Ploidy levels among species in the 'Oxalis tuberosa alliance' as inferred by flow cytometry.

Science.gov (United States)

Emshwiller, Eve

2002-06-01

The 'Oxalis tuberosa alliance' is a group of Andean Oxalis species allied to the Andean tuber crop O. tuberosa Molina (Oxalidaceae), commonly known as 'oca'. As part of a larger project studying the origins of polyploidy and domestication of cultivated oca, flow cytometry was used to survey DNA ploidy levels among Bolivian and Peruvian accessions of alliance members. In addition, this study provided a first assessment of C-values in the alliance by estimating nuclear DNA contents of these accessions using chicken erythrocytes as internal standard. Ten Bolivian accessions of cultivated O. tuberosa were confirmed to be octoploid, with a mean nuclear DNA content of approx. 3.6 pg/2C. Two Peruvian wild Oxalis species, O. phaeotricha and O. picchensis, were inferred to be tetraploid (both with approx. 1.67 pg/2C), the latter being one of the putative progenitors of O. tuberosa identified by chloroplast-expressed glutamine synthetase data in prior work. The remaining accessions (from 78 populations provisionally identified as 35 species) were DNA diploid, with nuclear DNA contents varying from 0.79 to 1.34 pg/2C.

Estabilidade do néctar misto de cajá e umbu.

OpenAIRE

MATTIETTO, R. de A.; LOPES, A. S.; MENEZES, H. C. de.

2008-01-01

As tendências do setor alimentício são ditadas pelo mercado consumidor e seu comportamento social. Atualmente, a busca por produtos saudáveis tem crescido e frutos exóticos estão sendo cada vez mais utilizados visando o fator inovação. O cajá e umbu são frutos bastante comercializados no Norte e Nordeste do Brasil e o desenvolvimento de produtos à base destes frutos mostra ser uma opção interessante, pelo sabor e pelas características de funcionalidade. Elaborou-se um néctar misto que foi sub...

IDENTIFIKASI SENYAWA AKTIF DAUN PLETEKAN (Ruellia tuberosa L. DENGAN MENGGUNAKAN GC-MS

Directory of Open Access Journals (Sweden)

Ida Ayu Nopiari

2017-02-01

Full Text Available ABSTRACT The use of traditional medicines in human therapies has been claimed to be much safer than that of synthetic medicines with many negative side effects. Pletekan plant (Ruellia tuberosa L. has been used empirically for years as an antidiabetic as its leaves contain poly phenolic compounds with the ability to stimulate beta cells of the pancreas so that its capability to produce insulin improved. The main objective of our research was to identify active compounds contained in Ruellia tuberosa L. leaves extracted with ethanol. Fractionation of these active compounds was conducted by applying column and thin layer chromatography using Dichlorometan and Ethylacetat with a ratio of 6:3 as eluent. Each active compound resulted from fractionation was identified using GC-MS analysis. The results showed that four active compounds (Hexadecanamide, 9-Octadecenamide, (Z, Octadecenamide and 1,2-Benzenedicarboxylic acid were identified in this analysis. Keywords: Ruellia tuberosa L., identification of active compounds.

DESENVOLVIMENTO DE GELEIA DE UMBU-CAJÁ CONVENCIONAL E DIETÉTICA

OpenAIRE

VIANA, ELISETH DE SOUZA; MAMEDE, MARIA EUGÊNIA DE OLIVEIRA; REIS, RONIELLI CARDOSO; CARVALHO, LEONARDO DIB DE; FONSECA, MÉRCIA DAMASCENO

2015-01-01

RESUMO O objetivo deste estudo foi desenvolver e caracterizar geleias de umbu-cajá, convencional (com sacarose) e dietética (com xilitol), a partir dos genótipos Suprema e Preciosa. As formulações foram elaboradas com a proporção 1:1, de polpa mais açúcar ou polpa mais xilitol, com 0,5% de pectina e teor final de sólidos solúveis entre 62 e 65 °Brix. As geleias foram analisadas em relação às suas características físico-químicas (pH, acidez titulável, sólidos solúveis, açúcares totais, umidade...

EN LAS CAJAS DE AHORROS ESPAÑOLAS

Directory of Open Access Journals (Sweden)

Isidoro Guzmán

2011-01-01

Full Text Available El rendimiento del sector financiero español ha sido objeto de diversos estudios alo largo del decenio de los novena del sigloXXcomo consecuencia de los impor-tantes cambios a los que ha estado sometido. Las cajas de ahorros españolas nohan sido ajenas a este tipo de estudios, si bien circunscritos de manera exclusiva alexamen de su eficiencia y productividad, relegando a un segundo plano el análisisdel cumplimiento de su fin social, materializado económicamente en el gasto anualdestinado a obra social.En este contexto, la principal aportación de nuestro estudio es la obtención deevidencia empírica de la existencia de una relación de causalidad entre la creaciónde valor social de las cajas de ahorro españolas, medida por medio del estableci-miento de unratiode gasto social, y sus cambios en productividad, cuantificadosmediante el cálculo del índice de productividad de Malmquist basado en el trazadode fronteras eficientes a partir de la técnica no paramétrica del análisis envolvente dedatos (AED (Data Envelopment Analysis,DEA.Para el censo de cajas de ahorro españolas en el periodo 2003-2007, nuestrosresultados revelan que las entidades que presentan mayor productividad alcanzancotas superiores en elratiode gasto social, incluso después de controlar por medi-das tradicionales como la rentabilidad económica y el tamaño.

Nootropic activity of tuber extract of Pueraria tuberosa (Roxb).

Science.gov (United States)

Rao, N Venkata; Pujar, Basavaraj; Nimbal, S K; Shantakumar, S M; Satyanarayana, S

2008-08-01

Nootropic effect of alcoholic (ALE; 50, 75, 100 mg/kg) and aqueous (AQE; 100, 200, 400 mg/kg) extracts of P. tuberosa was evaluated by using Elevated Plus Maze (EPM), scopolamine-induced amnesia (SIA), diazepam-induced amnesia (DIA), clonidine-induced (NA-mediated) hypothermia (CIH), lithium-induced (5-HT mediated) head twitches (LIH) and haloperidol-induced (DA- mediated) catalepsy (HIC) models. Piracetam was used as the standard drug. A significant increase in inflexion ratio (IR) was recorded in EPM, SIA and DIA models. A significant reversal effect was observed on rectal temperature in CIH model, reduction of head twitches in LIH models. However no significant reduction in catalepsy scores in HIC models were observed with test extracts and standard piracetam. The results indicate that nootropic activity observed with ALE and AQE of tuber extracts of P. tuberosa could be through improved learning and memory either by augmenting the noradrenaline (NA) transmission or by interfering with 5-hydroxytryptamine (5-HT) release. Further, the extracts neither facilitated nor blocked release of the dopamine (DA). Thus ALE and AQE elicited significant nootropic effect in mice and rats by interacting with cholinergic, GABAnergic, adrenergic and serotonergic systems. Phytoconstituents like flavonoids have been reported for their nootropic effect and these are present in both ALE and AQE extracts of tubers of P. tuberosa (Roxb) and these active principles may be responsible for nootropic activity.

flexZhouse : New business model for aff ordable housing in Malaysia

NARCIS (Netherlands)

Bin Mohd Noor, M.Z.

2017-01-01

Central to this PhD research was the problem of the lack of aff ordable housing for young starters in Malaysia. The solutions for aff ordable housing that are available in the market do not truly solve the problem from the customer’s point of view. Hence, it was important to analyse the contributing

Ploidy Levels among Species in the ‘Oxalis tuberosa Alliance’ as Inferred by Flow Cytometry

Science.gov (United States)

EMSHWILLER, EVE

2002-01-01

The ‘Oxalis tuberosa alliance’ is a group of Andean Oxalis species allied to the Andean tuber crop O. tuberosa Molina (Oxalidaceae), commonly known as ‘oca’. As part of a larger project studying the origins of polyploidy and domestication of cultivated oca, flow cytometry was used to survey DNA ploidy levels among Bolivian and Peruvian accessions of alliance members. In addition, this study provided a first assessment of C‐values in the alliance by estimating nuclear DNA contents of these accessions using chicken erythrocytes as internal standard. Ten Bolivian accessions of cultivated O. tuberosa were confirmed to be octoploid, with a mean nuclear DNA content of approx. 3·6 pg/2C. Two Peruvian wild Oxalis species, O. phaeotricha and O. picchensis, were inferred to be tetraploid (both with approx. 1·67 pg/2C), the latter being one of the putative progenitors of O. tuberosa identified by chloroplast‐expressed glutamine synthetase data in prior work. The remaining accessions (from 78 populations provisionally identified as 35 species) were DNA diploid, with nuclear DNA contents varying from 0·79 to 1·34 pg/2C. PMID:12102530

Esclerosis Tuberosa. Revisión

OpenAIRE

Fernández Concepción, Otman; Gómez García, Ariel; Sardiñaz Hernández, Norberto

1999-01-01

Se realiza una revisión actualizada sobre las peculiaridades clínicas, radiológicas y neuropatológicas de la esclerosis tuberosa, la más representativa de las enfermedades neurocutáneas que evolucionan con manchas hipocrómicas y segunda en frecuencia de las facomatosis. Las manchas hipocrómicas asociadas con espasmos infantiles o cardiomegalia en lactantes y la evidencia de crisis epilépticas y angiofibromas faciales en la infancia tardía, constituyen las formas habituales de presentación de ...

Avaliação do armazenamento a frio sobre os compostos bioativos e as características físico-químicas e microbiológicas do suco de umbu pasteurizado

OpenAIRE

Ribeiro, Leilson de Oliveira; Pontes, Sérgio Macedo; Ribeiro, Ana Paula de Oliveira; Pacheco, Sidney; Freitas, Suely Pereira; Matta, Virgínia Martins da

2017-01-01

Resumo Este trabalho teve como objetivo avaliar o efeito do armazenamento a 6 °C nas características do suco de umbu pasteurizado. A pasteurização foi realizada a 86 °C por 25 s em um pasteurizador de superfície raspada, sendo o suco de umbu mantido a 6 °C por 90 dias. O suco pasteurizado atendeu ao padrão estabelecido pela legislação brasileira com contagem

The Effects of Root Extract Ruellia tuberosa L on Histopathology and Malondialdehyde Levels on the Liver of Diabetic Rats

Science.gov (United States)

Nur Laily Kurniawati, Alfin; Aulanni'am; Srihardyastutie, Arie; Safitri, Anna

2018-01-01

The aim of this research is to study antidiabetic activity of root extract of Ruellia tuberosa L on rats (Rattus novergicus) induced by multiple-low dose streptozotocin as animal diabetic models. The parameters investigated were blood glucose levels, free radicals (MDA, malondialdehyde) levels and hepatic histopathology. The main materials used were n-hexane root extracts from Ruellia tuberosa L. Three groups of rats, including control group (group I), diabetic group (group II), and therapy group with Ruellia tuberosa L (group III), were used. Streptozotocin was given at multiple-low dose of 20 mg/kg of body weight for 5 times in 5 consecutive days i.p. to rats in groups II and III. The Ruellia tuberosa L extracts were then given orally for group III in the dose of 250 mg/kg of body weight per day for 3 weeks. Results of the current work showed that root extract Ruellia tuberosa L had lowered blood glucose levels on rats in group III by 60.3%, from 299.7 ± 24.7 mg/dL up to 119.0 ± 26.6 mg/dL. Moreover, the antidiabetic activity of Ruellia tuberosa L extracts also deduced from decrease of MDA levels in group III, from 3.5 ± 0.3 μg/mL up to 1.7 ± 0.4 μg/mL. The recovery of hepatic organ from treatment group has also been proven from the its histology profiles stained with hematoxylin-eosin.

Ploidy Levels among Species in the ‘Oxalis tuberosa Alliance’ as Inferred by Flow Cytometry

OpenAIRE

EMSHWILLER, EVE

2002-01-01

The ‘Oxalis tuberosa alliance’ is a group of Andean Oxalis species allied to the Andean tuber crop O. tuberosa Molina (Oxalidaceae), commonly known as ‘oca’. As part of a larger project studying the origins of polyploidy and domestication of cultivated oca, flow cytometry was used to survey DNA ploidy levels among Bolivian and Peruvian accessions of alliance members. In addition, this study provided a first assessment of C‐values in the alliance by estimating nuclear DNA contents of these acc...

Iridoid Glucosides from Phlomis tuberosa L. and Phlomis herba-ventis L

DEFF Research Database (Denmark)

Alipieva, Kalina A.; Jensen, Søren Rosendal; Franzyk, Henrik

2000-01-01

A new iridoid glucoside, 5-deoxysesamoside, was isolated from Phlomis tuberosa together with three known iridoid glucosides sesamoside, shanzhiside methyl ester and lamalbid. Lamiide was found in Ph. herba-ventis ssp. pungens. in high concentrations....

Rcdisterona de Pfaffia tuberosa (Spreng.) Hicken

OpenAIRE

Nishimoto, Nobushigue; Shiobara, Yoshinori; Inoue, Shun-suke; Fujino, Masumi; Takemoto, Tsunematsu; Yeoh, Cheow Lin; Hashimoto, Goro

1986-01-01

As raízes secas da espécie brasileira Pfaffia tuberosa (Spreng.) Hicken foram submetidas a extração com metanol. Deste extrato metanólico foram isolados a ecdisterona e o ácido oleanólico, através de processos de separação por HPLC e cromatografia em coluna. Tanto a ecdisterona como o ácido oleanólico foram identificados comparativamenve com os respectivos padrões. Análise quantitativa por HPLC mostrou 0,23% de ecdisterona. Este teor foi corsiderado baixo em relação a outra espécie, também br...

La Caja Real de la Villa de Santa Clara (Cuba: análisis histórico-contable (1689-1831

Directory of Open Access Journals (Sweden)

Yumaisi González Ochoa

2017-07-01

Full Text Available La Villa de Santa Clara en Cuba se fundó el 15 de julio de 1689, con una actividad económica fundamentalmente ganadera, se rigió en el orden administrativo y económico desde su fundación, al igual que las demás villas del país por las leyes u órdenes emitidas por la metrópoli española. Para el gobierno de las rentas reales, España utilizó las Cajas Reales como mecanismos de control y administración de los recursos en cada territorio americano bajo su dominio. La Caja Real de la Villa de Santa Clara se encontraba subordinada a la Caja Real Principal de la Habana, en la capital del país. A partir de la revisión de las Actas Capitulares del Cabildo de Santa Clara y los libros de cuentas conservados en el Archivo Nacional de Cuba, se explica el proceder de los administradores de los distintos ingresos y gastos de la Caja Real de la Villa de Santa Clara, así como la aplicación del método por cargo y data empleado para el registro de las operaciones y la interrelación entre los libros Manual, Mayor y de Caja del año 1831, y el uso de otros Libros Auxiliares.   Santa Clara village in Cuba was founded on July 15, 1689, with a primarily livestock economic activity, was governed at the administrative and economic order since its foundation, like other towns of the country by laws or orders issued by the Spanish metropolis. For the government in real incomes, Spain used the Cajas Reales as control mechanisms and management of resources in every American territory under its domain. The Caja Real of Santa Clara village was subordinated to the principal Caja Real in Havana, capital of the country. From the review of the Chapter Acts of the Cabildo of Santa Clara and accounting books preserved in the National Archives of Cuba, it's possible explain the proceeding of managers of the various revenue and expenditure of the Caja Real of Santa Clara village and the application of method of charge and discharge employed to register transactions

Caracterização físico-química de algumas tuberosas amiláceas

Directory of Open Access Journals (Sweden)

Leonel Magali

2002-01-01

Full Text Available As principais fontes de amido comercial no mundo são o milho, a batata e a mandioca. Entretanto, nos últimos anos vem crescendo o interesse em amidos naturais que possam ser utilizados pela indústria alimentícia. Assim, este trabalho teve por objetivo caracterizar, quanto à composição físico-química, açafrão, ahipa, araruta, batata-doce, biri, inhame e mandioquinha-salsa, tuberosas amiláceas potencialmente passíveis de introdução como matérias-primas de interesse comercial. Amostras das tuberosas foram analisadas quanto ao teor de umidade, cinzas, proteína, matéria graxa, açúcares redutores e totais, fibras e amido. Os resultados obtidos mostraram que das tuberosas analisadas as que apresentaram maior teor de amido foram a araruta (Maranta arundinacea, o inhame (Dioscorea sp e o biri (Canna edulis, sendo que o inhame e o biri apresentaram também o maior rendimento potencial em toneladas de amido/hectare.

Electromagnetically Inferred Structure of the Caja del Rio Plateau, New Mexico

Science.gov (United States)

Layton, M. E.; Speed, C.; Shukla, M.; Vila, A.; Chon, E.; Kitamikado, C.; Feucht, D. W.; Bedrosian, P.; Pellerin, L.

2016-12-01

Magnetotelluric (MT) and transient electromagnetic (TEM) data were acquired by students from the Summer of Applied Geophysical Experience (SAGE) to construct structural models in and around the Caja del Rio Plateau, New Mexico. The Caja del Rio is located on the La Bajada-Jemez constriction that separates the Española and Santa Domingo basins in the Rio Grande Rift. The Rio Grande Rift, the result of tectonic extensional forces, extends approximately north-south across northern New Mexico. MT data collected in 2016 were merged with that from previous years to make up an 11 km north line and a 16 km south line extending from the west side of the Caja Del Rio to the east off the plateau in the Old Buckman Road area. The resistivity distributions revealed in one-dimensional (1-D) and two-dimensional (2-D) inverse models show some robust features. Models of the north are interpreted as a top resistive layer (convention) point in the northwest direction towards the conductive Valles Caldera. The MT models are consistent with geologic interpretations of the stratigraphic units. In addition, models disclose an additional conductive layer below the basement that we interpret as the mid-crustal conductor. Transient electromagnetic (TEM) data were collected in seven locations atop the Caja del Rio plateau in an attempt to identify the basal contact of the Cerros del Rio volcanic field, which, in turn, allow for the thickness of these basaltic and andesitic deposits to be mapped across the plateau. One-dimensional inverse models produced from the TEM data were aligned and interpreted geologically. A resistive ( 1000 ohm-m) unit, interpreted to represent the Cerros del Rio volcanics, thickens from 70m to 175m from southeast to northwest. The volcanics are overlain by a thin conductor, interpreted as weathered material. The resistive body is underlain by a thicker conductor, interpreted as sedimentary rocks of the Tertiary-aged Santa Fe Group.

Rcdisterona de Pfaffia tuberosa (Spreng.) Hicken

OpenAIRE

Nishimoto,Nobushigue; Shiobara,Yoshinori; Inoue,Shun-suke; Fujino,Masumi; Takemoto,Tsunematsu; Yeoh,Cheow Lin; Hashimoto,Goro

1986-01-01

As raízes secas da espécie brasileira Pfaffia tuberosa (Spreng.) Hicken foram submetidas a extração com metanol. Deste extrato metanólico foram isolados a ecdisterona e o ácido oleanólico, através de processos de separação por HPLC e cromatografia em coluna. Tanto a ecdisterona como o ácido oleanólico foram identificados comparativamenve com os respec­tivos padrões. Análise quantitativa por HPLC mostrou 0,23% de ecdisterona. Este teor foi corsiderado baixo em relação a outra espécie, também b...

Rcdisterona de Pfaffia tuberosa (Spreng. Hicken

Directory of Open Access Journals (Sweden)

Nobushigue Nishimoto

Full Text Available As raízes secas da espécie brasileira Pfaffia tuberosa (Spreng. Hicken foram submetidas a extração com metanol. Deste extrato metanólico foram isolados a ecdisterona e o ácido oleanólico, através de processos de separação por HPLC e cromatografia em coluna. Tanto a ecdisterona como o ácido oleanólico foram identificados comparativamenve com os respectivos padrões. Análise quantitativa por HPLC mostrou 0,23% de ecdisterona. Este teor foi corsiderado baixo em relação a outra espécie, também brasileira, a Pfaffia iresinoides.

Esclerose tuberosa: avaliação de miofibroblastos em angiofibromas cutâneos - relato de caso

OpenAIRE

Perez,Erick Gomes; Paranaíba,Lívia Ribeiro; Bonan,Paulo Rogério; Orsi Júnior,Julian Miranda; Oliveira,Adriano Macedo de; Martelli Júnior,Hercílio

2010-01-01

Esclerose tuberosa é uma condição rara e autossômica dominante. Miofibroblastos são células que exibem fenótipo híbrido entre fibroblastos e células musculares lisas. O objetivo deste caso clínico é mostrar as características clínicas e histopatológicas da esclerose tuberosa e avaliar miofibroblastos nos angiofibromas cutâneos dessa condição. Lesões removidas foram coradas em HE e tricrômico de Masson. Para determinar a presença de miofibroblastos foi usada imunoistoquímica para α-SMA. E...

Kritiska framgångsfaktorer vid implementering av affärssystem : beaktas de i e-handelsföretag?

OpenAIRE

Choudhury, Nafiz

2010-01-01

Syfte: Analysera och diskutera huruvida teori om kritiska framgångsfaktorer vid implementering av affärssystem för fysiska företag beaktas i e-handelsföretag. Identifiera framgångsfaktorer för implementeringen av affärssystem i e-handelsföretag. Forskningsfråga: Beaktas samma kritiska framgångsfaktorer vid implementering av ett affärssystem i stora fysiska företag som små e-handelsföretag? Metod: En kvalitativ metod antogs vilket innebar att en fallstudie genomförts som omfattat två responden...

La reforma del sistema financiero: cajas de ahorros.- (Años 2011-2012

Directory of Open Access Journals (Sweden)

Octavio Vázquez Sotelo

2013-04-01

Full Text Available Este trabajo forma parte del libro “La dimensión social de las Cajas de Ahorro: España y Galicia”, publicado por la Editorial Académica Española, del cual soy autor.A través de la legislación promulgada en los años 2010, 2011 y 2012, se analiza la estrategia de privatización de las Cajas de Ahorro seguida por los gobiernos de turno que, en la mayor parte de los casos, ha supuesto la entrega de las mismas a precios irrisorios a su tradicionales competidores: la gran Banca.. Ello ha comportado la desfiguración o, incluso, la desaparición del rasgo más distintivo de aquellas: la Obra Social.

