamilies and includes important temperate cereals, turf grasses and forage species. Although numerous studies of the phylogeny of the subfamily have been undertaken, relationships among some 'early-diverging' tribes conflict among studies, and some relationships among subtribes of Poeae have not yet been resolved. To address these issues, we newly sequenced 25 whole plastomes, which showed rearrangements typical of Poaceae. These plastomes represent 9 tribes and 11 subtribes of Pooideae, and were analysed with 20 existing plastomes for the subfamily. Maximum likelihood (ML), maximum parsimony (MP) and Bayesian inference (BI) robustly resolve most deep relationships in the subfamily. Complete plastome data provide increased nodal support compared with protein-coding data alone at nodes that are not maximally supported. Following the divergence of Brachyelytrum, Phaenospermateae, Brylkinieae-Meliceae and Ampelodesmeae-Stipeae are the successive sister groups of the rest of the subfamily. Ampelodesmeae are nested within Stipeae in the plastome trees, consistent with its hybrid origin between a phaenospermatoid and a stipoid grass (the maternal parent). The core Pooideae are strongly supported and include Brachypodieae, a Bromeae-Triticeae clade and Poeae. Within Poeae, a novel sister group relationship between Phalaridinae and Torreyochloinae is found, and the relative branching order of this clade and Aveninae, with respect to an Agrostidinae-Brizinae clade, are discordant between MP and ML/BI trees. Maximum likelihood and Bayesian analyses strongly support Airinae and Holcinae as the successive sister groups of a Dactylidinae

  14. Escenarios de la conflictividad: elecciones municipales en la Corona de Castilla afines del siglo XVII

    Directory of Open Access Journals (Sweden)

    Jesús BRAVO LOZANO

    2009-12-01

    Full Text Available RESUMEN: Las elecciones municipales en los pueblos de la Corona de Castilla hacen aflorar las tensiones propias de cualquier comunidad organizada. A finales del siglo XVII estas tensiones parecen agudizarse, o mostrarse por primera vez allí donde no eran patentes. Tal es el caso de Carrascosa del Campo (provincia de Cuenca. La pugna por el control del ayuntamiento y sus recursos enfrenta a dos familias, pero la realidad se encarga de redimensionar la pugna familiar convirtiéndola en una pugna política entre dos bandos, mucho más complejos que los entramados familiares. La violencia individual se recubre de política y provoca la intervención del Consejo de Castilla.ABSTRACT: Municipal elections in the villages of the Crown of Castile bring out the usual tensions of any organised community. Towards the end of the XVIIth century these tensions seem to become more acute, or else they surface for the first time in places where they had been latent. Such is the case of Carrascosa del Campo, in the province of Cuenca. Two families compete there for the control of the village council, but this dispute between families develops eventually into a political fight between factions of a complexity which goes considerably beyond that of family networks. Individual violence acquires a political colouring and provokes the intervention of the Council of Castile.

  15. Museu de Artes e Ofícios, Belo Horizonte: afinal, como nascem os museus?

    OpenAIRE

    2005-01-01

    Responsável pela concepção do projeto do Museu de Artes e Ofícios de Belo Horizonte, o museólogo francês Pierre Catel discorre sobre sua experiência profissional, iniciada na década de 1970. Discute conceitos de museus, a evolução da formação neste campo multidisciplinar. Sobre o projeto de museu a ser montado no metrô da capital de Minas Gerais, ele diz que seu objetivo é promover o encontro entre a cultura das profissões e peças de uma coleção de arte popular brasileira com cerca de um milh...

  16. La industria textil en Tierra de Campos afines de la Edad Media

    Directory of Open Access Journals (Sweden)

    Hipólito Rafael OLIVA HERRER

    2009-12-01

    Full Text Available RESUMEN: El presente articulo trata de analizar el desarrollo de la industria textil rural en la región de Tierra de Campos, en torno al tradicional centro de producción textil de Palencia, a fines del XV y comienzos del XVI. La producción en el entorno rural conoció un amplio desarrollo basado en la producción de paños de calidad media-baja destinados al consumo interno, y dio lugar a formas organizativas complejas que se constituyeron en una alternativa frente al sistema gremial imperante en la urbe palentina, implicando intereses de un amplio espectro de grupos sociales.ABSTRACT: The present article aims to analyze the spreading of the rural textile industry in the region of Tierra de Campos in the late fifteenth and the early sixteenth centuries, around the traditional productive centre of Palencia. Here rural clothing experienced an important development based on the production of low and medium quality cloth under a putting-out system directed to interregional trade. The interests around rural industry involved a wide range of social groups, giving rise to complex organization forms and arising as an alternative to the traditional gudd stmcture.

  17. O que é, afinal, Marketing de Relacionamento? Uma Proposta de Conceito Unificador

    Directory of Open Access Journals (Sweden)

    Fernanda Bueno Cardoso Scussel

    2017-08-01

    Full Text Available Estudiosos entendem que ainda não há consenso sobre a definição de marketing de relacionamento, necessitando que haja uma limpeza conceitual a partir do fomento de um conceito unificador (GRÖNROOS, 2009; AGARIYA; SINGH, 2011; DEMO; ROZZETT, 2013; DEMO et al., 2015. Sendo assim, o presente estudo teórico atualiza a pesquisa de Agaryia e Singh (2011 a partir de uma revisão bibliométrica das publicações sobre o tema entre os anos 2011 e 2015 e, após a análise dos 69 artigos encontrados, sugere, como contribuição teórica, um conceito unificador de marketing de relacionamento. Limitações e sugestões para pesquisas futuras também são mencionadas neste trabalho.

  18. Afinal, quem é mesmo pedófilo? Who is really pedophile, after all?

    Directory of Open Access Journals (Sweden)

    Jane Felipe

    2006-06-01

    Full Text Available O presente artigo busca problematizar alguns dos aspectos pertinentes ao debate contemporâneo em torno das "novas" modalidades de experimentação dos desejos erótico-sexuais, em especial a pedofilia/o pedófilo, discutindo os modos pelos quais tais conceitos vêm sendo re-significados nos últimos anos. A partir do referencial teórico dos Estudos Culturais e dos Estudos de Gênero, numa abordagem pós-estruturalista de análise, pretendo mostrar que, apesar das tentativas de aprisionar/categorizar/ normatizar determinados comportamentos em torno da sexualidade, a partir de campos de conhecimento específicos, estes escorregam, escapam, vazam, nos sentidos que lhes são atribuídos.This article raises questions about some aspects of the contemporary debate concerning the "new" modes of experimenting erotic and sexual desires, especially pedophilia/the pedophile. It discusses the resignification of these concepts over the last years. The starting points are the Cultural Studies and the Gender Studies, in a post-structuralist analysis approach. I intend to show that, despite the attempts of confining/regulating/ categorizing certain behaviors regarding sexuality into specific fields of knowledge, they leak, slip, escape from the meanings attributed to them.

  19. Exploitation du savoir autochtone afin de créer des emplois pour les ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Transformer l'emploi des femmes. L'étude explorera le potentiel d'approches novatrices locales ou autochtones visant à appuyer l'emploi en milieu rural. Les chercheurs auront recours à des méthodes quantitatives et qualitatives pour analyser la façon dont le savoir autochtone et la technologie peuvent être utilisés pour ...

  20. Afinal, quem é mesmo pedófilo? Who is really pedophile, after all?

    OpenAIRE

    Jane Felipe

    2006-01-01

    O presente artigo busca problematizar alguns dos aspectos pertinentes ao debate contemporâneo em torno das "novas" modalidades de experimentação dos desejos erótico-sexuais, em especial a pedofilia/o pedófilo, discutindo os modos pelos quais tais conceitos vêm sendo re-significados nos últimos anos. A partir do referencial teórico dos Estudos Culturais e dos Estudos de Gênero, numa abordagem pós-estruturalista de análise, pretendo mostrar que, apesar das tentativas de aprisionar/categorizar/ ...

  1. Intensification du recours à l'irrigation intermittente en riziculture afin ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Un nouveau projet de recherche vise à contribuer à la lutte contre le paludisme dans un bassin versant du nord du Pérou. Sur la côte du nord du Pérou, qui est fort aride, le paludisme est répandu en raison de l'irrigation abondante que nécessitent les rizières. La riziculture pratiquée dans cette région représente 60 % de la ...

  2. Intensification du recours à l'irrigation intermittente en riziculture afin ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le projet de recherche a pour but de favoriser l'adoption de l'irrigation intermittente dans le bassin versant (vallée de Jequetepeque, dans le département de La Libertad) et d'examiner des moyens - de transmettre les connaissances et les compétences (vulgarisation agricole par et pour les riziculteurs); - d'évaluer et de ...

  3. Exploitation du savoir autochtone afin de créer des emplois pour les ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    La Commission des Nations unies pour la démarginalisation estime que quatre milliards de personnes ne peuvent pas exercer leurs droits juridiques à cause des coûts, du dysfonctionnement, de la corruption ou de l'abus de pouvoir. Il existe un besoin reconnu en institutions intermédiaires, comme les médias, les partis ...

  4. Svoboda 'severnõh Afin' : derptskaja Polonia / Sergei Issakov, Pavel Sigalov

    Index Scriptorium Estoniae

    Issakov, Sergei, 1931-2013

    1997-01-01

    Korporatsioonist 'Polonia' (asut. 1828. a.) jt. poola üliõpilaste ühendustest Tartus. Tartu ülikoolis õppinud poola kirjanikest ja kirjandusteadlasest: Alfons Walicki, Aleksander Karol Groza, Edward Zheligowski, Bronislaw Zaleski, Jzef Bohdan Dzienkonski, Ludomir Gadon, Jzef Weyssenhoff, Marian Zdziechowski, Andrzej Niemojewski, Ludwik Bruner, Jerzy Jankowski

  5. Exploitation du savoir autochtone afin de créer des emplois pour les ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    la pollution ou la détérioration des terres. ... pas exercer leurs droits juridiques à cause des coûts, du dysfonctionnement, de la corruption ou de l'abus de pouvoir. ... IDRC evidence and innovation supports India's adaptation to climate change.

  6. Papers in Language Learning and Language Acquisition. AFinLA Yearbook 1980. No. 28.

    Science.gov (United States)

    Sajavaara, Kari, Ed.; And Others

    Papers include: (1) "Language Acquisitional Universals: L1, L2, Pidgins, and FLT" (Henning Wode); (2) "Language Acquisition, Language Learning and the School Curriculum" (Norman F. Davies); (3) "Language Teaching and Acquisition of Communication" (Kari Sajavaara, Jaakko Lehtonen); (4) "On the Distinction between…

  7. Le CRDI investit dans la recherche et les connaissances afin de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    23 févr. 2018 ... (HomeNet South Asia Trust, 574 000 $ ; et Indian Institute for Human Settlements, 312 200 $) ... (Sedane Labour Resource Centre, 675 900 $) ... (par example Facebook, Twitter, Amazon) dans dix contextes locaux ou ...

  8. Renforcer la capacité de recherche afin d'orienter l'élaboration de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    17 août 2017 ... Ces programmes reposant sur des projets ont eu un impact durable sur la capacité des chercheurs du Sud à mener leurs propres études conformément aux normes internationales et à utiliser leurs résultats pour orienter les politiques en vue de favoriser un développement plus inclusif et plus équitable.

  9. Taxonomy, Variation, and Relationships in the Hordeum parodii Group (Poaceae)

    DEFF Research Database (Denmark)

    Von Bothmer, R.; Jacobsen, N.; Bagger Jørgensen, Rikke

    1986-01-01

    The Hordeum parodii group contains three species, viz. H. parodii Covas (6x), H. tetraploidum Covas (4x), and H. fuegianum Bothmer, Jacobsen, et Jorgensen, sp. nov. (4x). The former two species mainly occur in C and S Argentina, while H. fuegianum is native to Tierra del Fuego. All three species...

  10. Cynodon dactylon (L) Pers (Poaceae) root extract induces apoptotic ...

    African Journals Online (AJOL)

    has also been used for the treatment of weak vision, urinary tract infection, .... with an alternating 12 h dark/light cycle in ... detected by Western blot analysis as described previously .... the cyclin signaling pathways, induced apoptotic cell death ...

  11. In vitro anthelmintic and cytotoxicity activities the Digitaria insularis (Poaceae).

    Science.gov (United States)

    Santos, Francianne Oliveira; de Lima, Hélimar Gonçalves; de Souza Santos, Nathália Silva; Serra, Taiane Menezes; Uzeda, Rosângela Soares; Reis, Isabella Mary Alves; Botura, Mariana Borges; Branco, Alexsandro; Batatinha, Maria José Moreira

    2017-10-15

    This study aimed to evaluate the in vitro activity of D. insularis extracts and fractions against gastrointestinal nematodes of goats and its cytotoxicity on Vero cells. The egg hatch (EHT) and larval motility (LMT) tests were conducted to investigate the anthelmintic effects of the crude hydroethanolic (CH), ethyl acetate (EA), butanolic (BT) and residual hydroethanolic (RH) extracts. The elution of the active extract (EA) on column chromatography (SiO 2 ) using organic solvents furnished six fractions (FR1 to FR6), which were also tested. Cytotoxicity was determined using 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide (MTT) and Trypan Blue exclusion assays. All extracts, FR2 and FR3, inhibited egg hatching in a concentration-dependent manner. The EHT led to EC 50 values (effective concentration 50%) of 0.64; 0.69; 0.77; 0.96; 0.27 and 0.65mg/mL for CH, EA, BT, RH, FR2 and FR3, respectively. However, the extracts exhibited low effect on the motility of L 3. In the cytotoxicity evaluation (MTT assay), the IC 50 (inhibitory concentration 50%) was 1.18 (EA), 1.65 (FR2) and 1.59mg/mL (FR3), which was relatively high (low toxicity) in comparison to the EC 50 values in EHT, mainly for FR2. The chemical analyses of most active fractions (FR2) by Liquid Chromatography coupled to Mass Spectrometry (LC-MS) led the characterization of the flavones tricin and diosmetin. These results showed the high anthelmintic effect and low cytotoxicity of D. insularis and also that the flavones can be probably responsible for the nematocidal activity of this plant. Copyright © 2017 Elsevier B.V. All rights reserved.

  12. Genomic homeology between Pennisetum purpureum and Pennisetum glaucum (Poaceae

    Directory of Open Access Journals (Sweden)

    Gabriela Barreto dos Reis

    2014-08-01

    Full Text Available The genus Pennisetum (Richard, 1805 includes two economically important tropical forage plants: Pennisetum purpureum (Schumacher, 1827 (elephant grass, with 2n = 4x = 28 chromosomes and genomes A'A'BB, and Pennisetum glaucum (Linnaeus, 1753 (pearl millet, with 2n = 2x = 14 chromosomes and genomes AA. The genetic proximity between them allows obtaining hybrids (2n = 3x = 21 that yield forage of higher quality in relation to the parents. The study of genomic relationships provides subsidies for the knowledge about phylogenetic relations and evolution, and is useful in breeding programs seeking gene introgression. Concerning elephant grass and pearl millet, the homeology between the genomes A and A', and between these and the genome B, has been reported by conventional cytogenetic techniques. The objective of the present study was to demonstrate the degree of homeology between these genomes by means of genomic in situ hybridization (GISH. The results confirmed the homeology between the genomes A of pearl millet and A'B of elephant grass, and showed that there are differences in the distribution and proportion of homologous regions after hybridization. Discussion regarding the evolutionary origin of P. purpureum and P. glaucum was also included.

  13. Ecological Genetics of Vernalization Response in Bromus tectorum L. (Poaceae)

    Science.gov (United States)

    MEYER, SUSAN E.; NELSON, DAVID L.; CARLSON, STEPHANIE L.

    2004-01-01

    • Background and Aims Bromus tectorum (cheatgrass or downy brome) is an exotic annual grass that is dominant over large areas of former shrubland in western North America. To flower in time for seed production in early summer, B. tectorum plants generally require vernalization at winter temperatures, either as imbibed seeds or as established seedlings. • Methods Variation in response to increasing periods of vernalization as seeds or seedlings for progeny of ten full‐sib families from each of four B. tectorum populations from contrasting habitats was studied. • Key Results As vernalization was increased from 0 to 10 weeks, the proportion of plants flowering within 20 weeks increased, weeks to initiation of flowering decreased, and seed yield per plant increased, regardless of whether plants were vernalized as seeds or seedlings. Most of the variation was accounted for by differences among populations. Plants of the warm desert population flowered promptly even without vernalization, while those of the cold desert, foothill and montane populations showed incremental changes in response variables as a function of vernalization period. Populations differed in among‐family variance, with the warm desert population generally showing the least variance and the cold desert population the most. Variation among populations and among families within populations decreased as vernalization period increased, whereas the non‐genetic component of variance showed no such pattern. • Conclusions Variation in vernalization response was found to be adaptively significant and apparently represents the result of contrasting selection regimes on a range of founder genotypes. PMID:15087300

  14. Sequencing and De Novo Transcriptome Assembly of Brachypodium sylvaticum (Poaceae

    Directory of Open Access Journals (Sweden)

    Samuel E. Fox

    2013-03-01

    Full Text Available Premise of the study: We report the de novo assembly and characterization of the transcriptomes of Brachypodium sylvaticum (slender false-brome accessions from native populations of Spain and Greece, and an invasive population west of Corvallis, Oregon, USA. Methods and Results: More than 350 million sequence reads from the mRNA libraries prepared from three B. sylvaticum genotypes were assembled into 120,091 (Corvallis, 104,950 (Spain, and 177,682 (Greece transcript contigs. In comparison with the B. distachyon Bd21 reference genome and GenBank protein sequences, we estimate >90% exome coverage for B. sylvaticum. The transcripts were assigned Gene Ontology and InterPro annotations. Brachypodium sylvaticum sequence reads aligned against the Bd21 genome revealed 394,654 single-nucleotide polymorphisms (SNPs and >20,000 simple sequence repeat (SSR DNA sites. Conclusions: To our knowledge, this is the first report of transcriptome sequencing of invasive plant species with a closely related sequenced reference genome. The sequences and identified SNP variant and SSR sites will provide tools for developing novel genetic markers for use in genotyping and characterization of invasive behavior of B. sylvaticum.

  15. Ecological genetics of floret mass variation in Bromus tectorum (Poaceae)

    Science.gov (United States)

    Susan E. Meyer

    2010-01-01

    Bromus tectorum L. (cheatgrass, downy brome) is a highly invasive inbreeding annual grass that dominates millions of hectares of former shrubland in interior western North America. Factors contributing to its success include strong genetic regulation of key adaptive traits coupled with high phenotypic plasticity in response to resource availability (Meyer and Allen...

  16. Aira (Poaceae: a new generic record for Nicobar Islands, India

    Directory of Open Access Journals (Sweden)

    Kumar Vinod Chhotupuri Gosavi

    2016-06-01

    Full Text Available During plant exploration of Andaman and Nicobar in 2014, we were collected some interesting grass specimens from Kamorta Islands of Nicobar. After critical study and taxonomic analysis the unidentified grass species has identified as an Aira caryophyllea L.  Perusals of relevant literature were revealed that, the genus Aira L. has so far not reported from Andaman and Nicobar islands. Hence, it is reported in present communication for new record to the Andaman and Nicobar Islands. 

  17. Nature of ergastic substances in some Poaceae seeds

    African Journals Online (AJOL)

    ajl yemi

    2011-08-29

    Aug 29, 2011 ... 1Department of Botany, University of Benin, PMB 1154, Benin City, Edo State, Nigeria. 2Department of Botany, Ambrose Alli University, PMB. 14, Ekpoma, Edo State, Nigeria. Accepted 6 May, 2011 ... grasses) contribute more food seeds than any other plant family; it contributes about 50% per capita energy ...

  18. Chloroplasts in anther endothecium of Zea mays (Poaceae).

    Science.gov (United States)

    Murphy, Katherine M; Egger, Rachel L; Walbot, Virginia

    2015-11-01

    Although anthers of Zea mays, Oryza sativa, and Arabidopsis thaliana have been studied intensively using genetic and biochemical analyses in the past 20 years, few updates to anther anatomical and ultrastructural descriptions have been reported. For example, no transmission electron microscopy (TEM) images of the premeiotic maize anther have been published. Here we report the presence of chloroplasts in maize anthers. TEM imaging, electron acceptor photosynthesis assay, in planta photon detection, microarray analysis, and light and fluorescence microscopy were used to investigate the presence of chloroplasts in the maize anther. Most cells of the maize subepidermal endothecium have starch-containing chloroplasts that do not conduct measurable photosynthesis in vitro. The maize anther contains chloroplasts in most subepidermal, endothecial cells. Although maize anthers receive sufficient light to photosynthesize in vivo and the maize anther transcribes >96% of photosynthesis-associated genes found in the maize leaf, no photosynthetic light reaction activity was detected in vitro. The endothecial cell layer should no longer be defined as a complete circle viewed transversely in anther lobes, because chloroplasts are observed only in cells directly beneath the epidermis and not those adjacent to the connective tissue. We propose that chloroplasts be a defining characteristic of differentiated endothecial cells and that nonsubepidermal endothecial cells that lack chloroplasts be defined as a separate cell type, the interendothecium. © 2015 Botanical Society of America.

  19. Micropropagation of Guadua angustifolia Kunth (Poaceae) using a ...

    African Journals Online (AJOL)

    Universidad del Quindio

    2016-07-13

    Jul 13, 2016 ... develop an application for RITA® for use in the commercial production of G. angustifolia. Key words: Giant .... Data were analyzed using a random block design with 20 replicates ..... Gray D (eds) Plant Tissue Culture Concepts and Laboratory ... A (eds) Current Issues in Plant Molecular and Cellular Biology,.

  20. 7 CFR 201.56-5 - Grass family, Poaceae (Gramineae).

    Science.gov (United States)

    2010-01-01

    ... ACT FEDERAL SEED ACT REGULATIONS Germination Tests in the Administration of the Act § 201.56-5 Grass.... During germination the scutellum remains inside the seed to absorb nutrients from the endosperm and... with the endosperm. During germination the scutellum remains inside the seed to absorb nutrients from...

  1. Nature of ergastic substances in some Poaceae seeds

    African Journals Online (AJOL)

    ajl yemi

    2011-08-29

    Aug 29, 2011 ... 1Department of Botany, University of Benin, PMB 1154, Benin City, Edo State, Nigeria. ... Since seed is the storage organs of ergastic materials such as .... Ultrastructure and Development of Silica Bodies in Monocotyledons.

  2. Palynological studies in tribe Chlorideae (Poaceae) from salt range ...

    African Journals Online (AJOL)

    Jane

    2011-08-15

    Aug 15, 2011 ... To determine pollen fertility, acetocarmine and glycerin jelly was used by the modified techniques used by Khan and Stace (1999). Anthers were squashed .... World. Kew bulletin additional series 13, Royal Botanic gardens,. Kew. p. 389. Edeoga HO, Okoli BE (1996). Apomictic behaviour in Costus after C.

  3. LAS ESPECIES DE MUHLENBERGIA (POACEAE: CHLORIDOIDEAE DE ARGENTINA

    Directory of Open Access Journals (Sweden)

    Peterson Paul

    2011-06-01

    Full Text Available Se presenta un estudio taxonómico de las especies nativas argentinas del géneroMuhlenbergia, basado en el análisis de los especímenes depositados en 48 herbarios.Se analizan diversos aspectos relativos a la clasifi cación, la nomenclatura y lavariación morfológica de los caracteres. Muhlenbergia está representado enArgentina por 18 especies nativas. Se proporcionan claves para reconocer lasespecies presentes en el país, así como también descripciones de éstas, sinónimos,ilustraciones, distribución geográfica y algunos comentarios morfológicos yecológicos. Muhlenbergia breviaristata (Hack. Parodi y Muhlenbergia holwayorumHitchc., se reducen como sinónimos del híbrido Muhlenbergia angustata (J. PreslKunth × M. rigida (Kunth Kunth. Muhlenbergia diversiglumis Trin. se cita porprimera vez para la Argentina. Por otra parte, las especies Muhlenbergia tenella(Kunth Trin. y Muhlenbergia tenuissima (J. Presl Kunth se excluyen de la fl orade Argentina.

  4. Novedades nomenclaturales en Cenchrus s.l. (Poaceae: Panicoideae: Paniceae)

    OpenAIRE

    Gutiérrez, Hugo F; Morrone, Osvaldo

    2012-01-01

    Recientes estudios filogenéticos con datos morfológicos y moleculares aportaron evidencia sobre la monofilia de los géneros Cenchrus, Pennisetum y Odontelytrum y, por ello, se propuso su unificación y transferencia a Cenchrus, el cual tiene prioridad. Resultados preliminares de la revisión taxonómica del género Cenchrus s.l. para América (Gutiérrez, en preparación) permitieron detectar problemas nomenclaturales. Para resolver dichos inconvenientes, en el presente trabajo se presentan nueve le...

  5. What is Cynodon radiatus Roth ex R. & S. (Poaceae)?

    NARCIS (Netherlands)

    Nowack, R.

    1992-01-01

    Roemer and Schultes (1817) described Cynodon radiatus, basing themselves on a manuscript by A.W. Roth, copying Roth's brief diagnosis and comment. It was compared to Cynodon dactylon, differing by its larger habit, the number and direction of the spikes, and the glabrous blades and sheaths. This was

  6. Micropropagation of Guadua angustifolia Kunth (Poaceae) using a ...

    African Journals Online (AJOL)

    The micropropagation of Guadua angustifolia Kunth, commonly known as giant bamboo, using semisolid culture medium, is reported to have low multiplication rates. This study evaluated the multiplication index of G. angustifolia in a temporary immersion system (RITA®), comparing results with those obtained using a ...

  7. Morphophysiological and chemical aspects of torpedograss (Panicum repens L., Poaceae

    Directory of Open Access Journals (Sweden)

    Simone Meredith Scheffer-Basso

    2007-09-01

    Full Text Available This work evaluated some of the morphophysiological and bromatological aspects of torpedograss (Panicum repens L. through the quantification of accumulation, allocation and chemical composition of dry matter (DM during spring-summer. Four destructive harvests of aerial and underground parts were carried out on 23 October 2003, 3 December 2003, 22 January 2004 and 20 February 2004, corresponding to 31, 73, 123 and 152 days after the start of the spring. In these harvests, the DM accumulation was respectively 1,650; 4,470; 10,900 and 14,540 kg/ha in the aerial part, with leaf percentages between 45% (first harvest and 35% (last harvest. The crude protein (CP, neutral detergent fiber (NDF and acid detergent fiber (ADF changed between the first and the last harvest, from 9.9 to 7% (CP, 63.9% to 70.3% (FDN, and 37% to 40.8% (FDA, in samples composed by leaves, culms, inflorescences and stolons. The DM allocation to rhizomes (Rh, roots (R, leaves (L, culms+stolons (C and inflorescences (I changed, between the first and the last harvest, from 42 to 19% (Rh, 10 to 7% (R, 22 to 27% (L, 25 to 44% (C, and 0 to 2% (I.

  8. The Mediterranean: the cradle of Anthoxanthum (Poaceae) diploid diversity

    Czech Academy of Sciences Publication Activity Database

    Chumová, Zuzana; Záveská, E.; Mandáková, T.; Krak, Karol; Trávníček, Pavel

    2017-01-01

    Roč. 120, č. 2 (2017), s. 285-302 ISSN 0305-7364 Institutional support: RVO:67985939 Keywords : Antoxanthum * rDNA FISH * incomplete lineage sorting Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 4.041, year: 2016

  9. Biological and ecological evidences suggest Stipa krylovii (Pooideae), contributes to optimal growth performance and population distribution of the grasshopper Oedaleus asiaticus.

    Science.gov (United States)

    Huang, X B; McNeill, M R; Ma, J C; Qin, X H; Tu, X B; Cao, G C; Wang, G J; Nong, X Q; Zhang, Z H

    2017-06-01

    Oedaleus asiaticus Bey. Bienko is a significant grasshopper pest species occurring in north Asian grasslands. Outbreaks often result in significant loss in grasses and economic losses. Interestingly, we found this grasshopper was mainly restricted to Stipa-dominated grassland. We suspected this may be related to the dominant grasses species, Stipa krylovii Roshev, and hypothesized that S. krylovii contributes to optimal growth performance and population distribution of O. asiaticus. A 4 year investigation showed that O. asiaticus density was positively correlated to the above-ground biomass of S. krylovii and O. asiaticus growth performance variables (survival rate, size, growth rate) were significantly higher in Stipa-dominated grassland. A feeding trial also showed that O. asiaticus had a higher growth performance when feeding exclusively on S. krylovii. In addition, the choice, consumption and the efficiency of conversion of ingested food (ECI) by O. asiaticus was highest for S. krylovii compared with other plant species found in the Asian grasslands. These ecological and biological traits revealed why O. asiaticus is strongly associated with Stipa-dominated grasslands. We concluded that the existence of S. krylovii benefited the growth performance and explained the distribution of O. asiaticus. These results are useful for improved pest management strategies and developing guidelines for the monitoring of grasshopper population dynamics against the background of vegetation succession and changing plant communities in response to activities such as grazing, fire and climate change.

  10. Número cromossômico em acessos de Pennisetum spp. (Poaceae, Poales = Chromosome number in Pennisetum spp. accessions (Poaceae, Poales

    Directory of Open Access Journals (Sweden)

    Vânia Helena Techio

    2008-07-01

    Full Text Available Avaliou-se o complemento cromossômico de 16 acessos de Pennisetum disponíveis na Coleção de Germoplasma da Embrapa Gado de Leite – Juiz de Fora, Estado de Minas Gerais. Para a avaliação citogenética, utilizou-se a técnica de esmagamento e coloração com Feulgen. Paraquatro acessos foram obtidas metáfases com 2n = 28 cromossomos, confirmando sua classificação como P. purpureum. A origem híbrida P. purpureum x P. glaucum foi constatada em oito acessos, os quais apresentaram 2n = 21. Em um acesso identificado como híbrido entre P.purpureum x P. glaucum, foram observadas metáfases com 2n = 54, permitindo inferir que não se trata de um híbrido interespecífico triplóide. Para outros três acessos avaliados, também foramobservadas células com 2n = 54, embora estivessem identificados como híbridos entre P. purpureum x espécie selvagem; P. glaucum policross x hexaplóide 200 e P. glaucum x [F92-161-01 (P. purpureum x P. glaucum].The chromosome complement of 16 Pennisetum accessions belonging to the Germplasm Collection of Embrapa Gado de Leite - Juiz de Fora, Minas Gerais State was evaluated. The cytogenetic analysis employed the smear technique and staining with Feulgen. In four accessions,metaphases with 2n = 28 chromosomes were obtained, confirming their classification as P. purpureum. The hybrid origin P. purpureum x P. glaucum was observed in eight accessions, which presented 2n = 21. In an accession identified as P. purpureum x P. glaucum hybrid, metaphases with 2n = 54 were observed, suggesting that it is not a triploid interspecific hybrid. For three other evaluated accessions, cells with 2n=54 were also observed, although they were identified ashybrids between P. purpureum x wild species; P. glaucum polycross x hexaploid 200 and P. glaucum x [F92-161-01 (P. purpureum x P. glaucum].

  11. Notas sobre escrofulariáceas de Colombia: I. - Nueva especie de Buchnera afin A B. Rubriflora Philcox

    Directory of Open Access Journals (Sweden)

    Fernández Soto José Luis

    1986-12-01

    Full Text Available Se describe una nueva especie de Buchnera que presenta pilosidad glandular, la única entre las especies americanas del género y próxima a  B. rubriflora Philcox. Se aportan nuevos datos sobre la distribución y variabilidad de esta última, comentando finalmente la relación entre ambos táxones.  Al revisar las escrofulariáceas del Herbario Nacional Colombiano (COL, se tuvo la oportunidad de estudiar una serie de colecciones del género Buchnera, que son el objeto de esta primera nota sobre escrofulariáceas colombianas. Aparte de la localización de nuevos registros de B. rubriflora, que amplían la distribución conocida de la especie y otras puntualizaciones relativas a su parentesco y ecología; sin duda el dato más interesante lo aportó el estudio de unas plantas procedentes del sur de la Sierra de La Macarena (Depto. del Meta, que presentan indumento glandular, mezclado con pilosidad más corta no glandular. Este carácter único conocido hasta ahora en las buchneras americanas, permite describir esta planta como nueva. Este nuevo taxon está morfológicamente relacionado con B. rubriflora, con la que comparte además y con carácter exclusivo en las especies americanas la coloración roja de sus corolas. Se hacen por último algunos comentarios sobre este pequeño grupo de buchneras, del que probablemente falte aún mucho por conocer en cuanto a distribución y diversidad, por la falta de muestreo en amplios territorios colombianos ecológica y geológicamente similares a los enclaves hasta ahora conocidos para estos táxones.

  12. Favoriser l'adaptation afin d'accroître la résilience de l'agriculture ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Les scientifiques prédisent que la pluviosité se fera plus variable en Éthiopie, et que les épisodes de sécheresse et d'inondation seront plus nombreux dans les années à venir. Les variations prévues des précipitations rendront l'Éthiopie encore plus vulnérable aux récoltes insuffisantes et aux pénuries alimentaires.

  13. Renforcement du réseau de politiques de santé d'Indonésie afin de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Malgré la croissance économique soutenue que connaît l'Indonésie et les efforts que déploie le pays pour mettre en place une couverture santé universelle, bon nombre de pauvres n'ont toujours pas accès, ou si peu, à des services de santé appropriés. À vrai dire, la prestation des services de santé demeure variable et ...

  14. Review of xenon-133 production and related problems; Estudio bibliografico de la produccion de xenon-133 y problemas afines

    Energy Technology Data Exchange (ETDEWEB)

    Barrachina, M; Ropero, M

    1980-07-01

    A literature survey is given on the production methods of fission xenon-133 and related problems, such as purification, metrological and dosimetric aspects, preparation of isotopic solutions, recycling, etc. 127 references are included. (Author) 127 refs.

  15. Rapprocher les gens et les idées afin d'améliorer les conditions de vie

    International Development Research Centre (IDRC) Digital Library (Canada)

    14 déc. 2010 ... à l'opportunité et à la qualité exceptionnelle des recherches qu'il finance: ... accès aux services communaux comme l'eau, l'électricité, le téléphone ? ... Dans la Corne de l'Afrique, des chercheurs élaborent des indices sur ...

  16. L'amélioration des services de garde d'enfants afin d'accroître les ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    -à déterminer si l'amélioration de l'abordabilité et de la qualité des services de garde augmente la participation au marché du travail, le nombre d'heures travaillées et le revenu gagné; -à favoriser la sensibilisation et les échanges chez les dirigeants communautaires et les responsables des politiques concernant les défis ...

  17. Feasibility of Implementing an Early Intervention Program in an Urban Low-Income Setting to Improve Neurodevelopmental Outcome in Survivors Following Birth Asphyxia Faisabilité de mise en œuvre d'un Programme d'Intervention Précoce dans les milieux urbains à faibles revenus afin d'améliorer le résultat neurodéveloppemental chez les enfants survivant à une asphyxie à la naissance Viabilidad de la aplicación de un Programa de Intervención Precoz en un entorno urbano de bajos ingresos para mejorar el neurodesarrollo en los supervivientes luego de un cuadro de asfixia perinatal

    Directory of Open Access Journals (Sweden)

    Elwyn Chomba

    2011-08-01

    une étude de soins standard ou un EIP. Les couples mère/bébé ont été randomisés dans des groupes témoins (soins standard et d'intervention (EIP, et ont été suivis à domicile sur une base bihebdomadaire/bimensuelle, de l'âge de 8 semaines à l'âge de 8 mois. Quarante-deux couples mère/bébé (52,5 % ont terminé l'étude à 8 mois. Les raisons du non-achèvement de cette étude sont les suivantes : 19 (50,1 % ont été perdus de vue, 16 (42,1 % ont abandonné et 3 (7,8 % sont décédés. Le suivi jusqu'à l'âge de 8 mois n'était pas réalisable pour la majorité des femmes dans une grande ville ayant une population à faibles revenus. Ainsi, pour les enfants ayant souffert d'une asphyxie à la naissance, les interventions nécessitant des visites de soins supplémentaires peuvent ne pas être réalisables dans le milieu testé. Il est donc nécessaire de conduire d'autres études EIP afin de déterminer les moyens d'amélioration des taux de suivi des enfants survivant à une asphyxie à la naissance. L'intégration de programmes d'intervention précoce à d'autres programmes de santé donnant de bons résultats, comme les programmes d'immunisation existants, pourra peut-être améliorer les taux de suivi.La asfixia perinatal es una de las principales causas de mortalidad neonatal (23%. Un programa de intervención precoz (EIP, por sus siglas en inglés podría mejorar el neurodesarrollo en los supervivientes de este cuadro, pero aún no se ha demostrado su viabilidad en países de bajos ingresos. En este estudio piloto llevado a cabo en Zambia, en el que se analizó la atención estándar y un EIP, participaron ochenta recién nacidos con un peso mínimo de 1.500 gramos que sufrieron asfixia perinatal y fueron reanimados con bolsa y mascarilla. Las parejas de madres y bebés fueron atendidas aleatoriamente en grupos de control (cuidados habituales e intervención (EIP y se les hizo un seguimiento bisemanal/quincenal  a domicilio desde las 8 semanas

  18. New chloroplast microsatellite markers suitable for assessing genetic diversity of Lolium perenne and other related grass species.

    Science.gov (United States)

    Diekmann, Kerstin; Hodkinson, Trevor R; Barth, Susanne

    2012-11-01

    Lolium perenne (perennial ryegrass) is the most important forage grass species of temperate regions. We have previously released the chloroplast genome sequence of L. perenne 'Cashel'. Here nine chloroplast microsatellite markers are published, which were designed based on knowledge about genetically variable regions within the L. perenne chloroplast genome. These markers were successfully used for characterizing the genetic diversity in Lolium and different grass species. Chloroplast genomes of 14 Poaceae taxa were screened for mononucleotide microsatellite repeat regions and primers designed for their amplification from nine loci. The potential of these markers to assess genetic diversity was evaluated on a set of 16 Irish and 15 European L. perenne ecotypes, nine L. perenne cultivars, other Lolium taxa and other grass species. All analysed Poaceae chloroplast genomes contained more than 200 mononucleotide repeats (chloroplast simple sequence repeats, cpSSRs) of at least 7 bp in length, concentrated mainly in the large single copy region of the genome. Nucleotide composition varied considerably among subfamilies (with Pooideae biased towards poly A repeats). The nine new markers distinguish L. perenne from all non-Lolium taxa. TeaCpSSR28 was able to distinguish between all Lolium species and Lolium multiflorum due to an elongation of an A(8) mononucleotide repeat in L. multiflorum. TeaCpSSR31 detected a considerable degree of microsatellite length variation and single nucleotide polymorphism. TeaCpSSR27 revealed variation within some L. perenne accessions due to a 44-bp indel and was hence readily detected by simple agarose gel electrophoresis. Smaller insertion/deletion events or single nucleotide polymorphisms detected by these new markers could be visualized by polyacrylamide gel electrophoresis or DNA sequencing, respectively. The new markers are a valuable tool for plant breeding companies, seed testing agencies and the wider scientific community due to

  19. Intoxicação por Sorhgum halepense (Poaceae em bovinos no semi-árido Poisoning by Sorghum halepense (Poaceae in cattle in the Brazilian semiarid

    Directory of Open Access Journals (Sweden)

    J. Escarião da Nóbrega Jr

    2006-12-01

    Full Text Available Descreve-se um surto de intoxicação por Sorghum halepense (L. Pers. no município de Santa Luzia, semi-árido da Paraíba. Nove bovinos foram colocados numa pastagem com S. halepense em fase de rebrota, com 25-30cm de altura, 15 dias após as primeiras chuvas. Sinais clínicos de dispnéia, ansiedade, tremores musculares e incoordenação apareceram 10-15 minutos após a ingestão. Dois animais morreram em um período aproximado de 3 horas. Na necropsia observaram-se congestão e cianose das mucosas, musculatura escura, pulmão com pontos hemorrágicos e edema, além de folhas da planta no rúmen. A planta foi positiva no teste do papel picrosódico. Mudas de S. halepense coletadas no Município de Currais Novos, Rio Grande do Norte, onde havia históricos de uma intoxicação semelhante, foram plantadas em vasos e realizado o teste de papel picrosódico a cada 15 dias. A planta foi positiva para HCN durante todos os estágios, sendo que nos primeiros 45 dias a reação ocorreu dentro de 1 minuto e, posteriormente, em até 3 minutos. Trinta dias após ter sido plantada, a planta de um dos vasos foi administrada a um caprino causando sinais característicos de intoxicação cianídrica na dose de 11,8g/kg de peso do animal. O caprino se recuperou após tratamento com uma solução de tiossulfato de sódio a 20% na dose de 5mL/10kg. No semi-árido, S. halepense é freqüentemente encontrado como invasora em beiras de açudes e culturas irrigadas, sendo utilizado como forrageira, na época seca, em áreas de vazante.An outbreak of poisoning by Sorghum halepense (L. Pers. in cattle in the Brazilian semiarid is reported. Nine cattle were introduced 15 days after the first rains into a paddock where the plant was sprouting and had 25-30cm high. Clinical signs of dyspnea, anxiety, muscular tremors and incoordination appeared 15 minutes after the animals began to graze. Two of them died within about 3 hours. The others recovered. Cyanotic mucosa, dark muscles, lung edema and hemorrhages, and leaves of the plant in the rumen were observed at necropsy. The plant was positive for the picrosodic paper test. S. halepense from another farm of occurrence of the poisoning was transplanted into two pots. The picrosodic paper test was performed fortnightly in the plants growing in one of them. The plant was positive for cyanide in all growth stages; during the first 45 days the test was positive within 1 minute, but after day 60 within 3 minutes. Thirty days after the plant had been transplanted into one of the pots, it was administered to a goat at a dose of 11.8g/kg, causing clinical signs of HCN poisoning. The animal recovered after the intravenous administration of 5mL/10kg body weight of a 20% sodium thiosulfate solution. In the Brazilian semiarid S. halepense is frequently found invading the border of ponds and irrigated crops, and is used as forage during the dry season.

  20. Mas, afinal, o que é o Tinder? – Um estudo sobre a percepção que os usuários têm do aplicativo

    OpenAIRE

    Souza, Ana Luiza de Figueiredo; escritora, pesquisadora independente

    2016-01-01

    Colin Campbell afirma que o hedonismo, ou seja, a busca pelo prazer, é o que movimenta tanto os desejos de consumo quanto as relações interpessoais dos indivíduos modernos. Já Zygmunt Bauman defende que, na sociedade de consumidores, a conduta e as relações dos indivíduos são influenciadas por valores de mercado inseridos na essência de atividades cotidianas. Este artigo apresenta uma pesquisa survey na qual são entrevistados usuários do aplicativo Tinder, a fim de verificar até onde as propo...

  1. Descrevendo a prática clínica junguiana no Brasil: quem somos, o que pensamos e o que fazemos nós, afinal?

    OpenAIRE

    Caetano, Aurea Afonso M.

    2016-01-01

    Este estudo teve como objetivo fazer uma pesquisa para verificar quem são, como trabalham e o que pensam, os terapeutas de abordagem junguiana brasileiros, acerca de sua prática clínica. Pretendemos verificar onde trabalham, com quem trabalham e como trabalham os terapeutas de abordagem junguiana; quais são os fundamentos teóricos mais importantes para seu atendimento clínico, quais as técnicas terapêuticas específicas que utilizam nesse trabalho e qual o sentido para o tera...

  2. Methodology for monitoring aquatic environment impacts derived from petrochemical and similar industries; Metodologia para monitoramento de impactos ambientais sobre o meio aquatico provenientes de industria petroquimica e afins

    Energy Technology Data Exchange (ETDEWEB)

    Sperling, Eduardo von [Minas Gerais Univ., Belo Horizonte, MG (Brazil)

    1994-12-31

    Methodological suggestions concerning the implementation of monitoring programs in aquatic environments subjected to impacts derived from petrochemical industries are presented. Some considerations are made about assessment criteria, with emphasis in the utilization hydro biological indicators, whose response capacity is far superior than that of the physicochemical parameters. (author). 1 ref.

  3. LES STRATEGIES D’APPRENTISSAGE DU FRANÇAIS LANGUE ÉTRANGÈRE MISES EN PRATIQUE PAR LES APPRENANTS AFIN DE PROMOUVOIR LEURS AUTONOMIES

    OpenAIRE

    Yasmine ADIB

    2016-01-01

    Ce travail de recherche présente les stratégies d’apprentissage du français langue étrangère et examine les liens entre stratégies et acquisition d’une compétence générale. Cette étude met en relief l’apport majeur des données issues de la psychologie cognitive qui nous renseigne sur les mécanismes qui permettent à l’apprenant d’acquérir, d’intégrer et de réutiliser des connaissances. Aussi, nous expliquons comment les données de la psychologie cognitive nous éclairent sur la nature de l’appr...

  4. Mas afinal, a memória é de quem? Histórias orais e modos de lembrar e contar

    Directory of Open Access Journals (Sweden)

    Antoinette Errante

    2012-06-01

    Full Text Available  Recentemente, a pesquisa em ciência social tem dado mais atenção às intrincadas relações entre biografia e história. Na pesquisa educacional, esse foco resultou numa explosão do interesse na narrativa pessoal como uma articulação da experiência individual e coletiva com os mundos social, político e cultural da educação. Esse interesse na narrativa pessoal deu, por conseqüência, proeminência ao trabalho em história oral. O crescimento da atração intuitiva das narrativas pessoais, no entanto, ganhou uma complacência metodológica. O que significa coletar e analisar narrativas pessoais? Como os narradores verbalizam suas narrativas e narram sua voz? Que papel exerce o jogo das entrevistas no desdobramento dessas narrativas? O que significam essas questões no contexto das histórias orais, que são narrativas em que a dinâmica entrevistador-narrador também é mediatizada pela natureza da memória? Este artigo examina o que a autora aprendeu sobre histórias orais das narrativas que a autora pôde, e não pôde,coletar.Palavras-chave: história oral, educação colonial, educação em Moçambique.   Abstract Social science inquiry has increasingly focused on the intricate relations between biography and history. In educational inquiry, this focus has led to an explosion of interest in the personal narrative as an articulation of individual and collective experience with the social, political and cultural worlds of education. This interest in the personal narrative has in tum given prominence to work in oral history as a research strategy. The growing intuitive appeal of personal narratives, however, has led to certain methodological complacency. What does it mean to collect and analyze personal narratives? How do narrators voice their narratives and narrate their voice? What role do interviewers play in the unfolding of these narratives? What do these questions mean in the context of oral histories, which are narratives where the interviewer-narrator dynamic is also mediated by the nature of memory? This paper examines what the author learned about oral histories from the narratives the author could, and could not, collect. Keywords: oral history, colonial history, education of Mozambique. 