Influence of different tropical fruits on biological and behavioral aspects of the Mediterranean fruit fly Ceratitis capitata (Wiedemann (Diptera, Tephritidae

Directory of Open Access Journals (Sweden)

Anne M. Costa

2011-09-01

Full Text Available Influence of different tropical fruits on biological and behavioral aspects of the Mediterranean fruit fly Ceratitis capitata (Wiedemann (Diptera, Tephritidae. Studies on Ceratitis capitata, a world fruit pest, can aid the implementation of control programs by determining the plants with higher vulnerability to attacks and plants able to sustain their population in areas of fly distribution. The objective of the present study was to evaluate the influence of eight tropical fruits on the following biological and behavioral parameters of C. capitata: emergence percentage, life cycle duration, adult size, egg production, longevity, fecundity, egg viability, and oviposition acceptance. The fruits tested were: acerola (Malpighia glabra L., cashew (Anacardium occidentale L., star fruit (Averrhoa carambola L., guava (Psidium guajava L., soursop (Annona muricata L., yellow mombin (Spondias mombin L., Malay apple (Syzygium malaccense L., and umbu (Spondias tuberosa L.. The biological parameters were obtained by rearing the recently hatched larvae on each of the fruit kinds. Acceptance of fruits for oviposition experiment was assessed using no-choice tests, as couples were exposed to two pieces of the same fruit. The best performances were obtained with guava, soursop, and star fruit. Larvae reared on cashew and acerola fruits had regular performances. No adults emerged from yellow mombin, Malay apple, or umbu. Fruit species did not affect adult longevity, female fecundity, or egg viability. Guava, soursop, and acerola were preferred for oviposition, followed by star fruit, Malay apple, cashew, and yellow mombin. Oviposition did not occur on umbu. In general, fruits with better larval development were also more accepted for oviposition.Influência de diferentes frutos tropicais em aspectos biológicos e comportamentais da mosca-das-frutas Ceratitis capitata (Wiedemann (Diptera, Tephritidae. Estudos em Ceratitis capitata, uma praga agrícola, pode auxiliar

Índice de infestação e diversidade de moscas-das-frutas em hospedeiros exóticos e nativos no pólo de fruticultura de Anagé, BA Index of infestation and diversity of fruit-flies in exotic hosts native to the fruitculture area in Anagé, Bahia, Brazil

Directory of Open Access Journals (Sweden)

Ricardo Falcão de Sá

2008-01-01

Full Text Available As moscas-das-frutas (Diptera: Tephritidae são os principais entraves às exportações de manga nos pólos de fruticultura da Região Sudoeste da Bahia. O presente trabalho teve como objetivo estudar índices de infestação e a diversidade de moscas-das-frutas no pólo de fruticultura de Anagé, BA, visando obter subsídios para o manejo integrado dessas pragas na mangueira, na região. Os estudos foram realizados em 2004 e 2005, nos municípios de Anagé, Belo Campo e Caraíbas, BA, procedendo-se à coleta de frutos de 21 espécies vegetais, nativas e exóticas, e identificação das espécies de moscas associadas. Estimaram-se os índices de infestação em pupários/kg de fruto e pupários/fruto. Os maiores índices de infestação, em pupários/kg de fruto, ocorreram em serigüela (Spondias purpurea L. com 61,3, juá (Ziziphus joazeiro L., 38,3 e umbu (Spondias tuberosa L., 33,1, considerados hospedeiros primários de Anastrepha fraterculus (Wiedemann e A. obliqua (Macquart. As maiores infestações em pupários/fruto ocorreram em serigüela (0,9; umbu (0,7 e cajarana (Spondias sp. (0,2. Com base no monitoramento larval, registra-se, para as condições do pólo de fruticultura de Anagé, a ocorrência das espécies Anastrepha fraterculus, A. obliqua, A. dissimilis, A. amita, A. distincta, A. sororcula, A. zenildae e Ceratitis capitata. Registram-se, pela primeira vez, as seguintes associações bitróficas: juá com A. fraterculus, A. obliqua, A. dissimilis e A. distincta; e umbu com A. amita e A. sororcula.Fruit-flies (Diptera: Tephritidae are the main hindrance for mango exportation in the fruitculture areas of the Southwestern Region of Bahia. The purpose of the present work was to study the indexes of infestation and diversity of fruit-flies in the fruitculture area of Anagé, BA, in order to obtain subsidies to the integrated management of these pests in mango, in this region. Studies were carried out in 2004 and 2005 in the

Origins of domestication and polyploidy in oca (Oxalis Tuberosa: Oxalidaceae). 2. Chloroplast-expressed glutamine synthetase data.

Science.gov (United States)

Emshwiller, Eve; Doyle, Jeff J

2002-07-01

In continuing study of the origins of the octoploid tuber crop oca, Oxalis tuberosa Molina, we used phylogenetic analysis of DNA sequences of the chloroplast-active (nuclear encoded) isozyme of glutamine synthetase (ncpGS) from cultivated oca, its allies in the "Oxalis tuberosa alliance," and other Andean Oxalis. Multiple ncpGS sequences found within individuals of both the cultigen and a yet unnamed wild tuber-bearing taxon of Bolivia were separated by molecular cloning, but some cloned sequences appeared to be artifacts of polymerase chain reaction (PCR) recombination and/or Taq error. Nonetheless, three classes of nonrecombinant sequences each joined a different part of the O. tuberosa alliance clade on the ncpGS gene tree. Octoploid oca shares two sequence classes with the Bolivian tuber-bearing taxon (of unknown ploidy level). Fixed heterozygosity of these two sequence classes in all ocas sampled suggests that they represent homeologous loci and that oca is allopolyploid. A third sequence class, found in eight of nine oca plants sampled, might represent a third homeologous locus, suggesting that oca may be autoallopolyploid, and is shared with another wild tuber-bearing species, tetraploid O. picchensis of southern Peru. Thus, ncpGS data identify these two taxa as the best candidates as progenitors of cultivated oca.

Influence of different tropical fruits on biological and behavioral aspects of the Mediterranean fruit fly Ceratitis capitata (Wiedemann (Diptera, Tephritidae

Directory of Open Access Journals (Sweden)

Anne M. Costa

2011-09-01

Full Text Available Influence of different tropical fruits on biological and behavioral aspects of the Mediterranean fruit fly Ceratitis capitata (Wiedemann (Diptera, Tephritidae. Studies on Ceratitis capitata, a world fruit pest, can aid the implementation of control programs by determining the plants with higher vulnerability to attacks and plants able to sustain their population in areas of fly distribution. The objective of the present study was to evaluate the influence of eight tropical fruits on the following biological and behavioral parameters of C. capitata: emergence percentage, life cycle duration, adult size, egg production, longevity, fecundity, egg viability, and oviposition acceptance. The fruits tested were: acerola (Malpighia glabra L., cashew (Anacardium occidentale L., star fruit (Averrhoa carambola L., guava (Psidium guajava L., soursop (Annona muricata L., yellow mombin (Spondias mombin L., Malay apple (Syzygium malaccense L., and umbu (Spondias tuberosa L.. The biological parameters were obtained by rearing the recently hatched larvae on each of the fruit kinds. Acceptance of fruits for oviposition experiment was assessed using no-choice tests, as couples were exposed to two pieces of the same fruit. The best performances were obtained with guava, soursop, and star fruit. Larvae reared on cashew and acerola fruits had regular performances. No adults emerged from yellow mombin, Malay apple, or umbu. Fruit species did not affect adult longevity, female fecundity, or egg viability. Guava, soursop, and acerola were preferred for oviposition, followed by star fruit, Malay apple, cashew, and yellow mombin. Oviposition did not occur on umbu. In general, fruits with better larval development were also more accepted for oviposition.

Instituciones microfinancieras y cajas de ahorro en Santo Tomás Hueyotlipan, Puebla

Directory of Open Access Journals (Sweden)

Kristiano Raccanello

2014-01-01

Full Text Available La exigua presencia de los intermediarios financieros formales en los municipios rurales mexicanos impulsa el uso de tandas y solicitud de dinero a prestamistas, familiares o amigos. Las cajas de ahorro constituyen una alternativa a estos métodos tradicionales y aprovechan el capital social comunitario. Esta investigación, fundamentado en una muestra realizada en el municipio de Santo Tomás Hueyotlipan (Puebla, México, analiza los factores que impulsan la participación en las cajas de ahorro informales y su interacción con otros intermediarios financieros informales. Los resultados del modelo probit indican que la participación responde a la posibilidad de poder ahorrar atrayendo a aquellos individuos que no utilizan tandas, prestamistas o deudas con familiares o amigos.

Yeasts associated with fresh and frozen pulps of Brazilian tropical fruits.

Science.gov (United States)

Trindade, Rita C; Resende, Maria Aparecida; Silva, Claudia M; Rosa, Carlos A

2002-08-01

The occurrence of yeasts on ripe fruits and frozen pulps of pitanga (Eugenia uniflora L), mangaba (Hancornia speciosa Gom.), umbu (Spondias tuberosa Avr. Cam.), and acerola (Malpighia glaba L) was verified. The incidence of proteolytic, pectinolytic, and mycocinogenic yeasts on these communities was also determined. A total of 480 colonies was isolated and grouped in 405 different strains. These corresponded to 42 ascomycetous and 28 basidiomycetous species. Candida sorbosivorans, Pseudozyma antarctica, C. spandovensis-like, C. spandovensis, Kloeckera apis, C. parapsilosis, Rhodotorula graminis, Kluyveromyces marxianus, Cryptococcus laurentii, Metchnikowia sp (isolated only from pitanga ripe fruits), Issatchenkia occidentalis and C. krusei (isolated only from mangaba frozen pulps), were the most frequent species. The yeast communities from pitanga ripe fruits exhibited the highest frequency of species, followed by communities from acerola ripe fruits and mangaba frozen pulps. Yeast communities from frozen pulp and ripe fruits of umbu had the lowest number of species. Except the yeasts from pitanga, yeast communities from frozen pulp exhibited higher number of yeasts than ripe fruit communities. Mycocinogenic yeasts were found in all of the substrates studied except in communities from umbu ripe fruits and pitanga frozen pulps. Most of the yeasts found to produce mycocins were basidiomycetes and included P. antarctica, Cryptococcus albidus, C. bhutanensis-like, R. graminis and R. mucilaginosa-like from pitanga ripe fruits as well as black yeasts from pitanga and acerola ripe fruits. The umbu frozen pulps community had the highest frequency of proteolytic species. Yeasts able to hydrolyse casein at pH 5.0 represented 38.5% of the species isolated. Thirty-seven percent of yeast isolates were able to hydrolyse casein at pH 7.0. Pectinolytic yeasts were found in all of the communities studied, excepted for those of umbu frozen pulps. The highest frequency of

8,14-Secopregnane glycosides from the aerial parts of Asclepias tuberosa.

Science.gov (United States)

Warashina, Tsutomu; Noro, Tadataka

2009-07-01

Twenty pregnane glycosides, tuberoside A(1)-L(5), were isolated from the diethyl ether-soluble fraction of the MeOH extract from the aerial parts of Asclepias tuberosa (Asclepiadaceae). The pregnane glycosides were composed of 8,12;8,20-diepoxy-8,14-secopregnane as aglycon, and D-cymarose, D-oleandrose, D-digitoxose and/or D-glucose as the component sugars. Their structures were established using NMR spectroscopic analysis and chemical methodologies.

An Apple Fruit Fermentation (AFF) Treatment Improves the Composition of the Rhizosphere Microbial Community and Growth of Strawberry (Fragaria × ananassa Duch ‘Benihoppe’) Seedlings

Science.gov (United States)

Bu, Yufen; Shao, Wei; Huang, Weijing; Ji, Qianlong; Yao, Yuncong

2016-01-01

Plant growth can be promoted by the application of apple fruit fermentation (AFF), despite unclear of the underlying mechanisms, the effects involved in AFF on rhizosphere microorganisms have been hypothesized. We investigated the consequences of applying AFF alone or in combination with Bacillus licheniformis to strawberry tissue culture seedlings in vitro, the analyses of Denaturing Gradient Gel Electrophoresis (DGGE) and 16S rDNA were performed to determine AFF effects on rhizosphere. Moreover, the growth index and antioxidant enzyme activities were determined 30 days after treatments. We identified five dominant bacteria in AFF: Coprinus atramentarius, Bacillus megaterium, Bacillus licheniformis, Weissella and B. subtilis. The greatest number of bacterial species were observed in the rhizosphere of control matrix (water treated), and the lowest diversity appeared in the rhizosphere soil treated with 108 cfu/mL B. licheniformis alone. Combining AFF plus B. licheniformis in one treatment resulted in the largest leaf area, plant height, root length, plant weight, and the markedly higher activities of antioxidant enzymes. We conclude that a combination of AFF plus B. licheniformis treatment to matrix can increase antioxidant enzymes activities in strawberry seedlings, optimize the status of rhizosphere microbial, and promote plant growth. PMID:27755580

PRODUÇÃO DE MUDAS DE UMBUZEIRO (Spondias tuberosa Arruda Câmara EM DIFERENTES SUBSTRATOS E TAMANHO DE RECIPIENTES

Directory of Open Access Journals (Sweden)

Flávio Ricardo da Silva Cruz

2016-01-01

Full Text Available The species Spondias tuberosa Arr. Cam. (umbuzeiro stands out as one of the tree species with the greatest potential of the Brazilian semiarid. Even though it’s significant socioeconomic and environmental importance, there is a lack of studies aimed at establishing a seedlings production model of this kind of plant. The purpose of this study was to evaluate the production of seedlings Spondias tuberosa using different substrates and size of bags. The experiment was conducted in the nursery of the Plant Ecology Laboratory (LEV from the Agrarian Sciences Center (CCA of the Federal University of Paraiba (UFPB, Areia/ PB. The experimental design was a randomized block in factorial 2 x 7 and subdivided blocks containers plots and subplots substrates. It were used substrates formulated from the starting mixture of subsoil land (37.5-100%, sand (12.5-25% and tanned cattle manure (10-50%. The containers used were black polyethylene bags with a volume of 1900 cm 3 (15 x 27 cm and 5000 cm 3 (25 x 26 cm. To obtain seedlings of Spondias tuberosa seeds were sown in seed masonry until the transplant (90 days after sowing. At 78 days after transplanting the seedlings were evaluated for height, root collar diameter, relationship shoot/root collar diameter, xylopodium diameter, root length, dry weigh of shoot and root. The datas were subjected to analysis of variance and F test, measured and compared by Tukey test at 5% probability, using the software SISVAR ® . The substrates with cattle manure provided higher values for height and root length. For the seedlings production of Spondias tuberosa , is recommended substrate subsoil land (45% + sand (15% + cattle manure (40%.

Processamento e avaliação físico-química do fermentado de caju + umbu-cajá

Directory of Open Access Journals (Sweden)

Clotildes Alvino Leite

2013-03-01

Full Text Available O Brasil é um dos maiores produtores de frutos de origem tropical, destacando-se o caju e umbu-cajá pelo sabor e aroma exóticos. Uma forma de agregar valor aos frutos e contribuir para o desenvolvimento sustentável da região Nordeste é utilizar os excedentes desses frutos como matéria-prima para produção de bebida fermentada. Desta forma, este trabalho teve como objetivo principal utilizar as polpas de caju e umbu-cajá na elaboração da bebida fermentada, visando à valorização destes frutos. A fermentação alcoólica foi conduzida em biorreator, em sistema de batelada, a temperatura de 25ºC ± 2ºC. Foi realizado o estudo da cinética da fermentação alcoólica na elaboração da bebida fermentada utilizando a levedura Saccharomyces cerevisiae. Na bebida fermentada avaliou-se o teor de açúcares solúveis totais, pH, teor alcoólico, alcoóis superiores, acetaldeído, acetato de etila e metanol. De acordo com os resultados obtidos, concluiu-se que a bebida fermentada apresentou uma concentração de etanol (10,7°GL dentro das especificações exigidas pela legislação brasileira acerca de bebidas. A concentração de metanol foi de 57,50 mg/L. O teor residual de açúcares solúveis totais de 0,33 g/L classificou a bebida como fermentado do tipo seco. 

New 8,12;8,20-diepoxy-8,14-secopregnane hexa- and hepta-glycosides from the roots of Asclepias tuberosa.

Science.gov (United States)

Warashina, Tsutomu; Miyase, Toshio

2018-01-01

Previously, phytochemical investigation of the roots of Asclepias tuberosa (Asclepiadaceae) led to the isolation of some 8,12;8,20-diepoxy-8,14-secopregnane tri-, tetra-, and penta-glycosides. An additional eight new minor 8,12;8,20-diepoxy-8,14-secopregnane glycosides were afforded in the recent investigation of this plant. These glycosides consisted of six or seven 2,6-dideoxy-hexopyranoses together with the aglycone, tuberogenin. The structures of each of these compounds were established using NMR, mass spectroscopic analysis and chemical evidence. As 8,12;8,20-diepoxy-8,14-secopregnane-type glycosides were observed only in A. tuberosa, these compounds were considered to be characteristic phytochemicals of this plant.

Produção e caracterização físico-química de fermentado de umbu

OpenAIRE

Carvalho Filho, Celso Duarte; Paula, Breno de; Matta, Virginia Martins da; Menezes, Julia da Silva; Lima, Pâmela da Costa; Pinto, Claudia Oliveira; Conceição, Lauro Eduardo Macedo Guedes

2012-01-01

p. 1688-1693 O objetivo deste trabalho foi desenvolver um fermentado de umbu visando a agregar valor a esse fruto e contribuir para a melhoria de renda das famílias do semiárido nordestino. A polpa utilizada nos experimentos foi submetida a análises físico-químicas e microbiológicas. Para a produção da bebida, a polpa foi diluída em água, sendo necessário realizar uma chaptalização com sacarose até atingir 20,5°Brix. A levedura vínica comercial utilizada foi Saccharomyces cerevisiae. A fer...

Produção e caracterização físico-química de fermentado de umbu.

OpenAIRE

PAULA, B. de; CARVALHO FILHO, C. D.; MATTA, V. M. da; MENEZES, J. da S.; LIMA, P. da C.; PINTO, C. O.; CONCEIÇÃO, L. E. M. G.

2012-01-01

O objetivo deste trabalho foi desenvolver um fermentado de umbu visando a agregar valor a esse fruto e contribuir para a melhoria de renda das famílias do semiárido nordestino. A polpa utilizada nos experimentos foi submetida a análises físico-químicas e microbiológicas. Para a produção da bebida, a polpa foi diluída em água, sendo necessário realizar uma chaptalização com sacarose até atingir 20,5°Brix. A levedura vínica comercial utilizada foi Saccharomyces cerevisiae. A fermentação foi con...

Caracterización de la esclerosis tuberosa en pacientes que consultan al Hospital Universitario San Vicente de Paúl, Medellín, Colombia

OpenAIRE

Dagoberto Nicanor Cabrera Hémer; Jaime Carrizosa Moog; Olga Juliana Cuéllar; Dionis Vallejo Mesa; José Vladimir Tobón Areiza; José William Cornejo Ochoa

2008-01-01

La esclerosis tuberosa (ET) es una enfermedad autosómica dominante, que afecta muchos sistemas y cursa con diversas manifestaciones clínicas, entre ellas epilepsia, retardo mental y lesiones cutáneas. Se hizo un estudio retrospectivo para contribuir a la caracterización de la esclerosis tuberosa en Medellín, Colombia. Se revisaron 21 historias, 62% mujeres y 38% hombres; la edad media al momento del diagnóstico fue 23 meses, todos los pacientes tenían epilepsia y lesiones cutáneas, las crisis...

IDENTIFIKASI SENYAWA AKTIF DAUN PLETEKAN (Ruellia tuberosa L.) DENGAN MENGGUNAKAN GC-MS

OpenAIRE

Ida Ayu Nopiari; Ni Putu Adriani Astiti; Ngurah Intan Wiratmini

2017-01-01

ABSTRACT The use of traditional medicines in human therapies has been claimed to be much safer than that of synthetic medicines with many negative side effects. Pletekan plant (Ruellia tuberosa L.) has been used empirically for years as an antidiabetic as its leaves contain poly phenolic compounds with the ability to stimulate beta cells of the pancreas so that its capability to produce insulin improved. The main objective of our research was to identify active compounds contained in Rue...

Habitat influence on antioxidant activity and tannin concentrations of Spondias tuberosa.

Science.gov (United States)

de Sousa Araújo, Thiago Antônio; de Almeida e Castro, Valerium Thijan Nobre; de Amorim, Elba Lúcia Cavalcanti; de Albuquerque, Ulysses Paulino

2012-06-01

Different habitat conditions can be responsible for the production of secondary metabolites and for the antioxidant properties of plant products. Thus, the aim of this study was to evaluate whether the antioxidant activity and tannin concentrations in the stem bark of Spondias tuberosa Arruda (Anacardiaceae) varied with collection site. The bark was collected from 25 individual trees, distributed in five different landscape units, as follows: agroforestry gardens, areas of pastures, maize cultivation areas, mountain areas and mountain bases, with the former 3 being considered as anthropogenic habitats, and the latter 2 considered as habitats with native coverage. The study was conducted in the rural area of the city of Altinho, Pernambuco State (Northeast Brazil). The DPPH (1,1-diphenyl-2-picrylhydrazyl) method was used to measure the antioxidant activity and tannin concentrations were evaluated by using the radial diffusion method. The results demonstrated that there were no significant differences among the tannin concentrations of the individuals from the native (6.27% ± 1.75) or anthropogenic areas (4.63% ± 2.55), (H = 2.24; p > 0.05). In contrast, there were significant differences (H = 5.1723; p 0.05) or in the anthropogenic areas (r = 0.38; p > 0.05). Because the variation of the antioxidant capacity of S. tuberosa bark was not accompanied by a variation in the tannin concentration, this property may be related to the presence of other metabolite(s).

A genome-wide association study identified AFF1 as a susceptibility locus for systemic lupus eyrthematosus in Japanese.

Directory of Open Access Journals (Sweden)

Yukinori Okada

2012-01-01

Full Text Available Systemic lupus erythematosus (SLE is an autoimmune disease that causes multiple organ damage. Although recent genome-wide association studies (GWAS have contributed to discovery of SLE susceptibility genes, few studies has been performed in Asian populations. Here, we report a GWAS for SLE examining 891 SLE cases and 3,384 controls and multi-stage replication studies examining 1,387 SLE cases and 28,564 controls in Japanese subjects. Considering that expression quantitative trait loci (eQTLs have been implicated in genetic risks for autoimmune diseases, we integrated an eQTL study into the results of the GWAS. We observed enrichments of cis-eQTL positive loci among the known SLE susceptibility loci (30.8% compared to the genome-wide SNPs (6.9%. In addition, we identified a novel association of a variant in the AF4/FMR2 family, member 1 (AFF1 gene at 4q21 with SLE susceptibility (rs340630; P = 8.3×10(-9, odds ratio = 1.21. The risk A allele of rs340630 demonstrated a cis-eQTL effect on the AFF1 transcript with enhanced expression levels (P<0.05. As AFF1 transcripts were prominently expressed in CD4(+ and CD19(+ peripheral blood lymphocytes, up-regulation of AFF1 may cause the abnormality in these lymphocytes, leading to disease onset.

Origins of domestication and polyploidy in oca (Oxalis tuberosa; Oxalidaceae). 3. AFLP data of oca and four wild, tuber-bearing taxa.

Science.gov (United States)

Emshwiller, Eve; Theim, Terra; Grau, Alfredo; Nina, Victor; Terrazas, Franz

2009-10-01

Many crops are polyploids, and it can be challenging to untangle the often complicated history of their origins of domestication and origins of polyploidy. To complement other studies of the origins of polyploidy of the octoploid tuber crop oca (Oxalis tuberosa) that used DNA sequence data and phylogenetic methods, we here compared AFLP data for oca with four wild, tuber-bearing Oxalis taxa found in different regions of the central Andes. Results confirmed the divergence of two use-categories of cultivated oca that indigenous farmers use for different purposes, suggesting the possibility that they might have had separate origins of domestication. Despite previous results with nuclear-encoded, chloroplast-expressed glutamine synthetase suggesting that O. picchensis might be a progenitor of oca, AFLP data of this species, as well as different populations of wild, tuber-bearing Oxalis found in Lima Department, Peru, were relatively divergent from O. tuberosa. Results from all analytical methods suggested that the unnamed wild, tuber-bearing Oxalis found in Bolivia and O. chicligastensis in NW Argentina are the best candidates as the genome donors for polyploid O. tuberosa, but the results were somewhat equivocal about which of these two taxa is the more strongly supported as oca's progenitor.

Characterization and drying of caja bagasse (Spondias mombin L. in a tray dryer using a factorial planning

Directory of Open Access Journals (Sweden)

Andréia Souto da Silva

2012-03-01

Full Text Available The caja (Spondias mombin L. is used in the manufacture of ice-cream, jams, pulps, beverages being also consumed in natura. One of the most important procedures in food conservation is drying, considering that most fresh fruits contain approximately 80% of water. Food drying is used to obtain two basic aspects: (1 the economic factor; in the shipping and handling of the product; (2 at the manipulation; once dried and grinded, the material is rehydrated, at desirable levels, to formulate a new product as in ice cream, jams, yoghurts and drinks and may also be added to pasta, biscuits and other industrialized products. The aim of this study was to investigate the kinetics of caja bagasse drying in a fixed-bed tray dryer, using central composite factorial planning. The following factors were evaluated: temperature (55, 65 and 75 ºC, dryer inlet air velocity (3.2, 4.6 and 6.0 m.s-1 and cake thickness (0.8, 1.2 and 1.6 cm where the response of the considered variable was caja bagasse moisture content (b.s. and the results showed that the main effects and their interactions were significant at a 95% confidence level being the best condition obtained at temperature of 75 ºC, velocity of 6.0 m.s-1 and cake thickness of 0.8 cm.

Curcuma longa as additive in the diet for Astyanax aff. bimaculatus.

Science.gov (United States)

de Moraes França Ferreira, Pollyanna; Martins, Maria Tatiana Soares; Caldas, Débora Werneck; Gomes, Juliana Rodrigues; de Oliveira, Jerusa Maria; Salaro, Ana Lucia; Rocha, Juliana Silva; Zuanon, Jener Alexandre Sampaio

2017-06-01

The aim of the present study was to evaluate the effect of turmeric (Curcuma longa) as additive in the diet for Astyanax aff. bimaculatus. Fish (0.83 ± 0.04 g) were fed, for 60 days, with six diets containing 0.0, 20.0, 40.0, 60.0, 80.0, and 100.0 g turmeric kg -1 feed. There was an increasing linear effect of turmeric on the thickness of the muscular layer, and height and width of the folds of the intestine. In the liver, a quadratic effect was observed of turmeric on the percentage of hepatocyte cytoplasm and a decreasing linear effect on the percentage of sinusoid capillaries. A quadratic effect was also observed of turmeric on the liver glycogen. There was no effect of turmeric on the antioxidant activity in the liver, carcass composition or productive performance of the fish. Thus, we concluded that Curcuma longa has trophic effects on the epithelium and the muscular layer of the intestine of A. aff. bimaculatus. Additionally, low levels of Curcuma longa cause increased deposition of liver glycogen and high levels cause reduction.

Las Unidades Básicas de Análisis para la Gestión de las Cajas de Ahorros y las Cajas Rurales Españolas: Un Análisis Comparativo

Directory of Open Access Journals (Sweden)

Pilar Ibarrondo Dávila

2002-06-01

Full Text Available Las unidades básicas de análisis para la gestión de las entidades de depósito representan los ejes centrales en tomo a los cuales se debe generar la información que suministra el sistema de contabilidad de gestión y, por consiguiente, se configuran como un instrumento esencial para apoyar las decisiones gerenciales. En este artículo, tras delimitar las unidades de análisis básicas para los sistemas de información de las cajas rurales y las cajas de ahorros, presentamos los resultados obtenidos a través de una encuesta realizada en dichas entidades, al objeto de contrastar la importancia que ostentan dichas unidades de análisis en sus sistemas de información. El estudio empírico llevado a cabo ha puesto de manifiesto que la unidad de análisis por excelencia en ambas categorías de entidades es la oficina, seguida por las direcciones regionales o de zona. Los productos y los clientes presentan un menor grado de implantación en sus sistemas de información, en especial en las cajas rurales. The basic units of analysis for managing Depository Financial Institutions are the central axes where management accounting information should be generated and, consequently, are also formed as an essential instrument to support the managerial decisions. Once the basic analysis units for information systems in the rural and savings banks are defined, we offer the results obtained by means of a survey carried out in the aforementioned institutions. So the relevance of this analysis unit in their information systems may be known. The empirical study carried out has shown that the main analysis unit in both categories of entities is the branch office, followed by regional management. Products and customers have a minor relevance in their information systems, particularly in the rural banks.

Estructura del gasto y del ingreso en la Caja Real de Santafé, 1803-1815

Directory of Open Access Journals (Sweden)

Edwin Alexander Muñoz Rodríguez

2010-07-01

durante el periodo colonial. El estallido de movimientos independentistas, autonomistas y realistas en varias regiones del Virreinato rápidamente produjo una crisis fiscal que implicó la transformación del mecanismo de financiación del gasto y la profundización de tendencias de crisis iniciadas en las últimas décadas del periodo colonial en algunos ramos específicos. El trabajo estudia la naturaleza de estas transformaciones comparando la estructura del gasto e ingreso de los últimos años de dominación colonial con la estructura que estos adquirieron en los años de la Primera República, entre 1811 y 1815. Como fuente, se utiliza material inédito derivado de la contabilidad de la Caja Real y de la Tesorería de Santafé, en particular los cortes y tanteos de cuentas producidos por la Caja Real entre 1803 y 1815.

Ocurrencia simultánea de neurofibromatosis y esclerosis tuberosa, adquiridas como neomutaciones

OpenAIRE

Janeiro, P; Cunha, M; Cordeiro, I; Santos, H; Antunes, N

2008-01-01

Introducción. La neurofibromatosis tipo 1 y la esclerosis tuberosa son dos síndromes neurocutáneos distintos, resultado de la mutación de genes supresores tumorales, que aumentan la propensión a la génesis tumoral. Ambas tienen una herencia autosómica dominante y la mitad de los casos corresponden a nuevas mutaciones. Estas enfermedades raramente se presentan asociadas. Caso clínico. Niño sin antecedentes familiares de enfermedades neurocutáneas, que presenta características de neurofibrom...

Qualidade de frutos de acessos de umbu-cajazeira (Spondias sp.

Directory of Open Access Journals (Sweden)

Perla J. S. Gondim

2013-11-01

Full Text Available Os frutos da umbu-cajazeira (Spondias sp. são amplamente consumidos frescos ou processados, em decorrência de suas características sensoriais, apresentando-se com boas perspectivas de cultivo e comercialização. No entanto, a avaliação da qualidade pós-colheita de frutos de acessos das suas áreas de ocorrência se faz necessária, no sentido não apenas de identificar materiais com características promissoras de interesse para a indústria ou consumo fresco, mas também para dar suporte aos programas de melhoramento. Neste trabalho foram avaliados frutos colhidos na maturidade comercial (coloração totalmente amarela de oito acessos provenientes do município de Areia, Brejo paraibano, quanto às características físicas e físico-químicas. A massa fresca média dos frutos dos acessos avaliados foi de 28,82 g e o rendimento médio em polpa foi de 68,5%. Com base na análise de componentes principais, o acesso A2 se destacou por apresentar conteúdos superiores de sólidos solúveis (12,9% e açúcares redutores (10,9%, mais baixa acidez titulável (0,94% de ácido cítrico e superior relação SS/AT (13,75, indicando que este acesso pode ser uma alternativa viável, tanto para o mercado de frutas frescas como para o processamento.

Efecto de extractos de la esponja calcarea Leucetta aff. floridana sobre el ciclo de líneas celulares leucemoides

OpenAIRE

Diana Margarita Márquez Fernández; Mariano Eliecer Acosta Lobo; María Elena Márquez Fernández; Alejandro Martínez Martínez; Edna Judith Márquez Fernández; Mauricio Camargo Guerrero

2012-01-01

Introducción: la esponja Leucetta aff. floridana produce compuestos con actividad antiproliferativa diferencial en células tumorales de pulmón y mama, la cual no ha sido explorada en otras líneas tumorales y se desconoce si su potencial antiproliferativo está relacionado con la progresión de células a través del ciclo celular. Objetivo: evaluar el potencial antiproliferativo, anticlonogénico y el efecto sobre el ciclo celular de los extractos hexánico y metanólico de la esponja Leucetta aff. ...

Oxalates in oca (New Zealand yam) (Oxalis tuberosa Mol.).

Science.gov (United States)

Ross, A B; Savage, G P; Martin, R J; Vanhanen, L

1999-12-01

Oca (Oxalis tuberosa Mol.) or New Zealand yam, in common with other members of this genus, contains oxalate, an antinutritive factor. Twelve South American and two New Zealand cultivars of oca were analyzed for total and soluble oxalate contents of the tubers. The range of total oxalate levels was 92-221 mg/100 g of fresh weight. Levels of soluble and total oxalate extracted from the tubers were not significantly different, suggesting that no calcium oxalate is formed in the tubers. The oxalate concentrations obtained in this study for oca suggest that previously reported values are too low and that oca is a moderately high oxalate-containing food. This is the first report of a tuber crop containing moderate to high levels of soluble oxalates in the tubers and no insoluble oxalates.

Sistemas de labranza y densidades de la batata: calidad del suelo y de las raíces tuberosas.

Directory of Open Access Journals (Sweden)

Maiby Pérez-Darniz

2016-12-01

Full Text Available El objetivo de este trabajo fue determinar el efecto de sistemas de labranza y densidades de siembra en la calidad de las raíces tuberosas de batata (Ipomoea batata (L Lamb.. El estudio se realizó en la Universidad Central de Venezuela, en el año 2014. Se determinaron los grados de severidad de la degradación del suelo y su correspondencia con las escalas de preferencia basadas en el peso unitario y dimensiones de la raíz tuberosa. Se usó un arreglo en franjas, donde los sistemas de labranza (SL fueron asignados a las parcelas, y las densidades de siembra (Ds a las franjas. Los SL consistieron en labranza vertical con cincel (LC, con arado de disco (LA, convencional con tres pases de rastra de disco (LCo y mínima con un pase de rastra de disco (LM. Las Ds fueron de 0,25 cm (D1 y 0,15 cm (D2 en la hilera. La calidad física del suelo fue superior en los tratamientos de LA. De estos, la combinación con la distancia de siembra más larga (LA-D1 favoreció la mayor calidad postcosecha del cultivo. Al contrario, en los tratamientos con cincel se promovió la menor aceptación del consumidor. La ligera a moderada severidad de la degradación del suelo no explicó la variación de la calidad postcosecha. Se in ere sobre la menor tasa de movimiento de agua en LC, que promovió un exceso de humedad y la más baja calidad de la raíz tuberosa.

Reproductive biology of a population of Gymnotus aff.carapo (Teleostei: Gymnotidae from southern Brazil

Directory of Open Access Journals (Sweden)

Diego de Paula Cognato

Full Text Available The reproductive period and its relation with somatic and abiotic factors, the relative and absolute fecundity, spawning type, length of first maturation and sex ratio is describe for Gymnotus aff.carapo from a small lake at Itapuã State Park, Rio Grande do Sul, Brazil. Gymnotus aff. carapo presents a relatively long reproductive cycle extending from November/2003 to March/2004. Decreases in water conductivity and increases in dissolved oxygen are correlated with increased gonadal development in males. In females, seasonal increases in temperature and photoperiod and decreases in dissolved oxygen are correlated with increased gonadal development. The mean absolute fecundity was 915.3 oocytes, and mean relative fecundity 0.20 oocytes/mg body weight. Egg size distributions indicate multiple spawning. The size of first maturation was 141 mm in females and 146 mm in males. The sex ratio was 1:1, with a male bias only in smaller size classes.

Asymbiotic germination, seedling development and plantlet propagation of Encyclia aff. oncidioides - an endangered orchid

Directory of Open Access Journals (Sweden)

Ewa Łojkowska

2011-01-01

Full Text Available In order to estimate the best germination conditions of Encyclia aff. oncidioides seeds, five different media (Fast, Knudson C modified by Vajrabhaya, Murashige and Skoog, PB2 and modified Vacin and Went with different concentrations of plant growth regulators such as benzyladenine (BA, naphthaleneacetic acid (NAA and gibberellic acid (GA3 were tested. No beneficial effect was observed when BA and NAA were applied to the germination medium and GA3 inhibited germination. The effect of light, activated charcoal, coconut water and casein hydrolysate on seed germination was also studied. The growth rate of seedlings on three different media supplemented with activated charcoal and plant growth regulators was checked. The applied plant growth regulators had no beneficial effect on the further growth of seedlings. Fast and PB2 media with 0.2% activated charcoal proved to be the best for E. aff. oncidioides seed germination, seedling development and plantlet propagation.

Distinctive exotic flavor and aroma compounds of some exotic tropical fruits and berries: a review.

Science.gov (United States)

Lasekan, Ola; Abbas, Kassim A

2012-01-01

The characteristic flavor of exotic tropical fruits is one of their most attractive attributes to consumers. In this article, the enormous diversity of exotic fruit flavors is reviewed. Classifying some of the exotic fruits into two classes on the basis of whether esters or terpenes predominate in the aroma was also attempted. Indeed, as far as exotic tropical fruits are concerned, the majority of fruits have terpenes predominating in their aroma profile. Some of the fruits in this group are the Amazonian fruits such as pitanga, umbu-caja, camu-camu, garcinia, and bacuri. The ester group is made up of rambutan, durians, star fruit, snake fruit, acerola, tamarind, sapodilla, genipap, soursop, cashew, melon, jackfruit, and cupuacu respectively. Also, the role of sulphur-volatiles in some of the exotic fruits is detailed.

8,12;8,20-Diepoxy-8,14-secopregnane glycosides from the aerial parts of Asclepias tuberosa.

Science.gov (United States)

Warashina, Tsutomu; Noro, Tadataka

2010-02-01

Further study of constituents from the aerial parts of Asclepias tuberosa afforded twenty-two new steroidal glycosides along with tuberoside B(5) and G(5). These glycosides were confirmed to contain 8,12;8,20-diepoxy-8,14-secopregnanes, tuberogenin and its congeners, as their aglycones. The structure of each of these compounds was elucidated based on the interpretation of NMR and MS measurements and from chemical evidence.

Aplicación de la Contabilidad de Costos en las Cajas Rurales de Ahorro y Crédito en el Perú, Arequipa - 2013

OpenAIRE

Pacheco Zegarra, Edward Víctor

2017-01-01

El presente trabajo de investigación busca determinar el grado de aplicación de la contabilidad de costos en las Cajas Rurales de Ahorro y Crédito en el Perú. ENUNCIADO “APLICACIÓN DE LA CONTABILIDAD DE COSTOS EN LA CAJAS RURALES DE AHORRO Y CRÉDITO EN EL PERÚ, AREQUIPA – 2013” La variable a investigar fue la aplicación de la contabilidad de costos cuyos indicadores son las generalidades de la aplicación de la contabilidad de costos, objetivos de la contabilidad de costos...

The association between chromaticity, phenolics, carotenoids, and in vitro antioxidant activity of frozen fruit pulp in Brazil: an application of chemometrics.

Science.gov (United States)

Zielinski, Acácio Antonio Ferreira; Ávila, Suelen; Ito, Vivian; Nogueira, Alessandro; Wosiacki, Gilvan; Haminiuk, Charles Windson Isidoro

2014-04-01

A total of 19 Brazilian frozen pulps from the following fruits: açai (Euterpe oleracea), blackberry (Rubus sp.), cajá (Spondias mombin), cashew (Anacardium occidentale), cocoa (Theobroma cacao), coconut (Cocos nucifera), grape (Vitis sp.), graviola (Annona muricata), guava (Psidium guajava), papaya (Carica papaya), peach (Prunus persica), pineapple (Ananas comosus), pineapple and mint (A. comosus and Mentha spicata), red fruits (Rubus sp. and Fragaria sp.), seriguela (Spondias purpurea), strawberry (Fragaria sp.), tamarind (Tamarindus indica), umbu (Spondias tuberosa), and yellow passion fruit (Passiflora edulis) were analyzed in terms of chromaticity, phenolic compounds, carotenoids, and in vitro antioxidant activity using ferric reducing antioxidant power (FRAP) and 1,1-diphenyl-2-picrylhydrazyl (DPPH) assays. Data were processed using principal component analysis (PCA) and hierarchical cluster analysis (HCA). Antioxidant capacity was measured by DPPH and FRAP assays, which showed significant (P antioxidant activity. © 2014 Institute of Food Technologists®

Neoparamoeba branchiphila infections in moribund sea urchins Diadema aff. antillarum in Tenerife, Canary Islands, Spain

Czech Academy of Sciences Publication Activity Database

Dyková, Iva; Lorenzo-Morales, J.; Kostka, Martin; Valladares, B.; Pecková, Hana

2011-01-01

Roč. 95, č. 3 (2011), 225-231 ISSN 0177-5103 R&D Projects: GA ČR GA524/09/0137; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Neoparamoeba * Diadema aff. antillarum * SSU rDNA phylogeny * Tenerife Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.201, year: 2011

The bioavailability of oxalate from Oca (Oxalis tuberosa).

Science.gov (United States)

Albihn, P B; Savage, G P

2001-08-01

It is believed that soluble oxalate has higher bioavailability than insoluble oxalate. Oca (Oxalis tuberosa) is moderately high in oxalate and contains oxalate in soluble form only. We estimated the bioavailability of oxalate in oca based on the urinary excretion of oxalate after oxalate loading with oca to estimate the bioavailability of oxalate in oca. We also clarified whether bioavailability differs in various oxalate loads from the same food source and studied the effect of an additional calcium source on the bioavailability of oxalate from oca. Four men and 4 women ingested 50, 100 and 150 gm. oca as well as 100 gm. oca with 100 gm. sour cream. Oxalate was measured in a 6-hour urine sample from each volunteer. The mean bioavailability of oxalate from oca plus or minus standard deviation was 1.44% +/- 1.31% during the 6-hour period after intake. There was no significant difference in oxalate bioavailability among oxalate intake levels in this study, although oca consumption with sour cream significantly decreased the uptake of oxalate (p oca appears to be similar to that in spinach. However, bioavailability varies among individuals and depends on other constituents of a combined meal.

A new species of Pristimantis (Anura, Craugastoridae) from the Cajas Massif, southern Ecuador

Science.gov (United States)

Sánchez-Nivicela, Juan C.; Celi-Piedra, Elvis; Posse-Sarmiento, Valentina; Urgiles, Verónica L.; Yánez-Muñoz, Mario; Cisneros-Heredia, Diego F.

2018-01-01

Abstract A new species of Pristimantis is described from the highland paramos on the eastern slopes of the Cajas Massif, southern Andes of Ecuador, at 3400 m. This new species is characterized by having a distinctive reddish color, cutaneous macroglands in suprascapular region and surfaces of arm and legs, and by lacking dentigerous processes of vomers. The cutaneous macroglands are similar to those exhibited by several species of the Pristimantis orcesi group, and may suggest a close phylogenetic relationship. The new species could be a latitudinal substitution of Pristimantis orcesi in the southern Andes of Ecuador. PMID:29713233

Evaluation of growth, cell size and biomass of Isochrysis aff. galbana (T-ISO with two LED regimes

Directory of Open Access Journals (Sweden)

Miguel Victor Cordoba-Matson

2013-04-01

Full Text Available In contrast to crops, there are fewer studies using LED-based light with green microalgae and none cultivating the microalga Isochrysis aff. galbana (T-ISO even though of its importance in marine aquaculture. The objective was to evaluate of white and red LEDs as an alternative source of light to cultivate I. aff. galbana (T-ISO. In order to carry this out white and red LEDs were used with a laboratory built Erlenmeyer-type photobioreactor to determine productivity, cell number and size and biomass composition. Results were compared with standard fluorescent lights of the same light intensity. The culture system consisted of 3 flasks for applying red LEDs and three for white LEDs and 3 control group flasks illuminated with the normal fluorescent lighting at the similar light intensity of ~60 mM m–2 s–1. It was found that the population cell density did not significantly increase with either red LEDs or white LEDs (p > 0.05, if at all. Standard fluorescent lighting (control group showed significant increases in population cell number (p < 0.05. Through microscopic observation cell size was found to be smaller for white LEDS and even smaller for red LEDs compared to fluorescent lighting. Biochemical composition of proteins, carbohydrates and lipids was similar for all light regimes. The authors suggest that the unexpected non-growth I. aff. galbana (T-ISO, a haptophyte microalga, with white and red LEDs is possibly due to fact that to initiate cell growth this microalgae requires other wavelengths (possibly green besides red and blue, to allow other pigments, probably fucoxanthin, to capture light

Exudation of fluorescent beta-carbolines from Oxalis tuberosa L roots.

Science.gov (United States)

Bais, Harsh Pal; Park, Sang-Wook; Stermitz, Frank R; Halligan, Kathleen M; Vivanco, Jorge M

2002-11-01

Root fluorescence is a phenomenon in which roots of seedlings fluoresce when irradiated with ultraviolet (UV) light. Soybean (Glycine max) and rye grass (Elymus glaucus) are the only plant species that have been reported to exhibit this occurrence in germinating seedling roots. The trait has been useful as a marker in genetic, tissue culture and diversity studies, and has facilitated selection of plants for breeding purposes. However, the biological significance of this occurrence in plants and other organisms is unknown. Here we report that the Andean tuber crop species Oxalis tuberosa, known as oca in the highlands of South America, secretes a fluorescent compound as part of its root exudates. The main fluorescent compounds were characterized as harmine (7-methoxy-1-methyl-beta-carboline) and harmaline (3, 4-dihydroharmine). We also detected endogenous root fluorescence in other plant species, including Arabidopsis thaliana and Phytolacca americana, a possible indication that this phenomenon is widespread within the plant kingdom.