  5. Poder económico y prestigio social afines del siglo XVII. Una indagación sobre las dotes de las nobles castellanas

    Directory of Open Access Journals (Sweden)

    María Luz González Mezquita

    2013-11-01

    Full Text Available Este trabajo propone el estudio de las dotes desde una perspectiva diferente a las realizadas desde una óptica exclusivamente económica, teniendo en cuenta que la historia entendida como proceso implica nociones de mediación, causación, contradicción y organización sistemática, en ocasiones estructurante de la vida social, política, económica e intelectual. El estudio de fuentes primarias permite una aproximación tanto a las relaciones intranobiliarias centradas en estrategias familiares para la consolidación de linajes como a la política del monarca en relación con la nobleza que intenta explicar desde la historia política y social la simbiosis entre la Corona y los titulados. A pesar de la "crisis" de los patrimonios nobiliarios desde fines del siglo XVI, las dotes eran imprescindibles ante la realización de un matrimonio y esto producía muchas veces un desfasaje entre los ingresos y los gastos. El endeudamiento se cubría en estas oportunidades con préstamos o favores regios. En cualquier caso, factores ideológicos, de ordenamiento social, de poder, las hacían necesarias como mecanismo a través de los cuales se llevaba a la práctica la reproducción del sistema socialThis work proposes the study of dowries from a different perspective to those carried out from an exclusively economic optic, keeping in mind that history understood as a process implies mediation and contradiction notions and systematic organization, in occasions structuring the social, politic, economic and intellectual life. The study of primary sources allows an approximation at the same time to the relationships inside the nobility centered in family strategies for the consolidation of Iineages, and to the king's politics in connection with the nobility that tries to explain from political and social history, the symbiosis among the Crown and the nobility. In spite of the "crisis" of the nobiliary patrimonies from the late XVIth century, the dowries were indispensable before the realization of a marriage and this caused many times a negative relationship between the incomes and the expenses. The indebtedness was covered in these opportunities with loan or regal favors. Anyway, ideological factors, or social regulation and power factors, made dowries necessary as mechanisms through which took place the practice of reproducting the social system.

  6. Estudio de pertinencia de las carreras afines al área administrativa de la Universidad de las Fuerzas Armadas-ESPE

    Directory of Open Access Journals (Sweden)

    Buenaño-Cabrera, Javier

    2015-09-01

    Full Text Available The change in the concept of education in Ecuador has caused the different actors of higher education seek new philosophical basis and a new legal framework that will enable this change. In these circumstances, the analysis of the relevance of the different careers with axes of state planning, development zones of the country and the growth prospects of Ecuador becomes vital. The purpose of this writing is to provide a guide for analyzing the appropriateness of the administrative career at the University of the Armed Forces - ESPE.

  7. Comportamiento electroquímico de colorantes antraquinónicos, azul de metileno, y compuestos afines en solución de solventes no-acuosos

    OpenAIRE

    Martínez Suárez, Jaime Fernando

    2017-01-01

    El trabajo realizado en esta Tesis doctoral pretende contribuir a la electroquímica orgánica, particularmente, en el campo del comportamiento electroquímico de colorantes en solución de solventes no acuosos. Se estudia por voltamperometría cíclica (VC) el comportamiento de los colorantes azul de metileno, alizarina, purpurina, ácido carmínico, quinalizarina y rojo de alizarina S, y además un precursor para la síntesis de colorantes indigoides, la isatina. El comportamiento electroquímico de l...

  8. Nível de alfabetização financeira dos estudantes universitários: afinal, o que é relevante? [doi: 10.5329/RECADM.2013025

    Directory of Open Access Journals (Sweden)

    Ani Caroline Grigion Potrich

    2013-12-01

    Full Text Available O presente estudo teve por objetivo verificar se os estudantes universitários são alfabetizados financeiramente e se a alfabetização é afetada por variáveis socioeconômicas e demográficas. Foram aplicados questionários a 534 estudantes de graduação de universidades na região central do Rio Grande do Sul. Os resultados revelam que os estudantes apresentam um comportamento financeiro positivo, mas não satisfatório, dado que não têm, de forma bem estabelecida, hábitos de poupar mensalmente e de manter uma reserva financeira para casos inesperados. Além disso, possuem atitudes financeiras adequadas, apesar de demonstrarem um nível insatisfatório de conhecimento financeiro, culminando em um grau mediano de alfabetização financeira. Os indivíduos do gênero masculino, detentores das maiores faixas de renda e com formação financeira são os que apresentaram os níveis mais elevados de alfabetização financeira. Constatou-se, ainda, que a alfabetização financeira é influenciada positivamente pelas variáveis formação, ocupação, gênero e renda. Assim, ratifica-se a urgência e a necessidade de serem desenvolvidas ações efetivas para minimizar o problema do analfabetismo financeiro.   Palavras-chave Alfabetização financeira; conhecimento financeiro; comportamento financeiro; atitude financeira; estudantes universitários.     LEVEL OF FINANCIAL LITERACY OF COLLEGE STUDENTS: WHAT IS RELEVANT? ABSTRACT The present study aimed to verify whether college students are financially literate and whether literacy is affected by socioeconomic and demographic variables. Questionnaires were applied to 534 undergraduate students from universities in the central region of Rio Grande do Sul. The results have indicated that students have a positive financial behavior, but not satisfactory. It has also been found that they do not have well-established habits to save monthly and to maintain a financial reserve for unexpected cases. Although they have adequate financial attitudes, they have showed an unsatisfactory level of financial knowledge, culminating in a moderate degree of financial literacy. The male individuals with higher income brackets and financial training are those with the highest levels of financial literacy. It was also found that financial literacy is positively influenced by variables such us training, occupation, gender and income. This way, the urgent need to develop effective actions to minimize the problem of financial illiteracy has been confirmed. Keywords Financial literacy; financial knowledge; financial behavior; financial attitude; college students.

  9. Evaluation des performances des mémoires CBRAM (Conductive bridge memory) afin d’optimiser les empilements technologiques et les solutions d’intégration

    OpenAIRE

    Guy, Jérémy

    2015-01-01

    The constant evolution of the data storage needs over the last decades have led the technological landscape to completely change and reinvent itself. From the early stage of magnetic storage to the most recent solid state devices, the bit density keeps increasing toward what seems from a consumer point of view infinite storage capacity and performances. However, behind each storage technology transition stand density and performances limitations that required strong research work to overcome....

  10. Museu de Artes e Ofícios, Belo Horizonte: afinal, como nascem os museus? Belo Horizonte's Museum of Arts and Trades: after all, how are museums born?

    Directory of Open Access Journals (Sweden)

    2005-01-01

    Full Text Available Responsável pela concepção do projeto do Museu de Artes e Ofícios de Belo Horizonte, o museólogo francês Pierre Catel discorre sobre sua experiência profissional, iniciada na década de 1970. Discute conceitos de museus, a evolução da formação neste campo multidisciplinar. Sobre o projeto de museu a ser montado no metrô da capital de Minas Gerais, ele diz que seu objetivo é promover o encontro entre a cultura das profissões e peças de uma coleção de arte popular brasileira com cerca de um milhão de pessoas a caminho de casa ou do trabalho.Responsible for the concept behind Belo Horizonte's Museum of Arts and Trades project, the French museologist Pierre Catel talks about his professional experience, which began in the 1970s. He discusses museum concepts and the evolution and shaping of this multidisciplinary field. In regard to the museum that will be installed inside the subway of Minas Gerais' state capital, Catel says his aim is to foster an encounter between the culture of professions and pieces from a collection of popular Brazilian art, where around one million people pass by on their way to work or home.

  11. Afinal, o que é endomarketing? Estudo das estratégias de endomarketing de uma Universidade Comunitária do Rio Grande do Sul

    OpenAIRE

    Cleber Cervi; Lurdes Marlene Seide Froemming

    2017-01-01

    Este artigo buscou evidenciar as práticas de endomarketing vivenciadas por uma Instituição de Ensino Superior comunitária do Rio Grande do Sul. Ao implementar um programa de endomarketing é necessário bastante esforço da alta administração e dos setores envolvidos, já que facilmente seu foco é desviado, detendo-se em questões mais simples que, por mais importantes que sejam, não trarão resultados efetivos e uma continuidade consistente. Através de pesquisa bibliográfica, documental e com entr...

  12. Afinal, o que é endomarketing? Estudo das estratégias de endomarketing de uma Universidade Comunitária do Rio Grande do Sul

    Directory of Open Access Journals (Sweden)

    Cleber Cervi

    2017-08-01

    Full Text Available Este artigo buscou evidenciar as práticas de endomarketing vivenciadas por uma Instituição de Ensino Superior comunitária do Rio Grande do Sul. Ao implementar um programa de endomarketing é necessário bastante esforço da alta administração e dos setores envolvidos, já que facilmente seu foco é desviado, detendo-se em questões mais simples que, por mais importantes que sejam, não trarão resultados efetivos e uma continuidade consistente. Através de pesquisa bibliográfica, documental e com entrevistas semiestruturadas com os responsáveis pelo programa de endomarketing da instituição, buscou-se caracterizar o programa e analisar as práticas de endomarketing em relação ao modelo teórico proposto por Berry e Parasuraman (1992. Defende-se, neste trabalho, que para que um programa de endomarketing tenha êxito é fundamental um constante alinhamento entre a alta administração (níveis hierárquicos maiores com os demais níveis hierárquicos. É importante destacar, com isso, que endomarketing não é legitimado por seus métodos, mas por seu propósito.

  13. Proyecto de ejercicios que restablecen la movilidad\ten la columna vertebral y articulaciones afines a la misma en los grupos de edades juveniles y adultos mayores

    Directory of Open Access Journals (Sweden)

    Gabriel de la Caridad Rodríguez Chirino

    2009-06-01

    Full Text Available El trabajo va encaminado al mejoramiento de la salud de los jóvenes y adultos mayores, para garantizar una calidad de vida óptima a todas las personas que deseen prolongar el período de la misma, así como mantenerse sanos, ágiles, rápidos y fuertes, índice del buen estado de salud con cierto desarrollo físico y con la   movilidad  adecuada,  símbolo  de  vitalidad  en  las  seres  humanos.  Nuestro sistema de ejercicios inhibe la espasticidad en los pacientes y sus  articulaciones afectadas, mejora la vitalidad sexual en ambos sexos y la potencia en el hombre, disminuye las crisis de los asmáticos de grado 3, mejora el funcionamiento del sistema cardiovascular, respiratorio, hace desaparecer los dolores de sacro lumbalgias y todas aquellas situaciones patológicas que se deriven del miembro de sostén (la columna vertebral. Se logra mejoría en apenas 70 días, una vez comenzado el tratamiento el cual debe realizarse dos veces al día con intervalo mínimo  de  recuperación,  tres  horas  de  una  sesión  a  la  otra  donde  apenas consume 30 minutos por sesión. El paciente transita por tres etapas de  ejercicios, método principal del tratamiento, a través del procedimiento de contracción isométrica  que  origina  estiramiento,  activos  aeróbicos  que  se  realizan  en diferentes planos y posiciones. En el sistema de ejercicios, como toda acción física que genera desarrollo y salud, ya sea una terapia física terapéutica o terapia física estética, se deben realizar exámenes físicos al paciente, además de una radiografía de columna total. En las personas que sea por terapia  física estética  solamente se debe tener presente el examen físico al comenzar la gimnasia, la cual debe ir precedida por un acondicionamiento de las articulaciones y luego de una calistenia (comúnmente llamado calentamiento de la gran mayoría los planos musculares.

  14. Equality in Language Learning. Proceedings of the Nordic Conference of Applied Linguistics, (5th, Jyvaskyla, Finland, June 4-7, 1987). AFinLA Series No. 45.

    Science.gov (United States)

    Sajavaara, Kari, Ed.

    Papers presented at the conference on applied linguistics include the following: "Speaking of Grammars: Is Big Beautiful?" (Jan Svartvik); "A Sociosemiotic View of the Grasp of Language at Reality: The Lexical Field 'Aesthetic Judgment'" (Wolfgang Kuhlwein); "Language as a Target and Instrument of the Educational Process…

  15. O que ou quem eu sou, afinal de contas? Sou brasileiro ou uruguaio, professor? What or who am I, after all? Am I Brazilian or Uruguayan, teacher?

    Directory of Open Access Journals (Sweden)

    Regina Maria de Souza

    2010-12-01

    Full Text Available O presente trabalho terá como objetivo transformar em tema de reflexão as inquietações de duas crianças, Alicia e João, a respeito de sua nacionalidade; quer dizer, trazer em cena o sentimento ambíguo de pertença que possuem em relação a suas identidades. Diálogos com o pensamento filosófico serão realizados a respeito da fronteira, como lugar onde a naturalização da igualdade é posta por terra; naturalização na qual o conceito de identidade aparece como uma peça monolítica coesa e impenetrável. Defendemos o contrário: que a identidade é efeito de um processo constante, e sempre inacabado, de transformação subjetiva, pela mescla, pela angústia de não ser UM consigo mesmo e nem em relação aos outros. Apostamos, portanto, no universo múltiplo e incalculável do processo identitário, que torna único cada sujeito em seus dilemas.The aim of the present paper is to bring about a reflection on the uneasiness of two children, Alicia and João, regarding their nationalities, that is, on their ambiguous feeling of belonging regarding their own identities. Dialogues based on philosophical thinking will be carried out about the frontier as a place where the naturalization of equality is extinguished, and naturalization, in which identity is perceived as a cohesive and impenetrable monolithic piece. The opposite is actually what we stand up for: identity is the effect of a never-ending, always unfinished process of subjective transformation, through miscellany, through anguish for not being ONE with oneself or with others. In short, we believe in the multiple and immeasurable universe of the identity process, which makes every subject unique concerning his or her dilemmas.

  16. Trabalho corporal na educação infantil: afinal, quem deve realizá-lo? Body work in early childhood education: finally who should actually achieve it?

    Directory of Open Access Journals (Sweden)

    Frederico Jorge Saad Guirra

    2010-09-01

    Full Text Available A educação infantil constitui-se no momento em que as crianças internalizam importantes conhecimentos que as auxiliarão para o resto de suas vidas, influenciando na sua formação e em suas práticas. O presente artigo reflete sobre o professor generalista, responsável pelo trabalho corporal, na educação infantil, de quais conhecimentos dispõe para desenvolver tal tarefa e como vê a importância desse trabalho para as crianças; aborda, ainda, segundo pesquisa realizada, a possível necessidade de um professor especialista na área para trabalhar o movimento e faz um questionamento sobre a preparação desse profissional para lidar com crianças de educação infantil. Conclui o presente, dialogando com essas questões e abrindo uma discussão sobre a possibilidade de um trabalho desses dois profissionais, em parceria, no sentido de garantir à criança, uma educação mais específica e que auxilie no seu desenvolvimento integral,Early childhood education is at the moment that the children internalize important knowledge that help the rest of their lives, influencing its formation and its practices. This article reflects on the teacher generalist, responsible for working on body movement with the children in early childhood education, which has expertise to develop such a task and sees the importance of this work for children, also discusses the second survey conducted, the possible need for a specialist teacher to work in the movement and is a question on the preparation of this work to deal with children in early childhood education. This article concludes the dialogue with these issues and open a discussion about the possibility of these two professionals work in partnership to ensure the child a more specific education and to help in its full development.

  17. Особенности фитоценозов с участием Melica virgata Turcz. ex Trin. (Poaceae Восточного Забайкалья в сравнении с сопредельными территориями

    Directory of Open Access Journals (Sweden)

    E. A. Bondarevich

    2015-03-01

    Full Text Available В работе рассмотрены особенности видового состава редких растительных сообществ с участием Melica virgata Turcz. ex Trin. (Poaceae. При сравнении с ранее известными данными по фитоценозам Монголии с участием этого вида выяснилось, что состав их значительно отличается. Также для фитоценозов из Восточного Забайкалья характерен уникальный видовой состав (заросли трех видов рода Rhamnus: R. davurica, R. erythroxylon, R. pissjaukovae + Ulmus pumila, с высоким проективным покрытием Melica virgata и участием крайне редкого вида для региона – Artemisia rutifolia, представленный на крайне ограниченной территории в бассейне реки Чикой (у с. Усть-Урлук. Сохранение комплекса видов требует создание охраняемой территории и включение в её состав нескольких наиболее ценных участков.

  18. Local climate and cultivation, but not ploidy, predict functional trait variation in Bouteloua gracilis (Poaceae)

    Science.gov (United States)

    Butterfield, Bradley J.; Wood, Troy E.

    2015-01-01

    Efforts to improve the diversity of seed 18 resources for important restoration species has become a high priority for land managers in many parts of the world. Relationships between functional trait values and the environment from which seed sources are collected can provide important insights into patterns of local adaptation and guidelines for seed transfer. However, little is known about which functional traits exhibit genetic differentiation across populations of restoration species and thus may contribute to local adaptation. Here, we report the results of a common garden experiment aimed at assessing genetic (including ploidy level) and environmental regulation of several functional traits among populations of Bouteloua gracilis, a dominant C4 grass and the most highly utilized restoration species across much of the Colorado Plateau. We found that leaf size and specific leaf area (SLA) varied significantly among populations, and were strongly correlated with the source population environment from which seeds were collected. However, variation in ploidy level had no significant effect on functional traits. Leaves of plants grown from commercial seed releases were significantly larger and had lower SLA than those from natural populations, a result that is concordant with the overall relation between climate and these two functional traits. We suggest that the patterns of functional trait variation shown here may extend to other grass species in the western USA, and may serve as useful proxies for more extensive genecology research. Furthermore, we argue that care should be taken to develop commercial seed lines with functional trait values that match those of natural populations occupying climates similar to target restoration sites.

  19. Adaptive divergence with gene flow in incipient speciation of Miscanthus floridulus / sinensis complex (Poaceae)

    KAUST Repository

    Huang, Chao-Li; Ho, Chuan-Wen; Chiang, Yu-Chung; Shigemoto, Yasumasa; Hsu, Tsai-Wen; Hwang, Chi-Chuan; Ge, Xue-Jun; Chen, Charles; Wu, Tai-Han; Chou, Chang-Hung; Huang, Hao-Jen; Gojobori, Takashi; Osada, Naoki; Chiang, Tzen-Yuh

    2014-01-01

    Young incipient species provide ideal materials for untangling the process of ecological speciation in the presence of gene flow. The Miscanthus floridulus/sinensis complex exhibits diverse phenotypic and ecological differences despite recent divergence (approximately 1.59million years ago). To elucidate the process of genetic differentiation during early stages of ecological speciation, we analyzed genomic divergence in the Miscanthus complex using 72 randomly selected genes from a newly assembled transcriptome. In this study, rampant gene flow was detected between species, estimated as M=3.36x10(-9) to 1.20x10(-6), resulting in contradicting phylogenies across loci. Nevertheless, beast analyses revealed the species identity and the effects of extrinsic cohesive forces that counteracted the non-stop introgression. As expected, early in speciation with gene flow, only 3-13 loci were highly diverged; two to five outliers (approximately 2.78-6.94% of the genome) were characterized by strong linkage disequilibrium, and asymmetrically distributed among ecotypes, indicating footprints of diversifying selection. In conclusion, ecological speciation of incipient species of Miscanthus probably followed the parapatric model, whereas allopatric speciation cannot be completely ruled out, especially between the geographically isolated northern and southern M.sinensis, for which no significant gene flow across oceanic barriers was detected. Divergence between local ecotypes in early-stage speciation began at a few genomic regions under the influence of natural selection and divergence hitchhiking that overcame gene flow.

  20. Surface properties correlate to the digestibility of hydrothermally pretreated lignocellulosic Poaceae biomass feedstocks

    DEFF Research Database (Denmark)

    Tristan Djajadi, Demi; Hansen, Aleksander R.; Jensen, Anders

    2017-01-01

    physical and chemical features of the biomass surfaces, specifically contact angle measurements (wettability) and attenuated total reflectance-Fourier transform infrared (ATR-FTIR) spectroscopy (surfacebiopolymer composition) produced data correlating pretreatment severity and enzymatic digestibility......, and they also revealed differences that correlated to enzymatic glucose yield responses among the three different biomass types. Conclusion: The study revealed that to a large extent, factors related to physico-chemical surface properties, namely surface wettability as assessed by contact angle measurements...

  1. Leaf anatomy of the South African Danthonieae (Poaceae. XIII. Pentameris macrocalycina and P. obtusifolia

    Directory of Open Access Journals (Sweden)

    R. P. Ellis

    1984-12-01

    Full Text Available The leaf blade anatomy of Peniameris macrocalycina (Steud. Schweick. and P. obtusifolia (Hochst, Schweick. is described and illustrated. The leaf anatomy of these two species shows many similarities suggesting a close relationship between them. A slight problem appears to exist with the circumscription of P. obtusifolia and a minor taxonomic adjustment may result in a classification which agrees totally with that based on leaf anatomy. This would result in details of the leaf outline being diagnostic for these two taxa. The nomenclature of P. obtusifolia is also very confusing and clarification is needed by reference to the relevant type specimens. P. macrocalycina and P. obtusifolia together with  P. longiglumis (Nees Stapf, appear to form a distinct genus and do not bear close anatomical resemblances to either P. thuarri Beauv. or P. dregeana Stapf.

  2. Additions to the grasses (Poaceae of Telangana from Kawal Tiger Reserve, Adilabad District, India

    Directory of Open Access Journals (Sweden)

    Alok Chorghe

    2015-07-01

    Full Text Available Three species of grasses viz., Dimeria orissae, Iseilema holei and Spodiopogon rhizophorus are being reported for the first time as new distributional records to Telangana from the Kawal Tiger Reserve. Detailed description and illustrations are provided here.

  3. Development of chromosome-arm-specific microsatellite markers in Triticum aestivum (Poaceae) using NGS technology

    Czech Academy of Sciences Publication Activity Database

    Nie, X.; Li, B.; Wang, L.; Liu, P.; Biradar, S. S.; Li, T.; Doležel, Jaroslav; Edwards, D.; Luo, M.; Weining, S.

    2012-01-01

    Roč. 99, č. 9 (2012), e369-e371 ISSN 0002-9122 Institutional research plan: CEZ:AV0Z50380511 Keywords : chromosome-arm-specific DNA * flow-sorted chromosomes * next-generation sequencing Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.586, year: 2012

  4. Impact of Corn Earworm (Lepidoptera: Noctuidae) on Field Corn (Poales: Poaceae) Yield and Grain Quality.

    Science.gov (United States)

    Bibb, Jenny L; Cook, Donald; Catchot, Angus; Musser, Fred; Stewart, Scott D; Leonard, Billy Rogers; Buntin, G David; Kerns, David; Allen, Tom W; Gore, Jeffrey

    2018-05-28

    Corn earworm, Helicoverpa zea (Boddie), commonly infests field corn, Zea mays (L.). The combination of corn plant biology, corn earworm behavior in corn ecosystems, and field corn value renders corn earworm management with foliar insecticides noneconomical. Corn technologies containing Bacillus thuringiensis (Bt) Berliner (Bacillales: Bacillaceae) were introduced that exhibit substantial efficacy against corn earworm and may reduce mycotoxin contamination in grain. The first generation Bt traits in field corn demonstrated limited activity on corn earworm feeding on grain. The pyramided corn technologies have greater cumulative protein concentrations and higher expression throughout the plant, so these corn traits should provide effective management of this pest. Additionally, reduced kernel injury may affect physical grain quality. Experiments were conducted during 2011-2012 to investigate corn earworm impact on field corn yield and grain quality. Treatments included field corn hybrids expressing the Herculex, YieldGard, and Genuity VT Triple Pro technologies. Supplemental insecticide treatments were applied every 1-2 d from silk emergence until silk senescence to create a range of injured kernels for each technology. No significant relationship between the number of corn earworm damaged kernels and yield was observed for any technology/hybrid. In these studies, corn earworm larvae did not cause enough damage to impact yield. Additionally, no consistent relationship between corn earworm damage and aflatoxin contamination was observed. Based on these data, the economic value of pyramided Bt corn traits to corn producers, in the southern United States, appears to be from management of other lepidopteran insect pests including European and southwestern corn borer.

  5. Ultraestructura del bambú Guadua macclurei (Poaceae: Bambusoideae de Costa Rica

    Directory of Open Access Journals (Sweden)

    Mayra Montiel

    2006-06-01

    Full Text Available Se evaluaron ultraestructuralmente secciones de la lámina de la hoja, vaina de la hoja y rama, de una planta adulta de Guadua macclurei. Las brácteas del culmo carecen de setas orales. En la superficie adaxial de la lámina foliar se observó un patrón celular diferente al de otras especies de este género. Además, hay tricomas tricelulares y bandas de estomas de alto domo muy ordenadas y evidentes, característica que la podría diferenciar de otras especies en el género. Esta es la primera descripción microscópica de esta especie.We studied the ultrastructure of sections of leaf lamina, leaf sheath and branches of an adult plant of Guadua macclurei. Culm sheaths lack fimbriae (oral setae. The adaxial section of the leaf lamina has a particular cellular pattern, previously unreported in this genus. The tricellular trichomes, and the evident and ordered bands of high dome stomata may be useful for taxonomic purposes. To the best of our knowledge, this is the first microscopic description of this species. Rev. Biol. Trop. 54(Suppl. 2: 35-42. Epub 2006 Dec. 01.

  6. Leaf anatomy of the genus Ehrharta (Poaceae in southern Africa: the Setacea group

    Directory of Open Access Journals (Sweden)

    R. P. Ellis

    1987-10-01

    Full Text Available The leaf blade anatomy of the taxa of the Setacea group of species of the genus Ehrharta is described and illustrated. This group includes E. rupestris Nees ex Trin. subsp.  rupestris, subsp.  tricostata (Stapf Gibbs Russell and subsp.  dodii (Stapf Gibbs Russell, as well as E. setacea Nees subsp.  setacea, subsp.  scabra (Stapf Gibbs Russell, subsp.  uniflora (Burch, ex Stapf Gibbs Russell and subsp.  disticha Gibbs Russell. All these taxa share a very characteristic leaf anatomy with inrolled or infolded leaves without keels and have adaxial ribs with interlocking prickles. The chlorenchyma is dense and compact with inwardly projecting invaginations visible in all taxa except  E. setacea subsp.  setacea. In E .  setacea subsp. scabra typical arm cells are present. Abaxial costal and intercostal zones are not differentiated and stomata are absent. The long cells are hexagonal or inflated with sinuous walls. Silica bodies are single or paired and rounded in shape. Small hook-like prickles with short barbs are common. Microhairs with a short, truncated distal cell occur. This leaf anatomical structure differs considerably from that of the other species groups recognized in African  Ehrharta and the Setacea group appears to be more distinct from the other groups than they are from each other.

  7. A new species of Otatea (Poaceae: Bambusoideae: Bambuseae) from Querétaro, Mexico

    OpenAIRE

    Ruiz-Sánchez, Eduardo

    2012-01-01

    Based on recent systematic studies of the genus Otatea, that included an extensive taxonomic investigation of herbaria specimens, and recent fieldwork in the Mexican state of Querétaro, a new Otatea species, O. ramirezii, is here described and illustrated. The new species is endemic to the Sierra Gorda in Querétaro, Mexico. It is compared with Otatea acuminata, O. carrilloi and O. glauca, from which it can be separated by the presence of only one (rarely two) branches per node, erect culm lea...

  8. Meiosis in elephant grass (Pennisetum purpureum, pearl millet (Pennisetum glaucum (Poaceae, Poales and their interspecific hybrids

    Directory of Open Access Journals (Sweden)

    Vânia Helena Techio

    2006-01-01

    Full Text Available The cultivated and sexually compatible species Pennisetum purpureum (elephant grass, 2n = 4x = 28 and Pennisetum glaucum (pearl millet, 2n = 2x = 14 can undergo hybridization which favors the amplification of their genetic background and the introgression of favorable alleles into breeding programs. The main problem with interspecific hybrids of these species is infertility due to triploidy (2n = 3x = 21. This study describes meiosis in elephant grass x pearl millet hybrids and their progenitors. Panicles were prepared according to the conventional protocol for meiotic studies and Alexander’s stain was used for assessing pollen viability. Pearl millet accessions presented regular meiosis with seven bivalents and high pollen viability. For elephant grass, 14 bivalents in diakinesis and metaphase I were observed. The BAG 63 elephant grass accession, derived from tissue culture, presented a high frequency of meiotic abnormalities. The three hybrid accessions presented a high frequency of abnormalities characterized by irregular chromosomal segregation which resulted in the formation of sterile pollen.

  9. Nota sobre el género Imperata (Poaceae, Panicoideae, Sacchareae) en Argentina

    OpenAIRE

    Peichoto, Myriam Carolina

    2017-01-01

    En este trabajo se confirma la presencia de Imperata tenuis en Argentina. Se presenta una ilustración, material de referencia y un mapa de su distribución geográfica en el sur de Sudamérica. Se incluye una clave para identificar las especies del género Imperata presentes en la Argentina. This work confirms the presence of Imperata tenuis in Argentina, and includes an illustration, reference material, a map showing its geographic distribution in southern South America, and a key to identi...

  10. Phylogeny and biogeography of North-American wild rice (Zizania L.Poaceae)

    Science.gov (United States)

    The wild-rice genus Zizania includes four species disjunctly distributed in eastern Asia and North America, with three species (Z. aquatica, Z. palustris, and Z. texana) in North America and one (Z. latifolia) in eastern Asia. The phylogeny and biogeography of Zizania were explored using sequences o...

  11. DNA barcoding of western North American taxa: Leymus (Poaceae) and Lepidium (Brassicaceae)

    Science.gov (United States)

    Catherine Mae Culumber

    2007-01-01

    My objective was to determine if polymorphic information from the 18S-5.8S-26S nuclear ribosomal DNA internal transcribed spacer regions and the trnK-psbA, trnK-rps16 chloroplast DNA spacer regions is sufficient 1) to identify a plant specimen to the species level, and 2) to establish the phylogenetic relationship between species. The first study examined the...

  12. Geographical distribution of present day Poaceae as evidence for the origin of African floras

    Directory of Open Access Journals (Sweden)

    W. D. Clayton

    1983-11-01

    Full Text Available The major tribes and sub-families of grasses occupy worldwide latitudinal belts, which can be related to an evolutionary sequence of climatic adaptations. However, genera tend to be confined to individual continents, suggesting that grasses do not easily cross the oceans, and that the worldwide distribution of the family may have been achieved when the continents were closer together. Species distributions are likewise strongly influenced by the effect of climatic adaptation and continental isolation, but they show a number of aberrations. These are probably a legacy of climatic disturbance during the Pleistocene.

  13. Phylogenetic relationships in the Festuca-Lolium complex (Loliinae; Poaceae: New insights from chloroplast sequences

    Directory of Open Access Journals (Sweden)

    Yajuan Cheng

    2016-07-01

    Full Text Available The species within the Lolium/Festuca grass complex have dispersed and colonized large areas of temperate global grasslands both naturally and by human intervention. The species within this grass complex represent some of the most important grass species both for amenity and agricultural use worldwide. There has been renewed interest by grass breeders in producing hybrid combinations between these species and several countries now market Festulolium varieties as a combination of genes from both genera. The two genera have been differentiated by their inflorescence structure, but controversy has surrounded the taxonomic classification of the Lolium-Festuca complex species for several decades. In order to better understand the complexities within the Lolium/Festuca complex and their genetic background, the phylogeny of important examplers from the Lolium-Festuca complex were reconstructed. In total 40 taxa representing the Festuca and Lolium species with Vulpia myuros and Brachypodium distachyon as outgroups were sampled, using two noncoding intergenic spacers (trnQ-rps16, trnH-psbA and one coding gene (rbcL. Maximum parsimony (MP, Bayesian inference (BI analyses based on each partition and combined plastid DNA dataset, and median-jointing network analysis were employed. The outcomes strongly suggested that the subgen. Schedonorus has a close relationship to Lolium, and it is also proposed to move the sect. Leucopoa from subgen. Leucopoa to Subgen. Schedonorus and to separate sect. Breviaristatae from the subgen. Leucopoa. We found that F. californica could be a lineage of hybrid origin because of its intermediate placement between the broad-leaved and fine-leaved clade.

  14. [Use of Leersia hexandra (Poaceae) for soil phytoremediation in soils contaminated with fresh and weathered oil].

    Science.gov (United States)

    Arias-Trinidad, Alfredo; Rivera-Cruz, María del Carmen; Roldán-Garrigós, Antonio; Aceves-Navarro, Lorenzo Armando; Quintero-Lizaola, Roberto; Hernández-Guzmán, Javier

    2017-03-01

    The oil industry has generated chronic oil spills and their accumulation in wetlands of the state of Tabasco, in Southeastern Mexico. Waterlogging is a factor that limits the use of remediation technologies because of its high cost and low levels of oil degradation. However, Leersia hexandra is a grass that grows in these contaminated areas with weathered oil. The aim of the study was to evaluate the bacteria density, plant biomass production and phytoremediation of L. hexandra in contaminated soil. For this, two experiments in plastic tunnel were performed with fresh (E1) and weathered petroleum (E2) under waterlogging experimental conditions. The E1 was based on eight doses: 6 000, 10 000, 30 000, 60 000, 90 000, 120 000, 150 000 and 180 000 mg.kg-1 dry basis (d. b.) of total petroleum hydrocarbons fresh (TPH-F), and the E2, that evaluated five doses: 14 173, 28 400, 50 598, 75 492 and 112 142 mg. kg-1 d. b. of total petroleum hydrocarbons weathered (TPH-W); a control treatment with 2 607 mg.kg-1 d. b. was used. Each experiment, with eight replicates per treatment, evaluated after three and six months: a) microbial density of total free-living nitrogen-fixing bacteria (NFB) of Azospirillum (AZP) and Azotobacter group (AZT), for viable count in serial plate; b) dry matter production (DMP), quantified gravimetrically as dry weight of L. hexandra; and c) the decontamination percentage of hydrocarbons (PDH) by Soxhlet extraction. In soil with TPH-F, the NFB, AZP y AZT populations were stimulated five times more than the control both at the three and six months; however, concentrations of 150 000 and 180 000 mg.kg-1 d. b. inhibited the bacterial density between 70 and 89 %. Likewise, in soil with TPH-W, the FNB, AZP and AZT inhibitions were 90 %, with the exception of the 14 173 mg.kg-1 d. b. treatment, which stimulated the NFB and AZT in 2 and 0.10 times more than the control, respectively. The DMP was continued at the six months in the experiments, with values of 63 and 89 g in fresh and weathered petroleum, respectively; had no significant differences with the control (p≤0.05). The PDH reached values of 66 to 87 % both TPH-F and TPH-W at six months, respectively. These results demonstrated the ability the L. hexandra rhizosphere to stimulate the high NFB density, vegetal biomass production and phytoremediation of contaminated soils (with fresh and weathered petroleum), in a tropical waterlogging environment.

  15. From schedonorus and micropyropsis to lolium (Poaceae: Loliinae): New combinations and typifications

    Czech Academy of Sciences Publication Activity Database

    Banfi, E.; Galasso, G.; Foggi, B.; Kopecký, David; Ardenghi, N.M.G.

    2017-01-01

    Roč. 66, č. 3 (2017), s. 708-717 ISSN 0040-0262 Institutional support: RVO:61389030 Keywords : Epitypification * Fescues * Grasses * Lectotypification * Nomenclature * Nothospecies * Taxonomy Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 2.447, year: 2016

  16. Seasonal responses of six Poaceae to differential levels of solar UV-B radiation

    International Nuclear Information System (INIS)

    Deckmyn, G.; Impens, I.

    1999-01-01

    The effects of changes in solar UV-B on the growth and pigmentation of six grass species from cold-temperate grasslands (Lolium perenne, Lolium multiflorum, Festuca arundinacea, Festuca rubra, Phleum pratense and Dactylis glomerata) in spring and summer were studied. The grasses were grown in greenhouses with different foils, resulting in three treatments: no UV-B, 80% of ambient and 90% of ambient UV-BBE (biologically effective UV-B). The results indicated important effects of ambient UV-B levels on grass, but the different species reacted in very different ways. Both morphology and biomass production were influenced by UV-B in some species. However, changes in biomass production did not necessarily occur within the same species as changes in morphology. The grasses were more sensitive in summer. Overall, only F. rubra was positively influenced by UV-B under all circumstances. The biomass of D. glomerata and L. perenne was reduced by UV-B in spring and summer. Morphological changes included reduced height and increased tillering. The sensitivity of the different species was partially explained by their ability to reduce their specific leaf area in response to UV-B. Only the more sensitive species showed increased production of protective pigments. Overall, there were important differences between the effect of a low level of UV-B, and the further increase in UV-B, indicating that several mechanisms are operating at different light levels. (author)

  17. Multiple homoplasious insertions and deletions of a Triticeae (Poaceae DNA transposon: a phylogenetic perspective

    Directory of Open Access Journals (Sweden)

    Mason-Gamer Roberta J

    2007-06-01

    Full Text Available Abstract Background Stowaway elements are short, non-autonomous DNA transposons categorized as miniature inverted-repeat transposable elements (MITEs. The high MITE copy number in grass genomes suggests an active history of amplification and insertion, but ongoing MITE activity has only rarely been seen, and ongoing Stowaway activity has never been observed. Thus, a phylogenetic perspective on presence vs. absence of elements in an aligned data set can provide valuable historical insights into the dynamics of MITE acquisition and loss. Results A Stowaway-like element resides within the fourth intron of a β-amylase gene in representatives of five genera in the wheat tribe, Triticeae. Its presence vs. absence was examined with reference to the β-amylase gene tree topology, and in light of sequence comparisons of the β-amylase elements to Triticeae Stowaway elements in the Entrez nucleotide database. Among the sequences lacking the element, there are five distinct putative excision footprints (one widespread and four restricted to unrelated lineages and two flanking deletions. The sequences that do contain elements are polyphyletic on the β-amylase tree, and their elements are divergent at the sequence level. The β-amylase elements do not form a monophyletic group relative to other Stowaway elements in Entrez; most are more similar to elements from other loci in other Triticeae genomes than they are to one another. Conclusion Combined, the phylogenetic distribution, sequence variation, and Entrez database comparisons indicate that a Stowaway-like element has undergone multiple deletions from and insertions into the same site in β-amylase intron 4 during the history of the tribe. The elements currently at the site represent multiple, distinct lineages that transcend generic boundaries. While patterns of Stowaway polymorphism across a phylogenetic data set do not allow evolutionary mechanisms to be inferred with certainty, they do provide insights into the dynamics of element evolution over an extended time scale. The historical perspective provided by a phylogenetic approach is complementary to the few studies in which ongoing MITE activity has been documented.

  18. Mechanisms of Oryza sativa (Poaceae resistance to Tagosodes orizicolus (Homoptera: Delphacidae under greenhouse condition in Venezuela

    Directory of Open Access Journals (Sweden)

    Alex González

    2012-03-01

    Full Text Available Tagosodes orizicolus is one of the main plagues of rice in tropical America causing two types of damages, the direct one, feeding and oviposition effect, and an indirect one, by the transmission of the “Rice hoja blanca virus”. During 2006-2007 we carried out research under greenhouse conditions at Fundación Danac, Venezuela, in order to determine the mechanisms of antixenosis, antibiosis and tolerance to T. orizicolus, which could be acting in commercial varieties and advanced lines of the rice genetic breeding programs of INIA and Fundación Danac. The method of free feeding was used for the antixenosis evaluation, whereas the method of forced feeding was used for antibiosis evaluation (effect on survival and oviposition. Additionally, we used the indirect method based on biomass depression to estimate the tolerance. Some of the evaluated traits included: grade of damage, number of insects settling on rice plants, percentage of sogata mortality at the mature state, number of eggs in the leaf midrib and an index of tolerance. The results showed that rice genotypes possess different combinations of resistance mechanisms, as well as different grades of reactions. The susceptible control ‘Bluebonnet 50’ was consistently susceptible across experiments and the resistant control ‘Makalioka’ had high antixenosis and high antibiosis based on survival and oviposition. The rest of the genotypes presented lower or higher degrees of antixenosis and antibiosis for survival and viposition. The genotype ‘FD0241-M-17-6-1-1-1-1’ was identified with possible tolerance to the direct damage of sogata.Tagosodes orizicolus es una de las principales plagas del cultivo del arroz en América tropical causando dos tipos de daños a la planta, el directo, por efecto de la alimentación y oviposición; el indirecto, por la transmisión del virus de la hoja blanca del arroz. Durante el período 2006-2007 se llevó a cabo una investigación bajo condiciones de umbráculo en la Fundación Danac, Venezuela, con el objeto de determinar los mecanismos de resistencia de antixenosis, antibiosis y tolerancia a T. orizicolus que pudieran estar actuando en líneas avanzadas y cultivares del programa de mejoramiento enético de arroz de las instituciones INIA y Fundación Danac. Para la evaluación de antixenosis se utilizó el método de libre elección, para antibiosis (efecto sobre sobrevivencia y oviposición de los insectos el de alimentación forzada, adicionalmente se usó un método indirecto para estimar la tolerancia. Dentro de los principales parámetros determinados se encontraban: grado de daño, número de insectos posados sobre plantas de arroz, porcentaje de mortalidad de sogata en estado adulto, número de huevos y se calculó un índice de tolerancia con base en la biomasa. Los resultados mostraron que los genotipos de arroz evaluados poseen diferentes combinaciones en cuanto a los mecanismos de resistencia, así como el grado de su efecto. El testigo ‘Bluebonnet 50’ se mantuvo consistentemente susceptible en las evaluaciones y el testigo resistente ‘Makalioka’ fue el único genotipo que presentó alta antixenosis y alta antibiosis para sobrevivencia y oviposición. El resto de los genotipos presentaron un menor o mayor grado de resistencia de tipo antixenosis y antibiosis para sobrevivencia y oviposición. Se identificó el genotipo ‘FD0241-M-17-6-1-1-1-1’ con posible tolerancia al daño directo de sogata.

  19. Effect of some adjuvants application on enhancing sulfosulfuron herbicide performance on Phalaris minor- Poaceae

    Directory of Open Access Journals (Sweden)

    Mohammad Mehdizadeh

    2015-02-01

    Full Text Available Nowadays environmental pollution by pesticides application is a major concern for health. Efficiency of many herbicides can be increased by adding adjuvants to the spray solution. Therefore greenhouse study was conducted during 2014 to determine the efficacy of three adjuvants (Citogate, Castor oil and Canola oil at concentrations of 0.1 and 0.2 (%v/v with 5, 10, 20, 30 and 40 g a.i\\ha of sulfosulfuron herbicide on littleseed canary grass. Results showed that the adjuvants enhanced the efficacy of sulfosulfuron in decreasing the dry weights of littleseed canary grass. Performance of herbicide was increased with enhancing its concentrations. Measured ED50 and ED90 concentrations of sulfosulfuron in control were 16.74 and 32.22 g a.i\\ha, respectively. Whereas the values for Citogate 0.2 (%v\\v, was 5.86 and 13.34 g a.i\\ha, respectively. The addition of Citogate and Castor oil had the highest and lowest effect on sulfosulfuron efficacy against Littleseed canary grass. In conclusion, the study revealed that Citogate concentrations had powerful effects on herbicide efficacy followed by Canola oil.

  20. Taxonomy and leaf anatomy of the genus Ehrharta (Poaceae in southern Africa: the Dura group

    Directory of Open Access Journals (Sweden)

    G. E. Gibbs Russel

    1988-10-01

    Full Text Available The Dura species group in the genus Ehrharta Thunb. is differentiated morphologically by the perennial habit and the very large, awned, subglabrous spikelets and anatomically by the occurrence of tanniniferous cells and wax platelets obscuring the stomatal pores. The Dura group consists of two species, E. dura Nees ex Trin. and E. microlaena Nees ex Trin., which occur only in Mountain Fynbos. The group shows no clear morphological or anatomical relationship with other species groups in the genus in southern Africa.

  1. Recent natural hybridization between two allopolyploid wheatgrasses (Elytrigia, Poaceae): Ecological and evolutionary implications

    Czech Academy of Sciences Publication Activity Database

    Mahelka, Václav; Fehrer, Judith; Krahulec, František; Jarolímová, Vlasta

    2007-01-01

    Roč. 100, - (2007), s. 249-260 ISSN 0305-7364 R&D Projects: GA ČR GA206/05/0778; GA ČR(CZ) GD206/03/H137 Institutional research plan: CEZ:AV0Z60050516 Keywords : Triticeae * polyploidy * gene flow Subject RIV: EF - Botanics Impact factor: 2.939, year: 2007

  2. Diversification of C(4) grasses (Poaceae) does not coincide with their ecological dominance.

    Science.gov (United States)

    Bouchenak-Khelladi, Yanis; Slingsby, Jasper A; Verboom, G Anthony; Bond, William J

    2014-02-01

    The radiation of a lineage and its rise to ecological dominance are distinct phenomena and driven by different processes. For example, paleoecological data has been used to show that the Cretaceous angiosperm radiation did not coincide with their rise to dominance. Using a phylogenetic approach, we here explored the evolution of C4 grasses and evaluated whether the diversification of this group and its rise to ecological dominance in the late Miocene were decoupled. We assembled a matrix including 675 grass species of the PACMAD clade and 2784 characters (ITS and ndhF) to run a molecular dating analysis using three fossils as reference calibrations. We coded species as C3 vs. C4 and reconstructed ancestral states under maximum likelihood. We used the program BiSSE to test whether rates of diversification are correlated with photosynthetic pathway and whether the radiation of C4 lineages preceded or coincided with their rise to ecological dominance from ∼10 Ma. C4 grass lineages first originated around 35 Ma at the time of the Eocene-Oligocene transition. Accelerated diversification of C4 lineages did not coincide with their rise to ecological dominance. C4-dominated grasslands have expanded only since the Late Miocene and Pliocene. The initial diversification of their biotic elements can be tracked back as far as the Eocene-Oligocene transition. We suggest that shifts in taxonomic diversification and ecological dominance were stimulated by different factors, as in the case of the early angiosperms in the Cretaceous.

  3. Genetic improvement and diversity in Snake River wheatgrass (Elymus wawawaiensis) (Poaceae: Triticeae)

    Science.gov (United States)

    With the increased emphasis to use native plant materials in range revegetation programs in the western US, it is critical to develop native grasses that are competitive with invasive weeds, easy to establish, persistent, and produce high seed yield. One such native grass species with appreciable d...

  4. Karyotype characterization and comparison of three hexaploid species of Bromus Linnaeus, 1753 (Poaceae

    Directory of Open Access Journals (Sweden)

    Leonardo Luís Artico

    2017-04-01

    Full Text Available Chromosome morphometry and nuclear DNA content are useful data for cytotaxonomy and to understand the evolutionary history of different taxa. For the genus Bromus Linnaeus, 1753, distinct ploidy levels have been reported, occurring from diploid to duodecaploid species. The geographic distribution of Bromus species has been correlated with chromosome number and ploidy level. In this study, the aims were to determine the nuclear genome size and characterize the karyotype of the South American Bromus species: Bromus auleticus Trinius ex Nees, 1829, Bromus brachyanthera Döll, 1878 and Bromus catharticus Vahl, 1791. The mean nuclear 2C value ranged from 2C = 12.64 pg for B. catharticus to 2C = 17.92 pg for B. auleticus, meaning a maximum variation of 2C = 5.28 pg, equivalent to 41.70%. Despite this significant difference in 2C value, the three species exhibit the same chromosome number, 2n = 6x = 42, which confirms their hexaploid origin. Corroborating the genome size, the chromosome morphometry (total, short- and long-arm length and, consequently, the class differed among the karyotypes of the species. Based on the first karyograms for these Bromus species, some morphologically similar and several distinct chromosome pairs were found. Therefore, the karyotype characterization confirmed the hexaploid origin of the studied Bromus species, which differ in relation to the karyogram and the nuclear 2C value. Considering this, cytogenetics and flow cytometry can be used to discriminate Bromus species, contributing to taxonomy and systematic studies and providing information on the evolutionary history of this taxa.

  5. Karyotype characterization and comparison of three hexaploid species of Bromus Linnaeus, 1753 (Poaceae).

    Science.gov (United States)

    Artico, Leonardo Luís; Mazzocato, Ana Cristina; Ferreira, Juliano Lino; Carvalho, Carlos Roberto; Clarindo, Wellington Ronildo

    2017-01-01

    Chromosome morphometry and nuclear DNA content are useful data for cytotaxonomy and to understand the evolutionary history of different taxa. For the genus Bromus Linnaeus, 1753, distinct ploidy levels have been reported, occurring from diploid to duodecaploid species. The geographic distribution of Bromus species has been correlated with chromosome number and ploidy level. In this study, the aims were to determine the nuclear genome size and characterize the karyotype of the South American Bromus species: Bromus auleticus Trinius ex Nees, 1829, Bromus brachyanthera Döll, 1878 and Bromus catharticus Vahl, 1791. The mean nuclear 2C value ranged from 2C = 12.64 pg for B. catharticus to 2C = 17.92 pg for B. auleticus , meaning a maximum variation of 2C = 5.28 pg, equivalent to 41.70%. Despite this significant difference in 2C value, the three species exhibit the same chromosome number, 2n = 6x = 42, which confirms their hexaploid origin. Corroborating the genome size, the chromosome morphometry (total, short- and long-arm length) and, consequently, the class differed among the karyotypes of the species. Based on the first karyograms for these Bromus species, some morphologically similar and several distinct chromosome pairs were found. Therefore, the karyotype characterization confirmed the hexaploid origin of the studied Bromus species, which differ in relation to the karyogram and the nuclear 2C value. Considering this, cytogenetics and flow cytometry can be used to discriminate Bromus species, contributing to taxonomy and systematic studies and providing information on the evolutionary history of this taxa.

  6. Grass pollen (Poaceae in the air of Sosnowiec (Poland, 1997 - 2006

    Directory of Open Access Journals (Sweden)

    Kazimiera Chłopek

    2012-12-01

    Full Text Available The article presents the analysis results of the grass pollen seasons from 1997 to 2006 in Sosnowiec. The research was carried out by means of the volumetric method with the use of a Burkard device. The duration of the pollen seasons was determined by means of the 98% method. The influence of meteorological conditions on the starting date and duration of the grass pollen seasons has been estimated in the article. The beginning of the pollen seasons was recorded between 23 April and 23 May. It has been demonstrated that the average duration of the pollen season amounted to 138 days. The period of maximum concentrations was recorded in June and the first half of July. The highest daily concentration was found in 2000 (495 grains in m3 and the highest annual sums in 2002 and 2000. The daily concentration distribution curve has shown three peaks. The highest values were recorded from 7 am until 11 am, from 13 pm until 17 pm and from 19 pm until 21 pm. It has been found that there is a significant influence of weather conditions (temperature, precipitation and relative humidity on the beginning and duration of the pollen seasons and the period of maximum concentrations.

  7. Chromosomal organization of repetitive DNAs in Hordeum bogdanii and H. brevisubulatum (Poaceae

    Directory of Open Access Journals (Sweden)

    Quanwen Dou

    2016-10-01

    Full Text Available Molecular karyotypes of H. bogdanii Wilensky, 1918 (2n = 14, and H. brevisubulatum Link, 1844 ssp. brevisubulatum (2n = 28, were characterized by physical mapping of several repetitive sequences. A total of 18 repeats, including all possible di- or trinucleotide SSR (simple sequence repeat motifs and satellite DNAs, such as pAs1, 5S rDNA, 45S rDNA, and pSc119.2, were used as probes for fluorescence in situ hybridization on root-tip metaphase chromosomes. Except for the SSR motifs AG, AT and GC, all the repeats we examined produced detectable hybridization signals on chromosomes of both species. A detailed molecular karyotype of the I genome of H. bogdanii is described for the first time, and each repetitive sequence is physically mapped. A high degree of chromosome variation, including aneuploidy and structural changes, was observed in H. brevisubulatum. Although the distribution of repeats in the chromosomes of H. brevisubulatum is different from that of H. bogdanii, similar patterns between the two species imply that the autopolyploid origin of H. brevisubulatum is from a Hordeum species with an I genome. A comparison of the I genome and the other Hordeum genomes, H, Xa and Xu, shows that colocalization of motifs AAC, ACT and CAT and colocalization of motifs AAG and AGG are characteristic of the I genome. In addition, we discuss the evolutionary significance of repeats in the genome during genome differentiation.

  8. Muhlenbergia monandra (Poaceae: Eragrostideae, nueva especie anual endémica del Perú

    Directory of Open Access Journals (Sweden)

    J. José Alegría Olivera

    2001-01-01

    Full Text Available Se describe e ilustra Muhlenbergia monandra, endémica de Perú. La nueva especie se caracteriza por sus glumas mayores que el antecio, por tener inflorescencias espiciformes y las flores cleistógamas con un estambre. La anatomía foliar se describe e ilustra y se detallan sus caracteres diferenciales. Se incluyen observaciones sobre la epidermis de la lemma y las glumas realizadas con el Microscopio Electrónico de Barrido. Se discute la posición taxonómica de la nueva entidad y las diferencias con las especies anuales relacionadas que habitan en América del Sur

  9. Higher level phylogenetic relationships within the bamboos (Poaceae: Bambusoideae) based on five plastid markers.

    Science.gov (United States)

    Kelchner, Scot A

    2013-05-01

    Bamboos are large perennial grasses of temperate and tropical forests worldwide. Two general growth forms exist: the economically and ecologically important woody bamboos (tribes Arundinarieae and Bambuseae), and the understory herbaceous bamboos (tribe Olyreae). Evolutionary relationships among the 1400+described species have been difficult to resolve with confidence. Comparative analysis of bamboo plastid (chloroplast) DNA has revealed three to five major lineages that show distinct biogeographic distributions. Taxon sampling across tribes and subtribes has been incomplete and most published data sets include a relatively small number of nucleotide characters. Branching order among lineages is often poorly supported, and in more than one study herbaceous bamboos form a clade within the woody bamboos. In this paper, the Bamboo Phylogeny Group presents the most complete phylogeny estimation to date of bamboo tribes and subtribes using 6.7 kb of coding and noncoding sequence data and 37 microstructural characters from the chloroplast genome. Quality of data is assessed, as is the possibility of long branch attraction, the degree of character conflict at key nodes in the tree, and the legitimacy of three alternative hypotheses of relationship. Four major plastid lineages are recognized: temperate woody, paleotropical woody, neotropical woody, and herbaceous bamboos. Woody bamboos are resolved as paraphyletic with respect to Olyreae but SH tests cannot reject monophyly of woody species (Arundinarieae+Bambuseae). Published by Elsevier Inc.

  10. Airborne grass (Poaceae) pollen in southern Spain. Results of a 10-year study (1987-96).

    Science.gov (United States)

    González Minero, F J; Candau, P; Tomás, C; Morales, J

    1998-03-01

    This work reports an exhaustive study of the aerobiology of the Gramineae in Seville, Spain, which is typical of coastal Mediterranean areas. Sampling was done with a Cour trap installed on the roof terrace of the School of Pharmacy, Seville, from 1987 to 1996, both inclusive. The climatic pattern of that period was characterized by two exceptionally wet years (1989 and 1996), between which were 5 consecutive years of drought (1990-5). This typically Mediterranean climate affects grass aerobiology. The annual amounts of total grass pollen are low, never exceeding 2500 grains/m3. The start, length, and intensity of the pollen season are significantly correlated with preseasonal meteorologic factors (precipitation and temperature), but intraseasonal meteorologic conditions have no effect on the three variables. The relationships are stated by three equations that, while further years of observations are anticipated, can be considered models to forecast the characteristics of the pollen season: the starting date depends on the mean temperatures of January and February, and the length and intensity of the season depend on the rainfall between the beginning of January and the starting date of the season. For the study period, the weekly concentrations (pollen curves) throughout the year showed no typical pattern of variation over the years, so that it was impossible to make mid- and long-term forecasts of the variation in weekly concentration. The most noteworthy aspects of grass pollen curves are a long pollen season, which starts in February or March and lasts until September or October; peaks of higher concentration (> 100 grains/m3) in May and June, associated with increases in temperature and absence of precipitation; and other peaks in the summer months that may be as high as the spring peaks.

  11. Genetic analysis and gene fine mapping of aroma in rice (Oryza sativa L. Cyperales, Poaceae

    Directory of Open Access Journals (Sweden)

    Shu Xia Sun

    2008-01-01

    Full Text Available We investigated inheritance and carried out gene fine mapping of aroma in crosses between the aromatic elite hybrid rice Oryza sativa indica variety Chuanxiang-29B (Ch-29B and the non-aromatic rice O. sativa indica variety R2 and O. sativa japonica Lemont (Le. The F1 grains and leaves were non-aromatic while the F2 non-aroma to aroma segregation pattern was 3:1. The F3 segregation ratio was consistent with the expected 1:2:1 for a single recessive aroma gene in Ch-29B. Linkage analysis between simple sequence repeat (SSR markers and the aroma locus for the aromatic F2 plants mapped the Ch-29B aroma gene to a chromosome 8 region flanked by SSR markers RM23120 at 0.52 cM and RM3459 at 1.23 cM, a replicate F2 population confirming these results. Three bacterial artificial chromosome (BAC clones cover chromosome 8 markers RM23120 and RM3459. Our molecular mapping data from the two populations indicated that the aroma locus occurs in a 142.85 kb interval on BAC clones AP005301 or AP005537, implying that it might be the same gene reported by Bradbury et al (2005a; Plant Biotec J. 3:363-370. The flanking markers Aro7, RM23120 and RM3459 identified by us could greatly accelerate the efficiency and precision of aromatic rice breeding programs.

  12. Intergeneric hybridization and C-banding patterns in Hordelymus (Triticeae, Poaceae)

    DEFF Research Database (Denmark)

    Bothmer, R. von; Lu, B.-R.; Linde-Laursen, I.

    1994-01-01

    Crosses of Hordelymus europaeus (2n = 4x = 28) with four genera in the Triticeae were attempted. Adult hybrids were obtained in combinations with Hordeum bogdanii (2x), Hordeum depressum (4x), and Secale cereale (2x). The meiotic pairing was very low in the hybrids with H. bogdanii and Secale...... cereale (0.12 and 0.30 chiasmata/cell, respectively), whereas high pairing (9.90 chiasmata/cell) was found in hybrids with H. depressum due to autosyndetic pairing of H. depressum chromosomes. The chromosome complement of Hordelymus europaeus comprised 16 metacentrics, 8 submetacentrics, and 4 SAT...

  13. Hybridization between invasive Spartina Densiflora (Poaceae) and native S. Foliosa in San Francisco Bay, California, USA

    Science.gov (United States)

    Rapid evolution in contemporary time can result when related species, brought together through human-aided introduction, hybridize. The evolutionary consequences of post introduction hybridization range from allopolyploid speciation to extinction of species through genetic amalg...

  14. Cytogenetic relationships within the Maghrebian clade of Festuca subgen. Schedonorus (Poaceae), using flow cytometry and FISH

    Czech Academy of Sciences Publication Activity Database

    Ezquerro-López, D.; Kopecký, David; Inda, L. A.

    2017-01-01

    Roč. 74, č. 1 (2017), č. článku e052. ISSN 0211-1322 Institutional support: RVO:61389030 Keywords : Broad-leaved fescues * Festuca subgen. Schedonorus * fish * Genome size * rdna Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Plant sciences, botany Impact factor: 0.385, year: 2016

  15. Ultrastructure and histology of organogenesis induced from shoot tips of maize (Zea mays, Poaceae

    Directory of Open Access Journals (Sweden)

    Walter Marín-Méndez

    2009-11-01

    Full Text Available Shoot tips of maize (Zea mays L. were cultured on Murashige and Skoog medium supplemented with 2 mg/l BA +1 mg/l 2,4-D +40 mg/l, to investigate phases of ontogenetic development. The study used light microscopy as well as scanning and transmission electronic microscopy techniques. Shoot tips of maize are composed of small cells with a dense cytoplasm and a prominent nucleus. The process of organogenesis began with swelling of the shoot tip, as the first evidence of organogenic calli formation observed three weeks after culture get started. There were two morphologically different types of cells within the organogenic calli. The layer consisted of large cells with small nucleus, free-organelle cytosol, irregular plasmatic membrane, trichome-like structures, and thick cell walls. In the inner cell layer, small and isodiametric cells with a prominent nucleus, small vacuoles, endoplasmatic reticulum, Golgi, mitochondrias and chloroplasts were observed. The presence of trichomes in the more active morphogenic zones could indicate an organogenic potential. Rev. Biol. Trop. 57 (Suppl. 1: 129-139. Epub 2009 November 30.Los ápices de vástagos de maíz (Zea mays L. fueron cultivados con el medio Murashige y Skoog, utilizando como suplemento 2 mg/l BA +1 mg/l 2,4-D +40 mg/l, con el fin de investigar el proceso organogénico durante las diferentes fases del desarrollo ontogenético. El estudio utilizó tanto microscopía de luz, como técnicas de microscopía electrónica. Los análisis histológicos revelaron que los vástagos de maíz están compuestos de pequeñas células con citoplasma denso y núcleo prominente. El proceso de organogénesis inicia con el engrosamiento del ápice del vástago, como primera evidencia de la formación organogénica del calli observada tres semanas después del inicio del cultivo. El estudio ultraestructural muestra dos tipos de células morfológicamente diferentes en el calli organogénico. La capa externa consiste de células grandes con núcleo pequeño, citosol sin organelas, membrana plamática irregular, estructuras similares a tricomas y paredes celulares delgadas. Mientras que en la capa interna se observaron células pequeñas e isodiamétricas con un núcleo prominente, vacuolas pequeñas, retículo endoplasmático, Golgi, mitocondrias y cloroplastos. Observaciones de microscopía electrónica revelan la organización externa de la organogénesis del calli del maíz. Los resultados obtenidos en el presente estudio contribuyen con la comprensión del proceso de organogénesis en los ápices de los vástagos del maíz. Este estudio mejorará nuestro conocimiento acerca de los estados anatómicos óptimos para la integración estable de genes externos. Además, provee información de las condiciones apropiadas en el cultivo in vitro para la regeneración de plantas transgénicas. Este estudio sugiere que la presencia de tricomas en las zonas morfogénicas más activas podría indicar su potencial organogénico.

  16. A phylogenetic analysis of the monogenomic Triticeae (Poaceae) based on morphology

    DEFF Research Database (Denmark)

    Seberg, Ole; Frederiksen, Signe Elisabeth

    2001-01-01

    not traditionally included in Aegilops s.J. Most of the 33 characters used in the analysis are coded as binary. The only four multistate characters in the matrix are treated as unordered. Three diploid species of Bromus are used as outgroup. The number of equally parsimonious trees found is very large (approx....... 170000; length = 107, ci = 0.36, ri = 0.75) and the strict consensus tree has an expectedly low level of resolution. However, most of the equally parsimonious trees owe their existence to an unresolved Aegilops clade. If this clade is replaced by its hypothetical ancestor, the number of equally...... parsimonious trees drops dramatically (48; length = 78, ci = 0.45, ri = 0.76). When trees for which more highly resolved compatible trees exist are excluded, only two trees remain. Bremer support is used as a measure of branch support. The trees based on morphology and on molecular data are largely incongruent....

  17. Mechanisms of Oryza sativa (Poaceae) resistance to Tagosodes orizicolus (Homoptera: Delphacidae) under greenhouse condition in Venezuela.

    Science.gov (United States)

    González, Alex; Labrín, Natalia; Alvarez, Rosa M; Jayaro, Yorman; Gamboa, Carlos; Reyes, Edicta; Barrientos, Venancio

    2012-03-01

    Tagosodes orizicolus is one of the main plagues of rice in tropical America causing two types of damages, the direct one, feeding and oviposition effect, and an indirect one, by the transmission of the "Rice hoja blanca virus". During 2006-2007 we carried out research under greenhouse conditions at Fundaci6n Danac, Venezuela, in order to determine the mechanisms of antixenosis, antibiosis and tolerance to T. orizicolus, which could be acting in commercial varieties and advanced lines of the rice genetic breeding programs of INIA and Fundaci6n Danac. The method of free feeding was used for the antixenosis evaluation, whereas the method of forced feeding was used for antibiosis evaluation (effect on survival and oviposition). Additionally, we used the indirect method based on biomass depression to estimate the tolerance. Some of the evaluated traits included: grade of damage, number of insects settling on rice plants, percentage of sogata mortality at the mature state, number of eggs in the leaf midrib and an index of tolerance. The results showed that rice genotypes possess different combinations of resistance mechanisms, as well as different grades of reactions. The susceptible control 'Bluebonnet 50' was consistently susceptible across experiments and the resistant control 'Makalioka' had high antixenosis and high antibiosis based on survival and oviposition. The rest of the genotypes presented lower or higher degrees of antixenosis and antibiosis for survival and oviposition. The genotype 'FD0241-M-17-6-1-1-1-1' was identified with possible tolerance to the direct damage of sogata.

  18. Chromosome number, microsporogenesis, microgametogenesis, and pollen viability in the Brazilian native grass Mesosetum chaseae (Poaceae).

    Science.gov (United States)

    Silva, L A C; Pagliarini, M S; Santos, S A; Silva, N; Souza, V F

    2012-11-28

    The genus Mesosetum is a primarily South American genus with 42 species. Mesosetum chaseae, regionally known as 'grama-do-cerrado', is abundant in the Pantanal Matogrossense (Brazil); it is a valuable resource for livestock and for environmental conservation. We collected specimens from the Nhecolandia sub-region of the Brazilian Pantanal, located in Corumbá, Mato Grosso do Sul, Brazil. We examined chromosome number, ploidy level, meiotic behavior, microgametogenesis, and pollen viability of 10 accessions. All the accessions were diploid, derived from x = 8, presenting 2n = 2x = 16 chromosomes. Chromosomes paired as bivalents showing, predominantly, two terminal chiasmata. Interstitial chiasmata were rare. Meiosis was quite normal producing only a few abnormal tetrads in some accessions. Microgametogenesis, after two mitotic divisions, produced three-celled pollen grains. Pollen viability was variable among plant and accessions and was not correlated with meiotic abnormalities.

  19. Meiosis in elephant grass (Pennisetum purpureum), pearl millet (Pennisetum glaucum) (Poaceae, Poales) and their interspecific hybrids

    OpenAIRE

    Techio, Vânia Helena; Davide, Lisete Chamma; Pereira, Antônio Vander

    2006-01-01

    The cultivated and sexually compatible species Pennisetum purpureum (elephant grass, 2n = 4x = 28) and Pennisetum glaucum (pearl millet, 2n = 2x = 14) can undergo hybridization which favors the amplification of their genetic background and the introgression of favorable alleles into breeding programs. The main problem with interspecific hybrids of these species is infertility due to triploidy (2n = 3x = 21). This study describes meiosis in elephant grass x pearl millet hybrids and their proge...

  20. Variation in sequences containing microsatellite motifs in the perennial biomass and forage grass, Phalaris arundinacea (Poaceae).

    Science.gov (United States)

    Barth, Susanne; Jankowska, Marta Jolanta; Hodkinson, Trevor Roland; Vellani, Tia; Klaas, Manfred

    2016-03-22

    Forty three microsatellite markers were developed for further genetic characterisation of a forage and biomass grass crop, for which genomic resources are currently scarce. The microsatellite markers were developed from a normalized EST-SSR library. All of the 43 markers gave a clear banding pattern on 3% Metaphor agarose gels. Eight selected SSR markers were tested in detail for polymorphism across eleven DNA samples of large geographic distribution across Europe. The new set of 43 SSR markers will help future research to characterise the genetic structure and diversity of Phalaris arundinacea, with a potential to further understand its invasive character in North American wetlands, as well as aid in breeding work for desired biomass and forage traits. P. arundinacea is particularly valued in the northern latitude as a crop with high biomass potential, even more so on marginal lands.

  1. Development of 12 genic microsatellite loci for a biofuel grass, Miscanthus sinensis (Poaceae).

    Science.gov (United States)

    Ho, Chuan-Wen; Wu, Tai-Han; Hsu, Tsai-Wen; Huang, Jao-Ching; Huang, Chi-Chun; Chiang, Tzen-Yuh

    2011-08-01

    Miscanthus, a nonfood plant with high potential as a biofuel, has been used in Europe and the United States. The selection of a cultivar with high biomass, photosynthetic efficiency, and stress resistance from wild populations has become an important issue. New genic microsatellite markers will aid the assessment of genetic diversity for different strains. Twelve polymorphic microsatellite markers derived from the transcriptome of Miscanthus sinensis fo. glaber were identified and screened on 80 individuals of M. sinensis. The number of alleles per locus ranged from 6 to 12, and the mean expected heterozygosity was 0.75. Cross-taxa transferability revealed that all loci can be applied to all varieties of M. sinensis, as well as the closely related species M. floridulus. These new genic microsatellite markers are useful for characterizing different traits in breeding programs or to select genes useful for biofuel.

  2. Reproductive biology of the native forage grass Trichloris crinita (Poaceae, Chloridoideae).

    Science.gov (United States)

    Kozub, P C; Barboza, K; Galdeano, F; Quarin, C L; Cavagnaro, J B; Cavagnaro, P F

    2017-05-01

    Trichloris crinita is a perennial forage grass species native to arid regions of the American continent. Due to its extensive area of distribution, good forage quality and resistance to drought and grazing, this species is widely utilised as forage and for revegetation purposes in environments with low water availability. Despite its importance, genetic improvement of T. crinita has been very limited, partly as consequence of the lack of knowledge on its mode of reproduction. In the present work, we studied the reproductive biology of T. crinita by means of embryological analyses, flow cytometric seed screen (FCSS), self-compatibility tests and progeny testing with morphological and molecular markers. Cytological analyses revealed embryo sacs with eight nuclei and of Polygonum type for all T. crinita accessions analysed. FCSS histograms exhibited two clear peaks corresponding to 2C and 3C DNA content, indicating embryo sacs of sexual origin. Controlled pollination experiments designed to evaluate seed set (%) demonstrated that T. crinita is self-compatible, whereas results from morphological and simple sequence repeat (SSR) marker analysis of progeny revealed lack of outcrossing. Together, these results indicate that T. crinita reproduces sexually. It is a self-compatible and autogamous species. It is expected that these data will have a positive impact in the genetics and breeding of this species, and therefore contribute to its proper utilisation in arid regions. © 2017 German Botanical Society and The Royal Botanical Society of the Netherlands.

  3. Microsatellite markers for the native Texas perennial grass, Panicum hallii (Poaceae).

    Science.gov (United States)

    Lowry, David B; Purmal, Colin T; Meyer, Eli; Juenger, Thomas E

    2012-03-01

    We developed microsatellites for Panicum hallii for studies of gene flow, population structure, breeding experiments, and genetic mapping. Next-generation (454) genomic sequence data were used to design markers. Eighteen robust markers were discovered, 15 of which were polymorphic across six accessions of P. hallii var. hallii. Fourteen of the markers cross-amplified in a P. capillare accession. For the 15 polymorphic markers, the total number of alleles per locus ranged from two to 26 (mean: 11.0) across six populations (11-19 individuals per population). Observed heterozygosity (mean: 0.031) was 13.7 times lower than the expected heterozygosity (mean: 0.426). The deficit of heterozygous individuals is consistent with P. hallii having a high rate of self-fertilization. These markers will be useful for studies in P. hallii and related species.

  4. Ecological genetics of the Bromus tectorum (Poaceae) - Ustilago Bullata (Ustilaginaceae): A role for frequency dependent selection?

    Science.gov (United States)

    Susan E. Meyer; David L. Nelson; Suzette Clement; Alisa Ramakrishnan

    2010-01-01

    Evolutionary processes that maintain genetic diversity in plants are likely to include selection imposed by pathogens. Negative frequency-dependent selection is a mechanism for maintenance of resistance polymorphism in plant - pathogen interactions. We explored whether such selection operates in the Bromus tectorum - Ustilago bullata pathosystem. Gene-for-gene...

  5. Cercosporoid fungi (Mycosphaerellaceae) 2. Species on monocots (Acoraceae to Xyridaceae, excluding Poaceae)

    OpenAIRE

    Braun, Uwe; Crous, Pedro W.; Nakashima, Chiharu

    2014-01-01

    Cercosporoid fungi (formerly Cercospora s. lat.) represent one of the largest groups of hyphomycetes belonging to the Mycosphaerellaceae (Ascomycota). They include asexual morphs, asexual holomorphs, or species with mycosphaerella-like sexual morphs. Most of them are leaf-spotting plant pathogens with special phytopathological relevance. In the first part of a new monographic work, cercosporoid hyphomycetes occurring on other fungi (fungicolous species), on ferns (pteridophytes) and gymnosper...

  6. Adaptive divergence with gene flow in incipient speciation of Miscanthus floridulus / sinensis complex (Poaceae)

    KAUST Repository

    Huang, Chao-Li

    2014-11-11

    Young incipient species provide ideal materials for untangling the process of ecological speciation in the presence of gene flow. The Miscanthus floridulus/sinensis complex exhibits diverse phenotypic and ecological differences despite recent divergence (approximately 1.59million years ago). To elucidate the process of genetic differentiation during early stages of ecological speciation, we analyzed genomic divergence in the Miscanthus complex using 72 randomly selected genes from a newly assembled transcriptome. In this study, rampant gene flow was detected between species, estimated as M=3.36x10(-9) to 1.20x10(-6), resulting in contradicting phylogenies across loci. Nevertheless, beast analyses revealed the species identity and the effects of extrinsic cohesive forces that counteracted the non-stop introgression. As expected, early in speciation with gene flow, only 3-13 loci were highly diverged; two to five outliers (approximately 2.78-6.94% of the genome) were characterized by strong linkage disequilibrium, and asymmetrically distributed among ecotypes, indicating footprints of diversifying selection. In conclusion, ecological speciation of incipient species of Miscanthus probably followed the parapatric model, whereas allopatric speciation cannot be completely ruled out, especially between the geographically isolated northern and southern M.sinensis, for which no significant gene flow across oceanic barriers was detected. Divergence between local ecotypes in early-stage speciation began at a few genomic regions under the influence of natural selection and divergence hitchhiking that overcame gene flow.

  7. Nuevas especies de Axonopus (Poaceae: Panicoideae: Paniceae de la Amazonia Colombiana

    Directory of Open Access Journals (Sweden)

    Giraldo Cañas Diego

    1998-11-01

    Full Text Available Two new species of Axonopus, A. morronei (series Axonopus and A. zuloagae (series Barbigen are described. The new species are known only from the savannas and sandstone plateau of Colombian northwest Amazonia.Se describen dos nuevas especies de Axonopus, A. morronei y A. zuloagae, de las series Axonopus y Barbigeri, respectivamente. Las nuevas especies son conocidas únicamente de las sabanas y afloramientos rocosos de la Amazonia noroccidental colombiana.

  8. The phytoremediation potential of heavy metals from soil using Poaceae energy crops: A review

    Directory of Open Access Journals (Sweden)

    Melissa PRELAC

    2016-09-01

    Full Text Available Phytoremediation is a method that use plants which can remove or stabilize pollutants in the environment. The aim of the polluted area remediation is to return ecosystems into original condition. Phytoremediation is a green technology used for a wide range of pollutants as well as on various lands, low costs and reduced environment impacts. Energy crops are relatively new in this field of researches and insufficiently explored. However, the results so far show their potential in heavy metal removal. The aim of this research was to examine the available literature and determine the phytoremediation potential of cadmium, chromium, copper, lead, mercury, nickel and zinc from the soil using Arundo donax, Miscanthus x giganteus, Panicum virgatum, Pennisetum purpureum, Sida hermaphrodita and Sorghum x drummondii. According to the researches conditions, studied energy crops are reccomended in heavy metals phytoextraction, rhizofiltration, stabilization and accumulation. Still, those plants accumulate higher concentrations of heavy metals in the rhizosphere which makes them heavy metals excluders since heavy metals are not translocated into the plants' shoot system and favorable in the implementation of rhizofiltration as well.

  9. Early colonization pattern of maize (Zea mays L. Poales, Poaceae roots by Herbaspirillum seropedicae (Burkholderiales, Oxalobacteraceae

    Directory of Open Access Journals (Sweden)

    Rose A. Monteiro

    2008-12-01

    Full Text Available The bacterium Herbaspirillum seropedicae is an endophytic diazotroph found in several plants, including economically important poaceous species. However, the mechanisms involved in the interaction between H. seropedicae and these plants are not completely characterized. We investigated the attachment of Herbaspirillum to maize roots and the invasion of the roots by this bacterium using H. seropedicae strain SMR1 transformed with the suicide plasmid pUTKandsRed, which carries a mini-Tn5 transposon containing the gene for the Discosoma red fluorescent protein (Dsred constitutively expressed together with the kanamycin resistance gene. Integration of the mini-Tn5 into the bacterial chromosome yielded the mutant H. seropedicae strain RAM4 which was capable of expressing Dsred and could be observed on and inside fresh maize root samples. Confocal microscopy of maize roots inoculated with H. seropedicae three days after germination showed that H. seropedicae cell were attached to the root surface 30 min after inoculation, were visible in the internal tissues after twenty-four hours and in the endodermis, the central cylinder and xylem after three days.

  10. The utility of Bambusoideae (Poaceae, Poales leaf blade anatomy for identification and systematics

    Directory of Open Access Journals (Sweden)

    T. D. Leandro

    Full Text Available Abstract Bambusoideae is a diverse subfamily that includes herbaceous (Olyreae and woody (Arundinarieae and Bambuseae bamboos. Species within Bambusae are particularly difficult to identify due to their monocarpic lifecycle and the often long durations between mass flowering events; whereas the herbaceous bamboos are pluricarpic, but often are found with no reproductive structures. The leaf blade anatomy of 16 sympatric species of native Brazilian bamboos (Olyreae and Bambuseae from the Atlantic Rainforest was studied in order to detect useful features for their identification. All the studied species share the following features: epidermis with a single stratum of cells; adaxial bulliform cells; mesophyll with arm cells, rosette cells, and fusoid cells; and collateral vascular bundles. Herbaceous bamboos share two features: papillae scattered on the abaxial surface and parallel-sided arrays of bulliform cells; whereas woody bamboos share: centrally organized papillae and fan-shaped arrays of bulliform cells. Also within the woody bamboos, intercostal fibers and a midrib with only one vascular bundle (simple midrib characterize the subtribe Arthrostylidiinae; whereas a midrib with more than one vascular bundle (complex midrib and a stomatal apparatus with two pappilae per subsidiary cell characterize the subtribe Chusqueinae. There are also diagnostic features for the sampled species, such as: papillae shape, and the outline and structure of the midrib. An identification key for all the studied species is provided based on the anatomical features.

  11. Cytotaxonomy of some species and of interspecific hybrids of Pennisetum (Poaceae, Poales

    Directory of Open Access Journals (Sweden)

    Vânia Helena Techio

    2002-01-01

    Full Text Available Cytotaxonomic studies were carried out on 26 accessions of Pennisetum spp. originating from the Active Germplasm Bank of Embrapa Gado de Leite-Juiz de Fora, Minas Gerais, Brazil.This study presents cytogenetics and reproductive morphological data for each one of these accessions, which allowed groupings and suggest botanical identifications to be established. The metaphases of the accessions characterized as P. purpureum confirmed the presence of 2n = 28 chromosomes that have already been described for this species. For the hybrids between P. purpureum and P. glaucum and for the hexaploids, resulting from the chromosome duplication of these hybrids, 2n = 21 and 2n = 42 chromosomes were confirmed, respectively. The wild accession identified as P. setosum showed metaphases with 2n = 54 chromosomes, while those characterized as P. nervosum had cells with 2n = 36 chromosomes. The wild accession 15 was different from the others for the morphological characters, with 2n = 36 chromosomes, and was classified as P. orientale. Two statistical procedures were used (canonical variables and cluster analysis on the basis of the Mahalanobis distance, and the results confirmed the conclusions obtained from the cytogenetic and morphologic analysis.

  12. Thresholds, injury, and loss relationships for thrips in Phleum pratense (Poales: Poaceae).

    Science.gov (United States)

    Reisig, Dominic D; Godfrey, Larry D; Marcum, Daniel B

    2009-12-01

    Timothy (Phleum pratense L.) is an important forage crop in many Western U.S. states. Marketing of timothy hay is primarily based on esthetics, and green color is an important attribute. The objective of these studies was to determine a relationship between arthropod populations, yield, and esthetic injury in timothy. Economic injury levels (EILs) and economic thresholds were calculated based on these relationships. Thrips (Thripidae) numbers were manipulated with insecticides in small plot studies in 2006, 2007, and 2008, although tetranychid mite levels were incidentally flared by cyfluthrin in some experiments. Arthropod population densities were determined weekly, and yield and esthetic injury were measured at each harvest. Effects of arthropods on timothy were assessed using multilinear regression. Producers were also surveyed to relate economic loss from leaf color to the injury ratings for use in establishing EILs. Thrips population levels were significantly related to yield loss in only one of nine experiments. Thrips population levels were significantly related to injury once before the first annual harvest and twice before the second. Thrips were the most important pest in these experiments, and they were more often related to esthetic injury rather than yield loss. EILs and economic thresholds for thrips population levels were established using esthetic injury data. These results document the first example of a significant relationship between arthropod pest population levels and economic yield and quality losses in timothy.

  13. Response to flooding intensity in Elytrigia repens, E. intermedia (Poaceae: Triticeae) and their hybrid

    Czech Academy of Sciences Publication Activity Database

    Mahelka, Václav

    2006-01-01

    Roč. 46, - (2006), s. 82-90 ISSN 0043-1737 R&D Projects: GA ČR GA206/05/0778; GA ČR GD206/03/H137; GA MZe QC1362 Institutional research plan: CEZ:AV0Z60050516 Keywords : phenotypic plasticity * flooding * weed Subject RIV: EF - Botanics Impact factor: 1.705, year: 2006

  14. Ribosomal DNA in diploid and polyploid Setaria (Poaceae) species: number and distribution

    OpenAIRE

    Nani, Thaís Furtado; Cenzi, Gisele; Pereira, Daniele Lais; Davide, Lisete Chamma; Techio, Vania Helena

    2015-01-01

    Abstract Setaria Beauvois, 1812 is a genus of economically important forage species, including Setaria italica (Linnaeus, 1753) Beauvois, 1812 and Setaria viridis (Linnaeus, 1753) Beauvois, 1812, closely related species and considered as model systems for studies of C4 plants. However, complications and uncertainties related to taxonomy of other species of the genus are frequent due to the existence of numerous synonyms for the same species or multiple species with the same name, and overlapp...

  15. Ribosomal DNA in diploid and polyploid Setaria (Poaceae) species: number and distribution

    Science.gov (United States)

    Nani, Thaís Furtado; Cenzi, Gisele; Pereira, Daniele Lais; Davide, Lisete Chamma; Techio, Vânia Helena

    2015-01-01

    Abstract Setaria Beauvois, 1812 is a genus of economically important forage species, including Setaria italica (Linnaeus, 1753) Beauvois, 1812 and Setaria viridis (Linnaeus, 1753) Beauvois, 1812, closely related species and considered as model systems for studies of C4 plants. However, complications and uncertainties related to taxonomy of other species of the genus are frequent due to the existence of numerous synonyms for the same species or multiple species with the same name, and overlapping of morphological characteristics. Cytogenetic studies in Setaria can be useful for taxonomic and evolutionary studies as well as for applications in breeding. Thus, this study is aimed at locating 45S and 5S rDNA sites through fluorescent in situ hybridization (FISH) in Setaria italica, Setaria viridis and Setaria sphacelata (Schumacher, 1827) Stapf, Hubbard, Moss, 1929 cultivars (cvs.) Narok and Nandi. Setaria italica and Setaria viridis have 18 chromosomes with karyotype formulas 6m + 3sm and 9m, respectively. The location of 45S and 5S rDNA for these species was in different chromosome pairs among the evaluated species. Setaria viridis presented a more symmetrical karyotype, strengthening the ancestral relationship with Setaria italica. Setaria sphacelata cvs. Narok and Nandi have 36 chromosomes, and karyotype formulas 11m+7sm and 16m+2sm, respectively. The 45S rDNA signals for both cultivars were also observed in distinct chromosome pairs; however chromosomes bearing 5S rDNA are conserved. Karyotypic variations found among the studied species are evidence of chromosomal rearrangements. PMID:26753080

  16. Genetic control and comparative genomic analysis of flowering time in Setaria (Poaceae).

    Science.gov (United States)

    Mauro-Herrera, Margarita; Wang, Xuewen; Barbier, Hugues; Brutnell, Thomas P; Devos, Katrien M; Doust, Andrew N

    2013-02-01

    We report the first study on the genetic control of flowering in Setaria, a panicoid grass closely related to switchgrass, and in the same subfamily as maize and sorghum. A recombinant inbred line mapping population derived from a cross between domesticated Setaria italica (foxtail millet) and its wild relative Setaria viridis (green millet), was grown in eight trials with varying environmental conditions to identify a small number of quantitative trait loci (QTL) that control differences in flowering time. Many of the QTL across trials colocalize, suggesting that the genetic control of flowering in Setaria is robust across a range of photoperiod and other environmental factors. A detailed comparison of QTL for flowering in Setaria, sorghum, and maize indicates that several of the major QTL regions identified in maize and sorghum are syntenic orthologs with Setaria QTL, although the maize large effect QTL on chromosome 10 is not. Several Setaria QTL intervals had multiple LOD peaks and were composed of multiple syntenic blocks, suggesting that observed QTL represent multiple tightly linked loci. Candidate genes from flowering time pathways identified in rice and Arabidopsis were identified in Setaria QTL intervals, including those involved in the CONSTANS photoperiod pathway. However, only three of the approximately seven genes cloned for flowering time in maize colocalized with Setaria QTL. This suggests that variation in flowering time in separate grass lineages is controlled by a combination of conserved and lineage specific genes.

  17. Diazotrophic bacteria isolated from wild rice Oryza glumaepatula (Poaceae in the Brazilian Amazon

    Directory of Open Access Journals (Sweden)

    Paulo Ivan Fernandes Júnior

    2013-06-01

    Full Text Available The association of wild grasses with diazotrophic bacteria in Brazilian biomes is poorly understood. The isolation and characterization of bacteria associated with wild grasses can contribute to understand the diazotrophic ecology as well as to identify bacteria with biotechnological applications. In this study, we isolated and characterized diazotrophic bacterial isolates from Oryza glumaepatula collected in Cerrado and Forest areas of the Amazon in Roraima State, Brazil. Healthy O. glumepatula plants were collected at five sampling sites at Forest and seven at Cerrado, respectively. The plants were collected at the Cerrado areas in September 2008 while the Forest plants were collected in June/2008 and April/2009. The plants and the soil adhering to the roots were transferred to pots and grown for 35 days in greenhouse conditions. During the harvest, the shoots and the roots were crushed separately in a saline solution; the suspension was diluted serially and inoculated in Petri dishes containing Dyg’s medium. All distinct bacterial colonies were purified in the same medium. The diazotrophic capacity of each bacterium in microaerophilic conditions was assessed in semisolid BMGM medium. In addition, the pellicles forming bacterial isolates were also evaluated by PCR amplification for nifH gene. The diversity of nifH+ bacteria was analyzed by Box-PCR fingerprinting. For selected strains, the growth promoting capacity of O. sativa as a model plant was also evaluated. A total of 992 bacterial isolates were obtained. Fifty- one bacteria were able to form pellicles in the semisolid medium and 38 also positively amplified the 360bp nifH gene fragment. Among the 38 nifH+ isolates, 24 were obtained from the shoots, while 14 originated from the roots. The Box-PCR profiles showed that the bacterial isolates obtained in this study presented a low similarity with the reference strains belonging to the Herbaspirillum, Azospirillum and Burkholderia genus. The growth- promoting ability was confirmed for at least five isolates. For these bacteria, the root and shoot growing results showed higher increases when compared to those observed in plants inoculated with the evaluated reference strains. These results indicate that O. glumaepatula is colonized by a high diverse diazotrophic community in the Brazilian Amazon. Further investigations are now being carried out to determine the taxonomic positions of these isolates and their growth promoting mechanisms.

  18. Diazotrophic bacteria isolated from wild rice Oryza glumaepatula (Poaceae) in the Brazilian Amazon.

    Science.gov (United States)

    Júnior, Paulo Ivan Fernandes; Pereira, Gilmara Maria Duarte; Perin, Liamara; da Silva, Luana Mesquita; Baraúna, Alexandre Cardoso; Alvess, Francilene Muniz; Passos, Samuel Ribeiro; Zilli, Jerri Edson

    2013-06-01

    The association of wild grasses with diazotrophic bacteria in Brazilian biomes is poorly understood. The isolation and characterization of bacteria associated with wild grasses can contribute to understand the diazotrophic ecology as well as to identify bacteria with biotechnological applications. In this study, we isolated and characterized diazotrophic bacterial isolates from Oryza glumaepatula collected in Cerrado and Forest areas of the Amazon in Roraima State, Brazil. Healthy O. glumepatula plants were collected at five sampling sites at Forest and seven at Cerrado, respectively. The plants were collected at the Cerrado areas in September 2008 while the Forest plants were collected in June/2008 and April/2009. The plants and the soil adhering to the roots were transferred to pots and grown for 35 days in greenhouse conditions. During the harvest, the shoots and the roots were crushed separately in a saline solution; the suspension was diluted serially and inoculated in Petri dishes containing Dyg's medium. All distinct bacterial colonies were purified in the same medium. The diazotrophic capacity of each bacterium in microaerophilic conditions was assessed in semisolid BMGM medium. In addition, the pellicles forming bacterial isolates were also evaluated by PCR amplification for nifH gene. The diversity of nifH bacteria was analyzed by Box-PCR fingerprinting. For selected strains, the growth promoting capacity of O. sativa as a model plant was also evaluated. A total of 992 bacterial isolates were obtained. Fifty-one bacteria were able to form pellicles in the semisolid medium and 38 also positively amplified the 360 bp nifH gene fragment. Among the 38 nifH+ isolates, 24 were obtained from the shoots, while 14 originated from the roots. The Box-PCR profiles showed that the bacterial isolates obtained in this study presented a low similarity with the reference strains belonging to the Herbaspirillum, Azospirillum and Burkholderia genus. The growth-promoting ability was confirmed for at least five isolates. For these bacteria, the root and shoot growing results showed higher increases when compared to those observed in plants inoculated with the evaluated reference strains. These results indicate that O. glumaepatula is colonized by a high diverse diazotrophic community in the Brazilian Amazon. Further investigations are now being carried out to determine the taxonomic positions of these isolates and their growth promoting mechanisms.

  19. Ribosomal DNA variation in finger millet and wild species of Eleusine (Poaceae).

    Science.gov (United States)

    Hilu, K W; Johnson, J L

    1992-04-01

    Finger millet is an important cereal crop in the semi-arid regions of Africa and India. The crop belongs to the grass genus Eleusine, which includes nine annual and perennial species native to Africa except for the New World species E. tristachya. Ribosomal DNA (rDNA) variation in finger millet and related wild species was used to provide information on the origin of the genomes of this tetraploid crop and point out genetic relationships of the crop to other species in the genus. The restriction endonucleases used revealed a lack of variability in the rDNA spacer region in domesticated finger millet. All the rDNA variants of the crop were found in the proposed direct tetraploid ancestor, E. coracana subsp. africana. Wild and domesticated finger millet displayed the phenotypes found in diploid E. indica. Diploid Eleusine tristachya showed some similarity to the crop in some restriction sites. The remaining species were quite distinct in rDNA fragment patterns. The study supports the direct origin of finger millet from subspecies africana shows E. indica to be one of the genome donors of the crop, and demonstrates that none of the other species examined could have donated the second genome of the crop. The rDNA data raise the possibility that wild and domesticated finger millet could have originated as infraspecific polyploid hybrids from different varieties of E. indica.

  20. Basic chromosome numbers and polyploid levels in some South African and Australian grasses (Poaceae

    Directory of Open Access Journals (Sweden)

    J. J. Spies

    1991-10-01

    Full Text Available Chromosome numbers of 46 specimens of grasses, involving 24 taxa from South Africa and Australia, have been determined during the present study. For the first time chromosome numbers are given for Eragrostis sarmentosa (Thunb. Trin. (n = 20. Panicum aequinerve Nees (n = 18,  Digitaria argyrograpta (Nees Stapf (n = 9 and D. maitlandii Stapf & C.E. Hubb. (n = 9. Additional polyploid levels are described for Diplachne fusca (L. Beauv. ex Roem. & Schult. (n = 10 and Digitaria diagonalis (Nees Stapf var.  diagonalis (n = 9. B-chromosomes were observed in several different specimens. The presence of B-chromosomes often results in abnormal chromosomal behaviour during meiosis.

  1. Identification of putative orthologous genes for the phylogenetic reconstruction of temperate woody bamboos (Poaceae: Bambusoideae).

    Science.gov (United States)

    Zhang, Li-Na; Zhang, Xian-Zhi; Zhang, Yu-Xiao; Zeng, Chun-Xia; Ma, Peng-Fei; Zhao, Lei; Guo, Zhen-Hua; Li, De-Zhu

    2014-09-01

    The temperate woody bamboos (Arundinarieae) are highly diverse in morphology but lack a substantial amount of genetic variation. The taxonomy of this lineage is intractable, and the relationships within the tribe have not been well resolved. Recent studies indicated that this tribe could have a complex evolutionary history. Although phylogenetic studies of the tribe have been carried out, most of these phylogenetic reconstructions were based on plastid data, which provide lower phylogenetic resolution compared with nuclear data. In this study, we intended to identify a set of desirable nuclear genes for resolving the phylogeny of the temperate woody bamboos. Using two different methodologies, we identified 209 and 916 genes, respectively, as putative single copy orthologous genes. A total of 112 genes was successfully amplified and sequenced by next-generation sequencing technologies in five species sampled from the tribe. As most of the genes exhibited intra-individual allele heterozygotes, we investigated phylogenetic utility by reconstructing the phylogeny based on individual genes. Discordance among gene trees was observed and, to resolve the conflict, we performed a range of analyses using BUCKy and HybTree. While caution should be taken when inferring a phylogeny from multiple conflicting genes, our analysis indicated that 74 of the 112 investigated genes are potential markers for resolving the phylogeny of the temperate woody bamboos. © 2014 John Wiley & Sons Ltd.