Caja de Ahorros Municipal de Essen. Alemania Federal

Directory of Open Access Journals (Sweden)

Köllges, Hans

1977-05-01

Full Text Available Ten-story building on a slope, with following distribution: tellers desks, offices and administrative departments, reserved and rental space, a cafeteria, meeting room, installation rooms and a swimming pool with its corresponding services, located on the top of the building. It also has five basements for supplies, storage and garage. The site is surrounded on all four sides with streets on different levels which permit various entrances and different vertical Communications between floors, which results in an optimum relationship between the passage surface and the usable space, taking full advantage of the space available. The concrete structure, with 8.30 m reticule on the sides, provides sufficient flexibility for adapting the different floors to the different operation schemes. The building offers a special architectural interest as a result of the offset in the upper floors and the contrast achieved in treating the facades, where the dark aluminum of the offices floors is broken by the bodies jutting out of the stairwells and elevators, treated with artificial white stone. The building is topped with a roof made of inclined facing on the last floor, also treated with dark aluminum panels.Este edificio consta de diez plantas sobre rasante, en fas que se distribuyen: una sala de cajas, oficinas y departamentos administrativos, espacios de reserva y alquiler, una cafetería, salón de actos, cuartos de instalaciones, y una piscina, con sus correspondientes servicios, montada en el remate de la edificación. Asimismo cuenta con cinco sótanos destinados a abastecimientos, almacén y garaje. La parcela se halla delimitada en sus cuatro costados por redes viarias a distinto nivel, que permiten la existencia de diversos accesos exteriores, así como distintos núcleos de comunicación vertical entre plantas, de donde resulta una óptima relación entre las superficies de circulación y las útiles, aprovechándose plenamente los espacios

Spatial, seasonal and ontogenetic variation in the diet of Astyanax aff. fasciatus (Ostariophysi: Characidae in an Atlantic Forest river, Southern Brazil

Directory of Open Access Journals (Sweden)

Luciano Lazzarini Wolff

Full Text Available This study described the feeding habits of the characin Astyanax aff. fasciatus. The diet compositions of specimens from two sites (A and B on a river in Southern Brazil were compared according to the size of individuals and seasonal period. The collections were performed monthly from March 2005 to February 2006, where the stomach contents of 290 specimens were assessed. Food items for A. aff. fasciatus were basically composed of plants and insects, especially leaf fragments, seeds, fruits, filamentous algae, aquatic and terrestrial insects and insect fragments. At site A, the most common items were insect and plant fragments. Conversely at site B, plant fragments were more representative. In general, all items of animal origin showed the highest feeding index values at site A, whereas at site B detritus and grass items were more abundant. The composition of items varied seasonally, with higher diversity of items being recorded during the spring at both sites. Smaller individuals preferred items of animal origin, while the larger ones consumed mainly items of plant origin. According to its size, A. aff. fasciatus in this study may be considered a species with insectivorous tendencies when immature or herbivorous tendencies when adult. Nevertheless, its feeding habits may be flexible according to resource availability, showing wide ontogenetic, besides spatial and temporal variation.

Caracterização física e química dos frutos da umbu-cajazeira (Spondias spp em cinco estádios de maturação, da polpa congelada e néctar Physical and chemical characterization on the fruits of umbu-cajazeira (Spondias spp in five ripening stages, frozen pulp and nectar

Directory of Open Access Journals (Sweden)

ELIZA DOROTEA POZZOBON DE ALBUQUERQUE LIMA

2002-08-01

Full Text Available A umbu-cajazeira, no Brasil, apresenta boas potencialidades de cultivo e perspectivas de comercialização, o que objetivou este trabalho de avaliação da qualidade física e química dos frutos em cinco estádios de maturação classificados de acordo com o grau de cor da casca descritos como: fruto totalmente verde (1FTV, frutos com início de pigmentação (2FIP, frutos parcialmente amarelos (3FPA, frutos totalmente amarelos (4FTA, frutos totalmente amarelo-alaranjados (5FTAA, da polpa congelada e do néctar. As variáveis estudadas foram os atributos físicos: peso, diâmetro longitudinal, diâmetro transversal e rendimento em polpa, e químicos: vitamina C, acidez total titulável sólidos solúveis totais, pH e a relação sólidos solúveis totais/acidez total titulável. Os frutos, no estádio de maturação comercial (4FTA, apresentaram os seguintes valores mé ;dio: rendimento de polpa de 55,75%; pH de 2,08; SST de 11,25 °Brix; ATT de 1,77 g de ácido citrico/100g de polpa; SST/ATT de 6,39 e teor de vitamina C total de 17,75 mg/100g. A polpa congelada e o néctar mantiveram-se em condições estáveis em relaç ;ão ao pH, SST, ATT e SST/ATT, durante 60 dias de armazenamento. Quanto ao teor de vitamina C total, a polpa congelada apresentou um decréscimo signi ficativo, o que não ocorreu com o néctar.In Brazil some tropical fruits present great potential for cultivation and perspective of commercialization, one of them is the "umbu-cajazeira". A research has been developed aiming to measure the physical and chemical quality of the frozen pulp and the nectar obtained from "umbu-cajazeira" fruits, which were classified in distinct maturation stages. The fruits were divided according to shell colour in five groups: fruit completely green (1FCG, fruit starting to change shell's colour (2FSCC, fruit partially yellow (3FPY, fruit totally yellow (4FTY, fruit totaly orange-like yellow. The variables analysed comprised the physical

Efeito alelopático de frutos de umbu (Phytolacca dioica L. sobre a germinação e crescimento inicial de alface e picão-preto Allelopathic effects of fruits of Phytolacca dioica L. on the germination and early growth of lettuce and beggartick

Directory of Open Access Journals (Sweden)

Junior Borella

2010-10-01

Full Text Available As plantas produzem substâncias por meio do metabolismo secundário. Quando liberadas no meio ambiente são capazes de interferir na germinação e no desenvolvimento de outras plantas. Objetivou-se, nesta pesquisa investigar os efeitos alelopáticos de umbu (Phytolacca dioica L. sobre a germinação e o crescimento inicial de alface e picão-preto, em laboratório, utilizando-se extratos aquosos de frutos de umbu nas concentrações 0, 1, 2, 4 e 8%; foi realizada análise fitoquímica dos frutos e testes de pH e potencial osmótico dos extratos de frutos. Analisaram-se, para a germinação os parâmetros: porcentagem de germinação (PG, velocidade de germinação (VG e índice de velocidade de germinação (IVG; para o crescimento inicial analisaram-se os parâmetros: comprimento (radicular e da parte aérea e biomassa (fresca e seca das plântulas de alface e picão-preto. Os dados foram submetidos ao teste de Tukey, a 1% de probabilidade. Os parâmetros PG, VG e IVG foram alterados significativamente, proporcionais ao aumento da concentração dos extratos de frutos do umbu. O comprimento (radicular e da parte aérea e a biomassa (fresca e seca das plântulas de alface e picão-preto foram reduzidos significativamente com o aumento da concentração dos extratos aquosos de frutos de umbu. O pH e potencial osmótico dos extratos mantiveram-se dentro de padrões adequados e a análise fitoquímica revelou a presença de flavonoides. Pelos resultados os frutos de umbu apresentaram-se com efeito alelopático sobre a alface e o picão-preto.Plants produce substances through secondary metabolism. When these chemicals are released into the environment they can interfere in the germination and development of other plants. The objective of this research was to investigate the effects of allelopathic Phytolacca dioica L. on the germination and early growth of lettuce and beggartick, under laboratory conditions, using aqueous extracts of fruits of

Molecular variants in populations of Bryconamericus aff. iheringii (Characiformes, Characidae in the upper Paraná river basin - doi: 10.4025/actascibiolsci.v35i2.11451

Directory of Open Access Journals (Sweden)

Alberto José Prioli

2013-05-01

Full Text Available There are evidences that Bryconamericus aff. iheringii represents a species complex. DNA molecular markers have been effective in studies on phylogeny, taxonomy, and identification of cryptic species. In this study, partial sequences of genes of ATPase 6 and 8 were used to assess genetic diversity within and among populations of B. aff. iheringii of sub-basins of Tibagi, Pirapó and Ivaí rivers, belonging to the Upper Paraná river basin. The analysis of the sequences of genes pointed out high genetic diversity in B. aff. iheringii from the sub-basins studied with genetic distance values comparable to those found among different species. There was a division of the individuals into five groups. The comparison with other species of Bryconamericus that have sequences available in GenBank confirmed that the individuals studied have relevant values of genetic distance, found among different species. Nevertheless, with the available data it is not possible to refute the hypothesis that the populations correspond to a group resulting from hybridization or that there might have been introgression of mitochondrial DNA among different species.

Liquid chromatography-mass spectrometry identification of anthocyanins of isla oca (Oxalis tuberosa, Mol.) tubers.

Science.gov (United States)

Alcalde-Eon, Cristina; Saavedra, Gloria; de Pascual-Teresa, Sonia; Rivas-Gonzalo, Julián C

2004-10-29

High-performance liquid chromatography (HPLC)-diode array detection (DAD)-mass spectrometry (MS) techniques have been successfully employed in the identification of the anthocyanins of the coloured tubers of isla oca (Oxalis tuberosa), the second most cultivated tuber in the Andean region. Tubers underwent a pre-treatment step in order to inhibit enzymatic reactions and to obtain a stable powder or "concentrate". This concentrate was dissolved, purified and then analysed. Eight different compounds were found. The major peaks were malvidin glucosides (malvidin 3-O-glucoside and 3,5-O-diglucoside). The rest of the peaks were 3,5-O-diglucosides of petunidin and peonidin, and 3-O-glucosides of delphinidin, petunidin and peonidin. Only malvidin 3-O-acetylglucoside-5-O-glucoside was found as an acylated anthocyanin.

Mass production in liquid diet and radiosterilization of South American fruit fly Anastrepha sp.1 aff. fraterculus (Wied., 1830) (Diptera: Tephritidae); Criacao massal em dieta liquida e radioesterilizacao da mosca-sulamericana Anastrepha sp.1 aff. fraterculus (Wied., 1830) (Diptera: Tephritidae)

Energy Technology Data Exchange (ETDEWEB)

Kamiya, Aline Cristiane

2010-07-01

Both the biological control techniques as the Sterile Insect Technique (SIT), are used in many countries to control, suppress and even eradicate fruit flies and other pests in agriculture and public health. The use of such techniques minimizes the continuous employment of insecticides, protects the environment and conforms to standards for food safety. However, it is necessary to implement such programs, technology to produce millions of parasitoids and the pest in its own laboratory with biological quality similar to the insects found in nature and cost competitive with chemical control. The objectives of this study was to establish protocols for artificial rearing of A. sp. 1 aff. fraterculus in liquid larval diet that will achieve levels of mass production for a possible reduction in the cost of establishing and determining the dose of radiation sterilization of adult A. sp. 1 aff. fraterculus meeting the quality parameters required by the Sterile Insect Technique with insects from the creation of Radioentomology Laboratory of CENA/USP. Seven experimental diets compared to the conventional diet used in Radioentomology Lab. of CENA/USP, which was used as control. All seven diets have in common the exclusion of agar in its formulation. Only two of the diets tested were suitable for larval development of the fly, they compared with the standard diet, showed inferior results with respect to the volume of recovered larvae, pupae and weight of emergency, however, no significant differences regarding the periods of development , pupal recovery, sex ratio and longevity under stress. It is possible to replace the diet with agar for liquid diets for artificial creation of A. sp. 1 aff. fraterculus, reduced cost and greater convenience of handling, but due to their quality standards lower than the standard diet, more tests are needed especially regarding the adaptability of the insect to the new environment. To determine the sterilizing dose this study examined the

Esclerosis Tuberosa. Revisión

Directory of Open Access Journals (Sweden)

Otman Fernández Concepción

1999-09-01

Full Text Available Se realiza una revisión actualizada sobre las peculiaridades clínicas, radiológicas y neuropatológicas de la esclerosis tuberosa, la más representativa de las enfermedades neurocutáneas que evolucionan con manchas hipocrómicas y segunda en frecuencia de las facomatosis. Las manchas hipocrómicas asociadas con espasmos infantiles o cardiomegalia en lactantes y la evidencia de crisis epilépticas y angiofibromas faciales en la infancia tardía, constituyen las formas habituales de presentación de le enfermedad, aunque no es raro observar formas paucisintomáticas en la adultez. Los nódulos subependimarios, las tuberosidades corticales y los astrocitomas de células gigantes son las manifestaciones neuropatológicas características de este proceso, identificables radiológicamente mediante tomografía axial computadorizada y resonancia magnética nuclear craneales. El diagnóstico precoz permite brindar consejo genético a los padres; y la evaluación periódica de los casos, la identificación temprana de posibles complicaciones.An updated review on the clinical, radiological and neuropathological pecularities of tuberous sclerosis is made. This is the most representative of the neurocutaneous diseases that evolve with hypochromic stains and is the second in frequency of pharcomatosis. The hypochromic stains associated with infantile spasms or cardiomegaly in infants and the evidence of epileptic seizures and facial angiofibromas in late childhood are the habitual forms of presentation of this disease, although it is not rare to observe oligosymptomatic forms in adults. The subepindemal nodules, the cortical tuberosities and the astrocytomas of giant cells are the characteristic neuropathological manifestations of this process that may be radiologically identified by CAT and cranial magnetic resonance imaging. The early diagnosis allows to give genetic counseling to parents, to periodically evaluate the cases, and to identify the

Neuritogenic activity-guided isolation of a free base form manzamine A from a marine sponge, Acanthostrongylophora aff. ingens (Thiele, 1899)

NARCIS (Netherlands)

Zhang, B.; Miyamoto, T.; van Soest, R.W.M.

2008-01-01

Two manzamine-class alkaloids, manzamine A (1) and 8-hydroxymanzamine (2) were isolated from a Japanese marine sponge Acanthostrongylophora aff. ingens, together with three known alkaloids manzamine E (3), manzamine F (4), and manzamine X (5). The spectral features of 1 and 2 were different from the

Proyecto de factibilidad para la creación de una caja solidaria para las nacionalidades y pueblos de mujeres que laboran en el Mercado Mayorista en el sur del Distrito Metropolitano de Quito.

OpenAIRE

Flores Lara, Edgar Andrés

2012-01-01

La caja solidaria para las Nacionalidades y Pueblos de Mujeres QALLARIY PURIY será una entidad de Ahorro y Crédito Popular dirigida a las mujeres que laboran en el Mercado Mayorista al Sur del distrito Metropolitano de Quito, que realizan una actividad económica-productiva y se encuentran en situaciones de extrema marginalidad. El presente estudio de Factibilidad para la creación de una Caja Solidaria para las Nacionalidades y Pueblos de Mujeres consta de cinco capítulos en los cuales se p...

Ciclo de vida y aspectos poblacionales de Edessa aff. aulacosterna Stal, 1872 (Heteroptera: Pentatomidae chinche del fruto del camu camu (Myrtaceae en zona de restinga, Ucayali, Perú Life cycle and population aspects of camu camu fruit stink bug Edessa aff. aulacosterna Stal, 1872 (Heteroptera: Pentatomidae in restinga zone, Ucayali, Peru

Directory of Open Access Journals (Sweden)

José Iannacone

2007-01-01

Full Text Available El camu camu es uno de los frutales nativos con gran potencial económico para la agroindustria y agro exportación. Edessa es una de las plagas del camu camu que provoca sequedad en los brotes, y en los frutos una mancha decolorada con círculos concéntricos bien marcados y un punto central al alimentarse. El objetivo del presente trabajo fue determinar el ciclo biológico bajo condiciones de laboratorio y la fluctuación poblacional de Edessa aff. aulacosterna "Chinche del fruto del camu camu" durante enero a noviembre del 2004 en el cultivo de camu camu, en parcelas en desarrollo y producción ubicadas en áreas de restinga inundables en Pucallpa, Ucayali, Perú. Se colectaron huevos, ninfas y adultos procedentes del distrito de Yarinacocha, Pucallpa, Ucayali, Perú para iniciar la crianza artificial. El tiempo de duración del huevo al I estadio ninfal fue 5,1 días. Se encontró un 94,6% de eclosión de los huevos, variando entre 12 hasta 14 huevos por postura. El tiempo transcurrido desde el huevo hasta II estadío fue de 37,3 días y del III al V estadío ninfal fue de 81,9 días. El porcentaje de mortalidad del primer estadio ninfal a adulto fue de 98,1%. Los adultos colectados se localizaron preferentemente sobre las ramas y el tallo de la planta, mientras que las ninfas se encontraron en los brotes tiernos. Con relación a su fluctuación poblacional, solo se registró posturas a lo largo del año en parcelas en producción. No se encontraron diferencias entre ninfas I a V, y adultos de Edessa aff. aulacosterna, entre plantaciones en producción y desarrollo de camu camu. Solo se encontró diferencias entre la época seca y lluviosa en las ninfas de III a V estadio en las plantas de camu camu en desarrollo. Edessa aff. aulacosterna presentó mayormente una distribución contagiosa. El adecuado conocimiento de la bioecología nos permite mejorar la estrategia de control de esta plaga.Camu camu is one of the native fruits with a great

Social responsibility and social security: The foundation of caja de pensiones para la vejez y de ahorros

OpenAIRE

Argandoña, Antonio; Moreno, Carlos M.; Sola, Joan M.

2009-01-01

The concept of Corporate Social Responsibility (CSR) is not new. Over the course of time, many entrepreneurs have created and developed companies, with a strong sense of ethical and social responsibility. This paper presents an example of how CSR was conceived and put into practice when Caja de Pensiones para la Vejez y de Ahorros was created in Barcelona in 1905, following the life and ideas of its founder, Francesc Moragas, a lawyer with a deep commitment to social action and a successful c...

Cálculo de la transmisión paralela helicoidal de la caja multiplicadora de una turbina eólica

Directory of Open Access Journals (Sweden)

César Alberto Chagoyén-Méndez

2014-01-01

Full Text Available La caja multiplicadora de una turbina eólica es el componente de mayor complejidad mecánica y es la responsable de la mayoría de la pérdida de tiempo operacional de la turbina y del incremento de los costos. La misma no alcanza una vida proyectada de 20 años. Todos los estudios hasta el momento indican que estas fallas surgen desde el proceso de diseño. Este trabajo tuvo como objetivo demostrar algunas de las insuficiencias de las normas actuales de diseño de las cajas multiplicadoras de las turbinas eólicas, a través de la realización de una comparación de los resultados del cálculo de la transmisión paralela helicoidal de una turbina eólica de 2,5 MW, realizados por tres vías: con las normas ISO 6336:2006 Método B y AGMA 2101-D04 ( Metric Edition y mediante simulación numérica. De este análisis resulta que no existen problemas de resistencia ni de rigidez en ambas transmisiones, sin embargo la diferencia entre estos tres métodos de cálculo es considerable.

Biological aspects of Leucothyreus alvarengai Frey and Leucothyreus aff. semipruinosus Ohaus (Coleoptera, Melolonthidae, Rutelinae in crop succession at central Brazil

Directory of Open Access Journals (Sweden)

Alex Furquim Pereira

2013-09-01

Full Text Available Biological aspects of Leucothyreus alvarengai Frey and Leucothyreus aff. semipruinosus Ohaus (Coleoptera, Melolonthidae, Rutelinae in crop succession at central Brazil. Beetles of the family Melolonthidae make up a large group and some species are considered pests of planted crops. Little information is available on the basic biological aspects of the genus Leucothyreus, such as association with cultivated crops and their occurrence periods. Therefore studies were developed in soybean and corn crops in Tangará da Serra, Mato Grosso, Brazil, with the objective of studying the occurrence and biological aspects of Leucothyreus alvarengai Frey and Leucothyreus aff. semipruinosus Ohaus. For acquisition of immature specimens of both species, in April 2011 sampling was performed in corn fields, in July and October in the fallow area, and in soybeans fields planted in December; in 2012 sampling was performed in January and February in soybean fields and in March in corn fields. In 2011 the total number of larvae obtained in April, July, October and December were 100, 6, 30 and 27, and in January, February and March of 2012 these quantities were 32, 52 and 65 larvae, respectively. In all sampling events the larvae of L. alvarengai were collected in greater quantity. At the beginning of the reproductive period of L. alvarengai and L. aff. semipruinosus, it was observed that the adults began to fly and soon after started oviposition in the field in September. The appearance of larvae coincides with the time of soybean planting in the field, thus the larvae feed on roots of soybean plants at the beginning of their development and the cycle from egg to adult of the two species was completed in one year.

Ciclo vital de Pegoscapus aff. silvestrii (Hymenoptera:Agaonidae, polinizador de Ficus andicola (Moraceae

Directory of Open Access Journals (Sweden)

Sergio Jansen G.

2006-07-01

de sexo en las poblaciones de avispas que emergen de los frutos de cada especie de Ficus. A pesar de esto, son pocos los estudios que tratan la biología básica de las avispas, especialmente para el Neotrópico. El presente trabajo describe el ciclo vital de la avispa agaónida Pegoscapus aff. silvestrii, polinizadora de Ficus andicola, a partir de un seguimiento intensivo a los frutos de un árbol. La especie tiene cinco estadíos larvales que juntos abarcaron 80 días desde la postura, con presencia de aparato bucal en los últimos dos. A éstos les sigue una pupa del tipo exarata y finalmente el adulto.

LAS ENTIDADES FINANCIERAS DE ECONOMÍA SOCIAL ANTE LA CRISIS FINANCIERA: UN ANÁLISIS DE LAS CAJAS RURALES / THE SOCIAL FINANCIAL INSTITUTIONS IN A FRAME OF CRISIS: AN ANALYISIS OF SPANISH RURAL CO-OPERATIVE BANKS

Directory of Open Access Journals (Sweden)

Francisco SOLER TORMO

2010-01-01

Full Text Available Las cajas rurales, en su condición de entidades de crédito, al igual que los bancos y las cajas de ahorros, están experimentando las consecuencias derivadas de la actual crisis financiera internacional. Sin embargo, lejos de suponer un lastre para estas entidades, la actual situación ha de ser aprovechada como una oportunidad, lo que significa redefinir su modelo de negocio apostando por una mayor eficiencia. El objetivo del presente trabajo es analizar cuáles son los efectos que la crisis financiera está provocando en las cajas rurales españolas, partiendo de las características propias de las cajas rurales y teniendo en cuenta los trabajos más recientes publicados sobre la crisis financiera actual. El entorno de crisis financiera global requiere una caracterización comparativa del sector con la banca y las cajas de ahorros mediante el análisis de las tasas de morosidad, de cobertura de insolvencias y los ratings otorgados. / The small farm loan banks, as their credit organizations, like the banks and the savings banks, are undergoing the derived consequences of the present international financial crisis. Nevertheless, far from supposing a ballast for these organizations, the present situation has to be taken advantage of like an opportunity, which means to redefine its model of business betting by a greater efficiency. The objective of the present work is to analyze which are the effects that the financial crisis is causing in the Spanish small farm loan banks, starting off of the own characteristics of the small farm loan banks and considering the published most recent works on the present financial crisis. The surroundings of global financial crisis require a comparative characterization of the sector with the bank and the savings banks by means of the analysis of the rates of dilatoriness, cover of insolvencies and the granted ratings.

Relato de caso: esclerose tuberosa

Directory of Open Access Journals (Sweden)

Samuel Simis

2016-10-01

Full Text Available Introdução: O Complexo de Esclerose Tuberosa (CET é uma síndrome neurocutânea transmitida hereditariamente, de traço autossômico dominante e que se manifesta por uma tríade clássica: deficiência mental, convulsões e adenoma sebáceo. A mutação responsável pela síndrome está presente em até 85% dos portadores de CET e.ocorre nos genes supressores tumorais TSC1 e TSC2, que produzem hamartina e tuberina, respectivamente.A prevalência do CET é de 1:10.000 a 1:170.000, atinge mais indivíduos do sexo masculina e é rara em negros. Relato de Caso: R.C.S.B., paciente do sexo feminino, 16 anos, vem encaminhada ao ambulatório de neurologia devido a quadro de convulsões tônico-clônicas generalizadas e crises de ausência diárias há 1 ano, mas com história de convulsões aos 2 anos que cessaram espontaneamente. Está em tratamento com fenitoína 200mg/dia e carbamazepina 800mg/dia, mas ainda apresenta crises de ausência. A paciente apresenta as lesões cutâneas típicas do CET: adenomas sebáceos (angiofibroma em face distribuídos simetricamente entre nariz e bochechas, envolvendo ainda fronte e queixo. Não há sinais de retardo mental. A ressonância nuclear magnética revelou imagens com padrão compatível com áreas de desmielinização. O eletroencefalograma encontrava-se normal. Conclusão: O tratamento do CET ainda é um desafio para muitos neurologistas, uma vez que não há tratamento específico para doença. A paciente deve contar com equipe multidisciplinar, por vezes é necessário acompanhamento com neurologista, dermatologista, geneticista, psicólogos e outros, dependendo das manifestações do CET. A finalidade terapêutica é a qualidade de vida da paciente, que pode ser prejudicada pelas várias convulsões ou alterações estéticas da doença.