  2. Regional variation in Argentinean populations of Bromus catharticus (Poaceae as measured by morphological

    Directory of Open Access Journals (Sweden)

    Arturi, Miguel J.

    2008-06-01

    Full Text Available Thirty-one populations of Bromus catharticus Vahl., collected from the Pampean Dominion (Argentina, were classified using twenty four highly heritable traits by numerical taxonomic methods. After implementing a stepwise discriminant analysis, 18 traits were chosen as classificatory variables. Eight population groups were classified in two main clusters. Different morphotypes, primarily associated with panicle architecture and micro floral traits, were found. The patterns in the morphological variation seem to correspond to a gradient of humidity and temperature that diminishes from the NE to the SW. This pattern of classification reflects the geographical origin for most of the sampled populations, although there was some noise. Our results fit the patchy variation model, where populations are genetically selected for macro and micro environmental conditions.Treinta y una poblaciones de Bromus catharticus Vahl., recolectadas en el dominio Pampeano (Argentina, fueron clasificadas utilizando 24 caracteres altamente heredables por métodos de taxonomía numérica. Tras implementar el análisis discriminante del paso a paso (Stepwise, 18 variables fueron seleccionadas como variables clasificatorias. Ocho grupos de poblaciones fueron clasificadas en dos clusters principales. Diferentes morfotipos, principalmente asociados a la arquitectura de las panojas y a variables microflorales, fueron encontrados. El patrón de variación morfológico parece responder a un gradiente de humedad y temperatura que disminuye desde el NE al SW. Además, dicho patrón de clasificación refleja un origen geográfico para la mayoría de las poblaciones, aunque hubo algo de ruido. Nuestros resultados se ajustan a un modelo de variación en parches, donde las poblaciones están genéticamente seleccionadas por condiciones micro y macro ambientales.

  3. Leaf anatomy of the South African Danthonieae (Poaceae. III. Merxmuellera stricta

    Directory of Open Access Journals (Sweden)

    R. P. Ellis

    1980-11-01

    Full Text Available The anatomical structure, of the leaf blade as seen in transverse section, and of the abaxial epidermis, of Merxmuellera stricta (Schrad. Conert is described and illustrated. In this variable species four distinct anatomical “forms” are recognized viz. the typical  M. stricta form, the Cathedral Peak form, the Drakensberg form and the alpine form. The alpine and Cathedral Peak forms have recently been described as M. guillarmodiae Conert (1975. The degree of anatomical differentiation of these “forms” resembles the situation described in M. disticha (Nees Conert (Ellis, 1980. Populations of both M. stricta and M. disticha from the Drakensberg mountains display extensive anatomical diversification which appears to be correlated with environmental factors. In addition, morphological differences are exhibited as well and the anatomical “forms” of M. stricta probably warrant taxonomic recognition.

  4. Leaf anatomy of the South African Danthonieae (Poaceae. XV. The genus Elytrophorus

    Directory of Open Access Journals (Sweden)

    R. P. Ellis

    1986-10-01

    Full Text Available The leaf anatomy of  Elytrophorus globularis Hack, and  E. spicatus (Willd. A. Camus is described and illustrated from freshly fixed material from SWA/Namibia and Botswana. It is shown that these two species are anatomically indistinguishable. It is suggested that they are conspecific. and that  E. spicatus possibly represents juvenile plants with immature inflorescences. The anatomical evidence strongly refutes a chloridoid relationship for Elytrophorus but appears to support arundinoid affinities for the genus. Striking anatomical and ecological similarities exist between  Elytrophorus and  Sacciolepis huillensis (Rendle Stapf. No significant leaf anatomical differences separate  Elytrophorus from S.  huillensis and some of the other C3 panicoid taxa and. consequently,  Elytro­phorus may represent a link between the Arundinoideae and the Panicoideae.

  5. Studies upon morhological and biological traits of Festuca rubra, subsp.fallax (Poaceae

    Directory of Open Access Journals (Sweden)

    Bogusław Sawicki

    2013-12-01

    Full Text Available Observation and measurements of some traits of Festuca rubra L., subsp. fallax (Thuill. Hack. ecotypes were made in 1995-1997 using samples selected from natural habitats and collected in Grassland Experimental Station in Sosnowica. High differentiation of traits under study and their correlations were found. Valorized ecotypes are good material for new varieties breeding.

  6. Nota sobre EL GÉNERO Imperata (Poaceae, Panicoideae, Sacchareae en Argentina

    Directory of Open Access Journals (Sweden)

    Myriam C. Peichoto

    2013-01-01

    Full Text Available En este trabajo se confirma la presencia de Imperata tenuis en Argentina. Se presenta una ilustración, material de referencia y un mapa de su distribución geográfica en el sur de Sudamérica. Se incluye una clave para identificar las especies del género Imperata presentes en la Argentina.

  7. Characterization of 21 microsatellite markers from cogongrass, Imperata cylindrica (Poaceae), a weed species distributed worldwide.

    Science.gov (United States)

    Chiang, Yu-Chung; Tsai, Chi-Chu; Hsu, Tsai-Wen; Chou, Chang-Hung

    2012-11-01

    Microsatellite loci were developed from Imperata cylindrica, a traditional medicinal herb in Asia and among the top 10 worst invasive weeds in the world, to aid in the identification of the limits of asexual clonal individuals. A total of 21 microsatellite markers, including 18 polymorphic and three monomorphic loci, were developed from I. cylindrica using a magnetic bead enrichment protocol. The primers amplified dinucleotide, trinucleotide, and complex repeats. The number of alleles ranged from one to 19 per locus, with an observed heterozygosity ranging from 0.09 to 1.00. Several loci deviated significantly from the within-population Hardy-Weinberg equilibrium as a result of asexual clonal reproduction. These polymorphic markers should be useful tools in further studies on the identification of the range of clonal reproduction units and the selection and classification of the medicinal cultivar.

  8. The effect of the external medium on the gravitropic curvature of rice (Oryza sativa, Poaceae) roots

    Science.gov (United States)

    Staves, M. P.; Wayne, R.; Leopold, A. C.

    1997-01-01

    The roots of rice seedlings, growing in artificial pond water, exhibit robust gravitropic curvature when placed perpendicular to the vector of gravity. To determine whether the statolith theory (in which intracellular sedimenting particles are responsible for gravity sensing) or the gravitational pressure theory (in which the entire protoplast acts as the gravity sensor) best accounts for gravity sensing in rice roots, we changed the physical properties of the external medium with impermeant solutes and examined the effect on gravitropism. As the density of the external medium is increased, the rate of gravitropic curvature decreases. The decrease in the rate of gravicurvature cannot be attributed to an inhibition of growth, since rice roots grown in 100 Osm/m3 (0.248 MPa) solutions of different densities all support the same root growth rate but inhibit gravicurvature increasingly with increasing density. By contrast, the sedimentation rate of amyloplasts in the columella cells is unaffected by the external density. These results are consistent with the gravitational pressure theory of gravity sensing, but cannot be explained by the statolith theory.

  9. Characterization and multiplexing of EST-SSR primers in Cynodon (Poaceae) species1.

    Science.gov (United States)

    Jewell, Margaret C; Frere, Celine H; Prentis, Peter J; Lambrides, Christopher J; Godwin, Ian D

    2010-10-01

    Cynodon species are multiple-use grasses that display varying levels of adaptation to biotic and abiotic stress. Previously identified EST-SSR primers were characterized and multiplexed to assess the level of genetic diversity present within a collection of almost 1200 Cynodon accessions from across Australia. • Two multiplex reactions were developed comprising a total of 16 EST-SSR markers. All SSR markers amplified across different Cynodon species and different levels of ploidy. The number of alleles ranged from one to eight per locus and the total number of alleles for the germplasm collection was 79. • The 16 markers show sufficient variation for the characterization of Cynodon core collections and analysis of population genetic diversity in Cynodon grasses.

  10. The grasses (Poaceae) of the Colombian guayana: analyses on their composition, richness, endemism, and invasion

    International Nuclear Information System (INIS)

    Canas, Diego Giraldo

    2010-01-01

    The checklist of grasses from Colombian Guayana is presented. In all, 152 species, 69 genera, and six subfamilies were recorded. Thus, in the Colombian Guayana is represented the 18.7 and 43.7% of the species and genera of Colombian grasses, respectively. The subfamilies with the highest number of species were Panicoideae (110 species/46 genera), Chloridoideae (21/9), and Bambusoideae (11/9). The most diverse genera were Paspalum (19 species), Panicum (16), Axonopus (14), Eragrostis (9), and Digitaria (8). Nineteen species are introduced and naturalized in the Colombian Guayana, which represent 12.5% of the agrostological flora for the Colombian Guayana. There were 8 endemic species (5.3% of Colombian Guayanan grasses). In addition, some species are reported for the first time for Colombian flora (belonging to Axonopus, Cyphonanthus, Gymnopogon, and Paspalum), and some species are new to science (belonging to Axonopus, Digitaria, Eragrostis, and Sacciolepis). On the other hand, some preliminary biogeographical aspect are analyzed Flora of Colombia,

  11. The grasses (Poaceae) of the Colombian Guyana: analyses on their composition, richness, endemism, and invasion

    International Nuclear Information System (INIS)

    Giraldo Canas, Diego

    2010-01-01

    The checklist of grasses from Colombian Guyana is presented. In all, 152 species, 69 genera, and six subfamilies were recorded. Thus, in the Colombian Guyana is represented the 18.7 and 43.7% of the species and genera of Colombian grasses, respectively. The subfamilies with the highest number of species were Panicoideae (110 species/46 genera), Chloridoideae (21/9), and Bambusoideae (11/9). The most diverse genera were Paspalum (19 species), Panicum (16), Axonopus (14), Eragrostis (9), and Digitaria (8). Nineteen species are introduced and naturalized in the Colombian Guyana, which represent 12.5% of the agrostological flora for the Colombian Guyana. There were 8 endemic species (5.3% of Colombian Guayanan grasses). In addition, some species are reported for the first time for Colombian flora (belonging to Axonopus, Cyphonanthus, Gymnopogon, and Paspalum), and some species are new to science (belonging to Axonopus, Digitaria, Eragrostis, and Sacciolepis). On the other hand, some preliminary biogeographical aspect are analyzed.

  12. Embryo sac development in some representatives of the tribe Cynodonteae (Poaceae

    Directory of Open Access Journals (Sweden)

    A. Strydom

    1994-10-01

    Full Text Available Chloris virgata Sw., Cynodon dactylon (L. Pers., Harpochloa falx (L. f. Kuntze, and Tragus berteronianus Schult. have a Polygonum type of embryo sac development. Unreduced embryo sacs were found in Eustachys paspaloides (Vahl Lanza & Mattei,  Harpochloa falx, and  Rendlia altera (Rendle Chiov. Both facultative and obligate apomixis were observed. The Hieracium type of embryo sac development was observed in the aposporic specimens.

  13. El género Chloris Sw. (Poaceae: Chloridoideae) en México

    OpenAIRE

    Cerros-Tlatilpa, Rosa; Siqueiros Delgado, María Elena; Skendzic, Elizabeth M.

    2015-01-01

    En este estudio se reconocen 12 especies de Chloris para el territorio de la República. Cinco son cosmopolitas, cinco americanas y dos de ellas se restringen a México y E.U.A., una está en América y en Australia, mientras que C. truncata se reporta por primera vez de nuestro país. Chloris barbata, C. gayana y C. virgata son consideradas invasoras para el país. Se incluye una clave para su identificación, descripciones y mapas de distribución. El género ocupa una variedad de hábitats, desde zo...

  14. Embryo sac development in some representatives of the tribe Cynodonteae (Poaceae)

    OpenAIRE

    A. Strydom; J. J. Spies

    1994-01-01

    Chloris virgata Sw., Cynodon dactylon (L.) Pers., Harpochloa falx (L. f.) Kuntze, and Tragus berteronianus Schult. have a Polygonum type of embryo sac development. Unreduced embryo sacs were found in Eustachys paspaloides (Vahl) Lanza & Mattei,  Harpochloa falx, and  Rendlia altera (Rendle) Chiov. Both facultative and obligate apomixis were observed. The Hieracium type of embryo sac development was observed in the aposporic specimens.

  15. Ultraestructura del bambú Guadua paniculata (Poaceae: Bambusoideae de Costa Rica

    Directory of Open Access Journals (Sweden)

    Mayra Montiel

    2006-06-01

    Full Text Available Se evaluaron características ultraestructurales de la lámina y la bráctea de la hoja, así como de las ramas, de plantas adultas de Guadua paniculata recolectadas en Costa Rica. Sus características ultraestructurales diagnósticas incluyen el patrón celular de la zona adaxial de la lámina foliar, los largos tricomas unicelulares de la superficie abaxial, los más numerosos tricomas auriculares, agrupados en número de 17, el patrón de cera cuticular y las bandas de estomas rodeadas de papilas céricas.Sections of leaf lamina, leaf sheath and branches of adult Guadua paniculata collected in Costa Rica, were studied ultrastructurally. Diagnostic ultrastructural characteristics include the cellular pattern of the adaxial zone in the leaf blade; the large unicellular trichomes of the abaxial area, the more numerous auricular trichomes, grouped in number of 17, the pattern of cuticular wax and the bands of stomata surrounded by ceric papillae. Rev. Biol. Trop. 54(Suppl. 2: 29-34. Epub 2006 Dec. 01.

  16. Ultrastructural morphologic description of the wild rice species Oryza latifolia (Poaceae in Costa Rica

    Directory of Open Access Journals (Sweden)

    Ethel Sánchez

    2003-06-01

    Full Text Available The wild rice species Oryza latifolia is endemic to Tropical America, allotetraploid and has a CCDD genome type. It belongs to the officinalis group of the genus Oryza. This species is widely distributed through-out the lowlands of Costa Rica and it is found on different life zones, having great morphologic diversity. The purpose of this research is to perform a morphologic description of O. latifolia samples of three Costa Rican localities (Carara, Liberia and Cañas and to see if the phenotypic diversity of the species is reflected at the ultra-structure level. Structures such as the leaf blade, ligule, auricles and spikelet were analyzed. Leaf blade morphology of the specimens from the three localities is characterized by the presence of diamond-shaped stomata with papillae, zipper-like rows of silica cells; a variety of evenly distributed epicuticular wax papillae and bulky prickle trichomes. The central vein of the leaf blade from the Cañas populations is glabrous, while those from Carara and Liberia have abundant papillae. There are also differences among the borders of the leaf blade between these locations. Cañas and Liberia present alternating large and small prickle trichomes ca. 81 and 150 µm, while Carara exhibits even sized prickle trichomes of ca. 93 µm. Auricles from Cañas are rectangular and present long trichomes along the surface ca. 1.5 mm, while those of Liberia and Carara wrap the culm and exhibit trichomes only in the borders. The ligule from the plants of Carara has an acute distal tip, while that of Cañas and Liberia is blunt. The Liberia spikelet has large lignified spines while Cañas and Carara show flexible trichomes.La especie silvestre Oryza latifolia es endémica de América, tetraploide y de genoma CCDD. Pertenece a las especies del género Oryza del grupo officinalis. Presenta una amplia distribución en las tierras bajas de Costa Rica y se le encuentra en varias zonas de vida, mostrando una gran diversidad morfológica. El propósito de este trabajo fue realizar una descripción ultraestructural de plantas de O. latifolia provenientes de las localidades Carara, Liberia y Cañas con el fin de determinar si hay variación intrapo-blacional. Se analizó la lámina foliar, lígula, aurículas y espiguilla, con énfasis en las estructuras de valor taxonómico. La morfología de la lámina foliar de los especímenes de las tres localidades se caracteriza por la presencia de estomas romboidales con papilas, células de sílice de forma crenada, variedad de papilas de cera, distribuidas en forma regular y tricomas espinosos abultados de ca 53 µm. La vena central de la lámina foliar de O. latifolia, localidad Cañas, es lisa, mientras que en Carara y Liberia presenta papilas. Los bordes de la lámina foliar difieren entre localidades; Cañas y Liberia presentan tricomas ganchudos grandes de ca. 150 µm y pequeños de ca 81 µm que alternan, mientras que Carara tiene tricomas ganchudos pequeños de igual tamaño (ca. 93 µm. Las aurículas de Cañas son rectangulares y presentan tricomas atenuados largos de ca. 1.5mm en toda la superficie, mientras las de Liberia y Carara son envolventes y presentan dichos tricomas solamente en los bordes. La lígula de Carara tiene el extremo distal agudo, mientras que Cañas y Liberia lo tienen truncado. La espiguilla de Liberia presenta tricomas espinosos lignificados grandes, mientras que Cañas y Carara tienen tricomas flexibles.

  17. Ultraestructura del bambú Guadua angustifolia var. bicolor (Poaceae: Bambusoideae, presente en Costa Rica

    Directory of Open Access Journals (Sweden)

    Mayra Montiel

    2006-06-01

    Full Text Available Se estudió la ultraestructura anatómica de la lámina y la vaina de la hoja, así como de la bráctea del culmo, de Guadua angustifolia var. bicolor, por medio del microscopio electrónico de barrido. Se encontraron similitudes con otras guaduas: estomas de alto domo, células largas con paredes sinuosas y células de sílice. Son propios de la var. bicolor el patrón estomático en la zona abaxial de la hoja cerca de la vaina, con la presencia de gran cantidad de tricomas ganchudos y sin papilas; las brácteas de color café dorado que cubren los culmos y tienen tricomas papilares que cubren el haz; y el abundante número de tricomas auriculares, en grupos de 12.The anatomy of several parts of Guadua angustifolia var. bicolor was analyzed and characterized under a scanning electron icroscope. any similarities ere observed with other Guadua species, particularly the presence of high dome stomata, of large cells with sinuous walls and of silica cells. Specific bicolor characteristics include (1 a different stomatal pattern in the adaxial zone of the leaf base (close to the sheath; (2 the abundance of hook-sshaped trichomes without papilla; (3 the distinctive golden brown color of the bract that covers the culm (caused by papillar trichomes that cover the adaxial sheath; and (4 the size of the groups of auricular trichomes (formed by 12 trichomes. Rev. Biol. Trop. 54(Suppl. 2: 13-19. Epub 2006 Dec. 01.

  18. LAS ESPECIES COLOMBIANAS DEL GÉNERO DIGITARIA (POACEAE: PANICOIDEAE: PANICEAE

    Directory of Open Access Journals (Sweden)

    GIRALDO-CAÑAS DIEGO

    2005-06-01

    Full Text Available Se presenta un estudio sistemático, macro y micromorfológico de las especies colombianas del género Digitaria. Se analizan diversos aspectos relativos a la clasificación, la nomenclatura, las afinidades genéricas y la variación macro y micromorfológica de los caracteres, así como algunos aspectos anatómicos de la espiguilla y el antecio superior. El género Digitaria está representado en Colombia por 18 especies distribuidas en cinco secciones: Digitaria sect. Calvulae (una especie, Digitaria sect. Digitaria (siete especies, Digitaria sect. Ischaemum (tres especies, Digitaria sect. Ternatae (cuatro especies y Digitaria sect. Trichachne (tres especies. Dos especies son endémicas de Colombia (Digitaria cardenasiana y Digitaria andicola. Las especies Digitaria argillacea, Digitaria neesiana y Digitaria fragilis se excluyen de la flora de Colombia. Se presentan las claves para reconocer las secciones y las especies presentes en Colombia, así como también las descripciones de éstas, la iconografía, los usos, los nombres vulgares, la distribución geográfica y se comentan algunas observaciones morfológicas y ecológicas. Se documenta la presencia de espiguillas trifloras en el género Digitaria, situación observada en las especies Digitaria dioica y Digitaria nuda.

  19. Meristem identity and phyllotaxis in inflorescence development

    Directory of Open Access Journals (Sweden)

    Madelaine Elisabeth Bartlett

    2014-10-01

    Full Text Available Inflorescence morphology is incredibly diverse. This diversity of form has been a fruitful source of inquiry for plant morphologists for more than a century. Work in the grasses (Poaceae, the tomato family (Solanaceae, and Arabidopsis (Brassicaceae has led to a richer understanding of the molecular genetics underlying this diversity. The character of individual meristems, a combination of the number (determinacy and nature (identity of the products a meristem produces, is key in the development of plant form. A framework that describes inflorescence development in terms of shifting meristem identities has emerged and garnered empirical support in a number of model systems. We discuss this framework and highlight one important aspect of meristem identity that is often considered in isolation, phyllotaxis. Phyllotaxis refers to the arrangement of lateral organs around a central axis. The development and evolution of phyllotaxis in the inflorescence remains underexplored, but recent work analyzing early inflorescence development in the grasses identified an evolutionary shift in primary branch phyllotaxis in the Pooideae. We discuss the evidence for an intimate connection between meristem identity and phyllotaxis in both the inflorescence and vegetative shoot, and touch on what is known about the establishment of phyllotactic patterns in the meristem. Localized auxin maxima are instrumental in determining the position of lateral primordia. Upstream factors that regulate the position of these maxima remain unclear, and how phyllotactic patterns change over the course of a plant’s lifetime and evolutionary time, is largely unknown. A more complete understanding of the molecular underpinnings of phyllotaxis and architectural diversity in inflorescences will require capitalizing on the extensive resources available in existing genetic systems, and developing new model systems that more fully represent the diversity of plant morphology.

  20. Meristem identity and phyllotaxis in inflorescence development.

    Science.gov (United States)

    Bartlett, Madelaine E; Thompson, Beth

    2014-01-01

    Inflorescence morphology is incredibly diverse. This diversity of form has been a fruitful source of inquiry for plant morphologists for more than a century. Work in the grasses (Poaceae), the tomato family (Solanaceae), and Arabidopsis thaliana (Brassicaceae) has led to a richer understanding of the molecular genetics underlying this diversity. The character of individual meristems, a combination of the number (determinacy) and nature (identity) of the products a meristem produces, is key in the development of plant form. A framework that describes inflorescence development in terms of shifting meristem identities has emerged and garnered empirical support in a number of model systems. We discuss this framework and highlight one important aspect of meristem identity that is often considered in isolation, phyllotaxis. Phyllotaxis refers to the arrangement of lateral organs around a central axis. The development and evolution of phyllotaxis in the inflorescence remains underexplored, but recent work analyzing early inflorescence development in the grasses identified an evolutionary shift in primary branch phyllotaxis in the Pooideae. We discuss the evidence for an intimate connection between meristem identity and phyllotaxis in both the inflorescence and vegetative shoot, and touch on what is known about the establishment of phyllotactic patterns in the meristem. Localized auxin maxima are instrumental in determining the position of lateral primordia. Upstream factors that regulate the position of these maxima remain unclear, and how phyllotactic patterns change over the course of a plant's lifetime and evolutionary time, is largely unknown. A more complete understanding of the molecular underpinnings of phyllotaxis and architectural diversity in inflorescences will require capitalizing on the extensive resources available in existing genetic systems, and developing new model systems that more fully represent the diversity of plant morphology.

  1. Comparative analyses reveal potential uses of Brachypodium distachyon as a model for cold stress responses in temperate grasses

    Directory of Open Access Journals (Sweden)

    Li Chuan

    2012-05-01

    Full Text Available Abstract Background Little is known about the potential of Brachypodium distachyon as a model for low temperature stress responses in Pooideae. The ice recrystallization inhibition protein (IRIP genes, fructosyltransferase (FST genes, and many C-repeat binding factor (CBF genes are Pooideae specific and important in low temperature responses. Here we used comparative analyses to study conservation and evolution of these gene families in B. distachyon to better understand its potential as a model species for agriculturally important temperate grasses. Results Brachypodium distachyon contains cold responsive IRIP genes which have evolved through Brachypodium specific gene family expansions. A large cold responsive CBF3 subfamily was identified in B. distachyon, while CBF4 homologs are absent from the genome. No B. distachyon FST gene homologs encode typical core Pooideae FST-motifs and low temperature induced fructan accumulation was dramatically different in B. distachyon compared to core Pooideae species. Conclusions We conclude that B. distachyon can serve as an interesting model for specific molecular mechanisms involved in low temperature responses in core Pooideae species. However, the evolutionary history of key genes involved in low temperature responses has been different in Brachypodium and core Pooideae species. These differences limit the use of B. distachyon as a model for holistic studies relevant for agricultural core Pooideae species.

  2. An empirical test of the treatment of indels during optimization alignment based on the phylogeny of the genus Secale (Poaceae)

    DEFF Research Database (Denmark)

    Petersen, Gitte; Seberg, Ole; Aagesen, Lone

    2004-01-01

    The ability of the program POY, implementing optimization alignment, to deal with major indels is explored and discussed in connection with a phylogenetic analysis of the genus Secale based on partial Adhl sequences. The Adhl sequences used span exon 2-4. Nearly all variation is found in intron 2...... recovers both genera as monophyletic when knowledge of the duplication is incorporated in the analysis. The phylogenetic relationships within Secale are not clearly resolved. Subspecific taxa of Secale strictum have identical sequences and they are confined to a monophyletic group. However, the two...

  3. New additions to the Flora of Ethiopia and Eritrea in the families Euphorbiaceae, Fabaceae (Leguminosae), Lamiaceae, Campanulaceae, Eriocaulaceae and Poaceae

    DEFF Research Database (Denmark)

    Friis, Ib; Phillips, Sylvia M.; Gilbert, Michael G.

    2011-01-01

    During recent field work by Ib Friis and Sally Bidgood six collections were collected that did not represent taxa accounted for in the Flora of Ethiopia and Eritrea. These were Phyllanthus chevalieri, Indigofer bracteolata, Wahlenbergia paludicola, Clerodendrum triflorum, Tragus mongolorum and Hy...

  4. Autotetraploidia e número cromossómico em uma cultivar de Panicum maximum Jacq. (Gramineae / Poaceae

    Directory of Open Access Journals (Sweden)

    Caetano Creuci Maria

    2006-06-01

    Full Text Available

    O presente trabalho teve por objetivo avaliar o comportamento citológico e em especial o nível de ploidia de uma cultivar de P. maximum, denomi­nada Tanzânia, que, na realidade, é um ecótipo selvagem de origem africana. Foi empregada a metodologia convencional para estudos meióticos. As inflorescências foram fixadas em álcool acético 3:1 por 24 horas, transferidas para álcool a 70% e conservadas sob refrigeração. A técnica de esmaga­mento foi usada no preparo das lâminas. O corante foi o carmim propiônico a 1%. Foi considerado um mínimo de 200 células por planta. De forma geral, anormalidades meióticas ocorreram em 20% das células mães de pólen analisadas. Em todas as plantas avaliadas, o número de cromossomos observado nas diacineses foi 36. Entre 109 diacineses onde se realizou a contagem do número de cromossomos e se verificou os tipos de associações cromossômicas, 99 apresentaram multivalentes, com predomínio de tetravalentes. Tal ocorrência indica autotetraploidia, onde 2n=4x=36.

    Palavras-chave: associações cromossômicas multivalentes, autotetraplóide, cv. Tanzânia, número cromossômico.

  5. Variation in leaf anatomy within the Elytrigia intermedia – E. ×mucronata – E. repens (Poaceae) hybrid complex

    Czech Academy of Sciences Publication Activity Database

    Paštová, Ladislava

    2017-01-01

    Roč. 23, č. 2 (2017), s. 187-198 ISSN 1310-7771 Institutional support: RVO:67985939 Keywords : hybrid * leaf blade selection * micromorphology Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany

  6. Retroelement insertional polymorphisms, diversity and phylogeography within diploid, D-genome Aegilops tauschii (Triticeae, Poaceae) sub-taxa in Iran.

    Science.gov (United States)

    Saeidi, Hojjatollah; Rahiminejad, Mohammad Reza; Heslop-Harrison, J S

    2008-04-01

    The diploid goat grass Aegilops tauschii (2n = 2x = 14) is native to the Middle East and is the D-genome donor to hexaploid bread wheat. The aim of this study was to measure the diversity of different subspecies and varieties of wild Ae. tauschii collected across the major areas where it grows in Iran and to examine patterns of diversity related to the taxa and geography. Inter-retroelement amplified polymorphism (IRAP) markers were used to analyse the biodiversity of DNA from 57 accessions of Ae. tauschii from northern and central Iran, and two hexaploid wheats. Key Results Eight IRAP primer combinations amplified a total of 171 distinct DNA fragments between 180 and 3200 bp long from the accessions, of which 169 were polymorphic. On average, about eight fragments were amplified with each primer combination, with more bands being amplified from accessions from the north-west of the country than from other accessions. The IRAP markers showed high levels of genetic diversity. Analysis of all accessions together did not allow the allocation of individuals to taxa based on morphology, but showed a tendency to put accessions from the north-west apart from others regions. It is speculated that this could be due to different activity of retroelements in the different regions. Within the two taxa with most accessions, there was a range of IRAP genotypes that could be correlated closely with geographical origin. This supports suggestions that the centre of origin of the species is towards the south-east of the Caspian Sea. IRAP is an appropriate marker system to evaluate genetic diversity and evolutionary relationships within the taxa, but it is too variable to define the taxa themselves, where more slowly evolving morphological, DNA sequence or chromosomal makers may be more appropriate.

  7. Hypoglycemic activity of polysaccharide fractions containing ß-glucans from extracts of Rhynchelytrum repens (Willd. C.E. Hubb., Poaceae

    Directory of Open Access Journals (Sweden)

    A.C.C.F.F. De Paula

    2005-06-01

    Full Text Available ß-Glucans are soluble fibers with physiological functions, such as interference with absorption of sugars and reduction of serum lipid levels. The objective of the present study was to analyze the distribution of ß-glucans in different tissues of the African grass species Rhynchelytrum repens and also to evaluate their hypoglycemic activity. Leaf blades, sheaths, stems, and young leaves of R. repens were submitted to extraction with 4 M KOH. Analysis of the fractions revealed the presence of arabinose, glucose, xylose, and traces of rhamnose and galactose. The presence of ß-glucan in these fractions was confirmed by hydrolyzing the polymers with endo-ß-glucanase from Bacillus subtilis, followed by HPLC analysis of the characteristic oligosaccharides produced. The 4 M KOH fractions from different tissues were subjected to gel permeation chromatography on Sepharose 4B, with separation of polysaccharides with different degrees of polymerization, the highest molecular mass (above 2000 kDa being found in young leaves. The molecular mass of the leaf blade polymers was similar (250 kDa to that of maize coleoptile ß-glucan used for comparison. The 4 M KOH fraction injected into rats with streptozotocin-induced diabetes showed hypoglycemic activity, reducing blood sugar to normal levels for approximately 24 h. This performance was better than that obtained with pure ß-glucan from barley, which decreased blood sugar levels for about 4 h. These results suggest that the activity of ß-glucans from R. repens is responsible for the use of this plant extract as a hypoglycemic drug in folk medicine.

  8. Taxonomy and leaf anatomy of the genus Ehrharta (Poaceae) in southern Africa: the Dura group

    OpenAIRE

    G. E. Gibbs Russel; R. P. Ellis

    1988-01-01

    The Dura species group in the genus Ehrharta Thunb. is differentiated morphologically by the perennial habit and the very large, awned, subglabrous spikelets and anatomically by the occurrence of tanniniferous cells and wax platelets obscuring the stomatal pores. The Dura group consists of two species, E. dura Nees ex Trin. and E. microlaena Nees ex Trin., which occur only in Mountain Fynbos. The group shows no clear morphological or anatomical relationship with other species groups in the ge...

  9. Calamagrostis nyingchiensis, a new combination for Deyeuxia nyingchiensis (Poaceae: Agrostidinae, and its first record from Yunnan Province, SW China

    Directory of Open Access Journals (Sweden)

    Paszko Beata

    2016-07-01

    Full Text Available Deyeuxia nyingchiensis is here recombined as Calamagrostis nyingchiensis comb. nov. as a result of recent studies of worldwide Agrostidinae. A new record of C. nyingchiensis is reported from Shangri-la (Zhongdian County in Yunnan Province, SW China. Previously, C. nyingchiensis was noted from eastern Xizang and southern Sichuan, SW China. It is compared with the morphologically similar species C. scabrescens. A map with all known geographic records of C. nyingchiensis is presented.

  10. Ultraestructura de bambúes del género Dendrocalamus (Poaceae: Bambusoideae cultivados en Costa Rica I: Dendrocalamus latiflorus

    Directory of Open Access Journals (Sweden)

    Mayra Montiel

    2006-06-01

    Full Text Available Utilizando el microscopio electrónico de barrido, se evaluaron ultraestructuralmente, culmo joven (dos años de edad, brácteas del culmo, yemas, superficie abaxial de la lámina foliar y flores de Dendrocalamus latiflorus, un bambú susceptible a cambios bruscos de temperatura y precipitación, que lo hacen florecer con facilidad. Los rasgos más notables fueron la presencia de dos tipos de células operculadas en las glumas estériles de las flores, la abundancia de cera cuticular, la presencia de puntuaciones reticuladas en el xilema y los granos de polen especializados, por la presencia de discos o ventosas para su acople. Las células operculadas y los discos de acople son caracteres taxonómicos importantes.The bamboo Dendrocalamus latiflorus is easily affected by sudden changes in temperature and humidity, which cause it to bloom. We used a scanning electron microscope to describe the ultrastructure of young culm (2 years old, culm bracts, buds, abaxial surface of the leaf lamina and flowers. The most noticeable ultrastructural features were the presence of two types of operculated cells in the sterile flower glums, the abundant cuticular wax, the presence of reticulated punctuations in the xylem and pollen grains with interlocking disks or cups. The operculated cells and the interlocking disks are taxonomically important features. Rev. Biol. Trop. 54(Suppl. 2: 43-50. Epub 2006 Dec. 01.

  11. Clothianidin and Imidacloprid Residues in Poa annua (Poales: Poaceae) and Their Effects on Listronotus maculicollis (Coleoptera: Curculionidae).

    Science.gov (United States)

    Clavet, Christopher; Requintina, Matthew; Hampton, Emily; Cowles, Richard S; Byrne, Frank J; Alm, Steven R

    2014-12-01

    Competitive enzyme-linked immunosorbent assay was used to quantify the amounts of the neonicotinoids clothianidin and imidacloprid in Poa annua L. clippings from treated golf course fairways. Average clothianidin residues 7 d after application ranged from 674 to 1,550 ng/g tissue in 2012 and 455-2,220 ng/g tissue in 2013. Average clothianidin residues the day of application ranged from 17,100-38,800 ng/g tissue in 2014. Average imidacloprid residues 7 d after treatment ranged from 1,950-3,030 ng/g tissue in 2012 and 7,780-9,230 ng/g tissue in 2013. Average imidacloprid residues the day of application ranged from 31,500-40,400 ng/g tissue in 2014. Neonicotinoid or bifenthrin-neonicotinoid combination products applied in field plots in 2012 did not significantly reduce the numbers of larvae relative to the untreated control. However, in 2013, statistically significant reductions in the numbers of larvae recovered from treated field plots were associated with the presence of bifenthrin alone or when used in combination with neonicotinoid active ingredients. Listronotus maculicollis (Kirby) adults caged on neonicotinoid-, bifenthrin-, and bifenthrin-neonicotinoid-treated P. annua turf plugs fed on P. annua leaves, but mortality was only highly significantly different between treated and untreated foliage when weevils were placed on treated foliage the day after treatment and allowed to feed for 7 d. The modest degree of population suppression with bifenthrin in these experiments may not be adequate to justify the continued use of these products due to the increased risk of insecticide resistance and disruption of biological control. © 2014 Entomological Society of America.

  12. Evolutionary dynamics of the Pgk1 gene in the polyploid genus Kengyilia (Triticeae: Poaceae and its diploid relatives.

    Directory of Open Access Journals (Sweden)

    Xing Fan

    Full Text Available The level and pattern of nucleotide variation in duplicate gene provide important information on the evolutionary history of polyploids and divergent process between homoeologous loci within lineages. Kengyilia is a group of allohexaploid species with the StYP genomic constitutions in the wheat tribe. To investigate the evolutionary dynamics of the Pgk1 gene in Kengyilia and its diploid relatives, three copies of Pgk1 homoeologues were isolated from all sampled hexaploid Kengyilia species and analyzed with the Pgk1 sequences from 47 diploid taxa representing 18 basic genomes in Triticeae. Sequence diversity patterns and genealogical analysis suggested that (1 Kengyilia species from the Central Asia and the Qinghai-Tibetan plateau have independent origins with geographically differentiated P genome donors and diverged levels of nucleotide diversity at Pgk1 locus; (2 a relatively long-time sweep event has allowed the Pgk1 gene within Agropyron to adapt to cold climate triggered by the recent uplifts of the Qinghai-Tibetan Plateau; (3 sweep event and population expansion might result in the difference in the d(N/d(S value of the Pgk1 gene in allopatric Agropyron populations, and this difference may be genetically transmitted to Kengyilia lineages via independent polyploidization events; (4 an 83 bp MITE element insertion has shaped the Pgk1 loci in the P genome lineage with different geographical regions; (5 the St and P genomes in Kengyilia were donated by Pseudoroegneria and Agropyron, respectively, and the Y genome is closely related to the Xp genome of Peridictyon sanctum. The interplay of evolutionary forces involving diverged natural selection, population expansion, and transposable events in geographically differentiated P genome donors could attribute to geographical differentiation of Kengyilia species via independent origins.

  13. A phylogenetic analysis of the genus Psathyrostachys (Poaceae) based on one nuclear gene, three plastid genes, and morphology

    DEFF Research Database (Denmark)

    Petersen, Gitte; Seberg, Ole; Baden, Claus

    2004-01-01

    A phylogenetic analysis of the small, Central Asian genus Psathyrostachys Nevski is presented. The analysis is based on morphological characters and nucleotide sequence data from one nuclear gene, DMC1, and three plastid genes, rbcL, rpoA, and rpoC2. Separate analyses of the three data partitions...... (morphology, nuclear sequences, and plastid sequences) result in mostly congruent trees. The plastid and nuclear sequences produce completely congruent trees, and only the trees based on plastid sequences and morphological characters are incongruent. Combined analysis of all data results in a fairly well......-resolved strict consensus tree: Ps. rupestris is the sister to the remaining species, which are divided into two clades: one including Ps. fragilis and Ps. caduca, the other including Ps. juncea, Ps. huashanica, Ps. lanuginosa, Ps. stoloniformis, and Ps. kronenburgii. Pubescent culms and more than 20 mm long...

  14. High degree of genetic diversity among genotypes of the forage grass Brachiaria ruziziensis (Poaceae) detected with ISSR markers.

    Science.gov (United States)

    Azevedo, A L S; Costa, P P; Machado, M A; de Paula, C M P; Sobrinho, F S

    2011-11-17

    The grasses of the genus Brachiaria account for 80% of the cultivated pastures in Brazil. Despite its importance for livestock production, little information is available for breeding purposes. Embrapa has a population of B. ruziziensis from different regions of Brazil, representing most of existing variability. This population was used to initiate an improvement program based on recurrent selection. In order to assist the genetic improvement program, we estimated the molecular variability among 93 genotypes of Embrapa's collection using ISSR (inter-simple sequence repeat) markers. DNA was extracted from the leaves. Twelve ISSR primers generated 89 polymorphic bands in the 93 genotypes. The number of bands identified by each primer ranged from two to 13, with a mean of 7.41. Cluster analysis revealed a clearly distinct group, containing most of the B. ruziziensis genotypes apart from the outgroup genotypes. Genetic similarity coefficients ranged from 0.0 to 0.95, with a mean of 0.50 and analysis of molecular variance indicated higher variation within (73.43%) than among species (26.57%). We conclude that there is a high genetic diversity among these B. ruziziensis genotypes, which could be explored by breeding programs.

  15. Molecular diversity and population structure of the forage grass Hemarthria compressa (Poaceae) in south China based on SRAP markers.

    Science.gov (United States)

    Huang, L-K; Zhang, X-Q; Xie, W-G; Zhang, J; Cheng, L; Yan, H D

    2012-08-16

    Hemarthria compressa is one of the most important and widely utilized forage crops in south China, owing to its high forage yield and capability of adaptation to hot and humid conditions. We examined the population structure and genetic variation within and among 12 populations of H. compressa in south China using sequence-related amplified polymorphism (SRAP) markers. High genetic diversity was found in these samples [percentage polymorphic bands (PPB) = 82.21%, Shannon's diversity index (I) = 0.352]. However, there was relatively low level of genetic diversity at the population level (PPB = 29.17%, I = 0.155). A high degree of genetic differentiation among populations was detected based on other measures and molecular markers (Nei's genetic diversity analysis: G(ST) = 54.19%; AMOVA analysis: F(ST) = 53.35%). The SRAP markers were found to be more efficient than ISSR markers for evaluating population diversity. Based on these findings, we propose changes in sampling strategies for appraising and utilizing the genetic resources of this species.

  16. Linkage Maps of a Mediterranean x Continental Tall Fescue Population and their Comparative Analysis with Other Poaceae Species

    Czech Academy of Sciences Publication Activity Database

    Dierking, R.; Azhaguvel, P.; Kallenbach, R.; Saha, M.; Bouton, J.; Chekhovskiy, K.; Kopecký, David; Hopkins, A.

    2015-01-01

    Roč. 8, č. 1 (2015) ISSN 1940-3372 Institutional support: RVO:61389030 Keywords : FESTUCA-ARUNDINACEA SCHREB. * DIVERSITY ARRAYS TECHNOLOGY * SIMPLE SEQUENCE REPEATS Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.509, year: 2015

  17. Genetic diversity analysis of the durum wheat Graziella Ra, Triticum turgidum L. subsp. durum (Desf. Husn. (Poales, Poaceae

    Directory of Open Access Journals (Sweden)

    M. Stella Colomba

    2011-06-01

    Full Text Available For the first time, the durum wheat Graziella Ra was compared to four Italian durum wheat varieties (Cappelli,Grazia, Flaminio and Svevo and to Kamut in order to preliminary characterize its genome and to investigategenetic diversity among and within the accessions by Amplified Fragment Length Polymorphisms (AFLPs,Simple Sequence Repeats (SSRs and α-gliadin gene sequence analysis. The main aim of the study was anattempt to determine the relationship between the historic accession Graziella Ra and Kamut which isconsidered an ancient relative of the durum subspecies. In addition, nutritional factors of Graziella Ra werereported. Obtained results showed that (i both AFLP and SSR molecular markers detected highly congruentpatterns of genetic diversity among the accessions showing nearly similar efficiency; (ii for AFLPs,percentage of polymorphic loci within accession ranged from 6.57% to 19.71% (mean 12.77% and, for SSRs,from 0% to 57.14% (mean 28.57%; (iii principal component analysis (PCA of genetic distance amongaccessions showed the first two axes accounting for 58.03% (for AFLPs and 61.60% (for SSRs of the totalvariability; (iv for AFLPs, molecular variance was partitioned into 80% (variance among accessions and 20%(within accession and, for SSRs, into 73% (variance among accessions and 27% (within accession; (vcluster analysis of AFLP and SSR datasets displayed Graziella Ra and Kamut into the same cluster; and (vimolecular comparison of α-gliadin gene sequences showed Graziella Ra and Kamut in separate clusters. Allthese findings indicate that Graziella Ra, although being very similar to Kamut, at least in the little part of thegenome herein investigated by molecular markers, may be considered a distinct accession showing appreciablelevels of genetic diversity and medium-high nutritional qualities.

  18. INSECTICIDAL ACTIVITIES OF ESSENTIAL OILS EXTRACTED FROM THREE SPECIES OF POACEAE ON ANOPHELES GAMBIAE SPP, MAJOR VECTOR OF MALARIA

    Directory of Open Access Journals (Sweden)

    Dominique C. K. Sohounhloué

    2010-12-01

    Full Text Available In this paper, the insecticidal activities on Anopheles gambiae spp of the essential oils (EO extracted from the dry leaves of some species collected in Benin were studied. The essential oil yields are 2.8, 1.7 and 1.4�0respectively for Cymbopogon schoanenthus (L. Spreng (CS, Cymbopogon citratus Stapf. (CC and Cymbopogon giganteus (Hochst. Chiov (CG. The GC/MS analysis showed that the EO of CS had a larger proportion in oxygenated monoterpenes (86.3�20whereas those of the sheets of CC and CG are relatively close proportions (85.5�0and 82.7�0respectively with. The piperitone (68.5�  2-carene (11.5� and -eudesmol (4.6�20are the major components of the EO of CS while trans para-mentha-1(7,8-dien-2-ol (31.9� trans para-mentha-2,8-dien-1-ol (19.6� cis para-mentha-2,8-dien-1-ol (7.2� trans piperitol (6.3�20and limonene (6.3�20prevailed in the EO of CG. The EO of CC revealed a rich composition in geranial (41.3� neral (33� myrcene (10.4� and geraniol (6.6� The biological tests have shown that these three EO induced 100�0mortality of Anopheles gambiae to 1.1, 586.58 and 1549 µg•cm-2 respectively for CC, CS and CG. These effects are also illustrated by weak lethal concentration for 50�0anopheles population (CC: 0.306; CS: 152.453 and CG: 568.327 µg•cm-2 in the same order of reactivity. The EO of CC appeared most active on two stocks (sensitive and resistant of Anopheles gambiae.

  19. Effect of genotype and environment on branching in weedy green millet (Setaria viridis) and domesticated foxtail millet (Setaria italica) (Poaceae).

    Science.gov (United States)

    Doust, Andrew N; Kellogg, Elizabeth A

    2006-04-01

    Many domesticated crops are derived from species whose life history includes weedy characteristics, such as the ability to vary branching patterns in response to environmental conditions. However, domesticated crop plants are characterized by less variable plant architecture, as well as by a general reduction in vegetative branching compared to their progenitor species. Here we examine weedy green millet and its domesticate foxtail millet that differ in the number of tillers (basal branches) and axillary branches along each tiller. Branch number in F(2:3) progeny of a cross between the two species varies with genotype, planting density, and other environmental variables, with significant genotype-environment interactions (GEI). This is shown by a complex pattern of reaction norms and by variation in the pattern of significant quantitative trait loci (QTL) amongst trials. Individual and joint analyses of high and low density trials indicate that most QTL have significant GEI. Dominance and epistasis also explain some variation in branching. Likely candidate genes underlying the QTL (based on map position and phenotypic effect) include teosinte branched1 and barren stalk1. Phytochrome B, which has been found to affect response to shading in other plants, explains little or no variation. Much variation in branching is explained by QTL that do not have obvious candidate genes from maize or rice.

  20. Cytogenetic evidence for genome elimination during microsporogenesis in interspecific hybrid between Brachiaria ruziziensis and B. brizantha (Poaceae

    Directory of Open Access Journals (Sweden)

    Andréa Beatriz Mendes-Bonato

    2006-01-01

    Full Text Available Microsporogenesis was analyzed in an interspecific hybrid between an artificially tetraploidized sexual accession of Brachiaria ruziziensis (R genome and a natural apomictic tetraploid accession of B. brizantha (B genome. Chromosomes associated predominantly as bivalents. From this phase to the end of meiosis, chromosomes presented irregular segregation and abnormal arrangement in the metaphase plate. During metaphase I, in 27.8% of meiocytes, bivalents were distributed in two metaphase plates. In anaphase I, two distinct and typical bipolar spindles were formed. In 29.7% of pollen mother cells, one genome did not divide synchronically, with chromosomes lagging behind or not segregating at all. The second division was very irregular, resulting in polyads. Based on previous results from analysis of a triploid hybrid between these species, where the R genome was eliminated by asynchrony during meiosis, it is suggested that the laggard genome in this hybrid also belongs to B. ruziziensis.

  1. Evidence for distinct roles of the SEPALLATA gene LEAFY HULL STERILE1 in Eleusine indica and Megathyrsus maximus (Poaceae).

    Science.gov (United States)

    Reinheimer, Renata; Malcomber, Simon T; Kellogg, Elizabeth A

    2006-01-01

    LEAFY HULL STERILE1 (LHS1) is an MIKC-type MADS-box gene in the SEPALLATA class. Expression patterns of LHS1 homologs vary among species of grasses, and may be involved in determining palea and lemma morphology, specifying the terminal floret of the spikelet, and sex determination. Here we present LHS1 expression data from Eleusine indica (subfamily Chloridoideae) and Megathyrsus maximus (subfamily Panicoideae) to provide further insights into the hypothesized roles of the gene. E. indica has spikelets with three to eight florets that mature acropetally; E. indica LHS1 (EiLHS1) is expressed in the palea and lemma of all florets. In contrast, M. maximus has spikelets with two florets that mature basipetally; M. maximus LHS1 (MmLHS1) is expressed in the palea and lemma of the distal floret only. These data are consistent with the hypothesis that LHS1 plays a role in determining palea and lemma morphology and specifies the terminal floret of basipetally maturing grass spikelets. However, LHS1 expression does not correlate with floret sex expression; MmLHS1 is restricted to the bisexual distal floret, whereas EiLHS1 is expressed in both sterile and bisexual floret meristems. Phylogenetic analyses reconstruct a complex pattern of LHS1 expression evolution in grasses. LHS1 expression within the gynoecium has apparently been lost twice, once before diversification of a major clade within tribe Paniceae, and once in subfamily Chloridoideae. These data suggest that LHS1 has multiple roles during spikelet development and may have played a role in the diversification of spikelet morphology.

  2. Inheritance of resistance to anti-microtubule dinitroaniline herbicides in an "intermediate" resistant biotype of Eleusine indica (Poaceae).

    Science.gov (United States)

    Zeng, L; Baird, W V

    1999-07-01

    Inheritance of resistance to the anti-microtubule dinitroaniline herbicides was investigated in a goosegrass biotype displaying an intermediate level of resistance (I). Reciprocal crosses were made between the I biotype and previously characterized susceptible (S) or resistant (R) biotypes. Eight F(1) hybrids were identified, and F(2) populations were produced by selfing. The dinitroaniline-herbicide response phenotype (DRP) of F(1) plants, and F(2) seedlings was determined using a root-growth bioassay. The DRP of F(1) plants of S × I was "susceptible" (i.e., identical to the S parental plants), and the DRP of F(1) plants of I × R was "intermediate" (i.e., identical to the I parental plants). Nonparental phenotypes were not observed in F(1) plants. Results indicated susceptibility to be dominant over intermediate resistance and intermediate resistance to be dominant over high resistance. Analysis of reciprocal crosses ruled out any role for cytoplasmic inheritance. When treated at the discriminating concentration (e.g., 0.28 ppm oryzalin), F(2) seedlings of S × I were classified as either S or I phenotype, and F(2) seedlings of I × R were classified as either I or R phenotype. Again, nonparental phenotypes were not observed. The 3:1 (S:I or I:R) segregation ratios in F(2) seedlings were consistent across all eight F(2) families. The results show that dinitroaniline herbicide resistance in the I biotype of goosegrass is inherited as a single, nuclear gene. Furthermore, it suggests that dinitroaniline resistance in goosegrass is controlled by three alleles at a single locus (i.e., Drp-S, Drp-i, and Drp-r).

  3. Genetic Variability and Population Structure of the Potential Bioenergy Crop Miscanthus sinensis (Poaceae in Southwest China Based on SRAP Markers

    Directory of Open Access Journals (Sweden)

    Gang Nie

    2014-08-01

    Full Text Available The genus Miscanthus has great potential as a biofuel feedstock because of its high biomass, good burning quality, environmental tolerance, and good adaptability to marginal land. In this study, the genetic diversity and the relationship of 24 different natural Miscanthus sinensis populations collected from Southwestern China were analyzed by using 33 pairs of Sequence Related Amplified Polymorphism (SRAP primers. A total of 688 bands were detected with 646 polymorphic bands, an average of 19.58 polymorphic bands per primer pair. The average percentage of polymorphic loci (P, gene diversity (H, and Shannon’s diversity index (I among the 24 populations are 70.59%, 0.2589, and 0.3836, respectively. The mean value of total gene diversity (HT was 0.3373 ± 0.0221, while the allelic diversity within populations (HS was 0.2589 ± 0.0136 and the allelic diversity among populations (DST was 0.0784. The mean genetic differentiation coefficient (Gst = 0.2326 estimated from the detected 688 loci indicated that there was 76.74% genetic differentiation within the populations, which is consistent with the results from Analysis of Molecular Variance (AMOVA analysis. Based upon population structure and phylogenetic analysis, five groups were formed and a special population with mixed ancestry was inferred indicating that human-mediated dispersal may have had a significant effect on population structure of M. sinensis. Evaluating the genetic structure and genetic diversity at morphological and molecular levels of the wild M. sinensis in Southwest China is critical to further utilize the wild M. sinensis germplasm in the breeding program. The results in this study will facilitate the biofuel feedstock breeding program and germplasm conservation.

  4. Interactive effects of aluminum, phosphorus and mycorrhizae on growth and nutrient uptake of Panicum virgatum L. (Poaceae).

    Science.gov (United States)

    Koslowsky, S D; Boener, R E

    1989-01-01

    The effects of Al on Panicum virgatum (switchgrass), a widespread perennial grass, were determined in relation to factors which might interact with Al in the soil. Plants were grown for 8 weeks in sand culture and were treated with 3 Al levels (0.5, 2.0, 5.0 mM), 2 P levels (0.065, 0.161 mM), 2 inoculum types (vesicular-arbuscular mycorrhizal (VAM) inoculum or VAM-free soil inoculum) and 2 inoculum sources (a high Al forest in NY or a low Al forest in Ohio) in a factorial design. Plant growth decreased with increasing Al and increased with increasing P, but the Al effect was less at high P than low P. VAM-inoculated plants outgrew non-VAM plants, especially at low and medium Al levels. Total P and Ca uptake decreased with increasing Al concentration, especially at low P levels. VAM inoculation did not result in increased P uptake at any Al level though VAM plants took up significantly more Ca than non-VAM plants at any Al level. VAM plants had lower tissue Al concentrations and took up less Al than non-VAM plants; Al uptake increased with increasing soil Al in non-VAM plants but not in VAM plants. Plants given inoculum from the high Al site had significantly lower tissue Al than plants given the low Al site inoculum, regardless of VAM status. We conclude that the presence of a VAM infection, moderate levels of soil P, and the source of the inoculum can reduce the effects of soluble Al. We discuss potential physiological and edaphic mechanisms by which Al may be immobilized and Ca availability increased in the presence of VAM fungi and other soil microflora.

  5. The karyotype of Festucopsis serpentini (Poaceae Triticeae) from Albania studied by banding techniques and in situ hybridization

    DEFF Research Database (Denmark)

    Linde-Laursen, I.; Seberg, O.; Frederiksen, S.

    1996-01-01

    -chromosomes, a metacentric and a submetacentric pair. SAT-chromosomes from one population carried exclusively minute satellites, whereas SAT-chromosomes from another population also carried larger polymorphic satellites, suggesting a geographical differentiation. The existence of four chromosomes with nucleolus forming...

  6. Comparison of the karyotypes ofPsathyrostachys juncea andP. huashanica (Poaceae) studied by banding techniques

    DEFF Research Database (Denmark)

    Linde-Laursen, Ib; Bothmer, R. von

    1986-01-01

    . The patterns of both taxa are polymorphic, supporting that both taxa are outbreeders. The karyotypic characters suggest that P. juncea is more closely related to P. fragilis than either is to P. huashanica. N-banding stains weakly. Silver nitrate staining demonstrates that nucleolus organizers of both species...... have different nucleolus forming capacities. The presence of micronucleoli suggests that both species have an extra unidentified chromosome with nucleolus forming capacity....

  7. Transient heat stress compromises the resistance of wheat (Poales: Poaceae) seedlings to Hessian fly (Diptera: Cecidomyiidae) infestation.

    Science.gov (United States)

    Currie, Yaleaka; Moch, John; Underwood, Joshua; Kharabsheh, Hamzah; Quesenberry, Amy; Miyagi, Risa; Thomas, Carolyn; Boney, Melanie; Woods, Samantha; Chen, Ming-Shun; Zhu, Lieceng

    2014-02-01

    Heat stress exerts a profound impact on the resistance of plants to parasites. In this research, we investigated the impact of an acute transient heat stress on the resistance of the wheat line 'Molly,' which contains the R gene H13, to an avirulent Hessian fly (Mayetiola destructor (Say)) population. We found that a significant portion of Molly seedlings stressed at 40 degrees C for 6 h during or after the initial Hessian fly larval attack became susceptible to otherwise avirulent insects, whereas unstressed control plants remained 100% resistant. Specifically, 77.8, 73.3, 83.3, and 46.7% of plants heat stressed at 0, 6,12, and 24 h, respectively, after the initial larval attack became susceptible. Biochemical analysis revealed that heat stress caused a transient decrease in 12-oxo-phytodienoic acid, but an increase in salicylic acid accumulation in Molly plants. The change in phytohormones after heat stress and Hessian fly infestation was not observed in 'Newton,' a near-isogenic but Hessian fly susceptible wheat line. Instead, heat stress caused a relatively prolonged reduction in palmitoleic acid. The role of phytohormones in heat-induced loss of wheat resistance was discussed.

  8. The effects of gap size and disturbance type on invasion of wet pine savanna by cogongrass, Imperata cylindrica (Poaceae)

    Science.gov (United States)

    King, S.E.; Grace, J.B.

    2000-01-01

    Cogongrass is a nonindigenous species perceived to threaten native communities of the southeastern United States through modification of species composition and alteration of community processes. To examine how gap size and disturbance type influence the invasion of wet pine savannas by cogongrass, we performed three field experiments to evaluate the response of cogongrass seeds and transplanted seedlings to four different gap sizes, four types of site disturbance, and recent burning of savanna vegetation. Cogongrass germinated, survived, and grew in all gap sizes, from 0 to 100 cm in diameter. Similarly, disturbance type had no effect on germination or seedling and transplant survival. Tilling, however, significantly enhanced transplanted seedling growth, resulting in a tenfold increase in biomass over the other disturbance types. Seedling survival to 1 and 2 mo was greater in burned savanna than unburned savanna, although transplant survival and growth were not affected by burning. Results of this study suggest that cogongrass can germinate, survive, and grow in wet pine savanna communities regardless of gap size or type of disturbance, including burning. Burning of savanna vegetation may enhance establishment by improving early seedling survival, and soil disturbance can facilitate invasion of cogongrass by enhancing plant growth.

  9. THE RESURRECTION PLANT TRIPOGON SPICATUS (POACEAE HARBORS A DIVERSITY OF PLANT GROWTH PROMOTING BACTERIA IN NORTHEASTERN BRAZILIAN CAATINGA

    Directory of Open Access Journals (Sweden)

    Paulo Ivan Fernandes-Júnior

    2015-08-01

    Full Text Available Plant species that naturally occur in the Brazilian Caatinga(xeric shrubland adapt in several ways to these harsh conditions, and that can be exploited to increase crop production. Among the strategic adaptations to confront low water availability, desiccation tolerance stands out. Up to now, the association of those species with beneficial soil microorganisms is not well understood. The aim of this study was to characterize Tripogon spicatusdiazotrophic bacterial isolates from the Caatingabiome and evaluate their ability to promote plant growth in rice. Sixteen bacterial isolates were studied in regard to their taxonomic position by partial sequencing of the 16S rRNA gene, putative diazotrophic capacity, in vitro indole-acetic acid (IAA production and calcium phosphate solubilization, metabolism of nine different C sources in semi-solid media, tolerance to different concentrations of NaCl to pHs and intrinsic resistance to nine antibiotics. Finally, the ability of the bacterial isolates to promote plant growth was evaluated using rice (Oryza sativa as a model plant. Among the 16 isolates evaluated, eight of them were classified as Enterobacteriaceae members, related to Enterobacter andPantoeagenera. Six other bacteria were related toBacillus, and the remaining two were related toRhizobiumand Stenotrophomonas.The evaluation of total N incorporation into the semi-solid medium indicated that all the bacteria studied have putative diazotrophic capacity. Two bacteria were able to produce more IAA than that observed for the strain BR 11175Tof Herbaspirillum seropedicae.Bacterial isolates were also able to form a microaerophilic pellicle in a semi-solid medium supplemented with different NaCl concentrations up to 1.27 mol L-1. Intrinsic resistance to antibiotics and the metabolism of different C sources indicated a great variation in physiological profile. Seven isolates were able to promote rice growth, and two bacteria were more efficient than the reference strainAzospirillum brasilense, Ab-V5. The results indicate the potential of T. spicatus as native plant source of plant growth promoting bacteria.

  10. Ultraestructura de bambúes del género Dendrocalamus (Poaceae: Bambusoideae) cultivados en Costa Rica III: Dendrocalamus giganteus

    OpenAIRE

    Mayra Montiel; Ethel Sánchez

    2006-01-01

    Dendrocalamus giganteus es una de las especies de bambú más grandes y fuertes, y es ampliamente utilizada con propósitos varios. Se llevó a cabo un análisis ultraestructural de una población costarricense, determinando tres formas de acumulación de la cera cuticular en forma de papilas céricas. En la zona abaxial de la lámina foliar se aprecian estructuras cuadradas, constituidas por dos células de sílice en los extremos y en las partes laterales papilas céricas dobles, en el centro hay papil...

  11. Ultraestructura de bambúes del género Dendrocalamus (Poaceae: Bambusoideae cultivados en Costa Rica III: Dendrocalamus giganteus

    Directory of Open Access Journals (Sweden)

    Mayra Montiel

    2006-06-01

    Full Text Available Dendrocalamus giganteus es una de las especies de bambú más grandes y fuertes, y es ampliamente utilizada con propósitos varios. Se llevó a cabo un análisis ultraestructural de una población costarricense, determinando tres formas de acumulación de la cera cuticular en forma de papilas céricas. En la zona abaxial de la lámina foliar se aprecian estructuras cuadradas, constituidas por dos células de sílice en los extremos y en las partes laterales papilas céricas dobles, en el centro hay papilas céricas esféricas. Estas estructuras son únicas para este especie, por lo que tienen alto valor taxonómico.Dendrocalamus giganteus is one of the biggest, strongest and most used bamboos. An ultrastructural analysis of samples from a Costa Rican population showed that there are three forms of cuticular wax accumulations, shaped like ceric papillae. In the abaxial zone of the leaf lamina there are square structures composed by two silica cells in the boundaries and double ceric papillae in the lateral parts; in the center there are spherical papillae. These structures are unique for this species. Rev. Biol. Trop. 54(Suppl. 2: 59-63. Epub 2006 Dec. 01.

  12. Characterization of genome in tetraploid StY species of Elymus (Triticeae: Poaceae) using sequential FISH and GISH.

    Science.gov (United States)

    Liu, Ruijuan; Wang, Richard R-C; Yu, Feng; Lu, Xingwang; Dou, Quanwen

    2017-08-01

    Genomes of ten species of Elymus, either presumed or known as tetraploid StY, were characterized using fluorescence in situ hybridization (FISH) and genomic in situ hybridization (GISH). These tetraploid species could be grouped into three categories. Type I included StY genome reported species-Roegneria pendulina, R. nutans, R. glaberrima, R. ciliaris, and Elymus nevskii, and StY genome presumed species-R. sinica, R. breviglumis, and R. dura, whose genome could be separated into two sets based on different GISH intensities. Type I genome constitution was deemed as putative StY. The St genome were mainly characterized with intense hybridization with pAs1, fewer AAG sites, and linked distribution of 5S rDNA and 18S-26S rDNA, while the Y genome with less intense hybridization with pAs1, more varied AAG sites, and isolated distribution of 5S rDNA and 18S-26S rDNA. Nevertheless, further genomic variations were detected among the different StY species. Type II included E. alashanicus, whose genome could be easily separated based on GISH pattern. FISH and GISH patterns suggested that E. alashanicus comprised a modified St genome and an unknown genome. Type III included E. longearistatus, whose genome could not be separated by GISH and was designated as St l Y l . Notably, a close relationship between S l and Y l genomes was observed.

  13. Variation and geographical distribution of ploidy levels in Pennisetum section Brevivalvula (Poaceae) in Burkina Faso, Benin and southern Niger

    OpenAIRE

    Renno, Jean-François; Schmelzer, G.; De Jong, J.H.

    1995-01-01

    #Pennisetum$ sect. #Brevivalvula$ is a species complex characterized by polyploidy and apoximis. Ploidy level was assessed by DAPI-flow cytometry for 304 plants of the section, originating from Burkina Faso, Benin and southern Niger. The results were confirmed for 54 plants based on chromosome counts. The samples show four euploidy levels (with x = 9) distributed among five species : #P. hordeoides$ (2n = 36, 54), #P. pedicellatum$ (2n = 36, 45, 54), #P. polystachion$ (2n = 18, 36, 45, 54), #...

  14. Evolution and diversity of PAPhy_a phytase in the genepool of wheat (Triticum aestivum L., Poaceae)

    DEFF Research Database (Denmark)

    Madsen, Claus Krogh; Petersen, Gitte; Seberg, Ole

    2017-01-01

    Higher phytase activity in food and feedstuffs is desirable in order to counter the antinutritional effects of phytate. The most promising platform where this might be achieved through plant breeding is wheat and its Triticeae relatives. They already accumulate notable amounts of phytase...

  15. Population genetic analysis of Bromus tectorum (Poaceae) indicates recent range expansion may be facilitated by specialist genotypes

    Science.gov (United States)

    Keith R. Merrill; Susan E. Meyer; Craig E. Coleman

    2012-01-01

    The mechanisms for range expansion in invasive species depend on how genetic variation is structured in the introduced range. This study examined neutral genetic variation in the invasive annual grass Bromus tectorum in the Intermountain Western United States. Patterns of microsatellite (SSR) genotype distribution in this highly inbreeding species were used to make...

  16. Invertebrate fauna associated with Torpedograss, Panicum repens (Cyperales: Poaceae), in Lake Okeechobee, Florida, and prospects for biological control

    International Nuclear Information System (INIS)

    Cuda, J.P.; Dunford, J.C.; Leavengood, J.M. Jr.

    2007-01-01

    Torpedograss, Panicum repens L., is an adventive, rhizomatous grass species that has become an invasive weed of terrestrial, wetland, and aquatic environments in tropical and subtropical regions worldwide. Until recently, strategies for controlling torpedograss in the USA have focused almost exclusively on mechanical and chemical methods, either alone or in combination, with varied results. A survey of the arthropods and nematodes currently associated with the plant in Lake Okeechobee, Florida, was conducted as part of a feasibility study to determine whether torpedograss is an appropriate target for a classical biological control program. Overall, approximately 4,000 arthropods and 400 nematode specimens were collected. Sweep, clipped vegetation, and soil core samples were dominated by representatives of the arthropod orders Hemiptera, Hymenoptera, Diptera, and Acari. Lesion nematodes of the genus Pratylenchus were commonly associated with the roots of torpedograss. None of the organisms collected were torpedograss specialists. Although classical biological control of torpedograss is feasible based on the extent of the infestation, economic losses, resistance to conventional controls, and the report of a potentially host specific natural enemy in India, the botanical position of this grass weed will require a formal risk assessment before proceeding with a classical biological control program. (author) [es

  17. The academisation of technical education at the end of the Ancien Régime La academización de la educación técnica afines del Antiguo Régimen

    Directory of Open Access Journals (Sweden)

    Agustín ESCOLANO BENITO

    2013-09-01

    Full Text Available This study examines the genesis of academised technical education at the end of the Ancien Régime. The institutionalisation of the training of professionals of navigation, industry, commerce and agriculture emerged in the second half of the XVIII century in close relation to the programs of economic promotion, of diffusion of science and modern techniques and the pedagogical impulse of the Enlightenment. This process of academisation of the new knowledge would lead to the excision of the workshop- school and the revision of the teaching of the guilds, giving rise to a new model of education of the young, in contrast to the philological paradigm which had been predominant since the Renaissance in secondary schools. This new model was characterised by curricular planning according to the propositions of empirical science, mathematics and useful knowledge, by the discourse of the practicality of knowledge and by the new ethos of the middle class.Este trabajo examina la génesis de la educación técnica academizada a finales del Antiguo Régimen. La institucionalización de la formación de los profesionales de la navegación, la industria, el comercio y la agricultura emerge en la segunda mitad del siglo XVIII en estrecha relación con los programas de fomento económico, de difusión de la ciencia y de la técnica modernas y del impulso pedagógico de la Ilustración. Este proceso de academización de los nuevos saberes desencadena la escisión escuela-taller y la revisión de la enseñanza gremial, dando origen a un nuevo modelo de educación de la juventud, contrapuesto al paradigma filológico dominante desde el Renacimiento en las escuelas secundarias y caracterizado por una ordenación curricular conformada a los presupuestos de la ciencia empírica, la matemática y los conocimientos útiles, por el discurso de la practicidad del saber y por el nuevo ethos de la burguesía.

  18. RSR13 e modificação alostérica da afinidade hemoglobina-oxigênio: abuso entre atletas RSR13 and allosteric change in the hemoglobin-oxygen afinity: abuse among athletes

    Directory of Open Access Journals (Sweden)

    Antonio Claudio Lucas da Nóbrega

    2002-02-01

    Full Text Available O ácido metilpropiônico (RSR13 é um modificador alostérico da hemoglobina, com a qual se liga de forma não-covalente, diminuindo sua afinidade pelo oxigênio de modo dose-dependente e, conseqüentemente, aumentando a oxigenação periférica. O objetivo deste artigo é apresentar brevemente as evidências científicas acerca das características farmacológicas e funcionais, indicações médicas e efeitos adversos do uso do RSR13 por atletas, a mais recente alternativa de aumento artificial do desempenho. Estudos experimentais preliminares verificaram algum efeito positivo do RSR13 sobre a recuperação do miocárdio isquêmico e sobre a extensão da isquemia cerebral, mas as principais indicações estudadas atualmente são a cirurgia com hipotermia e cardioplegia durante circulação extracorpórea e o uso como agente coadjuvante potenciador da radioterapia para certos tumores sólidos. Somente um estudo em modelo canino mostrou aumento do consumo máximo de oxigênio em músculo isolado, não existindo evidências de que o RSR13 possa efetivamente melhorar o desempenho em humanos. Em realidade, já foram descritos efeitos adversos, como diminuição da perfusão sanguínea, elevação da pressão arterial e diminuição da função renal. Antecipando o potencial aumento da utilização do RSR13 por atletas, métodos já foram desenvolvidos para sua detecção em amostras de urina humana.Methylpropionic acid (RSR13 is an allosteric hemoglobin modifier to which it binds in a non-covalent manner, reducing its affinity to oxygen in a dose-dependent fashion, and consequently, increasing peripheral oxygenation. The purpose of this article is to briefly present scientific evidence concerning pharmacological and functional characteristics, medical indications, and adverse effects of RSR13 use by athletes, the most recent alternative to enhance performance artificially. Preliminary experimental studies have verified some positive effect of RSR13 on the recovery of ischemic myocardium and on the extension of cerebral ischemia. However, the main indications currently under study are surgery with hypothermia and cardioplegia during extra-corporeal circulation and the use as a radiotherapy enhancing agent for certain solid tumors. One single study with a canine model has shown increased maximal oxygen consumption in isolated muscles, there existing no evidence that RSR13 can effectively enhance performance in humans. Actually, adverse effects such as reduced blood perfusion, increased arterial blood pressure, and impaired renal function have been described. As an anticipation of the potential increased use of RSR13 by athletes, methods have been developed for its detection in human urine samples.

  19. Medición de la producción científica en América Latina y el Caribe en el campo agrícola y afines: un estudio bibliométrico

    Directory of Open Access Journals (Sweden)

    Saavedra Fernández, Óscar

    2002-06-01

    Full Text Available Twenty-two science and technology indicators from twenty countries, compiled by RICyT were used in an exploratory data analysis about the performance of the countries of the region in the field of Agriculture. Caribbean countries exhibit better performance compared with the rest. Results suggest the idea of widening the scope of such analysis for a larger time span.

    Veintidós indicadores de ciencia y tecnología producidos por la RICyT, correspondientes a veinte países de América Latina y el Caribe son empleados para realizar un análisis exploratorio de datos sobre el desempeño de los países de la región en Ciencias Agrícolas. Se identificaron los países de la cuenca del Caribe con mejor desempeño que los restantes. Los resultados sugieren la idea de extender este tipo de análisis a otras especialidades abarcando una mayor cantidad de años.

  20. « Inverser la plaisanterie afin de secouer le joug » ou comment vicier un stéréotype “Change the Joke and Slip the Yoke” or How to Twist a Stereotype

    Directory of Open Access Journals (Sweden)

    Jacqueline Berben

    2009-07-01

    Full Text Available A California professor, a painter, an author and an occasional rancher Percival Everett appears as an iconoclast who often undermines racial and political stereotypes, ethnocentric and cultural narratives while provoking the academic establishment by making fun of its various literary theories. An excellent example is the short story, “The Appropriation of Cultures,” in the collection Damned If IDo (2004. The tale is a not-so-subtle deconstruction/reconstruction of symbols deeply embedded in the culture of the American South and its ultra-conservative values. Everett endows his protagonist with his favorite tools – irony, humor, artifice – by turning the Confederate flag into a Black Power symbol and laying African American claim to the Southern anthem, “Dixie”. Thus the archetypal “trickster” figure triumphs over his bigger, stronger adversary by getting him to psychologically relinquish treasured icons of Southern white superiority and by playing on that very myth. This article shows that post-structuralism per se might be inherently linked to African Americans.

  1. Sur la reconnaissance de la compétence exclusive des groupements religieux afin d‘instaurer leur structure intrinsèque et les normes intérieures des relations en tant qu’une des garanties ...

    Directory of Open Access Journals (Sweden)

    Philip Ryabykh

    2012-11-01

    SOMMAIRE: 1. Brève histoire de l’affaire – 2. Préambule – 3. Protection de la compétence exclusive des groupements religieux en vue d’instaurer leur structure intrinsèque et les normes intérieures des relations au point de vue de la législation de la Roumanie – 4. Application du principe de l’autonomie des groupements religieux et du principe de l’inadmissibilité d’intervenir pour l’État aux affaires intérieures des groupements religieux – 5. Non-contradiction de la Convention des exigences intérieures des groupements religieux sur la loyauté et la conformité des personnes se trouvant dans les relations de service avec le groupement religieux – 6. Absence des raisons fournies par les faits juridiques suffisantes et justifiant réellement l’assimilation (la mise au même niveau des groupements religieux avec n’importe quelles autres organisations-employeurs dans la sphère de la réglementation des relations de travail – 7. Légalité de l’instauration des restrictions à la création et les activités des syndicats dans les certaines sphères des relations publiques – 8. Compétence de la Roumanie de fixer dans la législation les restrictions à la liberté des syndicats conformément à la sphère des relations religieuses – 9. Signification des résultats du jugement de l’affaire «Syndicat “Le Bon Pasteur” c. Roumanie» (requête 2330/09 pour L’Église Orthodoxe Russe- 10. Conclusion.

  2. Análise dos componentes principais e métodos multicritério ordinais no estudo de organossolos e solos afins Principal component analysis and ordinal multicriteria methods to study organosols and related soils

    Directory of Open Access Journals (Sweden)

    Gustavo Souza Valladares

    2008-02-01

    Full Text Available Uma importante propriedade dos Organossolos, e de outros solos com alto teor de C orgânico para predizer o potencial de uso e riscos de degradação, é o grau de subsidência (perda de massa e volume. Nos Organossolos ocorrem diferentes riscos de subsidência, resultantes de seus atributos, em especial da natureza da matéria orgânica e do ambiente de deposição. Este estudo foi realizado com dados de 19 perfis de solos de diferentes regiões do Brasil. Foram adotados os procedimentos da SBCS para descrição e coleta dos perfis, e os métodos analíticos da Embrapa Solos para caracterização dos solos. A análise dos componentes principais foi utilizada para agrupar os perfis com o auxílio de atributos morfológicos, físicos, químicos e do ambiente de ocorrência e mostrou-se adequada no agrupamento dos solos estudados com base em seus atributos, comparando-se com a sua taxonomia. Neste artigo foram usados os métodos multicritério ordinais de Borda, Condorcet e Copeland para ordenar, segundo o risco de subsidência, os perfis de Organossolos estudados. Os resultados mostram correlação entre os métodos (exceto Condorcet, que não foi capaz de ordenar as alternativas e o resíduo mínimo, parâmetro usual para avaliar subsidência. Isso indica eficácia para ordenar/classificar os perfis de solos estudados quanto ao risco de subsidência. Os métodos quantitativos utilizados neste trabalho mostraram-se promissores como ferramentas em estudos na Ciência do Solo.One important property of Organosols (Histosols (and soils with high content of organic carbon to predict use potential and degradation risks is the degree of subsidence (loss of mass and volume. In Organosols the subsidence risks vary according to the soil attributes, mainly the nature of organic matter and deposition environment. In this paper we studied 19 soil profiles from different parts of the country, collected and described according to procedures recommended by the SBCS (Brazilian Soil Science Society; the analytical methods proposed by EMBRAPA-Solos were used to characterize the soils. The principal component analysis was used to cluster the profiles based on morphological, physical, chemical and environmental attributes and proved adequate to group the soils under study based on the profile attributes and the grouping was well related to their taxonomy. The soil profiles were ranked by the ordinal multicriteria methods of Border, Condorcet and Copeland based on the subsidence risk. Results indicated a correlation between the methods (with exception of the Condorcet approach, unsuitable to rank the alternatives and the minimum residue, which is the classical parameter for the evaluation of subsidence, indicating efficacy to rank/classify the soil profiles in relation to subsidence risk. The quantitative approaches used are promising as evaluation tools in soil science studies.

  3. Minería de datos como herramienta para el desarrollo de estrategias de mercadeo B2B en sectores productivos, afines a los colombianos: una revisión de casos

    Directory of Open Access Journals (Sweden)

    Laura Altamiranda Echeverri

    2013-12-01

    Full Text Available Actualmente se estima que el suministro de datos del mundo se duplica cada 20 meses (Berndt y Clifford, 1996. Lo anterior implica un crecimiento excesivo en el volumen de datos que se maneja tanto en la comunidad científica como en los sectores productivos de la economía, que ha sobrepasado la capacidad humana de analizar, resumir y extraer conocimientos a tales cantidades de datos. Lo anterior, hace necesaria una nueva generación de herramientas capaces de automatizar el análisis de los datos almacenados. El conjunto de estas herramientas lo estudia un nuevo campo de investigación llamado minería de datos (Fayyad et al., 1996. La minería de datos se ha convertido en una herramienta estratégica para la toma de decisiones de mercadeo, producción, organización y demás factores en la empresa, que de cierta manera la hacen más competitiva. El presente artículo analiza la manera como la minería de datos, una técnica ampliamente relacionada con la investigación de operaciones, incide en el diseño de estrategias de mercadeo B2B, en empresas de sectores industriales. Esta investigación guarda relación directa con proyectos investigativos realizados por la Universidad Autónoma del Caribe, y relacionados con el desarrollo de la competitividad e innovación de los sectores estratégicos del departamento del Atlántico.

  4. Las tareas docentes integradoras, vía para la capacitación de los profesionales de nivel medio en especialidades afines a la Construcción

    Directory of Open Access Journals (Sweden)

    Otto Rafael Ruiz-Sánchez

    2017-11-01

    Full Text Available Las insuficiencias que se manifiestan hoy día en el aprendizaje de los futuros docentes y especialistas de la Construcción en cuanto a los procesos constructivos y su solución a través de la aplicación de alternativas didácticas, constituyen la esencia de este proceso investigativo. Se presentan en este artículo los resultados de un diagnóstico aplicado a los docentes en formación y personal en capacitación, lo cual permitió delimitar las carencias existentes en la implementación de acciones que potencien el aprendizaje de estos. Se ejemplifica con una de las tareas insertadas en el proceso de enseñanza aprendizaje.

  5. AVALIAÇÃO DA DIVERSIDADE GENÉTICA ATRAVÉS DE RAPD DE ACESSOS DE MANIÇOBA (Manihot pseudoglaziovii PAX & HOFFM. E DE DUAS ESPÉCIES AFINS DE INTERESSE FORRAGEIRO

    Directory of Open Access Journals (Sweden)

    Fabiana Augusta Santiago Beltrão

    2007-01-01

    Full Text Available With the objective to analyze the genetc variability in natural populations, 14 accesses of Manihot had been studied pseudglaziovii, collected in the state of the Paraíba, in the microregion Curimataú Paraibano, beyond an access of M. esculenta Cranz (cassava and a natural hybrid between these two species. Five plants of each access had been multiplied through statue and after that cultivated in an experimental area in standardized conditions, to have a homogeneous exteriorizacion of each genotype. The otimizaçãocion of the protocol of extraction of the DNA of some accesses of maniçoba and of two similar species of forager interest and to verify the genetic variability through the amplification with molecular markers RAPD saw PCR. Two methods of extraction of the DNA had been tested. The extraction protocol using detergent CTAB made possible to get clean products, less viscous and oxidized. In the analysis of genetic variability they had been used in a total of 10 starters (primers, and only 3 had produced bands, starter OPD2, OPD3 and OPD8 presented greater percentage of polymorphism followed of the OPD2, with values of 30,7% and 42,8%, respectively. These primers can discriminate molecular differences between the accesses of maniçoba and two similar species.

  6. Support to Industry Partners in Achieving Designation/Certification for the US Safety Act (Soutien aux Partenaires de L’industrie afin de les Aider a Obtenir la Designation/Certification Associee a la Loi Americaine sur la Securite)

    Science.gov (United States)

    2011-10-01

    stratégie et que l’industrie jouerait un rôle clé dans la mise au point et la commercialisation des technologies et des capacités appropriées...partners to apply more often because the costs would be covered. At the same time by educating industry partners on the value of SAFETY Act

  7. ¿Es adecuado el sistema español de evaluación de la actividad investigadora para su aplicación a las Ciencias de la Tierra y otros campos afines?

    Directory of Open Access Journals (Sweden)

    Rey Rocha, J.

    1999-08-01

    Full Text Available Through the survey «Research activities in the R&D system in Earth Sciences in Spain (1990-1994>>, information about different aspects of the professional activity of Spanish researchers in this field has been retrieved, as well as their opinion about prevailing research evaluation criteria. Starting from survey's results, we discuss the suitability of the present Spanish scientific evaluation system for assessing research activity of said researchers. Results show scientist's disagreement with the prevailing evaluation procedures and criteria. More than 70 % of both University and CSIC researchers consider that evaluation criteria are inappropriate or unacceptable, being this percentage significantly higher than the obtained from scientists belonging to other institutions. Disagreement with evaluation criteria is significantly lower among authors that only publish in foreign journals. Positive correlation has been found between opinion about evaluation criteria and the level of consolidation and stability of research teams. Main cause of disagreement is concerned with the over-valuation of papers published in SCI journals and the scarce consideration given to high quality papers published in serious domestic journals and to other scientific contributions. Results suggest that the evaluation system could have been detrimental to researchers working in some scientific fields, but does not seem to have discriminate among basic and applied research or among research of local or national interest and those more internationally-oriented. The research evaluation system should consider the idiosyncrasy of the different scientific fields, as well as their particular and distinctive characteristics and dynamics. It should take into the adequate consideration quality scientific work that, despite being of particular importance in fields as Earth Sciences, is not published in SCI joumals.A través de la opinión expresada por los propios investigadores, se discute la idoneidad del actual sistema español de evaluación de la actividad investigadora, para su aplicación en el campo de las Ciencias de la Tierra. Dicha opinión ha sido obtenida a través de la encuesta «Actividades de investigación realizadas en el Sistema de I+D en Ciencias de la Tierra en España, 1990-1994», que recoge información sobre distintos aspectos de la actividad profesional de los investigadores españoles en este campo. Los resultados muestran su desacuerdo con los criterios y el procedimiento de evaluación actualmente vigentes. Más del 70 % tanto de los profesores universitarios como de los investigadores del CSIC considera que los criterios de evaluación son inadecuados o inaceptables, siendo su grado de disconformidad con los mismos significativamente más elevado que el de los investigadores del resto de instituciones. Este porcentaje es significativamente menor entre los científicos que publican exclusivamente en revistas extranjeras. Asimismo, se ha detectado una correlación positiva entre la opinión acerca de los criterios de evaluación y el nivel de consolidación y estabilidad de los equipos de investigación, de modo que cuanto mayor es éste más elevada es la proporción de juicios favorables a los mismos. El principal motivo de disconformidad con el procedimiento de evaluación se refiere a la excesiva importancia que se concede a los trabajos publicados en revistas del SCI, en detrimento de los publicados en revistas españolas de calidad y de otras contribuciones científicas. Los resultados indican que el sistema de evaluación podría estar produciendo una discriminación entre los investigadores pertenecientes a distintos campos científicos, más que entre investigación básica y aplicada o entre investigación de interés local y/o nacional y aquella de ámbito internacional. Consideramos que el sistema de evaluación debe tener en cuenta la idiosincrasia y características propias y distintivas de cada campo científico y debe tomar en la adecuada consideración los trabajos de contrastada calidad que, por diversos motivos, no se publican en revistas del SCI, los cuales tienen una especial importancia en ciertos campos científicos, entre los que se encuentran las Ciencias de la Tierra.

  8. El caso de la ‘mala vida’, peligrosidad y prevención de conductas marginales en Revista de Criminología, Psiquiatría, Medicina Legal y Ciencias Afines, en Buenos Aires, 1914-1923

    Directory of Open Access Journals (Sweden)

    Mariana Dovio

    2013-11-01

    Full Text Available Analizamos la construcción de la noción de ‘mala vida’ en la ciudad de Buenos Aires, en la Revista de Criminología, Psiquiatría y Medicina Legal, entre 1914 y 1923. Nos dedicaremos a analizar la ‘mala vida’, entendiendo por tal aquellas conductas ubicadas en una zona fronteriza entre el crimen y la locura, a partir de la cuestión de la prevención y la peligrosidad. La primera forma de analizar la ‘mala vida’ se refiere a proyectos de instituciones ligados a la eugenesia para el encierro preventivo de peligrosos, ‘alcoholistas’ y vagabundos. La segunda, a la identificación, en términos morales y físicos, que puede ser vinculada a la confección de proyectos de intervención para los considerados ‘malvivientes’, que pudieran potencialmente dañar de algún modo al cuerpo social.

  9. Gestión integral de residuos sólidos generados en hospitales y centros afines : Comparación microbiológica entre residuos sanitarios y residuos sólidos urbanos

    OpenAIRE

    Mery Letelier, Francisco Santiago

    2011-01-01

    La tesis doctoral aborda temáticamente la gestión integral de los residuos sanitarios, y la caracterización de residuos generados en distintos tipos de centros sanitarios (hospital, clínicas, laboratorios clínicos y clínica veterinaria), así como de residuos sólidos urbanos, a través de su composición, parámetros físicos como la humedad y la densidad, así como de indicadores microbiológicos, culminando en una propuesta de reglamentación aplicable a la gestión de residuos sanitarios....

  10. Ploidy level variability in South American fescues (festuca L., poaceae): use of flow cytometry in up to 5 1/2-year-old caryopses and herbarium specimens.

    Science.gov (United States)

    Smarda, P; Stancík, D

    2006-01-01

    Ploidy levels and chromosome numbers for 24 species of Festuca L. from 29 sites in Bolivia, Colombia, Ecuador and Venezuela are given. The ploidy level of 22 species is reported for the first time. A higher proportion of tetraploids in northern South America and the high frequency of polyploids in the whole continent are documented. In combination with chromosome counts, ploidy level was determined using flow cytometry in 4- to 5 1/2 -year-old herbarium specimens and mature caryopses. Flow cytometric determination from seeds was more reliable than determination from herbarium specimens. In herbarium specimens, the youngest, fresh green leaves, still hidden in sheaths, seem to be most suitable for cytometric determination. In old, brownish leaves, or poorly preserved herbarium specimens, the degradation of DNA signal in flow histograms was documented. DNA content measured in seeds was always higher than that measured in herbarium specimens, which may be caused by the presence of different cytosolic compounds. Differences of about 15% in relative DNA content of F. sodiroana and F. vaginalis was found in simultaneous measurements in seeds.

  11. Comparison of the Giemsa C-banded and N-banded karyotypes of two Elymus species, E. dentatus and E. glaucescens (Poaceae; Triticeae)

    DEFF Research Database (Denmark)

    Linde-Laursen, I.; Seberg, O.; Salomon, B.

    1994-01-01

    The karyotypes of Elymus dentatus from Kashmir and E. glaucescens from Tierra del Fuego, both carrying genomes S and H, were investigated by C- and N-banding. Both taxa had 2n = 4x = 28. The karyotype of E. dentatus was symmetrical with large chromosomes. It had 18 metacentric, four submetacentric...

  12. Membrane Stabilization and Detoxification of Acetaminophen-Mediated Oxidative Onslaughts in the Kidneys of Wistar Rats by Standardized Fraction of Zea mays L. (Poaceae), Stigma maydis

    Science.gov (United States)

    Sabiu, S.; O'Neill, F. H.

    2016-01-01

    This study evaluated membrane stabilization and detoxification potential of ethyl acetate fraction of Zea mays L., Stigma maydis in acetaminophen-induced oxidative onslaughts in the kidneys of Wistar rats. Nephrotoxic rats were orally pre- and posttreated with the fraction and vitamin C for 14 days. Kidney function, antioxidative and histological analyses were thereafter evaluated. The acetaminophen-mediated significant elevations in the serum concentrations of creatinine, urea, uric acid, sodium, potassium, and tissue levels of oxidized glutathione, protein-oxidized products, lipid peroxidized products, and fragmented DNA were dose-dependently assuaged in the fraction-treated animals. The fraction also markedly improved creatinine clearance rate, glutathione, and calcium concentrations as well as activities of superoxide dismutase, catalase, glutathione reductase, and glutathione peroxidase in the nephrotoxic rats. These improvements may be attributed to the antioxidative and membrane stabilization activities of the fraction. The observed effects compared favorably with that of vitamin C and are informative of the fraction's ability to prevent progression of renal pathological conditions and preserve kidney functions as evidently supported by the histological analysis. Although the effects were prominently exhibited in the fraction-pretreated groups, the overall data from the present findings suggest that the fraction could prevent or extenuate acetaminophen-mediated oxidative renal damage via fortification of antioxidant defense mechanisms. PMID:27579048

  13. Kinetics of α-amylase and α-glucosidase inhibitory potential of Zea mays Linnaeus (Poaceae), Stigma maydis aqueous extract: An in vitro assessment.

    Science.gov (United States)

    Sabiu, S; O'Neill, F H; Ashafa, A O T

    2016-05-13

    Corn silk (Zea mays L., Stigma maydis) is an important herb used traditionally in many parts of the world to treat array of diseases including diabetes mellitus. Inhibitors of α-amylase and α-glucosidase offer an effective strategy to modulate levels of post prandial hyperglycaemia via control of starch metabolism. This study evaluated α-amylase and α-glucosidase inhibitory potentials of corn silk aqueous extract. Active principles and antioxidant attributes of the extract were also analysed. The α-amylase inhibitory potential of the extract was investigated by reacting its different concentrations with α-amylase and starch solution, while α-glucosidase inhibition was determined by pre-incubating α-glucosidase with different concentrations of the extract followed by addition of p-nitrophenylglucopyranoside. The mode(s) of inhibition of the enzymes were determined using Lineweaver-Burke plot. In vitro analysis of the extract showed that it exhibited potent and moderate inhibitory potential against α-amylase and α-glucosidase, respectively. The inhibition was concentration-dependent with respective half-maximal inhibitory concentration (IC50) values of 5.89 and 0.93mg/mL. Phytochemical analyses revealed the presence of alkaloids, flavonoids, phenols, saponins, tannins and phytosterols as probable inhibitory constituents. Furthermore, the extract remarkably scavenges reactive oxygen species like DPPH and nitric oxide radicals, elicited good reducing power and a significant metal chelating attributes. Overall, the non-competitive and uncompetitive mechanism of action of corn silk extract is due to its inhibitory effects on α-amylase and α-glucosidase, respectively. Consequently, this will reduce the rate of starch hydrolysis, enhance palliated glucose levels, and thus, lending credence to hypoglycaemic candidature of corn silk. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  14. Genetic and morphological differentiation between Melica ciliata L. and M. transsilvanica Schur (Poaceae in Europe reveals the non-presence of M. ciliata in the Polish flora

    Directory of Open Access Journals (Sweden)

    Magdalena Szczepaniak

    2011-12-01

    Full Text Available A good knowledge of species delimitation is crucial for the biodiversity protection and the conservation of wild species. We studied the efficiency of AFLP markers and morphological characters to assist species determination for Melica ciliata L. and M. transsilvanica Schur within European range of distribution, including isolated and range-limit populations of "M. ciliata" (i.e. M. cf. ciliata from the Polish Sudetes, where it is regarded as critically endangered. AFLP markers were found to be more effective then morphological characters (more or less continuous in distinguishing the both studied species. AMOVA revealed very low genetic diversity within populations and high differentiation among populations of M. ciliata and M. transsilvanica (FST = 0.89 and 0.95, respectively. The species-diagnostic AFLP markers of M. transsilvanica shared with "M. ciliata" from the Sudetes were detected. On the other hand, no species-diagnostic genetic markers of M. ciliata or hybrid-diagnostic markers of M. × thuringiaca were found within "M. ciliata". PCoA and NJ showed an overlapping genetic diversity of "M. ciliata" and M. transsilvanica. Hierar­chical AMOVA supported the absence of a significant genotypic distinction between "M. ciliata" and M. transsilvanica. ANOVA showed that the length ratio of lower to upper glumes was the best morphological character to discriminate between M. ciliata and M. transsilvanica. Combined morphological and genetic data show that M. ciliata is not currently present in Poland as its putative Polish populations represent M. transsilvanica. A significant decrease in genetic varia­bility that could influence viability was not observed the in Sudetian populations of M. transsilvanica. However, the population size changes significantly as a result of plant succession. Correction of the northern limit of the continuous distribution of M. ciliata L. in Central Europe is presented.