Caja de Previsión París-Francia

Directory of Open Access Journals (Sweden)

Tessier, J.

1978-11-01

Full Text Available The building housing the Pension Fund has three concrete undergrade levels and several floors above grade with a steel structure. This article analyses the layout of each floor and the construction method and materials used in the various areas throughout the building. Also described are the features of the mechanical installations, such as: heating, air conditioning, electrical, lifts and telephone. A 12-storey tower rises from the centre of the building to house the archives, fitted with a telephone equipped elevator.

La sede de la Caja de Previsión consta de tres sótanos realizados en hormigón armado, y una superestructura metálica de varias plantas. En este artículo se analiza la distribución de cada una de estas plantas, así como el sistema de construcción y los materiales empleados en las diversas partes del edificio. Se contemplan, también, las características de las instalaciones: calefacción, aire acondicionado, electricidad, ascensores y servicio telefónico. En la parte central del edificio se halla una torre, destinada a archivos, de 12 plantas, dotada de un ascensor con teléfono.

Cuestiones actuales del régimen jurídico-administrativo de las Cajas de ahorros españolas

Directory of Open Access Journals (Sweden)

Ana Belén Casares Marcos

2005-12-01

Full Text Available Las reformas legislativas que han afectado en los últimos tiempos a la organización y el funcionamiento del sistema financiero español han tenido una especial repercusión en el ámbito de las cajas de ahorros. La tramitación parlamentaria de la Ley 44/2002, de 22 de noviembre, de Medidas de Reforma del Sistema Fianciero, reavivó el debate sobre su régimen jurídico y la necesidad de acotar la intervención pública en su seno. Ahonda en ello la Ley 26/2003 , de 17 de julio, de Transparencia, que extiende al ámbito de las cajas la preocupación por el corporate governance. Ambas normas responden a la necesidad de dar respuesta a algunos de los problemas más inmediatos a que se enfrentan estas entidades, si bien adolecen de un defecto fundamental por cuanto no abordan de forma exhaustiva la regulación de la institución. Se perpetúa así la trayectoria tradicional de "parcheo" del régimen jurídico aplicable a las mismas, evitando entrar en la cuestión esencial de la definición de su naturaleza jurídica y abocando a las cajas, en consecuencia, al díficil reto de acompasar su vocación social tradicional a las nuevas exigencias legales en pro de una mayor eficiencia, racionalidad y neutralidad de su acitividad económica.Recent legal changes pertaining to the organization and performance of the Spanish financial system have had significant repercussions on the savings banks sector. The law on financial market reform passed in 2002, Ley Financiera, raised once again the debate on their legal situation and the urge to cut down public influence on their management. The 2003 Transparency Law, Ley de Transparencia, follows this reform and extends corporate governance to Spanish savings banks. Both Laws seek to confront some of the most important issues raised by these credit institutions, but they also share the flaw of not regulating its legal framework and status completely. They continue, therefore, to add "patches" to the savings

Perdas na comercialização de quatro hortaliças tuberosas em supermercados de Guanhães/MG

OpenAIRE

Castro, Eloísia Maria Canuto de

2013-01-01

O objetivo deste trabalho foi analisar as perdas pós-colheita de quatro raízes tuberosas: batata-baroa, batata-doce, beterraba e cenoura, ocorridas no processo de comercialização em dois supermercados (A e B), na cidade de Guanhães/MG. Os supermercados tinham a mesma capacidade, porém o supermercado B estocava as hortaliças em câmara frigorífica e a exposição nas gôndolas era parcelada de acordo com as vendas. Para obtenção dos dados, fez-se acompanhamento das atividades desenvolvidas pelo at...

Properties of Single K+ and Cl− Channels in Asclepias tuberosa Protoplasts 1

Science.gov (United States)

Schauf, Charles L.; Wilson, Kathryn J.

1987-01-01

Potassium and chloride channels were characterized in Asclepias tuberosa suspension cell derived protoplasts by patch voltage-clamp. Whole-cell currents and single channels in excised patches had linear instantaneous current-voltage relations, reversing at the Nernst potentials for K+ and Cl−, respectively. Whole cell K+ currents activated exponentially during step depolarizations, while voltage-dependent Cl− channels were activated by hyperpolarizations. Single K+ channel conductance was 40 ± 5 pS with a mean open time of 4.5 milliseconds at 100 millivolts. Potassium channels were blocked by Cs+ and tetraethylammonium, but were insensitive to 4-aminopyridine. Chloride channels had a single-channel conductance of 100 ± 17 picosiemens, mean open time of 8.8 milliseconds, and were blocked by Zn2+ and ethacrynic acid. Whole-cell Cl− currents were inhibited by abscisic acid, and were unaffected by indole-3-acetic acid and 2,4-dichlorophenoxyacetic acid. Since internal and external composition can be controlled, patch-clamped protoplasts are ideal systems for studying the role of ion channels in plant physiology and development. Images Fig. 5 PMID:16665712

Active phytochemicals of Pueraria tuberosa for DPP-IV inhibition: in silico and experimental approach.

Science.gov (United States)

Srivastava, Shivani; Shree, Priya; Tripathi, Yamini Bhusan

2017-01-01

We had earlier reported that the extract of Pueraria tuberosa significantly inhibits DPP-IV enzyme, resulting in glucose tolerance response in rats. In this study, we have explored the active phytochemicals responsible for this potential. The results have been validated in both fasting and postprandial states in the plasma of normal rats and also in fasting blood and intestinal homogenates of diabetic models. Pueraria tuberosa water extract (PTWE) was administered to normal Charles Foster rats for 35 days and to diabetic model (65 mg/kg bw) for 10 days. After treatments, oral glucose tolerance test (OGTT) and insulin was done for 90 min, and the changes in the levels of GLP-1, GIP, and DPP-IV activities were monitored in fasting and postprandial states. In the case of the diabetic model, DPP-IV activity was measured in intestinal homogenate and basal insulin in plasma. The components of PTWE were analyzed via HPLC-MS based on their chemical formula, molecular mass, and retention time. Using the molecular docking study, we have selected the top five components having strong binding energy with DPP-IV. The increase in secretion of GLP-1 and GIP was significantly higher in the postprandial state when compared to fasting condition. GLP-1 plasma concentration increased by 5.8 and 2.9 folds and GIP increased by 8.7 and 2.4 folds in PTWE and control rats, respectively. In contrast, the postprandial decrease in DPP-IV specific activities was recorded at 2.3 and 1.4 folds. The response in OGTT and insulin was also consistent with these changes. In comparison to diabetic controls, PTWE-administered rats showed decreased DPP-IV activity in the intestine, leading to enhanced basal insulin concentration. Through molecular docking, we found Puerarone and Robinin to be the most potential phytochemicals of PTWE for DPP-IV inhibition. Binding energy (kcal/mol) and dissociation constant (pM) of Robinin with DPP-IV protein were found to be 7.543 and 2,957,383.75, respectively

Cálculo y análisis de la caja de cambios y elementos de transmisión de una motocicleta

OpenAIRE

López Matías, José Javier

2015-01-01

Desarrolla el cálculo y análisis de la caja de cambios de una motocicleta de séis marchas junto con todos sus elementos de transmisión. Además adjunta índice de ilustraciones y de tablas de datos, así cómo al inicio un extenso resumen y dos archivos de vídeo. Proyecto Fin de Carrera-Universidad de Salamanca, Escuela Técnica Superior de Béjar, 2015

Los reales de minas de la caja de Guadalajara durante el siglo XVIII: Circuitos comerciales y producción de plata

Directory of Open Access Journals (Sweden)

de León Meza, C. René

2011-08-01

Full Text Available This article shows the economic significance of the group of mines that belonged to the jurisdiction of the «Caja de Guadalajara». The novelty lies in that local historiography had erroneously labeled these mining camps as being small. Recent studies show that they were not so small after all. These groups of mines were the focal point of the economy of a vast region and triggered the development of agriculture, livestock and trade activities. This article reveals the nexus between the fluctuations in silver production and events in Europe.

Este artículo da a conocer la importancia económica que tuvo un conjunto de reales de minas que perteneció a la jurisdicción de la caja de Guadalajara. Es novedoso porque por primera vez son estudiados aquéllos que la historiografía local ha considerado erróneamente como «pequeños reales de minas». Estas explotaciones fueron el eje articulador de la economía en una vasta región que impulsó el desarrollo de la ganadería, agricultura y comercio. Vincula las fluctuaciones en la producción de plata con sucesos ocurridos en Europa.

Morphological development of Corydoras aff. paleatus (Siluriformes, Callichthyidae) and correlation with the emergence of motor and social behaviors

OpenAIRE

Rodríguez-Ithurralde, Daniel; del Puerto, Gabriela; Fernández-Bornia, Fernando

2014-01-01

Here we examine major anatomical characteristics of Corydoras aff. paleatus (Jenyns, 1842) post-hatching development, in parallel with its neurobehavioral evolution. Eleutheroembryonic phase, 4.3-8.8 days post-fertilization (dpf); 4.3-6.4 mm standard length (SL) encompasses from hatching to transition to exogenous feeding. Protopterygiolarval phase (8.9-10.9 dpf; 6.5-6.7 mm SL) goes from feeding transition to the commencement of unpaired fin differentiation, which marks the start of pterygiol...

Caracterización de la esclerosis tuberosa en pacientes que consultan al Hospital Universitario San Vicente de Paúl, Medellín, Colombia

Directory of Open Access Journals (Sweden)

Dagoberto Nicanor Cabrera Hémer

2008-11-01

Full Text Available La esclerosis tuberosa (ET es una enfermedad autosómica dominante, que afecta muchos sistemas y cursa con diversas manifestaciones clínicas, entre ellas epilepsia, retardo mental y lesiones cutáneas. Se hizo un estudio retrospectivo para contribuir a la caracterización de la esclerosis tuberosa en Medellín, Colombia. Se revisaron 21 historias, 62% mujeres y 38% hombres; la edad media al momento del diagnóstico fue 23 meses, todos los pacientes tenían epilepsia y lesiones cutáneas, las crisis más frecuentes fueron las parciales con generalización secundaria (66%, 47% tuvieron espasmos infantiles, la mayoría presentaron dos o más tipos de crisis (90%. Todos los pacientes recibieron anticonvulsivantes, los más frecuentemente utilizados fueron: fenobarbital, ácido valproico, vigabatrina, carbamazepina y clonazepam. En general, la mayoría de los pacientes requirieron varios medicamentos durante la evolución de su enfermedad y los pocos que lograron un adecuado control de la epilepsia, lo hicieron con anticonvulsivantes de primera generación. CONCLUSIÓN:las características de nuestra serie son similares a las reportadas en la literatura mundial. Los antiepilépticos de primera generación siguen siendo la principal herramienta terapéutica para el tratamiento inicial de los pacientes Medellín.

Mass production in liquid diet and radiosterilization of South American fruit fly Anastrepha sp.1 aff. fraterculus (Wied., 1830) (Diptera: Tephritidae)

International Nuclear Information System (INIS)

Kamiya, Aline Cristiane

2010-01-01

Both the biological control techniques as the Sterile Insect Technique (SIT), are used in many countries to control, suppress and even eradicate fruit flies and other pests in agriculture and public health. The use of such techniques minimizes the continuous employment of insecticides, protects the environment and conforms to standards for food safety. However, it is necessary to implement such programs, technology to produce millions of parasitoids and the pest in its own laboratory with biological quality similar to the insects found in nature and cost competitive with chemical control. The objectives of this study was to establish protocols for artificial rearing of A. sp. 1 aff. fraterculus in liquid larval diet that will achieve levels of mass production for a possible reduction in the cost of establishing and determining the dose of radiation sterilization of adult A. sp. 1 aff. fraterculus meeting the quality parameters required by the Sterile Insect Technique with insects from the creation of Radioentomology Laboratory of CENA/USP. Seven experimental diets compared to the conventional diet used in Radioentomology Lab. of CENA/USP, which was used as control. All seven diets have in common the exclusion of agar in its formulation. Only two of the diets tested were suitable for larval development of the fly, they compared with the standard diet, showed inferior results with respect to the volume of recovered larvae, pupae and weight of emergency, however, no significant differences regarding the periods of development , pupal recovery, sex ratio and longevity under stress. It is possible to replace the diet with agar for liquid diets for artificial creation of A. sp. 1 aff. fraterculus, reduced cost and greater convenience of handling, but due to their quality standards lower than the standard diet, more tests are needed especially regarding the adaptability of the insect to the new environment. To determine the sterilizing dose this study examined the

La caja negra de la dinámica empresarial

Directory of Open Access Journals (Sweden)

María Callejón

2009-01-01

Full Text Available Este artículo intenta aportar conocimientos sobre la contribución a la política industrial de la investigación en dinámica empresarial. Los programas de fomento a la creación de empresas se han generalizado aunque se desconoce cuál es el ritmo óptimo de creación y destrucción empresarial. El análisis económico destaca la heterogeneidad empresarial como característica dominante en la dinámica industrial. La profundización en el conocimiento de los tipos de emprendedores, su comportamiento, y su contribución diferencial a la innovación y el crecimiento permitirá ver en la "caja negra" y diseñar programas públicos adecuados. El análisis empírico realizado encuentra que la naturaleza económica del autoempleo es muy diferente de las empresas con empleados. Los programas públicos deberían priorizar entrantes con capacidad de sobrevivir y no maximizar la entrada indiscriminadamente. La supervivencia de las nuevas empresas se encuentra positivamente relacionada con su tamaño al nacer. La innovación y la inversión mejoran la supervivencia de las nuevas empresas manufactureras. La inversión en I+D aumenta el riesgo de las nuevas empresas, aunque mejore la competitividad de las empresas establecidas.

La caja negra de la dinámica empresarial

Directory of Open Access Journals (Sweden)

María Callejón

2009-10-01

Full Text Available Este artículo intenta aportar conocimientos sobre la contribución a la política industrial de la investigación en dinámica empresarial. Los programas de fomento a la creación de empresas se han generalizado aunque se desconoce cuál es el ritmo óptimo de creación y destrucción empresarial. El análisis económico destaca la heterogeneidad empresarial como característica dominante en la dinámica industrial. La profundización en el conocimiento de los tipos de emprendedores, su comportamiento, y su contribución diferencial a la innovación y el crecimiento permitirá ver en la “caja negra” y diseñar programas públicos adecuados. El análisis empírico realizado encuentra que la naturaleza económica del autoempleo es muy diferente de las empresas con empleados. Los programas públicos deberían priorizar entrantes con capacidad de sobrevivir y no maximizar la entrada indiscriminadamente. La supervivencia de las nuevas empresas se encuentra positivamente relacionada con su tamaño al nacer. La innovación y la inversión mejoran la supervivencia de las nuevas empresas manufactureras. La inversión en I+D aumenta el riesgo de las nuevas empresas, aunque mejore la competitividad de las empresas establecidas.

Phytoremediation efficiency of Portulaca tuberosa rox and Portulaca oleracea L. naturally growing in an industrial effluent irrigated area in Vadodra, Gujrat, India.

Science.gov (United States)

Tiwari, K K; Dwivedi, S; Mishra, S; Srivastava, S; Tripathi, R D; Singh, N K; Chakraborty, S

2008-12-01

Phytoremediation is a novel, solar-driven and cost-effective technology for the remediation of heavy metal contaminated environments through exploitation of plants ability to accumulate heavy metals in their harvestable shoot parts. In the present investigation, we collected plants of two species of Portulaca i.e. P. tuberosa and P. oleracea from field sites in Vadodra, Gujrat, India. At one site, field was being irrigated with industrial effluent while at other with tube well water. Analysis of heavy metals was performed in industrial effluent, tube well water, soils irrigated with them, and in different parts viz., roots, stem, leaves and flowers of the plant samples. Industrial effluent and soil irrigated with it had very high level of heavy metals (Fe, Zn, Cd, Cr and As) as compared to the tube well water and soil irrigated with that. Plants of both the species growing in effluent irrigated soils showed high accumulation of metals in all plant parts with the maximum being in roots and the least in flowers. Interestingly, both species of Portulaca hyperaccumulated more than one heavy metal viz., Cd, Cr and As. The total shoot concentrations (microg g(-1) dw) of Cd, Cr and As in P. tuberosa were 1,571, 7,957 and 3,118, respectively while in P. oleracea, these were 1,128, 7,552 and 2,476, respectively. Portulaca plants have good biomass and high regeneration potential; hence appear to be suitable for the remediation of effluent (metal) contaminated areas.

La importancia del ciclo de caja y cálculo del capital de trabajo en la gerencia PYME

OpenAIRE

Jorge Iván Jiménez Sánchez; Farley Saray Rojas Restrepo; Heidy Julieth Ospina Galvis

2014-01-01

 El artículo aborda las finanzas en la pyme moderna, la cual necesita de un gerente dinámico y hábil en la gestión administrativa, la información contable y las finanzas, con conocimiento de los días necesarios para cubrir el ciclo de caja y el capital que se requiere para operar a corto plazo, calculo necesario para determinar si va a alcanzar el dinero o si va a necesitar financiación y su valor exacto. Las cifras de fracaso de las pymes en América Latina son abrumadoras, ochenta por ciento...

Cryopreservation of in vitro shoot apices of Oxalis tuberosa Mol.

Science.gov (United States)

Gonzalez-Benito, M E; Mendoza-Condori, V H; Molina-Garcia, A D

2007-01-01

Oca (Oxalis tuberosa Mol.) is an under-utilized tuber crop from the Andean region. Cryopreservation would allow the safe and long-term preservation of the genetic resources of this crop. A protocol for the cryopreservation of in vitro grown shoots has been developed using the vitrification solution PVS2. Two genotypes were studied (G1 and G27). Nodal segments were cultured on MS medium and incubated at 10 degree C with 16 h photoperiod and 10 mol per square meter per second irradiance, for two weeks. Apices were then excised and cultured on MS+0.15 M sucrose for 3 days at 5 degree C in darkness. Subsequently, apices were immersed in a loading solution (liquid MS medium+2 M glycerol+0.4 M sucrose), and then treated with the vitrification solution PVS2 for 0 to 40 minutes. Cryovials were then immersed in liquid nitrogen. Four weeks after rewarming and culture on recovery medium, genotype G1 showed approximately 60 percent recovery (normal growth) with 20 min PVS2 treatment. Genotype G27 showed lower recovery (30 percent). Differential scanning calorimetry yielded a Tg midpoint for PSV2 solution of ca. -120 degree C. Calorimetric studies on apices at different stages of the cryopreservation protocol showed a change in calorimetric parameters consistent with a decrease in the amount of frozen water as the protocol advanced.

Astrocitoma subependimario de células gigantes asociado a complejo de esclerosis tuberosa: recomendaciones para el diagnóstico oportuno y tratamiento.

OpenAIRE

Matilde Ruiz; Sandra Sánchez; Alejandro Rea; Roberto Sanromán; Joao García; Antonio Bravo; Infante Cantú; Hugo Ceja; Ariadna González; María del Mar Sáez

2015-01-01

RESUMEN El complejo de esclerosis tuberosa es una enfermedad genética poco frecuente, autosómica dominante con fenotipo y expresión clínica muy variables. Se caracteriza por alteraciones en la migración, diferenciación y proliferación celulares con formación de múltiples tumores benignos llamados hamartomas, las cuales afectan principalmente piel, encéfalo, riñón, ojo, corazón y pulmón. Los astrocitomas subependimarios de células gigantes son tumores benignos de crecimien...

The occurence of black spot disease in Astyanax aff. fasciatus(characiformes: characidae in the Guaíba Lake basin, RS, Brazil

Directory of Open Access Journals (Sweden)

F Flores-Lopes

Full Text Available Black spot disease is common in freshwater fish and is usually caused by the metacercaria stage of digenetic trematodes, normally from the Diplostomidae family. The present study evaluated the prevalence and intensity of this disease in Astyanax aff. fasciatus(Teleostei: Characiformes in the Guaíba Lake basin (RS, Brazil, including body parts assessment and the points of sampling with higher occurrence of black spots. Fish samples were taken seasonally from December 2002 until October 2004. The samples were collected with the use of a seine net at eleven points. The specimens were fixed in 10% formalin and stored in 70% ethanol. Black spot disease showed a low frequency in the Guaíba lake basin (2.07% and no specificity to the species Astyanax aff. fasciatus was observed. A high prevalence among the individuals and high intensity of infection levels was found in the ventral and dorsal regions in relation to other body parts (e.g., pectoral, pelvic and anal regions. Among the sampling points studied, we observed a higher prevalence on samples collected at points Gasômetro, Saco da Alemoa and Sinos, located in open areas with less occurrence of mollusks.

Cajas intersomáticas lumbares: ¿medios de fusión o sólo espaciadores? [Lumbar interbody cages: Fusing means or only spacers?

Directory of Open Access Journals (Sweden)

Diego Nicolas Flores Kanter

2013-06-01

Full Text Available Introducción La fusión quirúrgica de la columna lumbar es un método muy utilizado para el tratamiento de la inestabilidad segmentaria lumbar dolorosa. En la actualidad, las dos técnicas de fusión instrumentada más utilizadas son la fusión posterolateral con tornillos pediculares y la fusión circunferencial mediante asociación de caja intersomática. Si bien hay evidencia de que la asociación de dispositivos intersomáticos aumenta la tasa de fusión, la mayoría de los estudios no discriminan si esta se produce solo de forma posterolateral o si se asocia una fusión anterior. El objetivo de este trabajo es determinar si existe fusión ósea real a nivel de las cajas intersomáticas o si estas actúan solo como espaciadores. Material y métodos Se analizaron 28 pacientes con patología de la columna lumbar sometidos a artrodesis lumbar circunferencial en un solo nivel entre mayo de 2007 y enero de 2012, mediante tomografía computarizada posquirúrgica para valorar la presencia o no de artrodesis anterior. Se efectuó un estudio de valor terapéutico, descriptivo, de observación (nivel de evidencia IV; mediante evaluación estadística se realizó un análisis de frecuencias para describir la proporción de casos con fusión anterior. Resultados Se detectó una tasa de fusión del 92,86% y falta de fusión radiológica anterior en el 7,14% de los pacientes. Conclusiones Hay una alta tasa de fusión anterior a nivel de las cajas intersomáticas; de este modo, se demuestra que dichos dispositivos actúan como medios de fusión y no solo como espaciadores.

8,12;8,20-diepoxy-8,14-secopregnane glycosides from roots of Asclepias tuberosa and their effect on proliferation of human skin fibroblasts.