  15. Assessment of Functional EST-SSR Markers (Sugarcane in Cross-Species Transferability, Genetic Diversity among Poaceae Plants, and Bulk Segregation Analysis

    Directory of Open Access Journals (Sweden)

    Shamshad Ul Haq

    2016-01-01

    Full Text Available Expressed sequence tags (ESTs are important resource for gene discovery, gene expression and its regulation, molecular marker development, and comparative genomics. We procured 10000 ESTs and analyzed 267 EST-SSRs markers through computational approach. The average density was one SSR/10.45 kb or 6.4% frequency, wherein trinucleotide repeats (66.74% were the most abundant followed by di- (26.10%, tetra- (4.67%, penta- (1.5%, and hexanucleotide (1.2% repeats. Functional annotations were done and after-effect newly developed 63 EST-SSRs were used for cross transferability, genetic diversity, and bulk segregation analysis (BSA. Out of 63 EST-SSRs, 42 markers were identified owing to their expansion genetics across 20 different plants which amplified 519 alleles at 180 loci with an average of 2.88 alleles/locus and the polymorphic information content (PIC ranged from 0.51 to 0.93 with an average of 0.83. The cross transferability ranged from 25% for wheat to 97.22% for Schlerostachya, with an average of 55.86%, and genetic relationships were established based on diversification among them. Moreover, 10 EST-SSRs were recognized as important markers between bulks of pooled DNA of sugarcane cultivars through BSA. This study highlights the employability of the markers in transferability, genetic diversity in grass species, and distinguished sugarcane bulks.

  16. Relative efficiencies of the Burkard 7-Day, Rotorod and Burkard Personal samplers for Poaceae and Urticaceae pollen under field conditions

    DEFF Research Database (Denmark)

    Peel, Robert George; Kennedy, Roy; Smith, Matt

    2014-01-01

    Introduction: In aerobiological studies it is often necessary to compare concentration data recorded with different models of sampling instrument. Sampler efficiency typically varies from device to device, and depends on the target aerosol and local atmospheric conditions. To account for these di...

  17. Seed dormancy, seedling establishment and dynamics of the soil seed bank of Stipa bungeana (Poaceae on the Loess Plateau of northwestern China.

    Directory of Open Access Journals (Sweden)

    Xiao Wen Hu

    Full Text Available Studying seed dormancy and its consequent effect can provide important information for vegetation restoration and management. The present study investigated seed dormancy, seedling emergence and seed survival in the soil seed bank of Stipa bungeana, a grass species used in restoration of degraded land on the Loess Plateau in northwest China. Dormancy of fresh seeds was determined by incubation of seeds over a range of temperatures in both light and dark. Seed germination was evaluated after mechanical removal of palea and lemma (hulls, chemical scarification and dry storage. Fresh and one-year-stored seeds were sown in the field, and seedling emergence was monitored weekly for 8 weeks. Furthermore, seeds were buried at different soil depths, and then retrieved every 1 or 2 months to determine seed dormancy and seed viability in the laboratory. Fresh seeds (caryopses enclosed by palea and lemma had non-deep physiological dormancy. Removal of palea and lemma, chemical scarification, dry storage (afterripening, gibberellin (GA3 and potassium nitrate (KNO3 significantly improved germination. Dormancy was completely released by removal of the hulls, but seeds on which hulls were put back to their original position germinated to only 46%. Pretreatment of seeds with a 30% NaOH solution for 60 min increased germination from 25% to 82%. Speed of seedling emergence from fresh seeds was significantly lower than that of seeds stored for 1 year. However, final percentage of seedling emergence did not differ significantly for seeds sown at depths of 0 and 1 cm. Most fresh seeds of S. bungeana buried in the field in early July either had germinated or lost viability by September. All seeds buried at a depth of 5 cm had lost viability after 5 months, whereas 12% and 4% seeds of those sown on the soil surface were viable after 5 and 12 months, respectively.

  18. Membrane Stabilization and Detoxification of Acetaminophen-Mediated Oxidative Onslaughts in the Kidneys of Wistar Rats by Standardized Fraction of Zea mays L. (Poaceae, Stigma maydis

    Directory of Open Access Journals (Sweden)

    S. Sabiu

    2016-01-01

    Full Text Available This study evaluated membrane stabilization and detoxification potential of ethyl acetate fraction of Zea mays L., Stigma maydis in acetaminophen-induced oxidative onslaughts in the kidneys of Wistar rats. Nephrotoxic rats were orally pre- and posttreated with the fraction and vitamin C for 14 days. Kidney function, antioxidative and histological analyses were thereafter evaluated. The acetaminophen-mediated significant elevations in the serum concentrations of creatinine, urea, uric acid, sodium, potassium, and tissue levels of oxidized glutathione, protein-oxidized products, lipid peroxidized products, and fragmented DNA were dose-dependently assuaged in the fraction-treated animals. The fraction also markedly improved creatinine clearance rate, glutathione, and calcium concentrations as well as activities of superoxide dismutase, catalase, glutathione reductase, and glutathione peroxidase in the nephrotoxic rats. These improvements may be attributed to the antioxidative and membrane stabilization activities of the fraction. The observed effects compared favorably with that of vitamin C and are informative of the fraction’s ability to prevent progression of renal pathological conditions and preserve kidney functions as evidently supported by the histological analysis. Although the effects were prominently exhibited in the fraction-pretreated groups, the overall data from the present findings suggest that the fraction could prevent or extenuate acetaminophen-mediated oxidative renal damage via fortification of antioxidant defense mechanisms.

  19. A new species of Stenodiplosis (Diptera: Cecidomyiidae) on Spartina grasses (Poaceae) with notes on its biology and its parasitoid Tetrastichus bromi (Hymenoptera: Eulophidae).

    Science.gov (United States)

    López, J Manuel Perilla; Johnson, Paul J; Gagné, Raymond J; Boe, Arvid

    2015-12-09

    Stenodiplosis spartinae Gagné new species (Diptera: Cecidomyiidae) is described from eastern South Dakota and coastal North Carolina, and compared with other American congeners. The known host plants are Spartina alterniflora and S. pectinata. The larva is a seed predator of the ovule and immature caryopsis of the host plant. Adult activity is from the early emergence of the host inflorescence through anthesis. Oviposition occurs in the floret with eggs laid under the edges of the palea and lemma. The larva apparently overwinters in dehisced spikelets in the soil among rhizomes of S. pectinata, with pupation in late spring. Laboratory emergence and field activity of the adults suggest a potentialsecond or third generation developing on late emerging inflorescences. Larval feeding does not induce external color or shape changes in the spikelet. Apparently all three instars are ectoparasitized by Tetrastichus bromi Kostyukov (Hymenoptera: Eulophidae) that was probably introduced to North America in the late 1800's and is inculcated into parasitoid guilds of several Stenodiplosis species. Resource partitioning appears to occur between the gall midge and early instars of Aethes spartinana Barnes and McDunnough (Lepidoptera: Tortricidae) that feed on maturing caryopses. The feeding of this gall midge and the moth probably account for most of the reduced seed production in both natural and agronomic populations of S. pectinata.

  20. Extended distribution of endemic Travancore Murainagrass Ischaemum travancorense Stapf ex C.E.C. Fisch. (Poaceae to central India

    Directory of Open Access Journals (Sweden)

    Mandar N. Datar

    2014-12-01

    Full Text Available Ischaemum travancorense Stapf ex C.E.C. Fisch., an endemic species, earlier known only from the Western Ghats of Kerala, Maharashtra and Goa is reported here for the first time from central India. 

  1. Development of ent-kaurene Oxidase-Based Conserved Intron Spanning Primers for Species Identification in the Genus Poa (Poaceae; Bluegrass)

    OpenAIRE

    Jonathan M. LaMantia; Ambika Chandra; David R. Huff

    2018-01-01

    Interspecific hybridization has been attempted to combine the heat and drought of Poa arachnifera Torr. with the turf quality characteristics of several Poa species. Confirmation of an F1 hybrid through morphological analysis of vegetative and flowering characteristics is often time consuming and ambiguous. Ent-kaurene oxidase (KO) has been sequenced in rice, barley, and wheat. In rice, each of the five copies of KO gene has unique lengths for the first intron. Conserved intron spanning prime...

  2. Development of ent-kaurene Oxidase-Based Conserved Intron Spanning Primers for Species Identification in the Genus Poa (Poaceae; Bluegrass

    Directory of Open Access Journals (Sweden)

    Jonathan M. LaMantia

    2018-04-01

    Full Text Available Interspecific hybridization has been attempted to combine the heat and drought of Poa arachnifera Torr. with the turf quality characteristics of several Poa species. Confirmation of an F1 hybrid through morphological analysis of vegetative and flowering characteristics is often time consuming and ambiguous. Ent-kaurene oxidase (KO has been sequenced in rice, barley, and wheat. In rice, each of the five copies of KO gene has unique lengths for the first intron. Conserved intron spanning primers (CISP can be used as a DNA marker to exploit variations of intron lengths that flank conserved gene sequences. In the present study, we developed CISP to sequence partial genomic fragments of the KO gene from seven Poa species. Through sequence analysis, species-specific primers were also developed to produce co-dominant markers that can be used to identify interspecific hybrids between Texas bluegrass and six other Poa species used in the present study.

  3. Polyphyly, gene-duplication and extensive allopolyploidy framed the evolution of the ephemeral Vulpia grasses and other fine-leaved Loliinae (Poaceae).

    Science.gov (United States)

    Díaz-Pérez, A J; Sharifi-Tehrani, M; Inda, L A; Catalán, P

    2014-10-01

    The fine-leaved Loliinae is one of the temperate grass lineages that is richest in number of evolutionary switches from perennial to annual life-cycle, and also shows one of the most complex reticulate patterns involving distinct diploid and allopolyploid lineages. Eight distinct annual lineages, that have traditionally been placed in the genus Vulpia and in other fine-leaved ephemeral genera, have apparently emerged from different perennial Festuca ancestors. The phenotypically similar Vulpia taxa have been reconstructed as polyphyletic, with polyploid lineages showing unclear relationships to their purported diploid relatives. Interspecific and intergeneric hybridization is, however, rampant across different lineages. An evolutionary analysis based on cloned nuclear low-copy GBSSI (Granule-Bound Starch Synthase I) and multicopy ITS (Internal Transcribed Spacer) sequences has been conducted on representatives of most Vulpia species and other fine-leaved lineages, using Bayesian consensus and agreement trees, networking split graphs and species tree-based approaches, to disentangle their phylogenetic relationships and to identify the parental genome donors of the allopolyploids. Both data sets were able to reconstruct a congruent phylogeny in which Vulpia was resolved as polyphyletic from at least three main ancestral diploid lineages. These, in turn, participated in the origin of the derived allopolyploid Vulpia lineages together with other Festuca-like, Psilurus-like and some unknown genome donors. Long-distance dispersal events were inferred to explain the polytopic origin of the Mediterranean and American Vulpia lineages. Copyright © 2014 Elsevier Inc. All rights reserved.

  4. Phylogeny and evolutionary history of Leymus (Triticeae; Poaceae based on a single-copy nuclear gene encoding plastid acetyl-CoA carboxylase

    Directory of Open Access Journals (Sweden)

    Ding Cun-Bang

    2009-10-01

    Full Text Available Abstract Background Single- and low- copy genes are less likely subject to concerted evolution, thus making themselves ideal tools for studying the origin and evolution of polyploid taxa. Leymus is a polyploid genus with a diverse array of morphology, ecology and distribution in Triticeae. The genomic constitution of Leymus was assigned as NsXm, where Ns was presumed to be originated from Psathyrostachys, while Xm represented a genome of unknown origin. In addition, little is known about the evolutionary history of Leymus. Here, we investigate the phylogenetic relationship, genome donor, and evolutionary history of Leymus based on a single-copy nuclear Acc1 gene. Results Two homoeologues of the Acc1 gene were isolated from nearly all the sampled Leymus species using allele-specific primer and were analyzed with those from 35 diploid taxa representing 18 basic genomes in Triticeae. Sequence diversity patterns and genealogical analysis suggested that (1 Leymus is closely related to Psathyrostachys, Agropyron, and Eremopyrum; (2 Psathyrostachys juncea is an ancestral Ns-genome donor of Leymus species; (3 the Xm genome in Leymus may be originated from an ancestral lineage of Agropyron and Eremopyrum triticeum; (4 the Acc1 sequences of Leymus species from the Qinghai-Tibetan plateau are evolutionarily distinct; (5 North America Leymus species might originate from colonization via the Bering land bridge; (6 Leymus originated about 11-12MYA in Eurasia, and adaptive radiation might have occurred in Leymus during the period of 3.7-4.3 MYA and 1.7-2.1 MYA. Conclusion Leymus species have allopolyploid origin. It is hypothesized that the adaptive radiation of Leymus species might have been triggered by the recent upliftings of the Qinghai-Tibetan plateau and subsequent climatic oscillations. Adaptive radiation may have promoted the rapid speciation, as well as the fixation of unique morphological characters in Leymus. Our results shed new light on our understanding of the origin of Xm genome, the polyploidization events and evolutionary history of Leymus that could account for the rich diversity and ecological adaptation of Leymus species.

  5. Leaf transcriptome of two highly divergent genotypes of Urochloa humidicola (Poaceae), a tropical polyploid forage grass adapted to acidic soils and temporary flooding areas.

    Science.gov (United States)

    Vigna, Bianca Baccili Zanotto; de Oliveira, Fernanda Ancelmo; de Toledo-Silva, Guilherme; da Silva, Carla Cristina; do Valle, Cacilda Borges; de Souza, Anete Pereira

    2016-11-11

    Urochloa humidicola (Koronivia grass) is a polyploid (6x to 9x) species that is used as forage in the tropics. Facultative apospory apomixis is present in most of the genotypes of this species, although one individual has been described as sexual. Molecular studies have been restricted to molecular marker approaches for genetic diversity estimations and linkage map construction. The objectives of the present study were to describe and compare the leaf transcriptome of two important genotypes that are highly divergent in terms of their phenotypes and reproduction modes: the sexual BH031 and the aposporous apomictic cultivar BRS Tupi. We sequenced the leaf transcriptome of Koronivia grass using an Illumina GAIIx system, which produced 13.09 Gb of data that consisted of 163,575,526 paired-end reads between the two libraries. We de novo-assembled 76,196 transcripts with an average length of 1,152 bp and filtered 35,093 non-redundant unigenes. A similarity search against the non-redundant National Center of Biotechnology Information (NCBI) protein database returned 65 % hits. We annotated 24,133 unigenes in the Phytozome database and 14,082 unigenes in the UniProtKB/Swiss-Prot database, assigned 108,334 gene ontology terms to 17,255 unigenes and identified 5,324 unigenes in 327 known metabolic pathways. Comparisons with other grasses via a reciprocal BLAST search revealed a larger number of orthologous genes for the Panicum species. The unigenes were involved in C4 photosynthesis, lignocellulose biosynthesis and flooding stress responses. A search for functional molecular markers revealed 4,489 microsatellites and 560,298 single nucleotide polymorphisms (SNPs). A quantitative real-time PCR analysis validated the RNA-seq expression analysis and allowed for the identification of transcriptomic differences between the two evaluated genotypes. Moreover, 192 unannotated sequences were classified as containing complete open reading frames, suggesting that the new, potentially exclusive genes should be further investigated. The present study represents the first whole-transcriptome sequencing of U. humidicola leaves, providing an important public information source of transcripts and functional molecular markers. The qPCR analysis indicated that the expression of certain transcripts confirmed the differential expression observed in silico, which demonstrated that RNA-seq is useful for identifying differentially expressed and unique genes. These results corroborate the findings from previous studies and suggest a hybrid origin for BH031.

  6. Gene capture from across the grass family in the allohexaploid Elymus repens (L.) Gould (Poaceae, Triticeae) as evidenced by ITS, GBSSI, and molecular cytogenetics.

    Science.gov (United States)

    Mahelka, Václav; Kopecký, David

    2010-06-01

    Four accessions of hexaploid Elymus repens from its native Central European distribution area were analyzed using sequencing of multicopy (internal transcribed spacer, ITS) and single-copy (granule-bound starch synthase I, GBSSI) DNA in concert with genomic and fluorescent in situ hybridization (GISH and FISH) to disentangle its allopolyploid origin. Despite extensive ITS homogenization, nrDNA in E. repens allowed us to identify at least four distinct lineages. Apart from Pseudoroegneria and Hordeum, representing the major genome constituents, the presence of further unexpected alien genetic material, originating from species outside the Triticeae and close to Panicum (Paniceae) and Bromus (Bromeae), was revealed. GBSSI sequences provided information complementary to the ITS. Apart from Pseudoroegneria and Hordeum, two additional gene variants from within the Triticeae were discovered: One was Taeniatherum-like, but the other did not have a close relationship with any of the diploids sampled. GISH results were largely congruent with the sequence-based markers. GISH clearly confirmed Pseudoroegneria and Hordeum as major genome constituents and further showed the presence of a small chromosome segment corresponding to Panicum. It resided in the Hordeum subgenome and probably represents an old acquisition of a Hordeum progenitor. Spotty hybridization signals across all chromosomes after GISH with Taeniatherum and Bromus probes suggested that gene acquisition from these species is more likely due to common ancestry of the grasses or early introgression than to recent hybridization or allopolyploid origin of E. repens. Physical mapping of rDNA loci using FISH revealed that all rDNA loci except one minor were located on Pseudoroegneria-derived chromosomes, which suggests the loss of all Hordeum-derived loci but one. Because homogenization mechanisms seem to operate effectively among Pseudoroegneria-like copies in this species, incomplete ITS homogenization in our samples is probably due to an interstitial position of an individual minor rDNA locus located within the Hordeum-derived subgenome.

  7. Histopatología de Ustilaginales (carbones) en Poaceas de los géneros Sorghum, Bromus y Glyceria

    OpenAIRE

    Astiz Gassó, Marta Mónica

    2017-01-01

    Sporisorium cruentum (Kühn.), es el agente causal de enfermedades en el género Sorghum incluyendo Sorghum halepense (L.) Pers.. El presente trabajo tuvo por objeto analizar el desarrollo y la evolución del patógeno en los tejidos del hospedante, y evaluar las implicancias de la enfermedad en el crecimiento vegetativo de los rizomas del sorgo de alepo. Para determinar la presencia del hongo se realizaron cortes histológicos del hospedante que se observaron por medio de microscopía óptica (MO) ...

  8. Facilitative ecological interactions between invasive species: Arundo donax (Poaceae) stands as favorable habitat for cattle ticks (Acari: Ixodidae) along the U.S.-Mexico border

    Science.gov (United States)

    The southern cattle tick, Rhipicephalus (Boophilus) microplus (Canestrini), is a key vector of protozoa that causes bovine babesiosis. Largely eradicated from most of the U.S., the cattle tick continues to infest the Cattle Fever Tick Quarantine Zone in south Texas. Management areas of the souther...

  9. An updated checklist and key to the open-panicled species of Poa L. (Poaceae) in Peru including three new species, Poa ramoniana, Poa tayacajaensis, and Poa urubambensis

    Science.gov (United States)

    Sylvester, Steven P.; Soreng, Robert J.; Peterson, Paul M.; Sylvester, Mitsy D.P.V.

    2016-01-01

    Abstract We provide an updated checklist and key to the 30 Poa species with open panicles from Peru which includes previously circumscribed Dissanthelium and Aphanelytrum species, new taxon records, and three undescribed species. Poa compressa, Poa grisebachii, and Poa leioclada are recorded from Peru for the first time. A number of species are placed in synonymy: Poa carazensis, Poa ferreyrae and Poa tovarii are synonymized under the name Poa fibrifera; Poa adusta (tentatively) and Poa pilgeri are synonymized under Poa candamoana; Poa superata is synonymized under Poa grisebachii; and Poa paramoensis is synonymized under Poa huancavelicae. Included within this treatment are three new species, Poa ramoniana, Poa tayacajaensis and Poa urubambensis, which are described and illustrated. Poa ramoniana, found growing near lakes in high elevation Puna grasslands of Junín, is similar to a small form of Poa glaberrima, but differs in having rhizomes and growing to only 5 cm tall. Poa tayacajaensis, found from shrublands on Andean slopes of Huancavelica and Huánuco, bears similarities to Poa aequatoriensis but differs in having shorter lemmas which are pubescent between the veins, densely scabrous sheaths with smooth, glabrous throats, and shorter ligules. Poa urubambensis, a common element of the undisturbed Polylepis forest understory of the Cordillera Urubamba, Cusco, is distinct from all other members of open-panicled Poa’s by having glabrous lemmas with a smooth and glabrous callus, and notably small anthers. The type material for the name Poa adusta is discussed and a lectotype is selected. PMID:27489489

  10. REVISIÓN DEL GÉNERO AXONOPUS (POACEAE: PANICEAE: PRIMER REGISTRO DEL GÉNERO EN EUROPA Y NOVEDADES TAXONÓMICAS

    Directory of Open Access Journals (Sweden)

    GIRALDO-CAÑAS DIEGO

    2008-12-01

    Full Text Available Axonopus P. Beauv. es un género nativo del continente americano, del que se conocen unas 72 especies, principalmente concentradas en el norte de Sudamérica, con algunos representantes aparentemente introducidos en el Viejo Mundo. Se registra el género Axonopus por primera vez en Europa con la especie Axonopus fissifolius (Raddi Kuhlm. Por otra parte, cinco binomios se reducen a la sinonimia de Axonopus compressus (Sw. P. Beauv. y de Axonopus scoparius (Flüggé Kuhlm. Se presentan las descripciones de las tres especies tratadas, sus sinónimos, sus ilustraciones, su distribución geográfica y ecológica, y se comentan algunas particularidades

  11. Verification of the systematic position of California brome (Bromus carinatus Hook. and Arn., Poaceae, cv. 'Broma', on the basis of analysis of issr markers

    Directory of Open Access Journals (Sweden)

    Agnieszka Sutkowska

    2012-10-01

    Full Text Available ‘Broma’ is a grass cultivar belonging to the species Bromus carinatus. In the Lists of Agricultural Plant Varieties of the Research Centre for Cultivar Testing (COBORU, it is shown as Bromus willdenowii (= B. catharticus, B. unioloides (List of Agricultural Plant Varieties 1989-2009, whereas already in 1984 Mirek demonstrated on the basis of morphological analysis that this was a different closely related species – B. carinatus. The aim of the present study was to verify the species affiliation of cv. ‘Broma’. The conducted analysis of ISSR molecular markers included representatives of cv. ‘Broma” as well as of B. carinatus and B. willdenowii. The method used allowed the identification of molecular markers of the above-mentioned taxa. The numerical analysis of the obtained results suggests that cv. ‘Broma’ should be classified in the species B. carinatus, not B. willdenowii.

  12. Genetic structure and diversity of the selfing model grass Brachypodium stacei (Poaceae in Western Mediterranean: out of the Iberian Peninsula and into the islands

    Directory of Open Access Journals (Sweden)

    Valeriia Shiposha

    2016-09-01

    Full Text Available Annual Mediterranean species of the genus Brachypodium are promising model plants for energy crops since their selfing nature and short-life cycles are an advantage in breeding programs. The false brome, B. distachyon, has already been sequenced and new genomic initiatives have triggered the de-novo genome sequencing of its close relatives such as B. stacei, a species that was until recently mistaken for B. distachyon. However, the success of these initiatives hinges on detailed knowledge about the distribution of genetic variation within and among populations for the effective use of germplasm in a breeding program. Understanding population genetic diversity and genetic structure is also an important prerequisite for designing effective experimental populations for genomic wide studies. However, population genetic data are still limited in B. stacei. We therefore selected and amplified 10 nuclear microsatellite markers to depict patterns of population structure and genetic variation among 181 individuals from 19 populations of B. stacei occurring in its predominant range, the western Mediterranean area: mainland Iberian Peninsula, continental Balearic Islands and oceanic Canary Islands. Our genetic results support the occurrence of a predominant selfing system with extremely high levels of homozygosity across the analyzed populations. Despite the low level of genetic variation found, two different genetic clusters were retrieved, one clustering all SE Iberian mainland populations and the island of Minorca and another one grouping all S Iberian mainland populations, the Canary Islands and all Majorcan populations except one that clustered with the former group. These results, together with a high sharing of alleles (89% suggest different colonization routes from the mainland Iberian Peninsula into the islands. A recent colonization scenario could explain the relatively low levels of genetic diversity and low number of alleles found in the Canary Islands populations while older colonization events are hypothesized to explain the high genetic diversity values found in the Majorcan populations. Our study provides widely applicable information about geographical patterns of genetic variation in B. stacei. Among others, the genetic pattern and the existence of local alleles will need to be adequately reflected in the germplasm collection of B. stacei for efficient genome wide association studies.

  13. Genetic structure and diversity of the selfing model grass Brachypodium stacei (Poaceae) in Western Mediterranean: out of the Iberian Peninsula and into the islands.

    Science.gov (United States)

    Shiposha, Valeriia; Catalán, Pilar; Olonova, Marina; Marques, Isabel

    2016-01-01

    Annual Mediterranean species of the genus Brachypodium are promising model plants for energy crops since their selfing nature and short-life cycles are an advantage in breeding programs. The false brome, B. distachyon, has already been sequenced and new genomic initiatives have triggered the de-novo genome sequencing of its close relatives such as B. stacei, a species that was until recently mistaken for B. distachyon. However, the success of these initiatives hinges on detailed knowledge about the distribution of genetic variation within and among populations for the effective use of germplasm in a breeding program. Understanding population genetic diversity and genetic structure is also an important prerequisite for designing effective experimental populations for genomic wide studies. However, population genetic data are still limited in B. stacei. We therefore selected and amplified 10 nuclear microsatellite markers to depict patterns of population structure and genetic variation among 181 individuals from 19 populations of B. stacei occurring in its predominant range, the western Mediterranean area: mainland Iberian Peninsula, continental Balearic Islands and oceanic Canary Islands. Our genetic results support the occurrence of a predominant selfing system with extremely high levels of homozygosity across the analyzed populations. Despite the low level of genetic variation found, two different genetic clusters were retrieved, one clustering all SE Iberian mainland populations and the island of Minorca and another one grouping all S Iberian mainland populations, the Canary Islands and all Majorcan populations except one that clustered with the former group. These results, together with a high sharing of alleles (89%) suggest different colonization routes from the mainland Iberian Peninsula into the islands. A recent colonization scenario could explain the relatively low levels of genetic diversity and low number of alleles found in the Canary Islands populations while older colonization events are hypothesized to explain the high genetic diversity values found in the Majorcan populations. Our study provides widely applicable information about geographical patterns of genetic variation in B. stacei. Among others, the genetic pattern and the existence of local alleles will need to be adequately reflected in the germplasm collection of B. stacei for efficient genome wide association studies.

  14. DIVERSIDAD DE LA FAMILIA POACEAE (GRAMINEAE) EN LA REGIÓN DEL BÍO-BÍO, CHILE, BASADA EN COLECCIONES DE HERBARIO

    OpenAIRE

    Finot, Víctor L; Marticorena, Clodomiro; Barrera, Juan A; Muñoz-Schick, Mélica; Negritto, María A

    2009-01-01

    La Región del Bío-Bío se encuentra en la zona sur de Chile central, considerado un hotspot de biodiversidad. Aunque es una región fuertemente intervenida por el hombre, principalmente por la agricultura, la forestación, la industrialización y la urbanización, tiene un bajo porcentaje de superficie protegida por el Sistema Nacional de Áreas Silvestres Protegidas del Estado (SNASPE). Por ello, documentar la biodiversidad de la región es una tarea ineludible. Se analizó la diversidad de la famil...

  15. Gene Capture from Across the Grass Family in the Allohexaploid Elymus repens (L.) Gould (Poaceae, Triticeae) as Evidenced by ITS, GBSSI, and Molecular Cytogenetics

    Czech Academy of Sciences Publication Activity Database

    Mahelka, Václav; Kopecký, David

    2010-01-01

    Roč. 27, č. 6 (2010), s. 1370-1390 ISSN 0737-4038 R&D Projects: GA ČR GP206/09/P312; GA ČR GA206/09/1126 Institutional research plan: CEZ:AV0Z60050516; CEZ:AV0Z50380511 Keywords : Elymus repens * hybridization * Triticeae Subject RIV: EF - Botanics Impact factor: 5.510, year: 2010

  16. First record of Atherigona reversura Villeneuve (Diptera: Muscidae feeding on Bermudagrass (Cynodon dactylon cv. Jiggs, Poaceae in Brazil: morphological and molecular tools for identification

    Directory of Open Access Journals (Sweden)

    Leandro do Prado Ribeiro

    2016-07-01

    Full Text Available Bermudagrass (Cynodon dactylon cv. Jiggs is an important food source for dairy cattle in the semi-intensive milk production systems most often used in southern Brazil. Although many insect pests are associated with feed grasses, we report here the first occurrence of the fly Atherigona (Atherigona reversura Villeneuve, 1936 (Diptera: Muscidae feeding on bermudagrass in Brazil. This potential pest was observed in April 2015 in three localities (Abelardo Luz, Palmitos, and Videira in western Santa Catarina, in southern Brazil. The infested plants had senescent and necrotic terminal leaves that reduced plant growth. New growth had to sprout new tillers from basal nodes, which resulted in a reduced plant growth rate. We also provide a morphological identification key (with figures for A. (Atherigona reversura and A. (Acritochaeta orientalis Schiner, 1868. A molecular identification based on COI is also provided to better differentiate species. Keywords: COI gene, Insect pest, Pastures, Plant–insect interaction

  17. REVISIÓN DE LAS ESPECIES DEL GÉNERO SPOROBOLUS (POACEAE: CHLORIDOIDEAE: SPOROBOLINAE DEL NOROESTE DE SUDAMÉRICA: PERÚ, ECUADOR, COLOMBIA Y VENEZUELA

    Directory of Open Access Journals (Sweden)

    Giraldo-Cañas Diego

    2009-06-01

    Full Text Available Se presenta un estudio taxonómico de las especies de Sporobolus para el noroeste de Sudamérica. Se reconocen once especies para el área de estudio. Se incluyen las claves para determinar las especies así como las descripciones morfológicas y sus ilustraciones. Se discuten para cada una de las especies sus relaciones morfológicas, su distribución geográfica y sus preferencias ecológicas; adicionalmente, se relacionan sus usos y sus nombres comunes. Asimismo, se propone la lectotipificación para Sporobolus lasiophyllus Pilg. Por otra parte, se registran tres especies por primera vez para Colombia [Sporobolus pilifer (Trin. Kunth, Sporobolus tenuissimus (Mart. ex Schrank Kuntze y Sporobolus virginicus (L. Kunth]. Se excluyen de este tratamiento a Sporobolus brasiliensis (Raddi Hack. (=Eragrostis airoides Nees y Sporobolus domingensis (Trin. Kunth. Adicionalmente, se propone la adopción y la unificación de algunos términos morfológicos en agrostología, tales como caña, panoja, espiguilla, lema, antecio y cariopsis, en lugar de culmo, panícula, espícula, lemma, flósculo y cariopse-cariópside, respectivamente.

  18. Uso de Leersia hexandra (Poaceae) en la fitorremediación de suelos contaminados con petróleo fresco e intemperizado

    OpenAIRE

    Arias-Trinidad, Alfredo; Rivera-Cruz, María del Carmen; Roldán-Garrigós, Antonio; Aceves-Navarro, Lorenzo Armando; Quintero-Lizaola, Roberto; Hernández-Guzmán, Javier

    2017-01-01

    ResumenLa industria petrolera ha generado derrames crónicos de petróleo y su acumulación en Gleysoles en zonas anegadas en el estado de Tabasco, en el sureste de México. El anegamiento es un factor que limita el uso de tecnologías de remediación por el alto costo y los bajos niveles de degradación del petróleo, sin embargo, Leersia hexandra Sw. es un pasto que crece en estas zonas contaminadas con petróleo intemperizado. El objetivo del estudio fue evaluar la densidad de bacterias, producción...

  19. Ultraestructura de bambúes del género Dendrocalamus (Poaceae: Bambusoideae cultivados en Costa Rica II: Dendrocalamus latiflorus var. latiflorus

    Directory of Open Access Journals (Sweden)

    Mayra Montiel

    2006-06-01

    Full Text Available Mediante el microscopio electrónico de barrido se analizaron muestras de lámina foliar, culmo y rama, así como las brácteas del culmo y yemas de las ramas de Dendrocalamus latiflorus var. latiflorus. Se determinó la presencia en la epidermis abaxial de la lámina foliar de dos tipos de papilas céricas, esféricas y alargadas; éstas últimas rodeando los estomas de bajo domo. Sólo en la superficie adaxial de la nervadura central de la lámina foliar aparecen grandes tricomas en forma de gancho. En la zona abaxial de las brácteas del culmo, hay tricomas alargados y delgados similares a los de las brácteas de D. giganteus y las yemas de las ramas están cubiertas por tricomas bicelulares.We used a scanning electron microscope to observe leaf laminae, culms, branches, culm bracts and branch buds of Dendrocalamus latiflorus var. latiflorus grown in Costa Rica. In the abaxial epidermis of the leaf lamina we found two types of ceric papillae, rounded and elongated, the latter surrounding the low dome stomata. Only the adaxial surface of the central nervature (leaf lamina has big hook-sshaped trichomes. In the abaxial zone of the culm bract there are thin elongated trichomes, similar to those from the bract of Dendrocalamus giganteus. The branch buds are covered by bicelular trichomes. Rev. Biol. Trop. 54(Suppl. 2: 51-57. Epub 2006 Dec. 01.

  20. Ultraestructura de bambúes del género Dendrocalamus (Poaceae: Bambusoideae cultivados en Costa Rica IV: Dendrocalamus asper, clones Taiwán y Tailandia

    Directory of Open Access Journals (Sweden)

    Mayra Montiel

    2006-06-01

    Full Text Available El análisis ultraestructural de los clones taiwanés y tailandés de Dendrocalamus asper, realizado al microscopio electrónico de barrido, mostró que el clon de Taiwán tiene estomas de bajo domo en la lámina foliar, mientras que el de Tailandia tiene estomas de alto domo; las acumulaciones de cera cuticular en el clon de Taiwán son de dos formas (cuatro en el de Tailandia. La distribución de los tejidos vasculares es igual en ambos, así como los tejidos que los rodean. Sería difícil identificar estos clones por la observación macroscópica o microscópica de las brácteas del culmo, pues no presentan diferencias significativas: una identificación fiable requiere considerar la ultraestructura de los estomas y las acumulaciones de cera cuticular.An ultraestructural analysis of the Taiwan and Thailand clones of Dendrocalamus asper made with the scanning electron microscope showed that the Taiwan clone had low dome stomata while the Thailand clone has high dome stomata in the leaf lamina. Cuticular wax accumulations in the Taiwan clone has two shapes, against four in the Thailand clone. Both have the same distribution of vascular and surrounding tissues. Macroscopic or microscopic observation of culm bracts are not recommended to differentiate these clones: a reliable identification requires observation of the ultrastructure of stomata and cuticular wax accumulations. Rev. Biol. Trop. 54(Suppl. 2: 65-75. Epub 2006 Dec. 01.

  1. Species-Level Phylogeny and Polyploid Relationships in Hordeum (Poaceae) Inferred by Next-Generation Sequencing and In Silico Cloning of Multiple Nuclear Loci.

    Science.gov (United States)

    Brassac, Jonathan; Blattner, Frank R

    2015-09-01

    Polyploidization is an important speciation mechanism in the barley genus Hordeum. To analyze evolutionary changes after allopolyploidization, knowledge of parental relationships is essential. One chloroplast and 12 nuclear single-copy loci were amplified by polymerase chain reaction (PCR) in all Hordeum plus six out-group species. Amplicons from each of 96 individuals were pooled, sheared, labeled with individual-specific barcodes and sequenced in a single run on a 454 platform. Reference sequences were obtained by cloning and Sanger sequencing of all loci for nine supplementary individuals. The 454 reads were assembled into contigs representing the 13 loci and, for polyploids, also homoeologues. Phylogenetic analyses were conducted for all loci separately and for a concatenated data matrix of all loci. For diploid taxa, a Bayesian concordance analysis and a coalescent-based dated species tree was inferred from all gene trees. Chloroplast matK was used to determine the maternal parent in allopolyploid taxa. The relative performance of different multilocus analyses in the presence of incomplete lineage sorting and hybridization was also assessed. The resulting multilocus phylogeny reveals for the first time species phylogeny and progenitor-derivative relationships of all di- and polyploid Hordeum taxa within a single analysis. Our study proves that it is possible to obtain a multilocus species-level phylogeny for di- and polyploid taxa by combining PCR with next-generation sequencing, without cloning and without creating a heavy load of sequence data. © The Author(s) 2015. Published by Oxford University Press, on behalf of the Society of Systematic Biologists.

  2. FITODEPURACIÓN DE AGUAS RESIDUALES DOMESTICAS CON POACEAS: Brachiaria mutica, Pennisetum purpureum y Panicum maximunEN EL MUNICIPIO DE POPAYÁN, CAUCA

    Directory of Open Access Journals (Sweden)

    GIOVANI HERNÁN PALTA-PRADO

    2013-12-01

    Full Text Available El asentamiento Brisas de San Isidro del Municipio de Popayán no presenta sistema de colección de aguas servidas, las cuales son vertidas directamente sobre la Quebrada Lame, ocasionando contaminación por la carga orgánica y detergentes provenientes del uso doméstico. El objetivo fue evaluar diferentes especies de gramíneas, buscando una alternativa de manejo de las aguas residuales domésticas con plantas útiles en la alimentación animal. Para tal fin se establecieron humedales artificiales bajo un diseño de muestreo temporal y un arreglo factorial de bloques al azar. Se tomaron las muestras de agua residual (pH, oxígeno disuelto (OD, concentración de CO2, demanda biológica oxigeno (DBO, demanda química oxigeno (DQO, conductividad, amonio (NH4+, nitratos (NO3-, fosfatos (PO4 y nitritos (NO2- y Demanda Bioquímica de Oxigeno (DBO5 cada quince días durante seis meses. El análisis estadístico, se realizó por medio de una ANOVA comparando los tratamientos expuestos y una prueba posthoc de Tuckey. El análisis de varianza, mostro diferencias estadísticas significativas para los parámetros oxígeno disuelto (OD, demanda química oxigeno (DQO, amonio (NH4+, nitratos (NO3-, nitritos (NO2- y coliformes totales; evidenciando que los mejores tratamientos fueron B. mutica y P. maximun

  3. Diversity and biomass of native macrophytes are negatively related to dominance of an invasive Poaceae in Brazilian sub-tropical streams

    Directory of Open Access Journals (Sweden)

    Luiz Felipe Gonçalves Fernandes

    2013-06-01

    Full Text Available Besides exacerbated exploitation, pollution, flow alteration and habitats degradation, freshwater biodiversity is also threatened by biological invasions. This paper addresses how native aquatic macrophyte communities are affected by the non-native species Urochloa arrecta, a current successful invader in Brazilian freshwater systems. We compared the native macrophytes colonizing patches dominated and non-dominated by this invader species. We surveyed eight streams in Northwest Paraná State (Brazil. In each stream, we recorded native macrophytes' richness and biomass in sites where U. arrecta was dominant and in sites where it was not dominant or absent. No native species were found in seven, out of the eight investigated sites where U. arrecta was dominant. Thus, we found higher native species richness, Shannon index and native biomass values in sites without dominance of U. arrecta than in sites dominated by this invader. Although difficult to conclude about causes of such differences, we infer that the elevated biomass production by this grass might be the primary reason for alterations in invaded environments and for the consequent impacts on macrophytes' native communities. However, biotic resistance offered by native richer sites could be an alternative explanation for our results. To mitigate potential impacts and to prevent future environmental perturbations, we propose mechanical removal of the invasive species and maintenance or restoration of riparian vegetation, for freshwater ecosystems have vital importance for the maintenance of ecological services and biodiversity and should be preserved.

  4. Progenitor-derivative relationships of Hordeum polyploids (Poaceae, Triticeae inferred from sequences of TOPO6, a nuclear low-copy gene region.

    Directory of Open Access Journals (Sweden)

    Jonathan Brassac

    Full Text Available Polyploidization is a major mechanism of speciation in plants. Within the barley genus Hordeum, approximately half of the taxa are polyploids. While for diploid species a good hypothesis of phylogenetic relationships exists, there is little information available for the polyploids (4×, 6× of Hordeum. Relationships among all 33 diploid and polyploid Hordeum species were analyzed with the low-copy nuclear marker region TOPO6 for 341 Hordeum individuals and eight outgroup species. PCR products were either directly sequenced or cloned and on average 12 clones per individual were included in phylogenetic analyses. In most diploid Hordeum species TOPO6 is probably a single-copy locus. Most sequences found in polyploid individuals phylogenetically cluster together with sequences derived from diploid species and thus allow the identification of parental taxa of polyploids. Four groups of sequences occurring only in polyploid taxa are interpreted as footprints of extinct diploid taxa, which contributed to allopolyploid evolution. Our analysis identifies three key species involved in the evolution of the American polyploids of the genus. (i All but one of the American tetraploids have a TOPO6 copy originating from the Central Asian diploid H. roshevitzii, the second copy clustering with different American diploid species. (ii All hexaploid species from the New World have a copy of an extinct close relative of H. californicum and (iii possess the TOPO6 sequence pattern of tetraploid H. jubatum, each with an additional copy derived from different American diploids. Tetraploid H. bulbosum is an autopolyploid, while the assumed autopolyploid H. brevisubulatum (4×, 6× was identified as allopolyploid throughout most of its distribution area. The use of a proof-reading DNA polymerase in PCR reduced the proportion of chimerical sequences in polyploids in comparison to Taq polymerase.

  5. histone H3 predominantly mark the pericentromeric chromatin

    Indian Academy of Sciences (India)

    SANTOSH KUMAR SHARMA

    pericentromeric chromatin during mitosis in monokinetic plants. J. Genet. .... bigger), cytological preparations (easy to difficult) as well as their habitat ... Poaceae. Monocot. Land. 14. Triticum aestivum. Common wheat. Poaceae. Monocot. Land.

  6. Ocorrência e controle de lesmas do gênero Omalonyx (Gastropoda, Succineidae, pragas de capim-elefante Pennisetum purpureum (Poaceae em Rio Preto da Eva, Amazonas Occurrence and control of Omalonyx slugs (Gastropoda, Succineidae, pests of the elephant-grass Pennisetum purpureum (Poaceae in Rio Preto da Eva, Amazonas

    Directory of Open Access Journals (Sweden)

    Marcos Vinicius Bastos Garcia

    2012-06-01

    Full Text Available Lesmas do gênero Omalonyx d'Orbigny, 1837 são hermafroditas, herbívoras, de distribuição neotropical e vivem em plantas aquáticas, nas demais vegetações adjacentes e em solo úmido próximo a ambientes de água doce. No presente trabalho reporta-se a ocorrência atípica de O. pattersonae Tillier, 1981 e de Omalonyx sp. em área de terra firme, distante de ambiente aquático. Estas espécies aqui reportadas são simpátricas e devido à alta densidade populacional e prejuízos causados às folhas do capim-elefante Pennisetum purpureum Schumach, são caracterizadas como pragas agrícolas. No período da noite as lesmas se alimentavam das folhas do capim elefante e durante o dia permaneciam escondidas na base do caule, próximo a superfície úmida do solo. A aplicação de cal hidratada sobre agregados de indivíduos de Omalonyx spp foi um método efetivo para o controle das populações. As alterações ambientais dos ecossistemas amazônicos para uso agrícola e/ou urbanização tem promovido o aumento populacional de espécies que se adaptam a novos habitats e geralmente se tornam pragas de difícil controle.Slugs of the genus Omalonyx d'Orbigny, 1837 are hermaphrodites, herbivorous, distributed on Neotropical regions, living on aquatic plants, moist soil and terrestrial vegetation close to freshwater systems. The present paper reports the atypical occurrence of O. pattersonae Tillier, 1981 and Omalonyx sp. in an upland area far from any aquatic environment. Both species reported here are sympatric and due to the high populations density and damages caused on leaves of elephant-grass Pennisetum purpureum Schumach, they are recognized as agricultural pests. During the night, the slugs feed on the grass leaves and at the daylight they stayed hidden in the base of stems, near the moist soil surface. The use of hydrated lime distributed over the aggregations of Omalonyx spp. showed to be an effective method to control the populations. The environmental changes in the Amazonian ecosystems for agricultural or urban purposes have promoted the increase of populations of native species that adapt in the new habitat and usually become pests that are difficult to control.

  7. Efeitos fitotóxicos do fluoreto na morfoanatomia foliar de Brachiaria brizantha (Hochst. ex A. Rich. Stapf e Brachiaria decumbens Stapf (Poaceae Phytotoxic effects of fluoride in leaf morpho-anatomy of Brachiaria brizantha (Hochst. Ex A. Rich. Stapf and Brachiaria decumbens Stapf (Poaceae

    Directory of Open Access Journals (Sweden)

    Alice Pita-Barbosa

    2009-12-01

    Full Text Available Visando avaliar os efeitos do fluoreto sobre capim-braquiária, plantas de Brachiaria brizantha e B. decumbens foram submetidas a nevoeiros simulados com fluoreto (10 µg ml-1. Amostras foliares de porções aparentemente sadias foram coletadas 24 horas após a última exposição para análises microscópicas. Folhas, raízes e rizomas foram submetidos à quantificação do teor de fluoreto. As folhas apresentaram necroses pequenas e esparsas. Somente as folhas acumularam fluoreto, apresentando teores 4,4 e 5,2 vezes maiores que no tratamento controle, em B. brizantha e B. decumbens, respectivamente, não havendo diferença no potencial acumulador das duas espécies. As principais alterações micromorfológicas observadas foram lesões próximas aos tricomas, sugerindo que estes sejam as vias preferenciais de entrada do poluente nas plantas. Porções foliares, visualmente sadias, de ambas as espécies apresentaram danos microscópicos antes do surgimento de sintomas, havendo perda da turgidez das células buliformes em B. brizantha e de todos os tecidos em B. decumbens. Alterações micromorfométricas foram observadas somente em B. decumbens, indicando sua maior sensibilidade ao fluoreto, em comparação com B. brizantha. A realização de experimentos de longa duração será fundamental para elucidar o potencial bioacumulador de B. brizantha.To assess the effects of fluoride on signal grass, plants of Brachiaria brizantha and B. decumbens were submitted to simulated fluoride fog (10 µg ml-1. Leaf fragments from apparently healthy portions were colleted 24 hours after the last exposure and used for microscopic analysis. Roots, leaves and rhizomes were submitted to fluoride content quantification. The leaves presented small, sparse necroses. The accumulation of fluoride was observed on the leaves only. B. brizantha and B. decumbens presented, respectively, 4.4 and 5.2 times more fluoride than the control treatment. No difference was observed concerning the accumulation potential of both species. The main micromorphological alterations observed were injuries near the trichomes, therefore, suggesting that these are the preferential routes by which pollutants enter the plants. Visually healthy leaf portions of the two species showed microscopic damages before symptoms appeared, presenting turgidity loss in the bulliform cells of B. brizantha and in all tissues of B. decumbens. Micromorphometric alterations were observed only in B. decumbens, indicating higher sensibility to fluoride in comparison to B. brizantha. Further studies of long duration will be essential to determine the bioaccumulation potential of B. brizantha.