Science.gov (United States)

Warashina, Tsutomu; Umehara, Kaoru; Miyase, Toshio; Noro, Tadataka

2011-10-01

A pregnane glycoside fraction from the roots of Asclepias tuberosa L. caused normal human skin fibroblasts to proliferate. This fraction contained 21 pregnane glycosides whose structures were established using NMR spectroscopic analysis and chemical evidence. The aglycones of most of these compounds were identified as 8,12;8,20-diepoxy-8,14-secopregnanes, such as tuberogenin or 5,6-didehydrotuberogenin, the same aglycones as constituents of the aerial parts of this plant. Some of these compounds also caused proliferation of skin fibroblasts. Copyright © 2011 Elsevier Ltd. All rights reserved.

Morfologia do trato digestório e dieta de larvas de Bryconamericus aff. iheringii (Boulenger, 1887 (Osteichthyes, Characidae = Morphology of Digestive tract and diet of Bryconamericus aff. iheringii larvae (Boulenger, 1887 (Osteichthyes, Characidae

Directory of Open Access Journals (Sweden)

Renato Ziliani Borges

2006-01-01

Full Text Available Este trabalho teve como objetivo analisar alguns aspectos da alimentação de larvas de Bryconamericus aff. iheringii, capturadas nos meses de julho e novembro de 2001, nas regiões limnética e litorânea do reservatório de Santa Maria, rio Piquiri, Estado do Paraná. As larvas apresentaram boca subterminal durante todo o seu desenvolvimento. O tubo digestório se diferenciou em estômago e intestino apenas no estágio de pós-flexão. As larvas consumiram, principalmente, algas e microcrustáceos, o que permitiu caracterizá-las como planctófagas. A intensa modificação morfológica no trato digestório nos indivíduos em pósflexão coincidiu com o aumento na abundância de algas em relação aos itens de origemanimal; porém, de forma geral, a ocorrência aumentou para todos os itens. A análise do grau de digestão dos itens alimentares sugeriu que indivíduos em pré-flexão alimentaram-se, possivelmente, durante o dia, e os mais desenvolvidos, durante o entardecer e no períodonoturno.The aim of this study was to analyze some feeding treats of Bryconamericus aff. iheringii larvae, sampled in both the limnetic and littoral regions of the Piquiri River, in Santa Maria reservoir, between July and November 2001. The larvae presented sub-terminal mouth in larval period. The digestive tract differentiated in terms of stomach and intestine only in the postflexion larvae. The larvae fed mainly on algae and microcrustacea allowing to characterize them as planktivorous. The intense morphologic shift in the digestive tract in the postflexion larvae coincided with an increase in the abundance of algae in relation to animals items; however, in general, all the items had their occurrence increased. Analysis of the digestion stage suggested that preflexion larvae, possibly, fed themselves during the day, and those more developed, at dusk and night.

Measuring VaR of Discounted Cash Flows. Application to a Business Case Medición del valor en riesgo de los flujos de caja descontados. Aplicación a un caso empresarial

Directory of Open Access Journals (Sweden)

Jenny Moscoso Escobar

2009-12-01

Full Text Available This article seeks to appropriate a Cash Flow at Risk –CFAR- model from the literature developed in the research of Postgraduate, Measuring Value at Risk of Discounted Cash Flow for the Colombian Firm not listed on the stock market and apply it to a non-financial firm at the real sector, which specifies the operational and macroeconomic variables as random results, in a process of statistical modeling by Monte Carlo simulation approach structured in order to measure the variation in future cash flows discounted by a risk-adjusted rates for applications such as toolmaking decisions through the CFaR.A partir de la literatura existente se pretende mostrar el modelo de Flujo de Caja en Riesgo (CFaR, desarrollado en la investigación titulada, “Medición del valor en riesgo de los flujos de caja descontados para la empresa colombiana que no cotiza en bolsa”. Al mismo tiempo, aplicarlo a una empresa no financiera del sector real, con especificación de las variables operacionales y macroeconómicas como resultados aleatorios, en un proceso de modelado estadístico por medio del enfoque de Simulación Montecarlo Estructurado. El objetivo es medir la posible variación de los flujos de caja futuros descontados, a través de una tasa ajustada por riesgo, para aplicarla como herramienta de toma de decisiones con base en el CFaR.

Geomorphologic and sedimentologic controls on records of flood-induced alluviation in Las Cajas National Park, Ecuador

Science.gov (United States)

Rodbell, D. T.; Bustamante, M. G.; Marks, S.; Abbott, M. B.; Moy, C. M.

2017-12-01

The sediment record from Laguna Pallcacocha in Las Cajas National Park, southern Ecuador (4060 masl; 2°46'S; 79°14'W) has been interpreted to record El Niño floods spanning the Holocene (Rodbell et al., 1999; Moy et al., 2002). The sediment record is unusual for the nearly continuous dark- and light-colored laminations (0.1-2.0 cm thick) that comprise the Holocene. Light laminae typically have erosive basal contacts and fine-upwards, whereas dark laminae possess abrupt or gradational lower contacts and reveal no grain size trends. Light laminae contain 7%), and contain 3-10% biogenic silica. Light laminae represent deposition during periods of increased precipitation, mobilization of unvegetated sediment above the lake, and increased stream discharge, all of which generate density-driven undercurrents. Conversely, dark laminae are deposited relatively slowly by sedimentation of organic matter, some derived from surface soil horizons. Time series analysis of light laminae reveal the ENSO spectral signature (2-8 yr) that evolves through the Holocene. However, none of the sediment cores taken from many nearby lakes reveal an alluvial record comparable in terms of frequency and magnitude to that preserved in Pallcacocha thus raising questions as to the factors responsible for the rich stratigraphy preserved in Pallcacocha, and, moreover, the regional paleoclimatic significance of the Pallcacocha record. A review of lacustrine sediment cores obtained from Las Cajas National Park suggests that drainage basin factors are the primary control on the sedimentologic signal recorded. These factors include bedrock geology, presence of unvegetated sediment exposed on slopes, connectivity of exposed sediment to primary inflow streams, drainage basin slope, drainage basin:lake surface area ratio, and position of lake in paternoster sequence of lakes. Bedrock is comprised of Quaternary silicic ignimbrite, rhyolite, and andesite of the Tarqui Formation. Ignimibrite provides the

Identificación de tubérculos andinos (Oxalis tuberosa, Ullucus tuberosus y Tropaeolum tuberosum) : mediante caracteres anatómicos y exomorfológicos

OpenAIRE

Melchiorre, Pedro

1985-01-01

p.141-153 Se determinan las diferencias morfológicas entre los tubérculos de oca (Oxalis tuberosa Molina), ulluco (Ullucus tuberosus Loz.) y añu (Tropaeolum tuberosum Ruiz et Pav.) provenientes del noroeste argentino (provincias de Salta y Jujuy). El estudio de su anatomía y su morfología externa reveló caracteres útiles para el reconocimiento de esas especies tanto a través de materiales actuales como arqueológicos. Se describen los caracteres aludidos y se presenta una clave para la dete...

The physical, chemical and functional characterization of starches from Andean tubers: oca (Oxalis tuberosa Molina), olluco (Ullucus tuberosus Caldas) and mashua (Tropaeolum tuberosum Ruiz & Pavón)

OpenAIRE

Valcárcel-Yamani, Beatriz; Rondán-Sanabria, Gerby Giovanna; Finardi-Filho, Flavio

2013-01-01

The physical, chemical, and functional properties of starches isolated from the Andean tubers oca (Oxalis tuberosa M.), olluco (Ullucus tuberosus C.) and mashua (Tropaeolum tuberosum R. & P.) were studied. The tubers were obtained from a local grocery. The morphology of the starch granules (size and shape) was studied with scanning electron microscopy (SEM), which revealed ellipsoid, oval, conical, pear-shaped and prismatic forms: ellipsoids and oval granules with lengths up to 54.30 µm in oc...

Superação da dormência de sementes de umbuzeiro (Spondias tuberosa, Arr. Câm. utilizando diferentes métodos Overcoming dormancy of 'umbuzeiro' seeds (Spondias tuberosa, Arr. Câm. by using different methods

Directory of Open Access Journals (Sweden)

Paulo Sérgio Nascimento Lopes

2009-09-01

Full Text Available Vários frutos de espécies nativas da região semiárida possuem grande potencial de comercialização, dentre eles destaca-se o umbuzeiro (Spondias tuberosa, Arr. Câmara. Entretanto, cultivos comerciais desta espécie são limitados pela dificuldade da obtenção de mudas, em função principalmente da dormência de suas sementes. Desta forma, o objetivo do presente estudo foi avaliar os métodos de superação de dormência da semente de umbuzeiro, visando a promover incrementos nas taxas de germinação, uniformidade e vigor das plântulas. Foram montados dois experimentos independentes. Os tratamentos do primeiro experimento foram: testemunha, imersão dos pirênios em água por 24 horas, imersão dos pirênios em solução de ácido giberélico com 1.000 mg/L por 24 horas, escarificação dos pirênios com ácido sulfúrico PA por 10 minutos e escarificação mecânica. No segundo experimento, os tratamentos consistiram em se plantar os pirênios com 0; 30; 60; 90; 120; 150; 180 e 210 dias de armazenados em sacos de papel sob condições de laboratório, a uma temperatura média de 22,5C° e umidade relativa do ar média de 65%. No primeiro estudo, constatou-se que houve efeito significativo dos métodos de superação de dormência, sendo que escarificação mecânica foi o que apresentou os melhores resultados, com uma taxa de germinação média aos 60 dias pós-plantio de 26,6%. Já no segundo, as sementes armazenadas influenciaram positivamente na germinação e no vigor da plântula. Os melhores resultados para uniformidade e porcentagem de germinação (83% foram obtidos entre 120 e 210 dias de armazenamento das sementes, enquanto para o comprimento e massa fresca da radícula e hipocótilo foram entre 120 e 150 dias.Several fruits of native species of semi-arid region have great potential for commercialization, and among them there is the Spondias tuberosa. However, commercial cultivation of this species is limited by the

Efecto de extractos de la esponja calcarea Leucetta aff. floridana sobre el ciclo de líneas celulares leucemoides Effect of extracts from the calcareous sponge Leucetta aff. floridana on the cell cycle of leukemoid cell lines

Directory of Open Access Journals (Sweden)

Diana Margarita Márquez Fernández

2012-12-01

Full Text Available Introducción: la esponja Leucetta aff. floridana produce compuestos con actividad antiproliferativa diferencial en células tumorales de pulmón y mama, la cual no ha sido explorada en otras líneas tumorales y se desconoce si su potencial antiproliferativo está relacionado con la progresión de células a través del ciclo celular. Objetivo: evaluar el potencial antiproliferativo, anticlonogénico y el efecto sobre el ciclo celular de los extractos hexánico y metanólico de la esponja Leucetta aff. floridana del Caribe colombiano en las líneas celulares leucemoides Jurkat y K562. Métodos: la viabilidad y proliferación celular se determinaron mediante el ensayo de azul de tripano a 0, 24, 48, 72 y 96 h. La eficiencia de clonación y el efecto sobre el ciclo celular se evaluaron a 10 y 100 µg/mL. Los datos se analizaron usando ANOVA multifactorial y la prueba Tukey. Resultados: el extracto hexánico presentó actividad antiproliferativa en ambas líneas celulares siendo Jurkat más sensible que K562, lo cual se corroboró con los ensayos de clonogenicidad. Este extracto también mostró un efecto de acumulación de células Sub-G1 dependiente de la dosis, el cual fue diferencial entre las dos líneas celulares. La duración del tratamiento con el extracto hexánico no fue significativa para las células K562 pero sí para la línea celular Jurkat. Además, el porcentaje de acumulación de las células Sub-G1 fue mayor para células K562 comparado con Jurkat. El extracto metanólico presentó un efecto antiproliferativo similar al hexánico, pero fue más potente con la menor concentración (10 µg/mL en la clonogenicidad de K562. El efecto sobre el ciclo celular, también fue similar al hexánico, pero la duración del tratamiento no fue significativa en la acumulación de células en Sub-G1. Conclusiones: los resultados muestran el potencial diferencial de los extractos sobre el ciclo celular de las líneas leucemoides evaluadas

La norma en lo cotidiano del mobiliario de la Caja del Seguro Obrero Obligatorio

Directory of Open Access Journals (Sweden)

Alicia Campos Gajardo

2016-08-01

Full Text Available El presente artículo intenta exponer cómo el diseño participa de una configuración de la realidad desde una dimensión político administrativa, siendo incluido desde una perspectiva moderna, expresada en la construcción de una imagen normada de lo cotidiano. El caso de estudio presentado es el de la Caja del Seguro Obrero Obligatorio, o la historia de cómo a partir de la concepción de una institucionalidad vinculada al Estado asistencialista de la primera mitad del siglo XX, y de su correspondiente estructura administrativa, se construye una nueva realidad, sin precedente, donde la protección de la vida y el despliegue de los instrumentos requeridos convocan un correlato en arquitectura, vestuario y diseño de mobiliario, una realidad “otra” que se desarrolla o se desenvuelve y dispersa en el territorio, a partir de una concepción abstracta inicial, y que repercute en expresiones de diseño de extraordinaria calidad y personalidad.

La importancia del ciclo de caja y cálculo del capital de trabajo en la gerencia PYME

Directory of Open Access Journals (Sweden)

Jorge Iván Jiménez Sánchez

2014-01-01

Full Text Available  El artículo aborda las finanzas en la pyme moderna, la cual necesita de un gerente dinámico y hábil en la gestión administrativa, la información contable y las finanzas, con conocimiento de los días necesarios para cubrir el ciclo de caja y el capital que se requiere para operar a corto plazo, calculo necesario para determinar si va a alcanzar el dinero o si va a necesitar financiación y su valor exacto. Las cifras de fracaso de las pymes en América Latina son abrumadoras, ochenta por ciento de ellas quiebran en menos de cinco años gran parte debido a la mala gestión, se requiere una administración que incluso piense en cómo fortalecer la empresa, con sistemas como el Leasing, el factoring o la triangulación, en Colombia se habla incluso de crear un mercado de capitales y de un mercado alternativo bursátil para la pyme.Palabras Clave: Gerencia pyme; ciclo de caja; capital de trabajo; Mecanismos de financiación; mercados de capitales.AbstractThe importance of cash cycle and calculation of working capital management in smesThe article discusses the modern SME finance, which needsa dynamic and skilled manager in administrative management, the accounting and finance, with knowledge of the days needed to cover the cash cycle and the capital required to operate in the short term, calculation necessary to determine if you have enough money or if you will need financing and its exact value, failure figures of SMEs in Latin America are overwhelming, eighty percent of them go bankrupt in less than five years largely due to poor management, management is required to even think about how to strengthen the company with systems such as leasing, factoring or triangulation, in Colombia there is even talk of creating a capital market and an alternative stock market for SMEs.Keywords: Management SME cash cycle; working capital; financing mechanisms; capital markets. 

Fibroma desmoplásico de mandíbula asociado a esclerosis tuberosa: Revisión de la literatura y presentación de un caso Desmoplastic fibroma of the jaw associated with tuberous sclerosis: Literature review and case report

Directory of Open Access Journals (Sweden)

M. Acosta Feria

2008-04-01

Full Text Available La esclerosis tuberosa es una anomalía congénita del desarrollo embrionario que se transmite de forma autosómica dominante caracterizada por la presencia por trastornos neurológicos, cutáneos o dermatológicos, y retraso mental. Se pueden afectar otros órganos y sistemas, y dar manifestaciones orofaciales. La lesión a nivel del esmalte dental constituye la lesión intraoral más frecuente. Rara vez se pueden encontrar lesiones óseas en los maxilares. El fibroma desmoplásico es un infrecuente tumor fibroso intraóseo localmente agresivo de lento crecimiento, que se asocia muy rara vez a la esclerosis tuberosa. Presentamos el caso clínico de un paciente de 33 años afecto de esclerosis tuberosa con una lesión en la mandíbula diagnosticada como fibroma desmoplásico. Se discuten los métodos diagnósticos, presentación clínica y tratamiento.Tuberous sclerosis is a congenital anomaly of embryonic development with an autosomal dominant inheritance. It is characterized by the presence of neurologic and dermatologic disorders and mental retardation. It can affect other organs and systems and produce orofacial manifestations. Dental enamel defects are the most frequent intraoral lesion. Bone lesions rarely occur in the upper jaw. Desmoplastic fibroma is an infrequent, slow-growing, locally aggressive intraosseous fibrous tumor that rarely is associated with tuberous sclerosis. We report the clinical case of a 33-year-old man with tuberous sclerosis and a jaw lesion diagnosed as desmoplastic fibroma. The diagnostic methods, clinical presentation, and treatment are discussed.

Planeamiento estratégico de las cajas municipales de ahorro y crédito de la Región Junín

OpenAIRE

Corilla Ruiz, Mariella; Julcarima Iñigo, Gilmar; Meneses Galindez, Carolina; Rodríguez Rivera, Franchesca

2017-01-01

La presente tesis desarrolla un planeamiento estratégico, con el propósito de que las Cajas Municipales de Ahorro y Crédito de la región Junín, se mantengan para el año 2022 como líderes del sector microfinanciero dentro de esta región, mediante la generación de soluciones financieras eficientes y eficaces basadas en incrementar la inclusión y educación financiera, la responsabilidad social y el cuidado del medio ambiente. Así mismo, el presente trabajo tiene por finalidad aume...

Efeito dos conservantes sobre a densidade calórica em músculos de Hoplias aff. malabaricus (Bloch, 1794 (Osteichthyes, Erythrinidae Effect of preservatives on caloric density in the muscles of Hoplias aff. malabaricus (Bloch, 1794 (Osteichthyes, Erythrinidae

Directory of Open Access Journals (Sweden)

Milena Morimoto

2002-05-01

Full Text Available A conservação de amostras para a determinação dos valores calóricos em estudos de bioenergética de peixes tem se apresentado, na literatura, com uma variedade de métodos. Com o intuito de identificar o efeito de conservantes sobre os resultados obtidos com as diferentes técnicas de conservação, foram coletados exemplares adultos de Hoplias aff. malabaricus (Osteichthyes, Erythrinidae na planície de inundação do rio Paraná. De cada exemplar, foram retiradas 5 amostras da musculatura, as quais foram submetidas aos seguintes tratamentos: formol (4%, álcool (70%, congelamento (-10oC, nitrogênio líquido (-180oC e estufa à 60oC (amostra controle. Depois de 30 dias, todas as amostras foram secas em estufa à 60oC e posteriormente procedeu-se à determinação calórica de cada uma das amostras em bomba calorimétrica. Detectaram-se diferenças significativas entre os tratamentos (ANOVA: N=206; F=50,28; pThe preservation of samples for caloric values determination in bioenergetic studies of fish has been presented literature with a variety of methods. To identify the effect of preservatives over the results obtained with different preservation techniques, adult individuals of Hoplias aff. malabaricus (Osteichthyes, Erythrinidae were collected in Paraná river floodplain. From each fish, five samples were extracted from its dorsal muscle and submitted each sample for a different treatment: ice (-10ºC, formaldehyde (4%, alcohol (70%, liquid nitrogen (-180oC and a control sample immediately oven dried (60oC. After 30 days, the treatments were oven dried (60oC and caloric values of each sample were determined in a caloric bomb. Significant differences among the treatments were found (ANOVA: n = 206; F = 50.28; p < 0.001. Some evaluations of the effects of each treatment were presented for further comparisons with the results published in literature.

De Cajas de Ahorro a sociedades capitalistas y Fundaciones un nuevo enfoque en la gestión y aplicación de la Obra Social

OpenAIRE

Aranda Ruiviejo, Antonio Carlos; Sotomayor Morales, Eva

2017-01-01

El presente trabajo se ha desarrollado con la finalidad de analizar las estrategias emprendidas por las nuevas Fundaciones surgidas tras el proceso de reestructuración del sector de las Cajas de Ahorro para garantizar la sostenibilidad de la Obra Social que anteriormente venían realizando estas entidades. Para ello se realiza un estudio de carácter descriptivo y explorativo que comprende un horizonte temporal de diez años y en el que se contrastan planteamientos anteriores y posteriores a los...

Origins of domestication and polyploidy in oca (Oxalis tuberosa : Oxalidaceae): nrDNA ITS data.

Science.gov (United States)

Emshwiller, E; Doyle, J

1998-07-01

As part of a study aimed at elucidating the origins of the octoploid tuber crop "oca," Oxalis tuberosa, DNA sequences of the internal trancribed spacer of nuclear ribosomal DNA (nrDNA ITS) were determined for oca and several wild Oxalis species, mostly from Bolivia. Phylogenetic analysis of these data supports a group of these species as being close relatives of oca, in agreement with morphology and cytology, but at odds with traditional infrageneric taxonomy. Variation in ITS sequences within this group is quite low (0-7 substitutions in the entire ITS region), contrasting with the highly divergent (unalignable in some cases) sequences within the genus overall. Some groups of morphologically differentiated species were found to have identical sequences, notably a group that includes oca, wild populations of Oxalis that bear small tubers, and several other clearly distinct species. The presence of a second, minor sequence type in at least some oca accessions suggests a possible contribution from a second genome donor, also from within this same species group. ITS data lack sufficient variation to elucidate the origins of oca precisely, but have identified a pool of candidate species and so can be used as a tool to screen yet unsampled species for possible progenitors.

Evaluation of Anti-Inflammatory Properties of Isoorientin Isolated from Tubers of Pueraria tuberosa

Directory of Open Access Journals (Sweden)

Kotha Anilkumar

2017-01-01

Full Text Available Inflammation is the major causative factor of different diseases such as cardiovascular disease, diabetes, obesity, osteoporosis, rheumatoid arthritis, inflammatory bowel disease, and cancer. Anti-inflammatory drugs are often the first step of treatment in many of these diseases. The present study is aimed at evaluating the anti-inflammatory properties of isoorientin, a selective cyclooxygenase-2 (COX-2 inhibitor isolated from the tubers of Pueraria tuberosa, in vitro on mouse macrophage cell line (RAW 264.7 and in vivo on mouse paw edema and air pouch models of inflammation. Isoorientin reduced inflammation in RAW 264.7 cell line in vitro and carrageenan induced inflammatory animal model systems in vivo. Cellular infiltration into pouch tissue was reduced in isoorientin treated mice compared to carrageenan treated mice. Isoorientin treated RAW 264.7 cells and animals showed reduced expression of inflammatory proteins like COX-2, tumor necrosis factor-α (TNF-α, interleukin-6 (IL-6, 5-lipoxygenase (5-LOX, and interleukin 1-β (IL-1-β both in vitro and in vivo. The antioxidant enzyme levels of catalase and GST were markedly increased in isoorientin treated mice compared to carrageenan treated mice. These results suggest that isoorientin, a selective inhibitor of COX-2, not only exerts anti-inflammatory effects in LPS induced RAW cells and carrageenan induced inflammatory model systems but also exhibits potent antioxidant properties.

EL SISTEMA DE PENSIONES DE MARRUECOS: SOSTENIBILIDAD ACTUARIAL DE LA CAJA NACIONAL DE SEGURIDAD SOCIAL

Directory of Open Access Journals (Sweden)

José Enrique Devesa Carpio

2015-09-01

Full Text Available El trabajo analiza, desde el punto de vista actuarial, la sostenibilidad de la Caja Nacional de Seguridad Social de Marruecos, que es un régimen contributivo que incorpora tanto a trabajadores por cuenta ajena como por cuenta propia. Para ello se llevan a cabo casi 2000 simulaciones, a partir de individuos tipo definidos en función de las peculiaridades del sistema. Además de estudiar la situación actual se analiza el efecto de la reforma que se pretende aplicar al sistema. La conclusión principal es la insostenibilidad actuarial del mismo. The paper analyzes, from the actuarial point of view, the sustainability of the National Social Security Fund in Morocco, which is a contributory scheme that incorporates both employees and self-employed. To do this, almost 2000 simulations are conducted, from different type of individuals defined according to the peculiarities of the system. In addition to studying the current situation, the effect of the reform intended to apply to the system will be analyzed. The main conclusion is the actuarial unsustainability of the system.

Dolarización, caja de conversión o tipo de cambio flexible. ¿Opciones para América Latina hoy?

Directory of Open Access Journals (Sweden)

Esmeralda Villegas

2002-01-01

Full Text Available El objetivo del presente artículo es el de describir las diferentes opciones de regímenes cambiarios para los mercados emergentes de América Latina; que van desde el tipo de cambio fijo, al flexible; con sus variantes como son la Caja de Conversión y la dolarización de la economía, en el contexto actual caracterizado por situaciones de persistente volatilidad de capital y crisis cambiaria. Se concluye que existen hoy más argumentos en contra de establecer durante mucho tiempo regímenes de tipo de cambio fijo, no solamente debido a las distorsiones y costos de la sobrevaluación de la moneda nacional, sino también por los costos que entraña su abandono, asimismo habría que sopesar los argumentos en contra de una excesiva flexibilidad que devendría en volatilidad del tipo de cambio; para ello cabe dar un espacio a que la autoridad pública intervenga, dando con su intervención una señal del tipo de cambio real que se considera conveniente, y reafirmar la importancia de desalentar los flujos de capitales externos especulativos. Se destaca con respecto a la proposición de la Caja de Conversión o de la Dolarización que son alternativas que privilegian la estabilidad monetaria, sacrificando otros objetivos macroeconómicos como el de la producción, el comercio, el empleo. Por lo cual es necesario actuar sobre determinantes fundamentales como son la disciplina fiscal, el avance en las reformas económicas; impulsando el progreso tecnológico que consiste en hacer más eficiente los procesos productivos a través de la inversión en tecnologías de punta.

GOBERNANZA MULTIFIDUCIARIA DE STAKEHOLDERS: ANÁLISIS COMPARADO DE LA EFICIENCIA DE BANCOS Y CAJAS DE AHORROS. / MULTIFIDUCIARY GOVERNANCE OF STAKEHOLDERS: A COMPARATIVE ANALYSIS OF THE EFFICIENCY OF BANKS AND SAVING BANKS.

Directory of Open Access Journals (Sweden)

Jose Luis RETOLAZA

2012-05-01

Full Text Available Las cajas de ahorros Españolas son posiblemente el caso más significativo a nivel mundial de entidades multistakeholders, no sólo por su misión, sino también en su gobernanza. La teoría multifiduciaria de los stakeholders plantea, al menos de forma teórica lo que en las cajas de ahorros ha sido una realidad por más de un siglo. Así, las cajas se convierten en un “caso de laboratorio” para analizar la viabilidad e idoneidad de una gobernanza participada por el conjunto de stakeholders de la organización. Nuestra hipótesis es que la gobernanza multistakeholder, así como la orientación hacia los stakeholders, generan un planteamiento estratégico diferente, no centrado en los beneficios. Por tanto, la gobernanza multifiduciaria puede perfectamente ser más ineficiente en relación con indicadores económico-financieros referidos a los shareholders de una entidad. Sin embargo, estas entidades deberían ser más eficientes si se tienen en cuenta indicadores relacionados con la generación de valor social. Con el fin de contrastar la eficiencia relativa hemos utilizando la población de bancos y cajas de España y los datos de 2009, utilizando la técnica de Análisis Envolvente de Datos con objeto de comparar la eficiencia económica, social y global de ambos tipos de entidades. Los resultados indican una diferenciación significativa entre estos dos grupos de entidades financieras en relación con la eficiencia social y económica, si bien no ocurre lo mismo cuando se utiliza la eficiencia global –económica más social-. Por lo que podemos concluir que la eficiencia en la gestión entre inputs y outputs en cajas de ahorros y bancos es similar. / Probably, Spanish savings banks are the most significant worldwide multistakeholders entities, not only because of their mission, but also in their governance. The stakeholder multifiduciary theory, establishes at least theoretically what the saving banks has been a reality for more than

Feeding of Hoplias aff. malabaricus (Bloch, 1794 and Oligosarcus robustus Menezes, 1969 in a lagoon under estuarine influence, Pelotas, RS

Directory of Open Access Journals (Sweden)

Fabiano Corrêa

2009-09-01

Full Text Available The objective of the present paper was to study the diets of Hoplias aff. malabaricus and Oligosarcus robust in “Pequena Lagoon” and evaluate the importance of estuarine organisms in the feeding of freshwater fish. A total of twelve food categories were identified and it was established that the fish resource was the most frequent in the diet of both species. Euryhaline fish such as Mugil platanus mullets and Odontesthes argentinensis silversides were common items in the diets of these two species, which included not only freshwater fish but also euryhaline fish from the adjacent estuarine zone, integrating both resources in the food chain.

Composición química de “oca” (Oxalis tuberosa), ‘arracacha’ (Arracaccia xanthorriza) y ‘tarwi’ (Lupinus mutabilis). Formulación de una mezcla base para productos alimenticios

OpenAIRE

Sandra Elizabeth Pagador Flores; Misael Ydilbrando Villacorta González; María Elena León Marroú

2011-01-01

El presente trabajo tuvo como objetivo formular una mezcla base a partir de cultivos nativos, la cual una vez estandarizada, se constituye en materia prima de alto valor nutricional para su utilización en la elaboración de productos alimenticios como: purés, papillas y productos de panificación, entre otros. Se seleccionaron tres cultivos andinos: un tubérculo, “oca” (Oxalis tuberosa); una raíz, ‘arracacha’ (Arracaccia xanthorriza) y una leguminosa, ‘tarwi’ (Lupinus mutabilis). Se realizaron ...

Modeling natural photic entrainment in a subterranean rodent (Ctenomys aff. knighti, the Tuco-Tuco.

Directory of Open Access Journals (Sweden)

Danilo E F L Flôres

Full Text Available Subterranean rodents spend most of the day inside underground tunnels, where there is little daily change in environmental variables. Our observations of tuco-tucos (Ctenomys aff. knighti in a field enclosure indicated that these animals perceive the aboveground light-dark cycle by several bouts of light-exposure at irregular times during the light hours of the day. To assess whether such light-dark pattern acts as an entraining agent of the circadian clock, we first constructed in laboratory the Phase Response Curve for 1 h light-pulses (1000lux. Its shape is qualitatively similar to other curves reported in the literature and to our knowledge it is the first Phase Response Curve of a subterranean rodent. Computer simulations were performed with a non-linear limit-cycle oscillator subjected to a simple model of the light regimen experienced by tuco-tucos. Results showed that synchronization is achieved even by a simple regimen of a single daily light pulse scattered uniformly along the light hours of the day. Natural entrainment studies benefit from integrated laboratory, field and computational approaches.

Spongicoloides sp. aff. a Spongicoloides galapagensis (Decapoda: Stenopodidea: Spongicolidae: una nueva especie para la carcinofauna chilena y primer registro de un estenopodido en aguas del margen continental de Chile Spongicoloides sp. aff. to Spongicoloides galapagensis (Decapoda: Stenopodidea: Spongicolidae: a new species for Chilean carcinofauna and the first record of aStenopodid for the Chilean margin

Directory of Open Access Journals (Sweden)

Guillermo L Guzmán

2011-11-01

Full Text Available Se cita por primera vez para el margen continental de Chile una especie de camarón Stenopodidae, asociado a una esponja hexactinelida. Los especímenes fueron recolectados en dos sitios de Chile central (31°12'S, 71°52'W y 36°00'S, 73°38'W; 922 a 1000 m de profundidad. Las esponjas estaban adheridas al sustrato con probable origen en emanaciones de metano. Spongicoloides sp. aff. a S. gala-pagensis, es el primer registro de la familia en aguas del margen continental del Pacífico suroriental. Los ejemplares coinciden con los rangos de la variación morfológica de S. galapagensis, no obstante difieren en el número de branquias descrito.This is the first record of a species of Stenopodid shrimp along the Chilean margin, associated with a hexactinellid sponge. The specimens were collected at two sites in central Chile (31°12'S, 71°52'W and 36°00'S, 73°38'W; 922 to 1000 m depth. The sponges were attached to the substrate with probable origins in methane seepage. Spongicoloides sp. aff. to S. galapagensis constitutes the first record of the family for the eastern south Pacific continental margin. The specimens coincide with the ranges of morphological variation of S. galapagensis, although they differ in the number of brachia described.

Colección, caracterización y conservación de variabilidad genética de Oca (Oxalis Tuberosa Mol) en agroecosistemas paramunos del departamento de Nariño-Colombia

OpenAIRE

Rosero Alpala, María Gladys

2010-01-01

La oca es uno de los recursos fitogenéticos conservados aun en Colombia por comunidades indígenas. El propósito de este trabajo, por tanto, fue Conocer y conservar la variabilidad genética de Oxalis tuberosa Mol. en agroecosistemas páramunos del Departamento de Nariño (Colombia). Utilizando técnicas de investigación acción-participativa, se realizaron visitas a los resguardos para identificar zonas productoras en los municipios ubicados sobre los 2.500 msnm hasta las áreas de distribución fit...

Cocción de alimentos en Bogotá empleando una cocina solar tipo caja

Directory of Open Access Journals (Sweden)

Silvio Alejandro Jiménez Castellanos

2015-10-01

Full Text Available Este artículo tiene como objetivo presentar el campo transitorio de temperaturas de una cocina solar tipo caja básica (sin aditamentos tales como: doble acristalamiento, reflectores internos, reflectores externos, línea de alivio de vapor, entre otros; diseñada para las condiciones meteorológicas promedio anuales de Bogotá – Colombia, con el fin de determinar sí con este dispositivo es posible cocinar en esta ciudad. La metodología utilizada comprendió tres fases: el desarrollo de un modelo físico – matemático del proceso de calentamiento, con base en balances de energía para cada uno de los componentes: vidrio, tapa de recipiente, recipiente, absorbedor, pared y fluido, la realización de un experimento computacional en el software Autodesk Algor Simulation y la comparación de los resultados. La temperatura final del agua obtenida por el modelo físico - matemático fue de 81.85 ℃ y la máxima obtenida con la simulación térmica fue de 79.60 ℃. De los resultados se puede concluir que en la ciudad de Bogotá D.C no es posible cocinar con un dispositivo de esta clase.

Food flora in 17th century Northeast region of Brazil in Historia Naturalis Brasiliae.

Science.gov (United States)

Medeiros, Maria Franco Trindade; Albuquerque, Ulysses Paulino

2014-06-25

This article reports historical ethnobotany research conducted from a study of the work Historia Naturalis Brasiliae (Natural History of Brazil), authored by Piso and Marcgrave and published in 1648, with main focus on Caatinga of northeast region of Brazil. Focusing the content analysis on the section dedicated to plant species with multiple uses, Marcgrave's contribution to the aforementioned work, this research had the following objectives: the retrieval of 17th century knowledge about the food uses of the flora in the northeast region of Brazil, including the taxonomic classifications; the identification of plant parts, their modes of consumption and the ethnic group of consumers; and the verification of the use of these species over time. The use of 80 food species at the time of the publication of the work is indicated, some of which are endemic to the Caatinga, such as "umbu" (Spondias tuberosa Arruda), "mandacaru" (Cereus jamacaru DC.) and "carnauba" (Copernicia cerifera Mart.). It is noticeable that among the species listed by Marcgrave, some species still lack current studies indicating their real nutritional value. The present study is an unprecedented work because it introduces, in a systematic way, the food plants described in a study of 17th century Brazil. Finally, this study makes information about plants consumed in the past accessible, aiming to provide material for studies that could develop new food products today.

Evaluación del desempeño de cajas portátiles de procesamiento radiográfico en la filtración de luz

OpenAIRE

Ferreira Costa, André Luis; Montebello-Filho, Agenor; Ambrosano Bovi, Glaucia; Ortega Villalobos, Ana Isabel

2006-01-01

Este estudio evaluó el desempeño de cajas portátiles de procesamiento radiográfico (CPR) a través del efecto de la luz filtrada por el acrílico empleado en la construcción de las mismas, sobre la densidad base-velamiento (DBV) de radiografías intrabucales. Fueron expuestas a los rayos X, películas radiográficas en conjunto con una lámina de plomo de 4mm de espesor para obtener un área no sensibilizada a la radiación en la radiografía resultante y así determinar la DBV. Posteriormente, las pel...

Diseño de un sistema experto para el análisis de créditos en la Caja Municipal de Arequipa de la ciudad de Puno 2007

OpenAIRE

Albarracin Machicado, Rudy Shernell

2008-01-01

La presente investigación implementa un Sistema Experto de Evaluación de Créditos en la entidad microfinanciera Caja Municipal Arequipa de la ciudad de Puno, empresa dedicada al servicio crediticio, que busca disminuir el riesgo de pago al capital asignado; para tal objetivo se planteo el modelo basado en Sistemas Expertos que permite soportar estas decisiones de asignación de recursos financieros. Para el análisis crediticio, se implementó la base de conocimientos y las reglas de inferencia ...

Huellas digitales de cepas de Acinetobacter baumannii procedentes de pacientes hospitalizados en la Caja Petrolera de Salud de Obrajes, mediante el método de Pulsed Field Gel Electrophoresis (PFGE, La Paz, Bolivia. Marzo 2015

Directory of Open Access Journals (Sweden)

García-Rada Giovanni

2017-08-01

Full Text Available Acinetobacter baumannii, worldwide is considered an opportunistic microorganism, present in several cases of hospital-acquired infections. In the Caja Petrolera de Salud of Obrajes Hospital was made the isolation of four Acinetobacter baumannii strains. Identification was confirmed by biochemical tests. Then, the PFGE molecular technique was applied for the identification of genomic fingerprints using Apa I restriction en-zyme.

Prestamista de Última Instancia y Cajas de Conversión bajo Crisis Bancarias: "Inestabilidad Endógena" en un Modelo de Equilibrios Múltiples (El Caso de Argentina a Fines de 2001

Directory of Open Access Journals (Sweden)

Flavio E. Buchieri

2008-12-01

Full Text Available El presente trabajo intenta mostrar los ajustados límites que los arreglos de tipo Currency Board tienen a la hora de actuar como prestamista de última instancia que, en caso de producirse una corrida bancaria, puede llevar a las autoridades monetarias de un país a la difícil elección entre sostener al sistema bancario vs. el arreglo cambiario elegido, fruto del incremento en la inestabilidad del propio sistema bancario. Esta situación persiste aún en casos como el argentino donde su Caja de Conversión, instaurada en Abril de 1991, mostraba límites más flexibles que versiones más ortodoxas, dados por la propia conformación del backing de su base monetaria. La situación antes comentada permite plantear una hipótesis objeto de análisis y verificación empírica: cómo afecta al sistema financiero (esto es, el incremento en la inestabilidad del mismo cuando se dota a la autoridad monetaria de un país de una capacidad limitada de emisión de dinero para cubrir el rol de prestamista de última instancia ante una crisis bancaria bajo un contexto de Caja de Conversión no ortodoxa.

El costo de capital y su incidencia en los métodos de flujo de caja descontados

Directory of Open Access Journals (Sweden)

Gustavo A. Pérez

2012-06-01

Full Text Available Un estudio de factibilidad técnico económico en cualquier rama de la ingeniería o en cualquier tipo de negocio, implica conocer una medida de la rentabilidad del emprendimiento. Actualmente, nadie discute que para una toma de decisión fundamentada se deben utilizar los métodos de flujo de caja descontados (DCF, a pesar de que persisten otras formas muy difundidas (por ejemplo: período de repago, relación beneficio/costo. El objetivo del trabajo es analizar críticamente los métodos a utilizar para evaluar proyectos mutuamente excluyentes, como también proponer formas alternativas de análisis de rentabilidad que contemplen la incidencia de las distintas tasas y acoten la decisión de un modo adecuado. La propuesta presentada aquí permite ordenar alternativas excluyentes con criterios que contengan una visión mas completa. El resultado más interesante está relacionado con la sensibilidad de los métodos sobre las variables de decisión inherentes a estos.Palabras clave: DCF, costo de capital; proyectos excluyentes; rentabilidad de proyectos.

Regeneración in vitro de brotes de Polianthes tuberosa L. a partir de yemas vegetativas de la inflorescencia y de tejido de cormo

Directory of Open Access Journals (Sweden)

Fanny Hernández-Mendoza

2014-01-01

Full Text Available Polianthes tuberosa L. es una planta endémica de México, comercialmente se cultiva para flor de corte, y, además, es utilizada en la industria farmacéutica y del perfume. Tradicionalmente, los productores la propagan utilizando los cormos, lo que ha ocasionado que el cultivo presente poca variabilidad genética y posiblemente, por esta razón solo se conocen cultivares con flores blancas. Con base en lo anterior el objetivo de la presente investigación consistió en establecer la metodología práctica y competitiva para propagar in vitro Polianthes tuberosa L. Las yemas y pequeños segmentos de tejido de cormo fueron colocadas sobre la superficie del medio de cultivo, base GC (comunicación personal Guillermo Carrillo con las sales inorgánicas del medio de cultivo Murashige y Skoog (1962 por litro, 50 mL de agua de coco, 20 g de sacarosa, 6.4 g de agar y el pH fue ajustado a 5.7. Con este medio básico se prepararon medios de cultivo que contenían bencilaminopurina (BAP, ácido naftalenacético (ANA, ácido 2,4-diclorofenoxiacético (2,4-D, ácido indolacético (AIA, y cinetina. La formación de brotes que dieron origen a las plántulas ocurrió mediante, la regeneración directa de la yema floral la cual al crecer forma sólo una plántula y a partir del tejido de la base de la yema, de esta región se obtuvieron hasta seis brotes por yema en el medio que contiene BAP, 4.5 mg y ANA, 0.1 mg, del cual la regeneración de brotes fue mayor (56.1 %. En el caso de cormo el problema fue la contaminación llegando en algunos casos hasta el 100 % de los cultivos. Es de resaltar la importancia de poder lograr la regeneración masiva in vitro de plantas de nardo a partir de yemas florales.

Feeding and morphological analysis of the digestive tract of four species of fish (Astyanax altiparanae, Parauchenipterus galeatus, Serrasalmus marginatus and Hoplias aff. malabaricus from the upper Paraná River floodplain, Brazil

Directory of Open Access Journals (Sweden)

D. Peretti

Full Text Available The present study is inspired by the great wealth of species exhibited by the ichthiofauna. Not only concepts and techniques of ecology deserve attention, but also knowledge in other biological areas, such as zoology and anatomy, are necessary. The intention of the present work is to discover the morphology of fish through the study of the digestive tract morphology, associating it to diet data, in order to better understand the biology of four fish species of the upper Paraná River floodplain. The samples were collected quarterly in the year 2000 with gillnets of different meshes. The stomach content was analyzed under a stereoscopic microscope and the frequencies of occurrence (FO and volumetric (FV and the alimentary index (IAi were calculated. Various morphologic characteristics were analyzed and schematized using a light chamber. The species were grouped into two trophic guilds - insectivores (Astyanax altiparanae and Parauchenipterus galeatus and piscivores (Serrasalmus marginatus and Hoplias aff. malabaricus. The first two, although consumers of insects, preyed on different alimentary groups, notably Hymenoptera in the case of A. altiparanae and Coleoptera in the case of P. galeatus. Serrasalmus marginatus and H. aff. malabaricus consumed mainly fishes. However, only pieces of prey were usually found in the stomach content of the first species, whereas whole fishes were found in the stomach content of the second. Astyanax altiparanae exhibited characteristics that allowed it to obtain food in several compartments of the water column. Similarly P. galeatus consumed food resources that were available in all aquatic compartments, although the abilities to capture, to manipulate and to absorb food differed, as shown by the importance of teeth plates and pharyngeal teeth. Serrasalmus marginatus and H. aff. malabaricus, although resembling each other in many aspects of the digestive tract morphology, differed in the strategies used to capture

Finansiell Bootstrapping i SME : en kvantitativ studie om hur ett starkt socialt och affärsmässigt nätverk påverkar valet av bootstrappingmetoder

OpenAIRE

Nilsson, Ida; Sacic, Zehra

2016-01-01

Syftet med denna kandidatuppsats är se hur ett starkt socialt och affärsmässigt nätverk påverkar valet av bootstrappingmetoder i små och medelstora företag (SME). Detta eftersom SME står för 99,9 procent av samtliga företag på den svenska marknaden och därmed är betydelsefulla för landets ekonomiska tillväxt och sysselsättning. Däremot möter SME svårigheter vid extern finansiering av sin verksamhet. SME kompenserar detta genom att engagera sig i olika ”bootstrappingaktiviteter”. Bootstrapping...

EFECTO DE LA COLOCACIÓN DE DISPOSITIVOS ELÁSTICOS DE HULE, EN LAS MANOS SUPERIORES DEL RACIMO DE BANANO, SOBRE LA CONFORMACIÓN DE LA MANO, EL RECHAZO DE FRUTOS Y LA RELACIÓN CAJAS-RACIMO

Directory of Open Access Journals (Sweden)

Alfonso Vargas

2012-01-01

rechazo de frutos, en especial aquellos correspondientes a frutos deformes o a lesiones por el roce entre ellos durante su crecimiento en el racimo (cicatriz de crecimiento, no fueron afectados por el uso o no de la BEH en ninguno de los experimentos en donde ello se evaluó. El número de cajas obtenidas a partir de las 5 manos superiores del racimo no permitió definir la superioridad entre el uso o no de la BEH.

Large scale artificial rearing of Anastrepha sp.1 aff. fraterculus (Diptera: Tephritidae in Brazil

Directory of Open Access Journals (Sweden)

Julio Marcos Melges Walder

2014-08-01

Full Text Available Some species of the genus Anastrepha (Diptera: Tephritidae are successfully managed by matching the sterile insect technique with parasitoid releases. Such strategies used in integrated pest management can be implemented only where insect mass-rearing programs are feasible. In this study, we show the process of domestication, rearing technology and quality control data obtained from 54 generations of Anastrepha sp.1 aff. fraterculus (Wiedemann, 1830 kept under fully artificial conditions. Eggs were collected by an artificial oviposition panel consisting of one side of the cage made of blue voile fabric externally covered with a thin layer of silicon rubber. They were then air-bubbled in water at 25 ºC for 48 h before seeding. Larvae were reared on the regular laboratory artificial diet with 66 % of agar reduction turning over a semi-liquid diet, which reduced costs and improved insect quality. The adult and larval diets were composed of local ingredients including hydrolyzed yeast. When large-scale production of this fly is contemplated, the critical stage is larval development. This system of artificial rearing for A. fraterculus sp.1 developed in Brazil, allows for the production of a large number of insects of excellent quality using local ingredients and less agar in diet composition than the original medium used for this species. By reducing the interval of egg collection, the system might be optimized in terms of insect yield and, therefore, meet the demands of A. fraterculus sp.1 with regard to integrated pest management purposes.