  8. Número cromossômico em acessos de Pennisetum spp. (Poaceae, Poales - DOI: 10.4025/actascibiolsci.v30i3.5016 Chromosome number in Pennisetum spp. accessions (Poaceae, Poales - DOI: 10.4025/actascibiolsci.v30i3.5016

    Directory of Open Access Journals (Sweden)

    Antônio Vander Pereira

    2008-10-01

    Full Text Available Avaliou-se o complemento cromossômico de 16 acessos de Pennisetum disponíveis na Coleção de Germoplasma da Embrapa Gado de Leite – Juiz de Fora, Estado de Minas Gerais. Para a avaliação citogenética, utilizou-se a técnica de esmagamento e coloração com Feulgen. Para quatro acessos foram obtidas metáfases com 2n = 28 cromossomos, confirmando sua classificação como P. purpureum. A origem híbrida P. purpureum x P. glaucum foi constatada em oito acessos, os quais apresentaram 2n = 21. Em um acesso identificado como híbrido entre P. purpureum x P. glaucum, foram observadas metáfases com 2n = 54, permitindo inferir que não se trata de um híbrido interespecífico triplóide. Para outros três acessos avaliados, também foram observadas células com 2n = 54, embora estivessem identificados como híbridos entre P. purpureum x espécie selvagem; P. glaucum policross x hexaplóide 200 e P. glaucum x F92-161-01 ( P. purpureum x P. glaucum .The chromosome complement of 16 Pennisetum accessions belonging to the Germplasm Collection of Embrapa Gado de Leite - Juiz de Fora, Minas Gerais State was evaluated. The cytogenetic analysis employed the smear technique and staining with Feulgen. In four accessions, metaphases with 2n = 28 chromosomes were obtained, confirming their classification as P. purpureum. The hybrid origin P. purpureum x P. glaucum was observed in eight accessions, which presented 2n = 21. In an accession identified as P. purpureum x P. glaucum hybrid, metaphases with 2n = 54 were observed, suggesting that it is not a triploid interspecific hybrid. For three other evaluated accessions, cells with 2n=54 were also observed, although they were identified as hybrids between P. purpureum x wild species; P. glaucum polycross x hexaploid 200 and P. glaucum x [F92-161-01 (P. purpureum x P. glaucum].

  9. Regeneração de espécies arbóreas sob a influência de Merostachys multiramea Hack. (Poaceae em uma floresta subtropical Regeneration of tree species influenced by Merostachys multiramea Hack. (Poaceae in a subtropical forest

    Directory of Open Access Journals (Sweden)

    Suzana Cyrino dos Santos

    2012-03-01

    Full Text Available A ocorrência de bambúseas é comum em muitas fisionomias florestais, sendo que a elevada abundância destas espécies pode interagir com a regeneração de espécies arbóreas. Foi avaliada a regeneração de espécies arbóreas e de Merostachys multiramea Hack. em uma área de transição entre Floresta Ombrófila Mista e Floresta Estacional no Sul do Brasil e comparada a estrutura de regeneração da área entre dois e quatro anos após floração, frutificação e morte de M. multiramea. Foram alocadas 25 unidades amostrais de 100 m² dispostas de forma aleatória, onde foram amostrados todos os colmos vivos de M. multiramea e indivíduos regenerantes de espécies arbóreas > 30 cm de altura e com perímetro à altura do peito The occurrence of bamboo species is common in several forest physiognomies, and the high abundance of these species may affect the regeneration of other ones. We evaluated both tree species and Merostachys multiramea Hack. recruitment in a transition area between mixed Araucaria rain forest and seasonal semideciduous forests in southern Brazil. We compared the regeneration structure of the areas evaluated two and four years after flowering, fruiting and death of M. multiramea. We randomly distributed 25 100 m² sampling units, and surveyed all living culms of M. multiramea and tree saplings. We sampled 4,372 living bamboos and 2,918 tree saplings, belonging to 32 plant families and 75 species. Most species were classified as zoochorous and canopy light-demanding. On the other hand, plant abundance revealed a greater contribution of autochorous, understory and shade-tolerant trees. M. multiramea density was higher over the four years after the reproductive event (p<0.05, with taller culms (p<0.01, but with the same mean number of culms (p=0.46. A NPMANOVA revealed significant differences in composition and abundance between surveys, with higher similarity among samplings two years after the reproductive event of M. multiramea. We also detected higher species richness over the study period, which was found to be directly associated with the abundance of M. multiramea (p=0.002, but with lower evenness of abundance among regenerating species.

  10. Communication Received from Certain Member States Regarding Guidelines for Transfers of Nuclear-related Dual-use Equipment, Material, Software and Related Technology; Comunicacion recibida de algunos Estados Miembros relativa a las directrices para las transferencias de equipos, materiales y programas informaticos de doble uso del ambito nuclear y tecnologia afin

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2010-10-12

    The Agency has received a Note Verbale from the Permanent Mission of Hungary, dated 14 June 2010, in which it requests that the Agency circulate to all Member States a letter of 7 May 2010 from the Chairman of the Nuclear Suppliers Group, Ambassador Ms. Gyorgyi Martin Zanathy, to the Director General, on behalf of the Governments of Argentina, Australia, Austria, Belarus, Belgium, Brazil, Bulgaria, Canada, China, Croatia, Cyprus, Czech Republic, Denmark, Estonia, Finland, France, Germany, Greece, Hungary, Iceland, Ireland, Italy, Japan, Kazakhstan, Republic of Korea, Latvia, Lithuania, Luxemburg, Malta, Netherlands, New Zealand, Norway, Poland, Portugal, Romania, Russian Federation, Slovakia, Slovenia, South Africa, Spain, Sweden, Switzerland, Turkey, Ukraine, the United Kingdom of Great Britain and Northern Ireland and the United States of America,1 providing further information on those Governments' Guidelines for Nuclear Transfers [Spanish] El Organismo ha recibido una nota verbal de la Mision Permanente de Hungria, de fecha 14 de junio de 2010, en la que le solicita que distribuya a todos los Estados Miembros una carta de 7 de mayo de 2010 enviada al Director General por la Presidenta del Grupo de Suministradores Nucleares, la Sra. Embajadora Gyorgyi Martin Zanathy, en nombre de los Gobiernos de Alemania, Argentina, Australia, Austria, Belarus, Belgica, Brasil, Bulgaria, Canada, China, Chipre, Croacia, Dinamarca, Eslovaquia, Eslovenia, Espana, Estados Unidos de America, Estonia, Federacion de Rusia, Finlandia, Francia, Grecia, Hungria, Irlanda, Islandia, Italia, Japon, Kazajstan, Letonia, Lituania, Luxemburgo, Malta, Noruega, Nueva Zelandia, Paises Bajos, Polonia, Portugal, Reino Unido de Gran Bretana e Irlanda del Norte, Republica Checa, Republica de Corea, Rumania, Sudafrica, Suecia, Suiza, Turquia y Ucrania,1 por la que se proporciona mas informacion sobre las Directrices de esos Gobiernos para las transferencias nucleares.

  11. Development of a representative model of a wind turbine in order to study the installation of several machines on a wind park; Developpement d'un modele representatif d'une eolienne afin d'etudier l'implantation de plusieurs machines sur un parc eolien

    Energy Technology Data Exchange (ETDEWEB)

    Jourieh, M

    2007-12-15

    This thesis is devoted to the study of aerodynamics in wind turbines. It is divided into two main parts, one is experimental, and the other deals with modelling and numerical simulation. The velocity field downstream from a three-bladed wind turbine with a horizontal axis is explored in the wind tunnel at ENSAM-Paris. Two measurement techniques are used: hot wire anemometry and Particle Image Velocimetry (PIV). Experimental work gives a clear idea of the structure of the near wake and provides useful data to validate the numerical simulations and the hybrid models which are studied in this thesis. In the work concerning numerical simulation, two hybrid models are defined and implemented: a model of actuator disc and a model of actuator cylinder, coupled with a simulation based on the numerical resolution of the Navier-Stokes equations. These models are validated by the power of the wind turbine and on the velocity field in the near wake of the rotor. The numerical results are compared with the experimental data resulting from the tests carried out by the NREL for NREL phase II and VI cases. The experimental and numerical velocity fields are also compared in the wake of a wind turbine Rutland 503. In both validation cases, power and wake, the experimental data are in accordance with the results provided by the hybrid models. After this validation, the interaction between several wind turbines is studied and quantified. The tested hybrid models are also used to study the interaction between identical wind turbines placed one behind the other. The obtained results highlight the effect of spacing between the machines as well as the effect of free stream velocity. (author)

  12. Development of a representative model of a wind turbine in order to study the installation of several machines on a wind park; Developpement d'un modele representatif d'une eolienne afin d'etudier l'implantation de plusieurs machines sur un parc eolien

    Energy Technology Data Exchange (ETDEWEB)

    Jourieh, M

    2007-12-15

    This thesis is devoted to the study of aerodynamics in wind turbines. It is divided into two main parts, one is experimental, and the other deals with modelling and numerical simulation. The velocity field downstream from a three-bladed wind turbine with a horizontal axis is explored in the wind tunnel at ENSAM-Paris. Two measurement techniques are used: hot wire anemometry and Particle Image Velocimetry (PIV). Experimental work gives a clear idea of the structure of the near wake and provides useful data to validate the numerical simulations and the hybrid models which are studied in this thesis. In the work concerning numerical simulation, two hybrid models are defined and implemented: a model of actuator disc and a model of actuator cylinder, coupled with a simulation based on the numerical resolution of the Navier-Stokes equations. These models are validated by the power of the wind turbine and on the velocity field in the near wake of the rotor. The numerical results are compared with the experimental data resulting from the tests carried out by the NREL for NREL phase II and VI cases. The experimental and numerical velocity fields are also compared in the wake of a wind turbine Rutland 503. In both validation cases, power and wake, the experimental data are in accordance with the results provided by the hybrid models. After this validation, the interaction between several wind turbines is studied and quantified. The tested hybrid models are also used to study the interaction between identical wind turbines placed one behind the other. The obtained results highlight the effect of spacing between the machines as well as the effect of free stream velocity. (author)

  13. Theoretical and experimental study of ions focusing systems in order to improve the ions beam brightness by suppressing aberration causes; Etude theorique et experimentale de la focalisation des ions afin d'ameliorer la brillance du faisceau ionique par la suppression des causes d'aberration

    Energy Technology Data Exchange (ETDEWEB)

    Faure, J

    1966-07-01

    It is shown that a beam brightness can be improved by an order of magnitude when the sources of aberrations are suppressed in the anode region source, as well as in the extraction region and in the electrostatic focusing system. A calculation was first set up to determine a simple focusing system. The aberration ratio due to this focusing system is smaller than 10 to 15 per cent. The experimental study was developed by using an ion source and its extraction system capable of producing an aberration free beam at an energy of 20 keV and an accelerating unit up to 190 keV that confirms that the qualities of a 35 mA beam produced by the said ion source are not spoiled when the beam goes through the focusing and accelerating system that was designed to be aberration free. (author) [French] Dans ce travail, on s'attache a demontrer que la brillance d'un faisceau peut etre amelioree d'un ordre de grandeur lorsque l'on supprime les causes d'aberration aussi bien a la sortie de la source, dans la zone d'extraction, que dans le systeme de focalisation electrostatique. Un calcul est, tout d'abord, mis au point pour determiner un systeme de focalisation simple. Cette focalisation n'entraine pas un taux d'aberrations superieur a 10 ou 15 pour cent. Puis l'etude experimentale conduit: a) a la realisation d'une source et de son systeme d'extraction fournissant un faisceau sans aberration a une energie de 20 keV. b) et a l'elaboration d'un petit accelerateur a 190 keV qui verifie que les proprietes d'un faisceau de 35 mA issu de la source ne sont pas affectees par la traversee des systemes focalisateur et accelerateur lorsque ceux-ci n'apportent pas d'aberration. (auteur)

  14. O que, afinal, a criança adquire ao adquirir uma língua?: a tarefa da aquisição da linguagem em três fases e o processamento de informação de interface pela criança

    Directory of Open Access Journals (Sweden)

    Corrêa, Letícia Maria Sicuro

    2007-01-01

    Full Text Available Três fases da pesquisa em aquisição da linguagem são caracterizadas em função do modo como a tarefa da criança é concebida na trajetória da teoria lingüística: como aquisição de regras, feixação de parâmetros e fixação de parâmetros restritos ao léxico, diante de imposições das interfaces da língua com sistemas de desempenho. Constata-se convergência nos desenvolvimentos de diferentes campos das ciências cognitivas com relação à necessidade de haver restrições à forma das gramáticas. O modo como propriedades de traços formais de elementos funcionais podem ser identificadas nas interfaces é considerado. Este envolve tanto procedimentos de natureza estatística quanto o sistema computacional lingüístico. Perspectivas com relação a uma teoria da aquisição da linguagem são consideradas, apontando-se para a necessidade de um modelo integrado da competência lingüística ser tomado como referência no desenvolvimento da mesma

  15. A gestão de resíduos de laboratório na visão de alunos de um curso de graduação de quimica e áreas afins Waste laboratory management under the viewpoint of undergraduate students of a chemistry course and related areas

    Directory of Open Access Journals (Sweden)

    Zélia Therezinha Custódio Leite

    2008-01-01

    Full Text Available This work presents the students´ profile before and after working in the course "Laboratory Chemical Waste Treatment" in the last ten years. The structure of the course is also described. Although students have shown an increasing previous experience on waste management, many fundamental aspects are missing, especially knowledge on the directives focusing environmental aspects. Visits to industrial plants are also essential to better understand the impact of wastes in environment. Most students nowadays consider waste management as an essential part of their professional formation. A good waste management program must consider several topics of extreme relevance.

  16. Influence of host and geographic locale on the distribution of Colletotrichum cereale lineages

    Science.gov (United States)

    Colletotrichum cereale is an ascomycete inhabitant of cool-season grasses of the Pooideae subfamily. The fungus has increased in frequency over the past decade as a destructive pathogen of Poa annua and Agrostis stolonifera cultivated as turfgrass. DNA fingerprinting has revealed two distinct C. c...

  17. Ação do flúor dissolvido em chuva simulada sobre a estrutura foliar de Panicum maximum jacq. (colonião e Chloris gayana kunth. (capim-rhodes - Poaceae

    Directory of Open Access Journals (Sweden)

    Chaves Alba Lucilvânia Fonseca

    2002-01-01

    Full Text Available Panicum maximum e Chloris gayana foram submetidas à chuvas simuladas com soluções de fluoreto de potássio (15mg ml-1 com objetivo de identificar as injúrias causadas pelo flúor (F-, como poluente atmosférico, na estrutura da lâmina foliar e fornecer subsídios para a seleção de características diagnósticas a serem utilizadas na bioindicação. Os principais sintomas foram clorose e necrose, principalmente no ápice e margens das lâminas. Nos cortes transversais, quatro tipos de alterações causadas pelo flúor são relacionadas: redução do número, tamanho e arranjo dos cloroplastos; necrose dos tecidos principalmente nas margens das folhas; erosões na superfície da folha e hipertrofia das células. Em C. gayana, no entanto, não foram observadas as alterações nos cloroplastos e os outros sintomas foram bem mais discretos que em P. maximum. A ocorrência de compostos fenólicos foi registrada pela coloração com fucsina em todas as regiões da lâmina onde foram observadas lesões. Ao microscópio eletrônico de varredura foi observado o achatamento e formação de concavidades nas paredes externas das células. Este experimento confirma a maior sensibilidade de P. maximum ao flúor e revela algumas características anatômicas de C. gayana que, entre outros fatores, podem estar contribuindo para a maior resistência desta espécie a este poluente.

  18. A Fronteira do Gado e a Melinis Minutiflora P. Beauv. (POACEAE: A História Ambiental e as Paisagens Campestres do Cerrado Goiano no Século XIX

    Directory of Open Access Journals (Sweden)

    Sandro Dutra Silva

    2015-08-01

    Full Text Available Este artigo objetiva apresentar uma revisão da bibliografia que informa sobre a introdução de gramíneas exóticas, sobretudo de origem africana, no Cerrado goiano. A pecuária foi a principal atividade econômica de Goiás no século XIX e na primeira metade do século XX. Os campos do Cerrado goiano favoreceram o assentamento de parte da sociedade rancheira com seus currais e boiadas. Neste artigo, pretendemos analisar, por meio da história ambiental das gramíneas e da pecuária, a relação entre sociedade e natureza nas savanas do Planalto Central do Brasil nesse período. Dialogamos com os estudos de botânica e a sua relação com a história ambiental, no que se refere às transformações das paisagens pelas ações antrópicas. O estudo destaca a introdução de gramíneas exóticas, especialmente os registros históricos sobre o capim-gordura na expansão da atividade pastoril em Goiás.

  19. Comparison of the Giemsa C-banded karyotypes of the three subspecies of Psathyrostachys fragilis, subspp. villosus (2x), secaliformis (2x, 4x), and fragilis (2x) (Poaceae), with notes on chromosome pairing

    DEFF Research Database (Denmark)

    Linde-Laursen, I.; Baden, C.

    1994-01-01

    . Only the presence of 12 nucleoli in interphases identified 6 SAT-chromosome pairs. In subsp. villosus one or two extra micronucleoli indicated a chromosome pair with very low nucleolus-forming activity, bringing the number of SAT-chromosome pairs to 4. This number may be a characteristic...... of a common genome, N. NORs had different nucleolus-forming activities. Meiotic analysis demonstrated a high level of bivalent pairing in the three taxa. A chromosomal rearrangement was suggested in subsp. villosus. The low multivalent frequency in subsp. secaliformis indicates the presence of a pairing...

  20. Detecting latitudinal and altitudinal expansion of invasive bamboo Phyllostachys edulis and Phyllostachys bambusoides (Poaceae) in Japan to project potential habitats under 1.5°C-4.0°C global warming.

    Science.gov (United States)

    Takano, Kohei Takenaka; Hibino, Kenshi; Numata, Ayaka; Oguro, Michio; Aiba, Masahiro; Shiogama, Hideo; Takayabu, Izuru; Nakashizuka, Tohru

    2017-12-01

    Rapid expansion of exotic bamboos has lowered species diversity in Japan's ecosystems by hampering native plant growth. The invasive potential of bamboo, facilitated by global warming, may also affect other countries with developing bamboo industries. We examined past (1975-1980) and recent (2012) distributions of major exotic bamboos ( Phyllostachys edulis and P. bambusoides ) in areas adjacent to 145 weather stations in central and northern Japan. Bamboo stands have been established at 17 sites along the latitudinal and altitudinal distributional limit during the last three decades. Ecological niche modeling indicated that temperature had a strong influence on bamboo distribution. Using mean annual temperature and sun radiation data, we reproduced bamboo distribution (accuracy = 0.93 and AUC (area under the receiver operating characteristic curve) = 0.92). These results infer that exotic bamboo distribution has shifted northward and upslope, in association with recent climate warming. Then, we simulated future climate data and projected the climate change impact on the potential habitat distribution of invasive bamboos under different temperature increases (i.e., 1.5°C, 2.0°C, 3.0°C, and 4.0°C) relative to the preindustrial period. Potential habitats in central and northern Japan were estimated to increase from 35% under the current climate (1980-2000) to 46%-48%, 51%-54%, 61%-67%, and 77%-83% under 1.5°C, 2.0°C, 3.0°C, and 4.0°C warming levels, respectively. These infer that the risk areas can increase by 1.3 times even under a 1.5°C scenario and expand by 2.3 times under a 4.0°C scenario. For sustainable ecosystem management, both mitigation and adaptation are necessary: bamboo planting must be carefully monitored in predicted potential habitats, which covers most of Japan.

  1. The influence of land use on soil organic carbon and nitrogen content and redox potential

    DEFF Research Database (Denmark)

    Kusliene, Gedrime

    2010-01-01

    different farming systems (conventional and organic) as well as abandoned lands. We choose the plants of two botanical species (Poaceae and Fabaceae) in organic and conventional farming systems as well as abandoned lands. Experimental results show that the best soil organic matter status according...... to the investigated indexes is in the soils of conventional and orgaic farming systems occupied with mixtures of Poaceae and Fabaceae and the worst - in the soils of abandoned Poaceae meadowa. In the abandoned lands, Fabaceae (galega) had better influence on soil organic matter status than Poaceae....

  2. Guía ilustrada de la flora del “Desierto de la Tatacoa ”, Huila, Colombia

    Directory of Open Access Journals (Sweden)

    Yisela Figueroa Cardozo

    2004-07-01

    promedio de 28º C y una precipitación promedio anual cercana a 1.000 mm. Históricamente,la región ha sufrido un fuerte proceso de sabanización y desertificación, por lo cual la cobertura vegetal actual se encuentra representada principalmente por matorrales bajos, rastrojos y pastizales. En este estudio se presenta el inventario florístico preliminar de la región del “desierto” de la Tatacoa; además, se caracteriza la vegetación de la región de una forma general y se presenta una guía ilustrada con descripciones botánicas para 100 de las especies más representativas de la región. Se encontraron 227 especies, distribuidas en cerca de 170 géneros y 60 familias. La gran mayoría de las especies son dicotiledóneas (85%, mientras que las monocotiledóneas se encuentran representadas solo por el 14% de las especies, y un mínimo porcentaje (menos del 1% por helechos y afines. A nivel florístico, la familia Fabaceae (s.l. es la más destacada con 35 especies y 27 géneros, representando el 15,5% del total de las especies, discriminada en las subfamilias Faboideae con 18/16, Mimosoideae con 9/7 y Caesalpinioideae con 8/4. Otras de las familias que sobresalen por su riqueza son Poaceae con 20 especies y 15 géneros, Euphorbiaceae (13/7, Asteraceae (10/10, Malvaceae (9/4, Cactaceae (8/7, Asclepiadaceae (8/7 y Convolvulaceae (8/3. Como hallazgos importantes se presenta el primer registro para el país de Senna uniflora (Caesalpiniodeae y el reencuentro de Amoreuxia palmatifida (Cochlospermaceae, especie que era conocida para Colombia por un solo espécimen coleccionado antes de 1858 en cercanías al municipio del Espinal (Tolima. La guía ilustrada incluye para cada especie una descripción corta e información sobre su distribución, usos y nombres comunes (cuando los hay. Además, la mayoría de las especies están ilustradas con fotografías de su hábito y detalles de flores y/o frutos.

  3. Genome sequence analysis of the model grass Brachypodium distachyon: insights into grass genome evolution

    Energy Technology Data Exchange (ETDEWEB)

    Schulman, Al

    2009-08-09

    Three subfamilies of grasses, the Erhardtoideae (rice), the Panicoideae (maize, sorghum, sugar cane and millet), and the Pooideae (wheat, barley and cool season forage grasses) provide the basis of human nutrition and are poised to become major sources of renewable energy. Here we describe the complete genome sequence of the wild grass Brachypodium distachyon (Brachypodium), the first member of the Pooideae subfamily to be completely sequenced. Comparison of the Brachypodium, rice and sorghum genomes reveals a precise sequence- based history of genome evolution across a broad diversity of the grass family and identifies nested insertions of whole chromosomes into centromeric regions as a predominant mechanism driving chromosome evolution in the grasses. The relatively compact genome of Brachypodium is maintained by a balance of retroelement replication and loss. The complete genome sequence of Brachypodium, coupled to its exceptional promise as a model system for grass research, will support the development of new energy and food crops

  4. Démarche d’intervention sur l’organisation du travail afin d’agir sur les problèmes de santé mentale au travail Approach to work organization intervention in order to take action on mental health problems in the workplace Proceso de intervención sobre la organización del trabajo con el fin de actuar sobre los problemas de salud mental en el trabajo

    Directory of Open Access Journals (Sweden)

    Louise St-Arnaud

    2010-11-01

    Full Text Available Les problèmes de santé mentale au travail représentent actuellement un problème de santé publique et économique majeur. Bien que le caractère pathogène de certaines dimensions de l’organisation du travail sur la santé mentale ait été largement documenté, la recherche portant sur l’identification de stratégies efficaces pour réduire ces contraintes est peu développée. Prenant appui sur un cadre d’intervention d’une démarche participative sur l’organisation du travail, un groupe d’intervenants et de chercheurs en santé mentale au travail a expérimenté à plusieurs reprises la démarche proposée, en y intégrant un processus d’évaluation en continu. Chaque étape de la démarche a été revue en considérant les actions et les méthodes utilisées et ce, en tenant compte de l’expérience des intervenants et des observations faites dans les interventions en cours. Ce qui a été appris à partir des expériences menées dans les milieux de travail et à partir de la littérature a été utilisé pour modifier, améliorer ou préciser la démarche d’intervention. Cet article présente en détail chacune des étapes d’une démarche d’intervention préventive en santé mentale au travail, telle que revue par un processus d’expérimentation et d’évaluation en continu.Mental health problems in the workplace currently represent a public health and major economic problem. While the pathogenic impact of certain dimensions of work organization on mental health has been widely documented, research on the identification of effective strategies for reducing these constraints has not been extensively developed. Founded on an intervention framework of a participatory work organization process, a group of practitioners and researchers in mental health in the workplace tested the proposed process on several occasions, by integrating a continuous evaluation process into it. Each step in the process was reviewed by considering the actions and methods used, and by taking into account the preventionists’ experience as well as the observations in the interventions being pursued. What the workplace experiments and the literature revealed was used to modify, improve or define the intervention process. This article presents in detail each of the steps in a preventive intervention process in mental health in the workplace, revised by a continuous testing and evaluation process.Los problemas de salud mental en el trabajo representan actualmente un problema económico y de salud pública mayor. Si bien el carácter patógeno de ciertas dimensiones de la organización del trabajo sobre la salud mental ha sido ampliamente documentado, la investigación dirigida a la identificación de estrategias eficaces para reducir estas exigencias está poco desarrollada. Apoyándonos en un marco de intervención sobre la organización del trabajo que plantea un proceso participativo, un grupo de personas que intervienen en los lugares de trabajo y de investigadores en salud mental del trabajo experimentó en sucesivas ocasiones el proceso propuesto, integrando un aspecto de evaluación continua. Cada etapa de la intervención fue revisada considerando las acciones y los métodos utilizados, teniendo en cuenta la experiencia de las personas que intervienen en los lugares de trabajo y las observaciones hechas dentro de las intervenciones en curso. Lo que se aprendió a partir de las experiencias llevadas a cabo en los medios de trabajo y a partir de la literatura se utilizó para modificar, mejorar o precisar el proceso de la intervención. Este artículo presenta en detalle cada una de las etapas de un proceso de intervención preventiva en salud mental en el trabajo, revisado a través de la experimentación y la evaluación continua.

  5. Hydraulic Hybrid Propulsion for Heavy Vehicles: Combining the Simulation and Engine-In-the-Loop Techniques to Maximize the Fuel Economy and Emission Benefits Propulsion hybride hydraulique des poids lourds : une approche alliant les techniques de simulation et d’« Engine-In-the-loop » (EIL afin de maximiser les économies de carburant et les avantages en termes d’émissions

    Directory of Open Access Journals (Sweden)

    Filipi Z.

    2009-09-01

    Full Text Available The global energy situation, the dependence of the transportation sector on fossil fuels, and a need for a rapid response to the global warming challenge, provide a strong impetus for development of fuel efficient vehicle propulsion. The task is particularly challenging in the case of trucks due to severe weight/size constraints. Hybridization is the only approach offering significant breakthroughs in near and mid-term. In particular, the series configuration decouples the engine from the wheels and allows full flexibility in controlling the engine operation, while the hydraulic energy conversion and storage provides exceptional power density and efficiency. The challenge stems from a relatively low energy density of the hydraulic accumulator. This places particular emphasis on development of the supervisory controller. The conventional wisdom is to operate the engine at the “sweet spot”, but the aggressive pursuit of engine efficiency as the sole objective can lead to frequent and rapid diesel engine transients, thus causing an adverse affect on the soot emissions and driver feel. Therefore, we propose a comprehensive methodology for considering a combined hybrid system fuel-economy and emissions objective. The fuel economy is addressed with the simulation-based approach, while investigating the impact of engine transients on particulate emission relies on the Engine-In-the-loop (EIL capability. The EIL study confirms advantages of a modulated state-of-charge control over the thermostatic approach, and demonstrates the ability of the Series Hydraulic Hybrid to improve the fuel economy of the medium truck by 72%, while reducing the particulate emission by 74% compared to the conventional baseline over the city driving schedule. La situation énergétique mondiale, la dépendance du secteur des transports vis-à-vis des combustibles d’origine fossile et la nécessité d’une réponse rapide face au défi présenté par le réchauffement climatique fournissent une forte motivation pour le développement de moyens de propulsion véhiculaires économes. Pour les camions, cette tâche est particulièrement difficile à accomplir du fait d’importantes contraintes de taille et de poids. L’hybridation est la seule approche qui puisse déboucher sur des progrès importants à court et moyen termes. En particulier, la configuration “hybride série” découple le moteur thermique des roues et permet une flexibilité complète dans le contrôle des points de fonctionnement moteur. De plus, la conversion et le stockage de l’énergie hydraulique fournissent une densité de puissance et un rendement excellents. Le défi technologique tient à la faible densité d’énergie de l’accumulateur hydraulique, et met en avant l’importance particulière du développement du gestionnaire de l’énergie. Il est communément admis qu’il faut maintenir le moteur au point de rendement maximum mais, si l’objectif ultime en terme énergétique consiste à optimiser drastiquement le rendement du moteur, ceci induit des phases transitoires fréquentes causant pour des moteurs diesels des effets opposés tant sur l’émission de particules que sur l’agrément de conduite. Par conséquent, nous proposons une méthodologie pour le superviseur d’énergie d’un système hybride, qui prend en compte 2 objectifs : la réduction de consommation et la réduction des émissions polluantes. Les économies de carburant sont prises en compte par une approche fondée sur la simulation, alors que l’étude de l’impact des phases transitoires du moteur sur les émissions de particules, est fondée sur un dispositif expérimental combinant modèles temps réel et moteur réel – l’EIL (Engine-In-the-Loop. Le dispositif EIL confirme que le contrôle de la répartition énergétique thermique/hydraulique de l’état de charge des batteries (SOC présente des avantages certains sur celui basé sur l’approche de contrôle type « bang-bang ». De plus, elle démontre la capacité de l’Hybride Hydraulique Série à améliorer de 72 % les économies de carburant d’un camion de taille moyenne tout en réduisant les émissions de particules de 74 % comparée á la référence conventionnelle sur le cycle de conduiteurbain.

  6. Grass-specific CD4+ T-cells exhibit varying degrees of cross-reactivity, implications for allergen-specific immunotherapy

    Science.gov (United States)

    Archila, LD; DeLong, JH; Wambre, E; James, EA; Robinson, DM; Kwok, WW

    2014-01-01

    Background Conceptually, allergic responses may involve cross-reactivity by antibodies or T-cells. While IgE cross-reactivity amongst grass pollen allergens has been observed, cross-reactivity at the allergen-specific T-cell level has been less documented. Identification of the patterns of cross-reactivity may improve our understanding, allowing optimization of better immunotherapy strategies. Objectives We use Phleum pratense as model for the studying of cross-reactivity at the allergen-specific CD4+ T cell level amongst DR04:01 restricted Pooideae grass pollen T-cell epitopes. Methods After In vitro culture of blood mononucleated cells from Grass-pollen allergic subjects with specific Pooideae antigenic epitopes, dual tetramer staining with APC-labeled DR04:01/Phleum pratense tetramers and PE-labeled DR04:01/Pooideae grass homolog tetramers was assessed to identify cross-reactivity amongst allergen-specific DR04:01-restricted T-cells in 6 subjects. Direct ex vivo staining enabled the comparison of frequency and phenotype of different Pooideae grass pollen reactive T-cells. Intracellular cytokine staining (ICS) assays were also used to examine phenotypes of these T-cells. Results T-cells with various degree of cross reactive profiles could be detected. Poa p 1 97-116, Lol p 1 221-240, Lol p 5a 199-218, and Poa p 5a 199-218 were identified as minimally-cross-reactive T-cell epitopes that do not show cross reactivity to Phl p 1 and Phl p 5a epitopes. Ex vivo tetramer staining assays demonstrated T-cells that recognized these minimally-cross reactive T-cell epitopes are present in Grass-pollen allergic subjects. Conclusions Our results suggest that not all Pooideae grass epitopes with sequence homology are cross-reactive. Non-cross reactive T-cells with comparable frequency, phenotype and functionality to Phl p-specific T-cells, suggest that a multiple allergen system should be considered for immunotherapy instead of a mono allergen system. PMID:24708411

  7. Grass-specific CD4(+) T-cells exhibit varying degrees of cross-reactivity, implications for allergen-specific immunotherapy.

    Science.gov (United States)

    Archila, L D; DeLong, J H; Wambre, E; James, E A; Robinson, D M; Kwok, W W

    2014-07-01

    Conceptually, allergic responses may involve cross-reactivity by antibodies or T-cells. While IgE cross-reactivity among grass-pollen allergens has been observed, cross-reactivity at the allergen-specific T-cell level has been less documented. Identification of the patterns of cross-reactivity may improve our understanding, allowing optimization of better immunotherapy strategies. We use Phleum pratense as model for the studying of cross-reactivity at the allergen-specific CD4(+) T cell level among DR04:01 restricted Pooideae grass-pollen T-cell epitopes. After in vitro culture of blood mono-nucleated cells from grass-pollen-allergic subjects with specific Pooideae antigenic epitopes, dual tetramer staining with APC-labelled DR04:01/Phleum pratense tetramers and PE-labelled DR04:01/Pooideae grass homolog tetramers was assessed to identify cross-reactivity among allergen-specific DR04:01-restricted T-cells in six subjects. Direct ex vivo staining enabled the comparison of frequency and phenotype of different Pooideae grass-pollen reactive T-cells. Intracellular cytokine staining (ICS) assays were also used to examine phenotypes of these T-cells. T-cells with various degrees of cross-reactive profiles could be detected. Poa p 1 97-116 , Lol p 1 221-240 , Lol p 5a 199-218 , and Poa p 5a 199-218 were identified as minimally cross-reactive T-cell epitopes that do not show cross-reactivity to Phl p 1 and Phl p 5a epitopes. Ex vivo tetramer staining assays demonstrated T-cells that recognized these minimally cross-reactive T-cell epitopes are present in Grass-pollen-allergic subjects. Our results suggest that not all Pooideae grass epitopes with sequence homology are cross-reactive. Non-cross-reactive T-cells with comparable frequency, phenotype and functionality to Phl p-specific T-cells suggest that a multiple allergen system should be considered for immunotherapy instead of a mono-allergen system. © 2014 John Wiley & Sons Ltd.

  8. INVENTARISASI HIJAUAN PAKAN KUDA PACUAN DI NUSA TENGGARA BARAT

    Directory of Open Access Journals (Sweden)

    Sudirman Sudirman

    2014-12-01

    Full Text Available Pacuan kuda dilaksanakan setiap tahun di Provinsi Nusa Tenggara Barat yang diikuti oleh tidak kurang dari 700 ekor kuda pacuan dalam lima kelas lomba. Kegiatan ini umumnya berlangsung selama 1-2 minggu di Pulau Sumbawa dan senantiasa menjadi agenda hiburan rakyat serangkaian dengan acara perayaan hari-hari besar nasional maupun regional dan/atau lokal. Selama kurun waktu tersebut, semua kuda yang akan dilombakan diberikan pakan berupa hijauan dari jenis tumbuhan tertentu dan/atau spesifik. Tujuan penelitian ini adalah (1 menginventarisisr jenis-jenis tumbuhan yang dijadikan hijauan pakan kuda pacuan selama lomba berlangsung, dan (2 mengkaji komposisi nutrisi jenis hijauan pakan dimaksud. Metode yang digunakan untuk mengumpulkan data pada penelitian ini adalah metode observasi dan wawancara. Semua kuda pacuan yang berasal dari beberapa kabupaten di provinsi Nusa Tenggara Barat yangmengikuti lomba pacuan kuda di kabupaten Sumbawa tahun 2012 diamati pemberian pakannya, kemudian dilakukan identifikasi dan analisis komposisi nutrisi jenis hijauan yang diberikan. Untuk mengetahui jenis pakan yang diberikan, dilakukan pengamatan langsung dan wawancara dengan peternak kuda pacuan. Hasil penelitian menunjukkan bahwa tercatat 9 jenis tumbuhan (2 famili, 8 marga yang diberikan pada kuda pacuan selama lomba berlangsung, yaitu Alysicarpus vaginalis (Fabaceae, Desmodium dichotomum (Fabaceae, Cynodon dactylon (Poaceae, Cynodon sp. (Poaceae, Dactyloctenium aegyptium (Poaceae, Brachiaria sp. (Poaceae, Eleusine indica (Poaceae, Eulalia fimbriata (Poaceae dan Leersia hexandra (Poaceae. Hijauan pakan diberikan pada kuda pacuan dalam bentuk pakan tunggal maupun kombinasi diantara jenis-jenis tumbuhan tersebut dengan komposisi nutrisi yang berbeda.

  9. Environ: E00167 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available PD:C01530], Benzoxazinones, Polysaccharide, Protein Coix lacryma-jobi [TAX:714458] Same as: D06798 Poaceae (grass family) Coicis semen Major component: Coixenolide [CPD:C17566] ...

  10. Mycosarcoma (Ustilaginaceae), a resurrected generic name for corn smut (Ustilago maydis) and its close relatives with hypertrophied, tubular sori

    NARCIS (Netherlands)

    McTaggart, Alistair R; Shivas, Roger G; Boekhout, Teun; Oberwinkler, Franz; Vánky, Kálmán; Pennycook, Shaun R; Begerow, Dominik

    2016-01-01

    Ustilago is a polyphyletic genus of smut fungi found mainly on Poaceae. The development of a taxonomy that reflects phylogeny requires subdivision of Ustilago into smaller monophyletic genera. Several separate systematic analyses have determined that Macalpinomyces mackinlayi, M. tubiformis,

  11. Population genetic structure analysis in endangered Hordeum ...

    African Journals Online (AJOL)

    Administrator

    2011-09-07

    Sep 7, 2011 ... populations are grown by few local farmers in low-input farming systems. Based on 117 random ... Triticeae of the Poaceae (Graminae) family found throughout the ... populations and phylogeography is made easy by the.

  12. Cloning and characterization of cDNA encoding xyloglucan ...

    African Journals Online (AJOL)

    Jane

    2011-08-22

    Aug 22, 2011 ... plays important role in growth and development of plants. XETs are a family of enzymes .... cloned into pGEM-T Easy vector (Promega Corporation, WI, USA). The recombinant ..... wall modification in the poaceae. Protein Sci.

  13. 2127-IJBCS-Article-Koffi Badou Jérémie

    African Journals Online (AJOL)

    hp

    Determination of critical period for weed control in intensive and non-intensive sugarcane (Saccharum officinarum L., Poaceae) production systems in center Côte d'Ivoire ... and chemical methods for effective and ...... Handbook Series No. 4.

  14. Drug: D10238 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available ucris; Adlay ... Coix lacryma-jobi [TAX:714458] ... Same as: E00845 ... Poaceae (grass family) Adlay fruit and bract; Standards for non-pharmacopoeial crude drugs ... PubChem: 163312269 ...

  15. Commelinid Monocotyledon Lignins Are Acylated by p-Coumarate1[OPEN

    Science.gov (United States)

    Free, Heather C.A.; Smith, Bronwen G.

    2018-01-01

    Commelinid monocotyledons are a monophyletic clade differentiated from other monocotyledons by the presence of cell wall-bound ferulate and p-coumarate. The Poaceae, or grass family, is a member of this group, and most of the p-coumarate in the cell walls of this family acylates lignin. Here, we isolated and examined lignified cell wall preparations from 10 species of commelinid monocotyledons from nine families other than Poaceae, including species from all four commelinid monocotyledon orders (Poales, Zingiberales, Commelinales, and Arecales). We showed that, as in the Poaceae, lignin-linked p-coumarate occurs exclusively on the hydroxyl group on the γ-carbon of lignin unit side chains, mostly on syringyl units. Although the mechanism of acylation has not been studied directly in these species, it is likely to be similar to that in the Poaceae and involve BAHD acyl-coenzyme A:monolignol transferases. PMID:29724771

  16. Relationships between food quality and fitness in the desert locust, Schistocerca gregaria, and its distribution over habitats on the Red Sea coastal plain of Sudan

    NARCIS (Netherlands)

    Huis, van A.; Woldewahid, G.; Toleubayev, K.; Werf, van der W.

    2008-01-01

    The effect of millet, Pennisetum typhoideum Rich. (Poaceae), leaf nitrogen content on fitness parameters of the desert locust, Schistocerca gregaria Forsk. (Orthoptera: Acrididae), was studied under laboratory conditions. Locusts reared on high-nitrogen leaves were larger, developed faster, had

  17. Original Paper Weeds control through tree-crop associations in a ...

    African Journals Online (AJOL)

    these trees, two crops were grown: a shade tolerant crop (Colocasia esculenta, taro) ... The most represented weeds family in the open field was Poaceae while under both tree species, the ...... provided guide, corrections and supervision to.

  18. Haplotype Detection from Next-Generation Sequencing in High-Ploidy-Level Species: 45S rDNA Gene Copies in the Hexaploid Spartina maritima

    Czech Academy of Sciences Publication Activity Database

    Boutte, J.; Aliaga, B.; Lima, O.; de Carvalho, J.F.; Ainouche, A.; Macas, Jiří; Rousseau-Gueutin, M.; Coriton, O.; Ainouche, M.; Salmon, A.

    2016-01-01

    Roč. 6, č. 1 (2016), s. 29-40 ISSN 2160-1836 Institutional support: RVO:60077344 Keywords : poaceae * duplication * paralogy * bioinformatics * polyploidy Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.861, year: 2016

  19. Grass survey of the Itremo Massif records endemic central highland ...

    African Journals Online (AJOL)

    Grasses are members of the plant family Poaceae, and are primar- ily known for their ... Madagascar Conservation & Development is the journal of. Indian Ocean .... cording to the classification by Kellogg (2015). With 64 ..... Flowering plants.

  20. Complete chloroplast genome sequences of Hordeum vulgare, Sorghum bicolor and Agrostis stolonifera, and comparative analyses with other grass genomes

    Science.gov (United States)

    Saski, Christopher; Lee, Seung-Bum; Fjellheim, Siri; Guda, Chittibabu; Jansen, Robert K.; Luo, Hong; Tomkins, Jeffrey; Rognli, Odd Arne; Clarke, Jihong Liu

    2009-01-01

    Comparisons of complete chloroplast genome sequences of Hordeum vulgare, Sorghum bicolor and Agrostis stolonifera to six published grass chloroplast genomes reveal that gene content and order are similar but two microstructural changes have occurred. First, the expansion of the IR at the SSC/IRa boundary that duplicates a portion of the 5′ end of ndhH is restricted to the three genera of the subfamily Pooideae (Agrostis, Hordeum and Triticum). Second, a 6 bp deletion in ndhK is shared by Agrostis, Hordeum, Oryza and Triticum, and this event supports the sister relationship between the subfamilies Erhartoideae and Pooideae. Repeat analysis identified 19–37 direct and inverted repeats 30 bp or longer with a sequence identity of at least 90%. Seventeen of the 26 shared repeats are found in all the grass chloroplast genomes examined and are located in the same genes or intergenic spacer (IGS) regions. Examination of simple sequence repeats (SSRs) identified 16–21 potential polymorphic SSRs. Five IGS regions have 100% sequence identity among Zea mays, Saccharum officinarum and Sorghum bicolor, whereas no spacer regions were identical among Oryza sativa, Triticum aestivum, H. vulgare and A. stolonifera despite their close phylogenetic relationship. Alignment of EST sequences and DNA coding sequences identified six C–U conversions in both Sorghum bicolor and H. vulgare but only one in A. stolonifera. Phylogenetic trees based on DNA sequences of 61 protein-coding genes of 38 taxa using both maximum parsimony and likelihood methods provide moderate support for a sister relationship between the subfamilies Erhartoideae and Pooideae. PMID:17534593

  1. First nesting record of the Bay-Capped Wren-Spinetail Spartonoica maluroides (Aves, Furnariidae in Brazil, with nest and nestling descriptions and notes on breeding behavior Primeiro registro de nidificação da boininha Spartonoica maluroides (Aves, Furnariidae no Brasil, incluindo a descrição do ninho e ninhego e notas sobre o comportamento reprodutivo

    Directory of Open Access Journals (Sweden)

    Rafael A Dias

    2009-12-01

    the area on 15 December 2005 and found the nest abandoned. Observations confirm that S. maluroides is a resident breeder in southern Brazil and that the saltmarshes of the Lagoa do Patos estuary are an important year-round habitat for the species. A nestling and the nest were collected to document the record.O único registro de reprodução de Spartonoica maluroides (d'Orbigny & Lafresnaye, 1837 no Brasil é baseado na observação de um filhote recém-saído do ninho no sul do Rio Grande do Sul em janeiro de 1976. Em 7 de dezembro de 2005, descobrimos um ninho contendo três filhotes na extremidade sudoeste da Lagoa Pequena, município de Pelotas, Rio Grande do Sul. O ninho estava oculto na base de uma cavidade dentro de uma touceira de Spartina densiflora (Poaceae situada na margem de uma marisma. O ninho era constituído de pedaços delgados de folhas mortas de Scirpus olneyi (Cyperaceae e S. densiflora firmemente entrelaçados às folhas da touceira. Folhas vivas de S. densiflora que orlavam a cavidade compreendiam uma parte substancial da arquitetura do ninho, constituindo a maior parte da porção superior das paredes laterais e o teto. A seção inferior era mais elaborada, similar a uma taça profunda e formando uma câmara incubatória distinta. Os adultos acessavam o ninho através de uma abertura apical de formato irregular por entre as folhas. O ninho media 244 mm de altura e 140 mm de largura. A câmara incubatória apresentava um diâmetro externo de 138,5 mm, um diâmetro interno de 79,4 mm e uma profundidade de 86 mm, sendo forrada de folhas delgadas e fibras vegetais brancas. Os ninhegos tinham de cinco a seis dias de idade. Um ninhego exibiu um total de 107 neossóptilas restritas aos tratos capital, espinal e alar. A distribuição das neossóptilas na região ocular de S. maluroides forma um padrão distinto que pode ser típico de Furnariidae e famílias afins. Dois adultos atendiam o ninho, trazendo pequenos insetos para os ninhegos e removendo

  2. Quantification in mass units of group 1 grass allergens by a monoclonal antibody-based sandwich ELISA.

    Science.gov (United States)

    Arilla, M C; Ibarrola, I; Eraso, E; Aguirre, M; Martínez, A; Asturias, J A

    2001-08-01

    Grass pollen extracts currently used for allergy diagnosis and immunotherapy are a complex mixture of proteins of which only a few have allergenic activity. Lol p 1 is one of the most important allergens in grass pollen extracts. To develop a two-site enzyme-linked immunosorbent assay for the quantification of Lol p 1 and other group 1 allergens from grass species, and to assess its suitability for quantifying this group of allergens. Balb/c mice immunized with recombinant Lol p 1 were used for the production of monoclonal antibodies. Screening of hybridomas was performed by direct ELISA, and selected monoclonal antibodies were immobilized on ELISA plates and incubated with samples containing group 1 allergens. Bound allergens were detected by a combination of biotinylated Lol p 1-specific monoclonal antibody and peroxidase-streptavidin conjugate. The assay is based on three Lol p 1-specific monoclonal antibodies with different epitope specificities. The optimized ELISA measured Lol p 1 concentrations ranging from 125 to 1000 ng/mL and could quantify group 1 allergen from grass species belonging to the Pooidea subfamily. The assay does not depend on anti-sera production or availability of human sera and thus reactives can be produced in unlimited amounts. This sensitive and specific Lol p 1 assay will be helpful both for quantifying the group 1 allergen content of Pooideae pollen extracts intended for clinical use and for studying cross-reactivities among pollen extracts.

  3. Bourses Écosystèmes et santé humaine pour les cycles supérieurs ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le montant de chaque bourse sera de 15 000 CAD pour la recherche sur le terrain et jusqu'à 4 000 CAD pour participer à une conférence afin de diffuser les résultats des recherches ou pour retourner sur le terrain afin de présenter ses constatations aux parties prenantes locales. En outre, les boursiers participeront à une ...

  4. Le CRDI au Costa Rica

    International Development Research Centre (IDRC) Digital Library (Canada)

    région ont-elles besoin du commerce, mais elles doivent en outre acquérir de nouvelles compétences afin de pouvoir prospérer dans l'économie du savoir. La capacité d'utiliser les technologies de l'information, entre autres, est désormais une nécessité. Le CRDI subventionne la Fundación. Omar Dengo afin qu'elle puisse ...

  5. Airborne study of grass allergen (Lol p 1) in different-sized particles.

    Science.gov (United States)

    De Linares, C; Díaz de la Guardia, C; Nieto Lugilde, D; Alba, F

    2010-01-01

    The Poaceae family is considered one of the main causes of pollen allergy in industrialized countries. The aim of this study is to establish the dynamics of the Poaceae allergens and determine their distribution in the different-sized particles in the atmosphere. The air of Granada (southern Spain) was sampled during the pollination period of Poaceae using a cascade impactor and a Hirst-type volumetric collector simultaneously. The sampled airborne allergens were analyzed by indirect ELISA and field emission scanning electron microscopy. Airborne pollen was evaluated with the Spanish Aerobiological Network methodology. Poaceae pollen and allergenic activity have parallel dynamics during the period of maximum pollination, which is reflected in the positive correlations between the 2 variables. In addition, the highest Lol p 1 concentrations were recorded in particle sizes lower than 3.3 mum (stage 4-F). The Spearman correlation test showed that airborne allergens are not dependent on meteorological factors, such as humidity, wind direction or sunshine, however, Lol p 1 allergen correlated positively with Poaceae pollen. The results of the present study confirm that the Lol p 1 allergen is detected more frequently with pollutants than with coarse particles with similar dynamics and a positive correlation between airborne pollen and aeroallergens. Moreover, Lol p 1 is released in stable weather conditions without large changes in humidity or temperature. Copyright 2009 S. Karger AG, Basel.

  6. Developing regional weight-for-age growth references for malaria-endemic countries to optimize age-based dosing of antimalarials = Développer des références régionales de croissance pour le rapport poids/âge dans les pays où le paludisme est endémique, afin d’optimiser la posologie des médicaments antipaludiques en fonction de l’âge = Elaboración de referencias regionales sobre el crecimiento ponderal correspondiente a cada edad para los países donde la malaria es endémica a fin de optimizar la dosificación basada en la edad de los medicamentos contra la malaria

    NARCIS (Netherlands)

    Hayes, D.J.; Buuren, S. van; Kuile, F.O. ter; Stasinopoulos, D.M.; Rigby, R.A.; Terlouw, D.J.

    2015-01-01

    Methods: A weight-for-age database was constructed from pre-existing population-based anthropometric data obtained from household surveys and research groups. It contained data collected between 1995 and 2012 on 1 263 119 individuals (909 368 female, 353 751 male) older than 14 days and younger than

  7. SQ grass sublingual allergy immunotherapy tablet for disease-modifying treatment of grass pollen allergic rhinoconjunctivitis

    DEFF Research Database (Denmark)

    Dahl, Ronald; Roberts, Graham; de Blic, Jacques

    2016-01-01

    BACKGROUND: Allergy immunotherapy is a treatment option for allergic rhinoconjunctivitis (ARC). It is unique compared with pharmacotherapy in that it modifies the immunologic pathways that elicit an allergic response. The SQ Timothy grass sublingual immunotherapy (SLIT) tablet is approved in North...... America and throughout Europe for the treatment of adults and children (≥5 years old) with grass pollen-induced ARC. OBJECTIVE: The clinical evidence for the use of SQ grass SLIT-tablet as a disease-modifying treatment for grass pollen ARC is discussed in this review. METHODS: The review included...... the suitability of SQ grass SLIT-tablet for patients with clinically relevant symptoms to multiple Pooideae grass species, single-season efficacy, safety, adherence, coseasonal initiation, and cost-effectiveness. The data from the long-term SQ grass SLIT-tablet clinical trial that evaluated a clinical effect 2...

  8. Intracellular position of mitochondria and chloroplasts in bundle sheath and mesophyll cells of C3 grasses in relation to photorespiratory CO2 loss

    Directory of Open Access Journals (Sweden)

    Yuto Hatakeyama

    2016-10-01

    Full Text Available In C3 plants, photosynthetic efficiency is reduced by photorespiration. A part of CO2 fixed during photosynthesis in chloroplasts is lost from mitochondria during photorespiration by decarboxylation of glycine by glycine decarboxylase (GDC. Thus, the intracellular position of mitochondria in photosynthetic cells is critical to the rate of photorespiratory CO2 loss. We investigated the intracellular position of mitochondria in parenchyma sheath (PS and mesophyll cells of 10 C3 grasses from 3 subfamilies (Ehrhartoideae, Panicoideae, and Pooideae by immunostaining for GDC and light and electron microscopic observation. Immunostaining suggested that many mitochondria were located in the inner half of PS cells and on the vacuole side of chloroplasts in mesophyll cells. Organelle quantification showed that 62–75% of PS mitochondria were located in the inner half of cells, and 62–78% of PS chloroplasts were in the outer half. In mesophyll cells, 61–92% of mitochondria were positioned on the vacuole side of chloroplasts and stromules. In PS cells, such location would reduce the loss of photorespiratory CO2 by lengthening the path of CO2 diffusion and allow more efficient fixation of CO2 from intercellular spaces. In mesophyll cells, it would facilitate scavenging by chloroplasts of photorespiratory CO2 released from mitochondria. Our data suggest that the PS cells of C3 grasses have already acquired an initial structure leading to proto-Kranz and further C3–C4 intermediate anatomy. We also found that in the Pooideae, organelle positioning in PS cells on the phloem side resembles that in mesophyll cells.

  9. Psárky Alopecurus aequalis a A. geniculatus v České republice: jejich určování a rozšíření

    Czech Academy of Sciences Publication Activity Database

    Bureš, P.; Danihelka, Jiří; Husáková, M.; Pařil, P.

    2008-01-01

    Roč. 23, - (2008), s. 3-61 ISSN 0862-2035 R&D Projects: GA MŠk(CZ) LC06073; GA ČR(CZ) GA206/07/0706 Institutional research plan: CEZ:AV0Z60050516 Keywords : phytogeography * Poaceae * Central Europe Subject RIV: EF - Botanics

  10. Ajikah et al (11).cdr

    African Journals Online (AJOL)

    Timothy Ademakinwa

    Faculty of Science, Senate Building and New Hall respectively. A total of 3,495 palynomorphs belonging to about 22 families were recovered in all. The Poaceae family dominates representing 13.67 % of the total palynomorph count, followed by Cyperaceae (12.72 %) Euphorbiaceae (5.34 %) Mimosaceae (8.89 %), Fern.

  11. Modern pollen rain in Canary Island ecosystems and its implications for the interpretation of fossil records

    DEFF Research Database (Denmark)

    de Nascimento, Lea; Nogué, Sandra; Fernández-Lugo, Silvia

    2015-01-01

    -represented (.Pinus, Morella and Ericaceae trees, Chenopodiaceae, Poaceae, Rumex and Urticaceae herbs and shrubs) or under-represented (Lauraceae trees, Fabaceae and Euphorbia shrubs). Results indicate that pollen composition is a good reflection of vegetation in Canarian ecosystems and can be used effectively...

  12. Take-all or nothing

    NARCIS (Netherlands)

    Hernández-Restrepo, M.; Groenewald, J.Z.; Elliott, M.L.; Canning, G.; McMillan, V.E.; Crous, P.W.

    2016-01-01

    Take-all disease of Poaceae is caused by Gaeumannomyces graminis (Magnaporthaceae). Four varieties are recognised in G. graminis based on ascospore size, hyphopodial morphology and host preference. The aim of the present study was to clarify boundaries among species and varieties in

  13. Take-all or nothing

    NARCIS (Netherlands)

    Hernández-Restrepo, M.; Groenewald, J.Z.; Elliott, M.L.; Canning, G.; McMillan, V.E.; Crous, P.W.

    2016-01-01

    Take-all disease of Poaceae is caused by Gaeumannomyces graminis (Magnaporthaceae). Four varieties are recognised in G. graminis based on ascospore size, hyphopodial morphology and host preference. The aim of the present study was to clarify boundaries among species and varieties in Gaeumannomyces

  14. Computational identification of putative cytochrome P450 genes in ...

    African Journals Online (AJOL)

    Chattha

    Economically, legumes represent the second most important family of crop plants after Poacea (grass family), accounting for ... further characterization of P450 genes with both known and unknown functions. MATERIALS AND METHODS ..... Cytochrome P450. In: Somerville CR, Meyerowitz EM (eds) .The Arabidopsis book,.

  15. Study of the chemical composition of essential oils and floral waters ...

    African Journals Online (AJOL)

    This work aimed to study the chemical composition of essential oils and floral waters of Cymbopogon citratus (DC.) Stapf (Poaceae) from Senegal. The plants were collected in two different localities, Dakar and. Kaolack. The extracts were obtained by steam distillation from both fresh and dried plants and analyses carried.

  16. Study of the chemical composition of essential oils and floral waters ...

    African Journals Online (AJOL)

    This work aimed to study the chemical composition of essential oils and floral waters of Cymbopogon citratus (DC.) Stapf (Poaceae) from Senegal. The plants were collected in two different localities, Dakar and Kaolack. The extracts were obtained by steam distillation from both fresh and dried plants and analyses carried ...

  17. Chromosome numbers and meiotic analysis in the pre-breeding of ...

    Indian Academy of Sciences (India)

    2011-08-19

    Aug 19, 2011 ... of Brachiaria decumbens (Poaceae). GLÉIA CRISTINA LAVERDE ... widely used grass forage worldwide because it adapts to acid soils, is easy to man- ... individual plants growing in the field, fixed in a mixture of ethanol 95% ...

  18. Contribution of chloroplast DNA in the biodiversity of some Aegilops ...

    African Journals Online (AJOL)

    user

    2011-03-21

    Mar 21, 2011 ... caudata) belonging to the family Poaceae were used in this study. Nucleotides of 1651 ... terranean basin and grow well in the high rainy areas. Syria is ... ate and easy identification of Aegilops species is required. Molecular ...

  19. A field key to upload Kenya grasses | Agnew | Journal of East ...

    African Journals Online (AJOL)

    The species of Gramineae (Poaceae) that have been recorded in a delimited area of central and western Kenya are listed and keys are provided for their identification. The area is bounded by the 1000 m contour except in the southern Rift Valley where the Kenya/Tanzania boundary encorporates lower altitudes. For every ...

  20. Stress tolerant plant species spread in the road-ne

    Czech Academy of Sciences Publication Activity Database

    Šerá, Božena

    2011-01-01

    Roč. 14, Vol.14 (2011), s. 45-46 ISSN 1644-7298 R&D Projects: GA MŠk OC10032 Institutional research plan: CEZ:AV0Z60870520 Keywords : weed * invasive * road-ne * salinity * Poaceae Subject RIV: AP - Urban, Regional and Transport Planning

  1. Problems, control, and opportunity of starch in the large scale processing of sugarcane and sweet sorghum

    Science.gov (United States)

    Both sugarcane (Saccharum officinarum) and sweet sorghum (Sorghum bicolor) crops are members of the grass (Poaceae) family, and consist of stalks rich in soluble sugars. The extracted juice from both of these crops contains insoluble starch, with much greater quantities occurring in sweet sorghum. ...

  2. 10 - 18_Aworinde

    African Journals Online (AJOL)

    DR. AMINU

    From the data, Euphorbiaceae,. Solanaceae, Rutaceae, Malvaceae, Caesalpiniaceae, Poaceae and Apocynaceae (in order of decreasing number of species) were the most frequent Families. Taxa such as Musa species,. Vernonia amygdalina, Citrus species, Psidium guajava and Terminalia catappa were found to be the.

  3. Contribution of chloroplast DNA in the biodiversity of some Aegilops ...

    African Journals Online (AJOL)

    Four Aegilops species (Aegilops longissima, Aegilops speltoides, Aegilops searsii and Aegilops caudata) belonging to the family Poaceae were used in this study. Nucleotides of 1651 bp from 5.8 S rRNA gene and the intergenic spacers trnT-trnL and trnL-trnF from the chloroplast DNA were combined together in order to ...

  4. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics. Kellen Regina Boldrini. Articles written in Journal of Genetics. Volume 85 Issue 3 December 2006 pp 225-228 Research Note. Abnormal timing of cytokinesis in microsporogenesis in Brachiaria humidicola (Poaceae: Paniceae) · Kellen Regina Boldrini Maria Suely Pagliarini Cacilda ...

  5. cas du cordon littoral Port-Bouët-Grand-Bassam

    African Journals Online (AJOL)

    Formations végétales. Espèces. Familles. Cocoteraie. Fourré littoral. Jachère. Saccharum officinarum L. Poaceae x. Salacia baumannii Loes. Celastraceae x. Sansevieria liberica Gérôme & Labroy. Agavaceae x. Sauvagesia erecta L. Ochnaceae x. Scoparia dulcis L. Scrophulariaceae x x. Sesamum radiatum Schumacher.

  6. Ecology and management of the Prairie Division

    Science.gov (United States)

    Roger C. Anderson

    2012-01-01

    Grasslands occurred on all continents, comprised almost 42 percent of the world’s plant cover, and once covered approximately 46 million km2 of the Earth’s surface. Grasslands contain few trees or shrubs, are dominated by grasses (members of the family Poaceae), and have a mixture of nongraminoid herbaceous species called forbs. Plant families...

  7. Simulating the effects of localized red:far-red ratio on tillering in spring wheat (Triticum aestivum) using a three-dimensional virtual plant model

    NARCIS (Netherlands)

    Evers, J.B.; Vos, J.; Chelle, M.; Andrieu, B.; Fournier, C.; Struik, P.C.

    2007-01-01

    The outgrowth of tiller buds in Poaceae is influenced by the ratio of red to far-red light irradiance (R:FR). At each point in the plant canopy, R:FR is affected by light scattered by surrounding plant tissues. This paper presents a three-dimensional virtual plant modelling approach to simulate

  8. New species and records of Bipolaris and Curvularia from Thailand

    NARCIS (Netherlands)

    Marin-Felix, Yasmina; Senwanna, C; Cheewangkoon, Ratchadawan; Crous, P.W.

    2017-01-01

    Several Bipolaris and Curvularia spp. were collected from different disease symptoms of Poaceae in Thailand. Phylogenetic analyses based on DNA sequence data of the internal transcribed spacer region and intervening 5.8S nrRNA gene, and partial fragments of the glyceraldehyde-3-phosphate

  9. The effects of altered levels of UV-B radiation on an Antarctic grass and lichen

    NARCIS (Netherlands)

    Lud, D.; Huiskes, A.H.L.; Moerdijk-Poortvliet, T.C.W.; Rozema, J.J.

    2001-01-01

    We report a long-term experiment on the photosynthetic response of natural vegetation of Deschampsia antarctica (Poaceae) and Turgidosculum complicatulum (Lichenes) to altered UV-B levels on Leonie Island, Antarctica. UV-B above the vegetation was reduced by filter screens during two seasons. Half

  10. Phleum exaratum, nově zavlečený druh v České republice

    Czech Academy of Sciences Publication Activity Database

    Ducháček, M.; Chrtek, Jindřich

    2017-01-01

    Roč. 36, 1-2 (2017), s. 47-53 ISSN 0231-9616 R&D Projects: GA ČR GB14-36079G Institutional support: RVO:67985939 Keywords : Phleum exaratum * Poaceae * Eastern Bohemia * alien species Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany

  11. A synteny-based draft genome sequence of the forage grass Lolium perenne

    DEFF Research Database (Denmark)

    Byrne, Stephen; Nagy, Istvan; Pfeifer, Matthias

    2015-01-01

    -family of the grass family (Poaceae). Transcriptome data was used to identify 28 455 gene models, and we utilized macro-co-linearity between perennial ryegrass and barley, and synteny within the grass family, to establish a synteny-based linear gene order. The gametophytic self-incompatibility mechanism enables...

  12. Characterization of novel multi-seeded (msd) mutants of sorghum for increasing grain number

    Science.gov (United States)

    The tribe Andropogoneae of the Poaceae family exhibits highly branched inflorescence known as panicle or tassel. Characteristically, each spikelet in a panicle or tassel comprise of a combination of sessile/fertile and sterile florets. In sorghum, (Sorghum bicolor L. Moench), the existing cultivars ...

  13. A preliminary floristic inventory in the Sierra de Mazatan, Municipios of Ures and Mazatan, Sonora, Mexico

    Science.gov (United States)

    Jose Jesus Sanchez-Escalante; Manuel Espericueta-Betancourt; Reyna Amanda Castillo-Gamez

    2005-01-01

    Presently, the flora of the Sierra de Mazatán contains 357 species of vascular plants distributed in 248 genera and 80 families. The families with the most species are Asteraceae (48), Fabaceae (45), Poaceae (28), Euphorbiaceae (18), and Acanthaceae, Cactaceae, Scrophulariaceae, and Solanaceae (11 each). The results show that the flora of the Sierra de Mazat...

  14. Genome sequence of foxtail millet (Setaria italica) provides insights into grass evolution and biofuel potential

    DEFF Research Database (Denmark)

    Zhang, Gengyun; Liu, Xin; Quan, Zhiwu

    2012-01-01

    Foxtail millet (Setaria italica), a member of the Poaceae grass family, is an important food and fodder crop in arid regions and has potential for use as a C(4) biofuel. It is a model system for other biofuel grasses, including switchgrass and pearl millet. We produced a draft genome (∼423 Mb) an...

  15. Comparative analysis and relationships of six important crop ...

    African Journals Online (AJOL)

    Administrator

    tools using complete chloroplast genomes. Results obtained depict cases of major genome rearrangements, translocation, duplication, inversion and deletion of genes. Members of the poaceae family indicate a close relationship in the nature of conserved sequences while Oryza sativa and. Chlorella vulgaris, which are not ...

  16. De novo genome assembly of the fungal plant pathogen Pyrenophora semeniperda

    Science.gov (United States)

    Marcus M. Soliai; Susan E. Meyer; Joshua A. Udall; David E. Elzinga; Russell A. Hermansen; Paul M. Bodily; Aaron A. Hart; Craig E. Coleman

    2014-01-01

    Pyrenophora semeniperda (anamorph Drechslera campulata) is a necrotrophic fungal seed pathogen that has a wide host range within the Poaceae. One of its hosts is cheatgrass (Bromus tectorum), a species exotic to the United States that has invaded natural ecosystems of the Intermountain West. As a natural pathogen of cheatgrass, P. semeniperda has potential as a...

  17. Évaluation de la diversité floristique en herbacées des savanes de ...

    African Journals Online (AJOL)

    Thus, 37 species, 33 kinds and 10 families were identified in the savannah of Hyparrhenia diplandra (Hack.) Stapf and 27 species, 22 kinds and 8 families in the savannah of Loudetia simplex (Nees) CE Hubbard. Overall, the richest families in species were Poaceae, Fabaceae and the Cyperaceae. The Shannon diversity ...

  18. Genetic variation and population structure in Oryza ...

    Indian Academy of Sciences (India)

    Oryza malampuzhaensis Krish. et Chand. ( 2 n = 4 x = 48 ; Poaceae, Oryza) is endemic to Western Ghats, South India, and shows a highly localized distribution over a small geographical area in this region. This is the most poorly understood taxon in genus Oryza and is often misidentified as O. officinalis owing to their close ...

  19. Short-term effects of airborne pollens on asthma attacks as seen by general practitioners in the Greater Paris area, 2003-2007.

    Science.gov (United States)

    Huynh, Bich Tram; Tual, Séverine; Turbelin, Clément; Pelat, Camille; Cecchi, Lorenzo; D'Amato, Gennaro; Blanchon, Thierry; Annesi-Maesano, Isabella

    2010-09-01

    To investigate for the first time the short-term effects of airborne pollen counts on general practitioner (GP) consultations for asthma attacks in the Greater Paris area between 2003-2007. Counts were available for common pollens (Betula, Cupressa, Fraxinus and Poaceae). Weekly data on GP visits for asthma attacks were obtained from the French GP Sentinel Network. A quasi-Poisson regression with generalised additive models was implemented. Short-term effects of pollen counts were assessed using single and multi-pollen models after adjustment for air pollution and influenza. A mean weekly incidence rate of 25.4 cases of asthma attacks per 100,000 inhabitants was estimated during the study period. The strongest significant association between asthma attacks and pollen counts was registered for grass (Poaceae) in the same week of asthma attacks, with a slight reduction of the effect observed in the multi-pollen model. Adjusted relative risk for Poaceae was 1.54 (95% CI: 1.33-1.79) with an inter-quartile range increase of 17.6 grains/m3 during the pollen season. For the first time, a significant short-term association was observed between Poaceae pollen counts and consultations for asthma attacks as seen by GPs. These findings need to be confirmed by more consistent time-series and investigations on a daily basis.

  20. Development and Verification of a Weld Simulation Capability for VAST

    Science.gov (United States)

    2012-06-01

    d’abord été intégrées au modèle de matériaux élastiques- plastiques , afin de faciliter l’exécution d’analyses couplées thermiques et mécaniques; le...modèle constitutif thermique-élastique- plastique obtenu a été modifié afin de tenir compte des processus de fusion et de solidification des matériaux...chaleur ont d’abord été intégrées au modèle de matériaux élastiques- plastiques , afin de faciliter l’exécution d’analyses couplées thermiques et

  1. Rapid sequencing of the bamboo mitochondrial genome using Illumina technology and parallel episodic evolution of organelle genomes in grasses.

    Science.gov (United States)

    Ma, Peng-Fei; Guo, Zhen-Hua; Li, De-Zhu

    2012-01-01

    Compared to their counterparts in animals, the mitochondrial (mt) genomes of angiosperms exhibit a number of unique features. However, unravelling their evolution is hindered by the few completed genomes, of which are essentially Sanger sequenced. While next-generation sequencing technologies have revolutionized chloroplast genome sequencing, they are just beginning to be applied to angiosperm mt genomes. Chloroplast genomes of grasses (Poaceae) have undergone episodic evolution and the evolutionary rate was suggested to be correlated between chloroplast and mt genomes in Poaceae. It is interesting to investigate whether correlated rate change also occurred in grass mt genomes as expected under lineage effects. A time-calibrated phylogenetic tree is needed to examine rate change. We determined a largely completed mt genome from a bamboo, Ferrocalamus rimosivaginus (Poaceae), through Illumina sequencing of total DNA. With combination of de novo and reference-guided assembly, 39.5-fold coverage Illumina reads were finally assembled into scaffolds totalling 432,839 bp. The assembled genome contains nearly the same genes as the completed mt genomes in Poaceae. For examining evolutionary rate in grass mt genomes, we reconstructed a phylogenetic tree including 22 taxa based on 31 mt genes. The topology of the well-resolved tree was almost identical to that inferred from chloroplast genome with only minor difference. The inconsistency possibly derived from long branch attraction in mtDNA tree. By calculating absolute substitution rates, we found significant rate change (∼4-fold) in mt genome before and after the diversification of Poaceae both in synonymous and nonsynonymous terms. Furthermore, the rate change was correlated with that of chloroplast genomes in grasses. Our result demonstrates that it is a rapid and efficient approach to obtain angiosperm mt genome sequences using Illumina sequencing technology. The parallel episodic evolution of mt and chloroplast

  2. Counter-IED Initiative PPE Horizon 0, Phase 1, Protection Versus Performance Preliminary Trade-off Analysis, Behavioural Task Analysis (Initiative d’epi pour la Lutte aux IED - Horizon 0 Phase 1 - Analyse de Compromis Preliminaire de la Protection par Rapport au Rendement Analyse Comportementale des Taches)

    Science.gov (United States)

    2007-05-01

    fournit les connaissances spécialisées en ergonomie pour soutenir ce projet. Afin de formuler des recommandations relativement à l’EPI pour corriger...important. RDDC Toronto fournit les connaissances spécialisées en ergonomie pour soutenir ce projet. Afin de formuler des recommandations relativement à...Programme de démonstration de technologie (PDT) de C−IED plus important. RDDC Toronto fournit les connaissances spécialisées en ergonomie pour soutenir

  3. Banco de datos de presas de hormigón con expansiones

    OpenAIRE

    Pardo Marín, Félix; Aguado de Cea, Antonio; Agulló Fité, Luís; Buil Sanz, Juan Manuel; Gil, A.

    2010-01-01

    El estudio del comportamiento expansivo del hormigón en presas e instalaciones afines a las mismas comprende diferentes actuaciones que inciden de un modo transversal en aspectos que incluyen a los materiales, la tipología estructural y el régimen de explotación. Asimismo, los efectos derivados de las expansiones en el hormigón pueden incidir tanto en las condiciones de seguridad de la presa como en la funcionalidad de la misma, o de sus órganos afines. En esta comunicación se exponen las ...

  4. Développement de la pupillométrie pour la mesure objective des émotions dans le contexte de la consommation alimentaire

    OpenAIRE

    Lemercier, Anaïs

    2014-01-01

    Les perceptions sensorielles et hédoniques résultent de processus complexes d’intégration, qui ne sont pas seulement rationnels, mais aussi fondés sur des sentiments, des émotions et des souvenirs. Afin d'appréhender au mieux le comportement du consommateur, il est devenu indispensable de mesurer les émotions afin de comprendre leur rôle fondamental dans la prise de décision. En science du consommateur, les émotions sont principalement mesurées par questionnaire. Malheureusement, cette mesure...

  5. india : tous les projets | Page 12 | CRDI - Centre de recherches pour ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    'initiative Casablanca rassemble des militantes et des universitaires du Sud, afin d'intégrer les connaissances des femmes à la question de la pauvreté mondiale, dont le fardeau de plus en plus lourd afflige surtout les femmes. Date de début ...

  6. 8Wambi heritability.pmd

    African Journals Online (AJOL)

    ACSS

    Cultural, biological and chemical control measures have received limited ... as a percentage of the mean (GAM) and heritability were estimated using variance components. ... présente étude a été conduite afin de déterminer l'héritabilité de la ...

  7. Collecte de connaissances féministes en vue d'exercer une ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Collecte de connaissances féministes en vue d'exercer une influence sur les politiques publiques. Financée par le Programme des Nations Unies pour le développement (PNUD), l'initiative Casablanca rassemble des militantes et des universitaires du Sud, afin d'intégrer les connaissances des femmes à la question de la ...

  8. C:\\Users\\AISA\\Desktop\\FOFANA INZA.xps

    African Journals Online (AJOL)

    AISA

    objectif est d'évaluer la variabilité de certains descripteurs afin d'identifier les plus discriminants .... permis d'évaluer les performances biométriques des populations. Les Analyses en Composantes. Principales (ACP) ont été conduites à l'aide du.

  9. Traits morphologiques des graines et vigueur des jeunes plants de ...

    African Journals Online (AJOL)

    écologique du Sénégal afin de pouvoir sélectionner une meilleure semence qui sera destinée aux programmes de développement des énergies renouvelables. Morphological traits of seeds and seedling vigor of two sources of Jatropha curcas L. in ...

  10. Traits morphologiques des graines et vigueur des jeunes plants de ...

    African Journals Online (AJOL)

    SARAH

    écologique du Sénégal afin de pouvoir sélectionner une meilleure semence qui sera destinée aux programmes de développement des énergies renouvelables. Journal of Applied Biosciences 88:8249– 8255. ISSN 1997–5902 ...

  11. Food Sovereignty and Uncultivated Biodiversity in South Asia ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    1 janv. 2007 ... In the food systems of South Asia, the margin between cultivated and ... and guides the reader into new territory, where food, ecology, and culture converge. ... Based on extensive field research in India and Bangladesh, with and by ... Le CRDI se joint au Forum économique mondial afin de présenter les ...

  12. Recursos y enlaces sobre comunidades de aprendizaje

    OpenAIRE

    Ferrer Esteban, Gerard

    2005-01-01

    Obras y artículos sobre el proyecto Comunidades de Aprendizaje desarrollado en el Estado español. Tesis doctorales sobre comunidades de aprendizaje. Fundamentación teórica de las comunidades de aprendizaje. Sitios en Internet relacionados con las comunidades de aprendizaje y proyectos afines de desarrollo comunitario en contextos escolares.

  13. Création d'emplois dans l'agriculture africaine | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    agriculture africaine. ... collaborera avec la Banque africaine de développement et le Programme des Nations Unies pour le développement afin de compléter le soutien provenant du CRDI et de l'UK Department for International Development.

  14. El mundo está en tus manos

    OpenAIRE

    Cabrales Arzola, Fernanda; González Gamez, María F

    2017-01-01

    Esta inforgrafía va dirigida a niños especialmente de la edad de 8 a 12 años, con el objetivo de formar una cultura de cuidado al medio ambiente y al mismo tiempo sembrar un interés en temas afines a energía sustentable.

  15. Analyste de systèmes intermédiaire (h/f) | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'analyste de systèmes intermédiaire travaille sous la supervision du ... à la mise en œuvre et à la maintenance d'un large éventail de systèmes tout en assurant ... directement les consultants externes sous contrat afin de faciliter la transition ...

  16. Approche socio-culturelle de l'epilepsie en Cote d'Ivoire | Boa Yapo ...

    African Journals Online (AJOL)

    Contexte En Afrique, l'épileptique est encore trop souvent stigmatisé, du fait de la méconnaissance de la maladie et des croyances surnaturelles ou mystiques. Objectif Analyser la connaissance et la perception de l'épilepsie par l'entourage proche des personnes épileptiques suivies en milieu hospitalier neurologique, afin ...

  17. Mise en évidence d'une variation intra spécifique chez Botrytis ...

    African Journals Online (AJOL)

    SARAH

    25 avr. 2013 ... 2 Présidence de l'Université Ibn Tofaïl, Kenitra, Maroc. Auteur correspondant .... ambiante et sous lumière continue afin de favoriser davantage la .... formation de sclérotes sur les disques foliaires de tomate est observée chez ...

  18. Sécurité alimentaire : une lutte sur plusieurs fronts | CRDI - Centre ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    1 févr. 2011 ... En 1996, 180 pays – dont le Canada – ont participé à Rome au Sommet ... la Déclaration de Rome sur la sécurité alimentaire mondiale et le Plan .... de la finance, du marketing et de l'information à de petits exploitants afin ...

  19. Justice Project en Asie du Sud | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le Justice Project réunit des documentaristes de renom, des chercheurs chevronnés et des praticiens afin de documenter l'état de la justice dans la région. Seront ... As countries in South Asia move toward greater economic integration, a range of interconnected challenges to constitutional and human rights guarantees are ...

  20. Impact d'un module de formation à l'arbitrage sur l'implicaiton des bénévoles dans le volley-ball

    OpenAIRE

    Van Hoye, Martin; Roulin, Céline; Cloes, Marc

    2014-01-01

    En raison du manque de bénévoles dans les clubs de volley-ball, les clubs doivent trouver des solutions. Dans cette étude, nous avons proposé un module de formation à l'arbitrage afin d'impliquer des parents, des amis et des joueurs d'autres équipes dans la gestion de matches.

  1. BUYING AND SELLING A SMALL BUSINESS.

    Science.gov (United States)

    Part One takes the form of a manual of the processes and techniques of buying and selling a small business . This material is presented in a...finalizing the transaction and planning for operation under new ownership and management . Part Two reports the nature of the research conducted during the

  2. 1825-IJBCS-Article-Sandong Rodigue

    African Journals Online (AJOL)

    hp

    Essai d'analyses de la conception paysanne de l'évolution, de la gestion et de ... d'aménagement, découlant de cette perception, ont été proposées afin d'atténuer la dynamique régressive ..... contrôles nocturnes, surtout en saison sèche.

  3. Adjoint de programme régional (h/f) | CRDI - Centre de recherches ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'adjoint de programme doit établir les priorités parmi les multiples ... sur un système de contrôle, en établissant l'ordre prioritaire afin de respecter les ... Au besoin, aider les agents de gestion de programme à entretenir et à mettre à jour les ...

  4. S'adapter à une nouvelle réalité environnementale au Maroc | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    environnement ne cessent d'avoir une incidence sur le Maroc, un projet financé par le CRDI aide les populations à innover afin de survivre. Cet article fait partie d'une série de reportages sur des projets innovants mis en oeuvre ...

  5. Analyse complète et systématique des protéines mutantes p53 dans ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Une fois l'identification terminée, l'objectif ultime est de cribler des composés qui perturbent ces interactions afin de trouver de nouvelles stratégies thérapeutiques pour traiter les patients qui présentent ces mutations ... Sinai Health System.

  6. Defining, Measuring, and Comparing Organisational Cultures

    NARCIS (Netherlands)

    van den Berg, Peter T.; Wilderom, Celeste P.M.

    2004-01-01

    La littérature portant sur la culture des organisations souffre d’un manque manifeste d’enquêtes extensives débouchant sur des études comparatives. Afin de rendre plus comparables les cultures organisationnelles, nous proposons une définition et une série de dimensions. La culture organisationnelle

  7. Visitando a Mintzberg: Su concepto de estrategia y principales escuelas

    OpenAIRE

    Iván Alonso Montoya Restrepo

    2005-01-01

    El presente artículo explora las definiciones ofrecidas por Henry Mintzberg sobre estrategia, así como las escuelas afines a estos planteamientos. Identifica luego los nichos de investigación al cruzar las definiciones de Mintzberg con el concepto de distancia de poder empleado por Hofstede.

  8. Cap sur l'Ouest : les Prairies canadiennes, élément essentiel de la ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    1 mai 2014 ... Doté de 124 millions de dollars par le gouvernement du Canada, ce Fonds donne la possibilité à des chercheurs du Canada et de pays en développement de conjuguer leurs compétences afin de favoriser les innovations en agriculture et en nutrition, en particulier celles qui profitent aux petits exploitants ...

  9. Figura y fondo. Arquitectura y espacio público en el Montevideo contemporáneo

    Directory of Open Access Journals (Sweden)

    Liliana Carmona

    2011-12-01

    El análisis verifica prácticas afines a las prefiguradas, observándose distintas relaciones entre arquitectura y espacio público, entendidas como interacciones figura/fondo. Estas fluctúan entre lo escenográfico, el espacio existencial y la gravitación en torno a íconos.  

  10. Exigences réglementaires et recommandations concernant le traitement de l'eau vis-à-vis des agents pathogènes en entrée et en sortie d'écloseries conchylicoles

    OpenAIRE

    Bonvarlet, Florence

    2011-01-01

    Ce document présente les exigences réglementaires et recommandations relatives aux différents traitement de l'eau en entrée et en sortie d'écloseries conchylicoles. Afin de respecter cette réglementation des solutions, des méthodes de traitement y sont mentionnées.

  11. Managing Natural Resources for Sustainable Livelihoods : Uniting ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Il donne des idées afin que la recherche soit participative tout en restant ... au Centre pour la recherche forestière internationale (CIFOR), en Indonésie, ... coopération scientifique et technologique en appui aux projets de recherche conjoints.

  12. Résultats de recherche | Page 18 | CRDI - Centre de recherches ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'Initiative des conseils subventionnaires de la recherche scientifique en ... en matière de coopération dans les domaines de la science internationale, ... Le CRDI soutient Shirkat Gah afin d'améliorer les droits génésiques des Pakistanaises.

  13. Résultats de recherche | Page 29 | CRDI - Centre de recherches ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'Initiative des conseils subventionnaires de la recherche scientifique en ... en matière de coopération dans les domaines de la science internationale, ... Le CRDI soutient Shirkat Gah afin d'améliorer les droits génésiques des Pakistanaises.

  14. Résultats de recherche | Page 17 | CRDI - Centre de recherches ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'Initiative des conseils subventionnaires de la recherche scientifique en ... en matière de coopération dans les domaines de la science internationale, ... Le CRDI soutient Shirkat Gah afin d'améliorer les droits génésiques des Pakistanaises.

  15. Résultats de recherche | Page 29 | CRDI - Centre de recherches ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Les prix de la diplomatie scientifique reconnaissent les réalisations remarquables en matière de coopération dans les domaines de la science internationale, de la ... Le CRDI soutient Shirkat Gah afin d'améliorer les droits génésiques des ...

  16. Plate-forme d'outils en logiciel libre pour l'enseignement supérieur ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    POLLES) vise à mettre en place un réseau d'experts en logiciels libres afin de développer des outils informatiques pour l'usage des universités nord africaines. Trois sortes d'outils seront développées : des logiciels d'infrastructure technologique ...

  17. Neglected Issues Relating to African Health Systems: An Incentive ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Etudes et de Recherches sur les Dynamyques Sociales et le Développement Local. Pays d' institution. Niger. Site internet. http://www.lasdel.net. Contenus connexes. Favoriser les innovations en matière de vaccins afin d'améliorer les conditions ...

  18. Document de travail 6: A Conceptual Framework to Guide Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    16 déc. 2010 ... Document de travail 6: A Conceptual Framework to Guide Research on ... du secteur privé ainsi que les tendances qui influencent l'élaboration et la ... afin de guider l'élaboration de son agenda de recherche en matière de ...

  19. Les perspectives pour une repression efficace des infractions ...

    African Journals Online (AJOL)

    ... afin qu'il dispose de compétences nécessaires à son bon fonctionnement. Nous estimons que pour atteindre cet objectif, il faut nécessairement envisager, ... coherent environmental legislation, an operational and efficient legal framework.

  20. Literatura e História: loucura, paixão e guerra - conside-rações sobre uma questão pessoal, de Beppe Fenoglio

    OpenAIRE

    Vanessa Gomes Franca

    2008-01-01

    Notre recherche constitueune étude de la rélation entreLittérature et Histoire dans le romanUma questão pessoal, de BeppeFenoglio. Afin de verifier cetterélation, nous avons aborder desaspects relatifs à la folie, à l’amouret à la guerre.

  1. Literatura e História: loucura, paixão e guerra - conside-rações sobre uma questão pessoal, de Beppe Fenoglio

    Directory of Open Access Journals (Sweden)

    Vanessa Gomes Franca

    2008-01-01

    Full Text Available Notre recherche constitueune étude de la rélation entreLittérature et Histoire dans le romanUma questão pessoal, de BeppeFenoglio. Afin de verifier cetterélation, nous avons aborder desaspects relatifs à la folie, à l’amouret à la guerre.

  2. Prevalence of Tuberculosis among patients attending two ...

    African Journals Online (AJOL)

    . Cette étude a été menée afin d'examiner le taux d'infections à Mycobacteriumtuberculosi schez les individus suivis à la clinique externe de deux hôpitaux de métropole de Abeokuta au Sud-ouest du Nigéria. Sur les 132 individus examinés, ...

  3. Directeur, administration des subventions (h/f) | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Diriger l'élaboration de politiques régissant l'administration de projets du Centre ... Tenir à jour un aperçu stratégique des activités de projet du Centre afin d'en .... Gérer le recrutement du personnel de l'administration des subventions dans ...

  4. Frequently Asked Questions - GHRI Calls

    International Development Research Centre (IDRC) Digital Library (Canada)

    Genevieve Prud'homme

    16 mai 2014 ... politiques et recherche en matière de santé (OPRS). ..... utilisée afin de mettre en oeuvre une intervention ou une stratégie et le restant des fonds .... Est-il permis de recruter un(e) candidat(e) au doctorat et d'utiliser des fonds ...

  5. Pour lire le résumé complet, Stimuler les possibilités d'emploi pour ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    en matière de politiques doivent aller au-delà des efforts visant à garder les jeunes à ... qui facilitent le recrutement. Les sociétés du secteur de l' ... la Tanzanie devra se donner une stratégie claire afin d'améliorer ses résultats lamentables sur ...

  6. Rapport annuel

    International Development Research Centre (IDRC) Digital Library (Canada)

    1 janv. 2018 ... En avril 2015, le CRDI lançait son Plan stratégique 2015-. 2020 : Investir .... C'est dans cet esprit que la nouvelle Politique de libre accès du CRDI ...... mise en place afin d'améliorer les processus de recrutement, de formation ...

  7. Directeur de domaine de programme (h/f) | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... le directeur de domaine de programme, fournit de l'information stratégique, ... et assumer la responsabilité du recrutement, de l'affectation, de l'orientation, de ... des politiques et de la planification (GPP) afin de consolider la cohérence de la ...

  8. Activites antimicrobiennes des extraits de trios plantes medicinales ...

    African Journals Online (AJOL)

    Les propriétés antimicrobiennes des extraits hydroéthanoliques des feuilles de Spondias mombin L. (Anacardiaceae), de Psidium guajava L. (Myrtaceae) et de Pterocarpus santalinoides L. (Papilionadeae) sont étudiées afin de justifier leur utilisation pour le traitement des infections et toxi-infections alimentaires au Bénin.

  9. Jeunes à risque et emplois à l'ère numérique | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ; on aura recours aux ordinateurs portables, aux jeux et aux plateformes du Web 2.0 afin que les élèves puissent parfaire leur apprentissage dans un cadre scolaire. Le projet se déroulera dans une école de Buenos Aires où sont réunies les ...

  10. Commande non linéaire du moteur synchrone à aimants ...

    African Journals Online (AJOL)

    un entrainement d'une charge mécanique à deux masses. Afin d'assurer la stabilité ... robustness of the proposed control strategy and the efficiency of nonlinear controllers operating with ..... Fuzzy Logic in Solar-Wind Hybrid Power. System ...

  11. Contestation des Nobel une tradition aussi ancienne que leur attribution

    CERN Document Server

    Sevestre, G

    2003-01-01

    "La contestation des Nobel, avec cette annee la campagne lancee par un Americain afin de faire reconnaitre son role dans la mise au point de l'imagerie a resonance magnetique (IRM), constitue une tradition, quasiment aussi ancienne que l'attribution de ces distinctions" (1 page).

  12. Résultats de recherche | Page 149 | CRDI - Centre de recherches ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    La subvention permettra au Conseil des gouverneurs du CRDI de commander huit documents devant faire l'objet d'un examen par des pairs à d'éminents penseurs, afin de mettre en lumière les changements qui surviennent à l'échelle de la planète et les. Projet.

  13. Local community perceptions of conservation policy: rights ...

    African Journals Online (AJOL)

    tions have provoked a wide range of mostly negative reactions amongst local villagers ... conservation, afin notamment que ces actions soient efficaces. Cette étude se focalise .... since the 1980s, there has been a gradual move towards more in- .... getting as equal a representation of male and female informants as well as ...

  14. 12 Layout ppp2

    African Journals Online (AJOL)

    Nubidga

    des échantillons d'eau issus des différentes sources respectives afin de comparer la qualité de l'eau à la source ..... Figure 2: Piper's diagram showing the various water types of all the water samples sampled. ..... Information on Phosphorus.

  15. Visitando a Mintzberg: Su concepto de estrategia y principales escuelas

    Directory of Open Access Journals (Sweden)

    Iván Alonso Montoya Restrepo

    2005-07-01

    Full Text Available El presente artículo explora las definiciones ofrecidas por Henry Mintzberg sobre estrategia, así como las escuelas afines a estos planteamientos. Identifica luego los nichos de investigación al cruzar las definiciones de Mintzberg con el concepto de distancia de poder empleado por Hofstede.

  16. Le CRDI au Cambodge

    International Development Research Centre (IDRC) Digital Library (Canada)

    occasion aux chercheurs du ... afin de mieux comprendre comment les collec- tivités peuvent gérer les ressources forestières, côtières et ... situation, dont les autorités ne tiennent bien souvent pas compte. Des chercheurs fournis - sent à des ...

  17. : tous les projets | Page 589 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: HEALTH SURVEYS, HEALTH STATISTICS, INFORMATION NETWORKS, TELECOMMUNICATIONS, TELEPHONE, PRIMARY HEALTH CARE. Région: Mozambique, North of Sahara, South of Sahara. Financement total : CA$ 1,596,842.00. Réseau d'information sur la santé du Mozambique. Projet. Il est vital, afin ...

  18. 7 « ETAT, HERITAGE COLONIAL ET STRATEGIE DE ...

    African Journals Online (AJOL)

    gate lse

    d'une économie de marché basée sur la promotion de l'entreprise pri- vée afin ...... segmentation du marché du travail entre secteur formel et secteur info- rmel, ce dernier ... cules de tourisme et les médicaments) et enfin les biens alimentaires.

  19. As disciplinas de administração da produção: nos cursos superiores de administração de empresas ministrados na Grande São Paulo

    OpenAIRE

    Pilão, Nivaldo Elias

    1987-01-01

    Esta pesquisa pretende contribuir para a discussão sobre o ensino de Administração de Empresas de modo geral e, especificamente, sobre as disciplinas "Administração da Produção", "Administração de Materiais" e outras afins e/ou complementares.

  20. Les troubles gonadiques chez les hémodialysés chroniques à l ...

    African Journals Online (AJOL)

    étude montre une forte prévalence des manifestations cliniques des troubles gonadiques chez les patients en hémodialyse chronique. Aussi elles doivent être recherchées afin de mieux les prendre en charge, car ces troubles sont vécus par ...