Correlation, by multivariate statistical analysis, between the scavenging capacity against reactive oxygen species and the bioactive compounds from frozen fruit pulps

Directory of Open Access Journals (Sweden)

Lizziane Cynara Vissotto

2013-02-01

Full Text Available The contents of total phenolic compounds (TPC, total flavonoids (TF, and ascorbic acid (AA of 18 frozen fruit pulps and their scavenging capacities against peroxyl radical (ROO•, hydrogen peroxide (H2O2, and hydroxyl radical (•OH were determined. Principal Component Analysis (PCA showed that TPC (total phenolic compounds and AA (ascorbic acid presented positive correlation with the scavenging capacity against ROO•, and TF (total flavonoids showed positive correlation with the scavenging capacity against •OH and ROO• However, the scavenging capacity against H2O2 presented low correlation with TF (total flavonoids, TPC (total phenolic compounds, and AA (ascorbic acid. The Hierarchical Cluster Analysis (HCA allowed the classification of the fruit pulps into three groups: one group was formed by the açai pulp with high TF, total flavonoids, content (134.02 mg CE/100 g pulp and the highest scavenging capacity against ROO•, •OH and H2O2; the second group was formed by the acerola pulp with high TPC, total phenolic compounds, (658.40 mg GAE/100 g pulp and AA , ascorbic acid, (506.27 mg/100 g pulp contents; and the third group was formed by pineapple, cacao, caja, cashew-apple, coconut, cupuaçu, guava, orange, lemon, mango, passion fruit, watermelon, pitanga, tamarind, tangerine, and umbu pulps, which could not be separated considering only the contents of bioactive compounds and the scavenging properties.

Extraction and partial characterization of venom from the Colombian spider Pamphobeteus aff. nigricolor (Aranae:Theraphosidae).

Science.gov (United States)

Estrada-Gomez, Sebastian; Vargas Muñoz, Leidy Johana; Quintana Castillo, Juan C

2013-12-15

We report the first studies of characterization and extraction of the Pamphobeteus aff. nigricolor (Pocock, 1901) (Aranae:Theraphosidae) venom done in Colombia using the electro-stimulation technique previous anesthesia with isofluorane. After each extraction process, a low viscosity, colorless venom was obtained. This venom showed a 1.01 mg/μl density and a pH of 5. The humidity percentage did not show a significance difference between males and females (P > 0.05) with a general media of 77.49 ± 1.74%. In all cases the venom yielded was variable between males and females, with a media of 22.45 ± 5.17 mg (wet weight) and 4.58 ± 0.94 mg (dry weigh), obtaining larger amounts in females, 28.34 ± 7.49 mg and 5.69 ± 1.36 (wet and dry weight respectively). Venom showed a hemolytic activity dependent of enzymatic active phospholipase and neither coagulant nor proteolytic activities were observed. Electrophoretic profile showed a main protein content with a molecular mass below 14 kDa. RP-HPLC venom profile revealed a difference among male and female venom's content where 17 and 21 main fractions were obtained respectively. Three peptides, Theraphotoxin-Pn1a, Theraphotoxin-Pn1b and Theraphotoxin-Pn2a, were identified using HPLC-nESI-MS/MS. These peptides showed a high identity with other peptides found on Theraphosides which are proved to affect voltage-gated calcium channels. Copyright © 2013 Elsevier Ltd. All rights reserved.

Pulsed electric field processing reduces the oxalate content of oca (Oxalis tuberosa) tubers while retaining starch grains and the general structural integrity of tubers.

Science.gov (United States)

Liu, Tingting; Burritt, David John; Eyres, Graham T; Oey, Indrawati

2018-04-15

The aims of this research were to investigate if pulsed electric field (PEF) treatments caused cellular/structural alterations in Oxalis tuberosa (oca) tubers and if PEF treatment could reduce tuber oxalate levels. Whole oca tubers were treated with PEF at different electric field strengths up to 1.2 kV/cm. PEF treatments above 0.5 kV/cm caused tubers to soften, but differences in the electrical properties of the tuber tissues led to an uneven PEF effect with the tuber inner cores softening more than the middle regions. Cell viability tests confirmed the unevenness of the PEF effect, however PEF caused no changes in overall tuber/tissue structure. Even at high electric field strengths the cell remained largely intact and most starch grains were retained within the cells. Despite the retention of starch, PEF treatment reduced tuber oxalate contents by almost 50% in some tissues and could potentially aid the development of low oxalate oca-based foods. Copyright © 2017 Elsevier Ltd. All rights reserved.

Genetic diversity of the Andean tuber-bearing species, oca (Oxalis tuberosa Mol.), investigated by inter-simple sequence repeats.

Science.gov (United States)

Pissard, A; Ghislain, M; Bertin, P

2006-01-01

The Andean tuber-bearing species, Oxalis tuberosa Mol., is a vegetatively propagated crop cultivated in the uplands of the Andes. Its genetic diversity was investigated in the present study using the inter-simple sequence repeat (ISSR) technique. Thirty-two accessions originating from South America (Argentina, Bolivia, Chile, and Peru) and maintained in vitro were chosen to represent the ecogeographic diversity of its cultivation area. Twenty-two primers were tested and 9 were selected according to fingerprinting quality and reproducibility. Genetic diversity analysis was performed with 90 markers. Jaccard's genetic distance between accessions ranged from 0 to 0.49 with an average of 0.28 +/- 0.08 (mean +/- SD). Dendrogram (UPGMA (unweighted pair-group method with arithmetic averaging)) and factorial correspondence analysis (FCA) showed that the genetic structure was influenced by the collection site. The two most distant clusters contained all of the Peruvian accessions, one from Bolivia, none from Argentina or Chile. Analysis by country revealed that Peru presented the greatest genetic distances from the other countries and possessed the highest intra-country genetic distance (0.30 +/- 0.08). This suggests that the Peruvian oca accessions form a distinct genetic group. The relatively low level of genetic diversity in the oca species may be related to its predominating reproduction strategy, i.e., vegetative propagation. The extent and structure of the genetic diversity of the species detailed here should help the establishment of conservation strategies.

Morfologia do trato digestório e dieta de larvas de Bryconamericus aff. iheringii (Boulenger, 1887 (Osteichthyes, Characidae - DOI: 10.4025/actascibiolsci.v28i1.1059 Morphology of Digestive tract and diet of Bryconamericus aff. iheringii larvae (Boulenger, 1887 (Osteichthyes, Characidae - DOI: 10.4025/actascibiolsci.v28i1.1059

Directory of Open Access Journals (Sweden)

Keshiyu Nakatani

2006-03-01

Full Text Available Este trabalho teve como objetivo analisar alguns aspectos da alimentação de larvas de Bryconamericus aff. iheringii, capturadas nos meses de julho e novembro de 2001, nas regiões limnética e litorânea do reservatório de Santa Maria, rio Piquiri, Estado do Paraná. As larvas apresentaram boca subterminal durante todo o seu desenvolvimento. O tubo digestório se diferenciou em estômago e intestino apenas no estágio de pós-flexão. As larvas consumiram, principalmente, algas e microcrustáceos, o que permitiu caracterizá-las como planctófagas. A intensa modificação morfológica no trato digestório nos indivíduos em pós-flexão coincidiu com o aumento na abundância de algas em relação aos itens de origem animal; porém, de forma geral, a ocorrência aumentou para todos os itens. A análise do grau de digestão dos itens alimentares sugeriu que indivíduos em pré-flexão alimentaram-se, possivelmente, durante o dia, e os mais desenvolvidos, durante o entardecer e no período noturnoThe aim of this study was to analyze some feeding treats of Bryconamericus aff. iheringii larvae, sampled in both the limnetic and littoral regions of the Piquiri River, in Santa Maria reservoir, between July and November 2001. The larvae presented sub-terminal mouth in larval period. The digestive tract differentiated in terms of stomach and intestine only in the postflexion larvae. The larvae fed mainly on algae and microcrustacea allowing to characterize them as planktivorous. The intense morphologic shift in the digestive tract in the postflexion larvae coincided with an increase in the abundance of algae in relation to animals items; however, in general, all the items had their occurrence increased. Analysis of the digestion stage suggested that preflexion larvae, possibly, fed themselves during the day, and those more developed, at dusk and night

Synergism between sodium chloride, sucrose and tricalcium phosphate in the osmotic dehydration of oca (Oxalis tuberosa with and without chitosan coating

Directory of Open Access Journals (Sweden)

José Arroyo Portal

2010-12-01

Full Text Available We investigated the synergistic effect of three solutes (sodium chloride, sucrose, tricalcium phosphate in different combinations of concentration, on the moisture, solid gain and calcium gain in oca (Oxalis tuberosa with and without chitosan (CR and SR. In both cases applied the Simplex with Extended Centroid mixture design. Were used cylinders of oca of 0.9 cm of diameter and 3.4 cm of length. The kinetics of moisture, solid gain and calcium gain for 48 hours was evaluated. The effective diffusivity of water, solids and calcium was determined. We found that in samples CR is greater loss of water and less solid gain compared with SR samples mainly as sodium chloride or sucrose participate independently, while for the gain of calcium, in all cases, the CR samples gain more of calcium than SR samples. The effective diffusivities found are: water, 1.19E-09 m2 /s in samples CR and 1.34E-09 m2 /s in SR samples; for solid, 3.67E-09 m2 /s in samples CR and 5.43E-09 m2 /s in SR samples; and, for calcium 3.32E-11 m2 /s in samples CR and 1.57E-09 m2 /s in SR samples.

Composición química de “oca” (Oxalis tuberosa, ‘arracacha’ (Arracaccia xanthorriza y ‘tarwi’ (Lupinus mutabilis. Formulación de una mezcla base para productos alimenticios

Directory of Open Access Journals (Sweden)

María Elena León Marroú

2011-12-01

Full Text Available El presente trabajo tuvo como objetivo formular una mezcla base a partir de cultivos nativos, la cual una vez estandarizada, se constituye en materia prima de alto valor nutricional para su utilización en la elaboración de productos alimenticios como: purés, papillas y productos de panificación, entre otros. Se seleccionaron tres cultivos andinos: un tubérculo, “oca” (Oxalis tuberosa; una raíz, ‘arracacha’ (Arracaccia xanthorriza y una leguminosa, ‘tarwi’ (Lupinus mutabilis. Se realizaron por triplicado análisis bromatológicos, de minerales y vitaminas. Se formularon 8 mezclas bases a diferentes proporciones de cultivos nativos. Se seleccionó la mezcla base identificada como M7 en proporción 1:1:2 (oca:arracacha:tarwi por presentar mayor valor nutricional.

Composición química de “oca” (Oxalis tuberosa, ‘arracacha’ (Arracaccia xanthorriza y ‘tarwi’ (Lupinus mutabilis. Formulación de una mezcla base para productos alimenticios

Directory of Open Access Journals (Sweden)

Sandra Elizabeth Pagador Flores

2011-01-01

Full Text Available El presente trabajo tuvo como objetivo formular una mezcla base a partir de cultivos nativos, la cual una vez estandarizada, se constituye en materia prima de alto valor nutricional para su utilización en la elaboración de productos alimenticios como: purés, papillas y productos de panificación, entre otros. Se seleccionaron tres cultivos andinos: un tubérculo, “oca” (Oxalis tuberosa; una raíz, ‘arracacha’ (Arracaccia xanthorriza y una leguminosa, ‘tarwi’ (Lupinus mutabilis. Se realizaron por triplicado análisis bromatológicos, de minerales y vitaminas. Se formularon 8 mezclas bases a diferentes proporciones de cultivos nativos. Se seleccionó la mezcla base identificada como M7 en proporción 1:1:2 (oca:arracacha:tarwi por presentar mayor valor nutricional.

Osteology of a new specimen of Macrocnemus aff. M. fuyuanensis (Archosauromorpha, Protorosauria) from the Middle Triassic of Europe: potential implications for species recognition and paleogeography of tanystropheid protorosaurs

Science.gov (United States)

Jaquier, Vivien P.; Fraser, Nicholas C.; Furrer, Heinz; Scheyer, Torsten M.

2017-11-01

Over the past two decades, a wealth of marine and terrestrial reptiles, including protorosaurian archosauromorphs, has been described from Triassic shales and limestone layers in southern China. Recovered from the eastern margin of the Tethys Ocean, these forms often show remarkable similarities to taxa that were previously known and described from Europe, i.e., the western Tethyan margin. One protorosaurian that is known from the western and the eastern Tethyan province is the genus Macrocnemus, with currently three recognized species: 1) M. bassanii from the Middle Triassic Besano Formation and Meride Limestone (late Anisian – early Ladinian), UNESCO World Heritage Site Monte San Giorgio, Ticino, Switzerland; 2) M. obristi from the Prosanto Formation (early Ladinian) of the Ducan area, Grisons, Switzerland; and 3) M. fuyuanensis from the Falang Formation (Ladinian), Yunnan Province, southern China. Recently a new specimen, PIMUZ T 1559, from the upper Besano Formation at Meride, Ticino, Switzerland, was prepared, revealing a disarticulated skeleton which includes most of the cranium and lower jaw, pre-caudal vertebral column and ribs, the forelimbs, and girdle elements. Unambiguously assignable to the genus Macrocnemus, it evinces particularly gracile elongated cervical ribs, as well as a humerus/radius ratio that is comparable only to that of M. fuyuanensis from southern China. Based on this feature we tentatively recognize the new specimen as M. aff. fuyuanensis from Europe. The position and exquisite preservation of the clavicle and interclavicle in this specimen allows a revision of the shoulder girdle of Macrocnemus when articulated, which also has implications for closely related protorosaurian taxa, such as the long-necked Tanystropheus. Furthermore, differences in the shape and morphology of the interclavicle including pointed wing-like lateral processes and a short, fusiform caudal process represent rare discrete characters that allow separation of the

Osteology of a New Specimen of Macrocnemus aff. M. fuyuanensis (Archosauromorpha, Protorosauria from the Middle Triassic of Europe: Potential Implications for Species Recognition and Paleogeography of Tanystropheid Protorosaurs

Directory of Open Access Journals (Sweden)

Vivien P. Jaquier

2017-11-01

Full Text Available Over the past two decades, a wealth of marine and terrestrial reptiles, including protorosaurian archosauromorphs, has been described from Triassic shales and limestone layers in southern China. Recovered from the eastern margin of the Tethys Ocean, these forms often show remarkable similarities to taxa that were previously known and described from Europe, i.e., the western Tethyan margin. One protorosaurian that is known from the western and the eastern Tethyan province is the genus Macrocnemus, with currently three recognized species: (1 Macrocnemus bassanii from the Middle Triassic Besano Formation and Meride Limestone (late Anisian–early Ladinian, UNESCO World Heritage Site Monte San Giorgio, Ticino, Switzerland; (2 Macrocnemus obristi from the Prosanto Formation (early Ladinian of the Ducan area, Grisons, Switzerland; and (3 Macrocnemus fuyuanensis from the Falang Formation (Ladinian, Yunnan Province, southern China. Recently a new specimen, PIMUZ T 1559, from the upper Besano Formation at Meride, Ticino, Switzerland, was prepared, revealing a disarticulated skeleton which includes most of the cranium and lower jaw, pre-caudal vertebral column and ribs, the forelimbs, and girdle elements. Unambiguously assignable to the genus Macrocnemus, it evinces particularly gracile elongated cervical ribs, as well as a humerus/radius ratio that is comparable only to that of M. fuyuanensis from southern China. Based on this feature we tentatively recognize the new specimen as M. aff. fuyuanensis from Europe. The position and exquisite preservation of the clavicle and interclavicle in this specimen allows a revision of the shoulder girdle of Macrocnemus when articulated, which also has implications for closely related protorosaurian taxa, such as the long-necked Tanystropheus. Furthermore, differences in the shape and morphology of the interclavicle including pointed wing-like lateral processes and a short, fusiform caudal process represent rare

Simultaneous production of intracellular triacylglycerols and extracellular polyol esters of fatty acids by Rhodotorula babjevae and Rhodotorula aff. paludigena.

Science.gov (United States)

Garay, Luis A; Sitepu, Irnayuli R; Cajka, Tomas; Cathcart, Erin; Fiehn, Oliver; German, J Bruce; Block, David E; Boundy-Mills, Kyria L

2017-10-01

Microbial oils have been analyzed as alternatives to petroleum. However, just a handful of microbes have been successfully adapted to produce chemicals that can compete with their petroleum counterparts. One of the reasons behind the low success rate is the overall economic inefficiency of valorizing a single product. This study presents a lab-scale analysis of two yeast species that simultaneously produce multiple high-value bioproducts: intracellular triacylglycerols (TG) and extracellular polyol esters of fatty acids (PEFA), two lipid classes with immediate applications in the biofuels and surfactant industries. At harvest, the yeast strain Rhodotorula aff. paludigena UCDFST 81-84 secreted 20.9 ± 0.2 g L -1 PEFA and produced 8.8 ± 1.0 g L -1 TG, while the yeast strain Rhodotorula babjevae UCDFST 04-877 secreted 11.2 ± 1.6 g L -1 PEFA and 18.5 ± 1.7 g L -1 TG. The overall glucose conversion was 0.24 and 0.22 g (total lipid) g (glucose) -1 , respectively. The results present a stable and scalable microbial growth platform yielding multiple co-products.

VALORACIÓN DE INMUEBLES COMERCIALES MEDIANTE LA APLICACIÓN DEL MÉTODO DE CAPITALIZACIÓN DIRECTA Y EL MÉTODO DE FLUJOS DE CAJA DESCONTADOS

Directory of Open Access Journals (Sweden)

Alejandro Vargas Sanchez

2017-01-01

Full Text Available En el presente documento se exponen los conceptos relacionados con la valoración de Inmuebles Comerciales. El objetivo principal fue la determinación del valor de este tipo de bienes raíces mediante la aplicación de dos métodos: el primero Capitalización Directa y el segundo Flujos de Caja Descontados, para ambos métodos fue necesario estimar la Utilidad Operativa Neta por concepto del arrendamiento que percibe el propietario del inmueble, un aspecto importante en la investigación fue la determinación de la tasa de capitalización la cual fue calculada a partir de información primaria recabada sobre el arrendamiento por metro cuadrado y el valor de mercado de inmuebles comparables en la ciudad de La Paz. Los resultados alcanzados mediante ambos métodos de valoración presentaron diferencias que se explican principalmente porque se utilizaron diferentes tasas de crecimiento en las utilidades esperadas.

Efeito do ácido indolbutírico e raizon no enraizamento de estacas herbáceas e lenhosas de umbuzeiro = Effect of indolbutiric acid and raizon in the rooting of herbaceous and hardwoody cuttings of umbu tree

Directory of Open Access Journals (Sweden)

Luciane Arantes de Paula

2007-07-01

Full Text Available O umbuzeiro pode ser propagado assexuadamente, mas poucas informações se tem de que a espécie pode ser propagada por estaquia. Diante disso, o objetivo do trabalho foi avaliar o efeito de diferentes concentrações de AIB (ácido indolbutírico e do Raizon 05® no enraizamento de estacas herbáceas e lenhosas de umbuzeiro. Utilizou-se o delineamento experimental em bloco ao acaso, com quatro concentrações de AIB (0; 500; 1000 e 2000 mg L-1 e uma de Raizon 05® e dois tipos de estacas (herbácea e lenhosa. As estacas foramtratadas com Metiltiofan (Thiophanate methyl a 0,05% i.a. por um minuto, em seguida foram imersas nas soluções de AIB por dez minutos ou em contato com Raizon 05®. Realizou-se o plantio em tubetes plásticos contendo vermiculita média. O material permaneceu em telado com 50% de redução de luz, com nebulização intermitente. As variáveis analisadas foram: porcentagem de sobrevivência, enraizamento e massa seca das raízes. Pode-se concluir que: as estacas lenhosas apresentaram melhores resultados em relação às estacas herbáceas para a sobrevivência; o maior percentual de enraizamento foi verificado em estacas herbáceas com a aplicação de 500 mg L-1 de AIB, proporcionando33,33% de estacas enraizadas.The umbu tree can be propagated assexually, but few information are had that the species can be propagation by cutting. The objective of the present research was to evaluate the effect of different concentrations of IBA (indolbutiric acid and Raizon 05® in the rooting of cuttings herbaceous and hardwoody of umbu tree. The experimental design used was block at random, with four concentrations of IBA (0; 500; 1000 and 2000 mg L-1 and one of Raizon 05® and two types of cuttings (herbaceous and hardwoody. After the treatment of the cuttings with Metiltiofan (Thiophanate methyl a 0,05% i.a. for one minute, these were immersed in the solutions of IBA by ten minutes, or in contact with Raizon 05®, soon afterwards took

Proposal of a monitoring program of occupational exposure by incorporation of radioactive material for nuclear medicine services in the Caja Costarricense del Seguro Social

International Nuclear Information System (INIS)

Badilla Segura, Mirta

2013-01-01

A monitoring program of the occupational exposure by incorporation of radioactive material is proposed. Nuclear medicine services of the Caja Costarricense del Seguro Social (CCSS) are evaluated. The monitoring program is based on the provisions of the International Atomic Energy Agency and of study of nuclear medicine services of the CCSS. Radionuclides are determined for monitoring of the occupational exposure, according to the radioactive material that is worked in nuclear medicine services of the CCSS. The appropriate and alternative techniques are established for the monitoring of the occupational exposure by incorporation of radioactive material, depending on the type of radionuclide that is worked in nuclear medicine services. The worker occupationally exposed (TOE) should be subject of monitoring and how often should be realized the monitoring of the occupational exposure. The monitoring of the radiation by radioactive material must be applied to personnel working in radiopharmacies and the worker has carried out therapeutic procedures for handling of significant amounts of 13 1 I. The calculation of the committed effective dose is proposed by incorporation of radioactive material with the TOE [es

Nutritional value of dual-purpose wheat genotypes pastures under grazing by dairy cows

Directory of Open Access Journals (Sweden)

Mauricio Pase Quatrin

2017-07-01

Full Text Available In the south of Brazil, one of the major limitations to milk production is the low forage availability during autumn and early winter. The use of dual-purpose wheat genotypes is one alternative to minimize the impact of low forage availability in addition to produce grains. Therefore, this study aimed to evaluate the nutritional value of two dual-purpose wheat genotypes (BRS Tarumã and BRS Umbu. Structural composition and forage nitrogen uptake were evaluated. The nutritional value of the forage was analyzed for mineral matter (MM, organic matter (OM, neutral detergent fiber (NDF, crude protein (CP, total digestible nutrients (TDN, in situ organic matter digestibility (ISOMD and in situ dry matter digestibility (ISDMD. Differences in NDF (49.03 vs. 46.44%, CP (24.4 vs. 27.4%, ISOMD (83.53 vs. 85.45%, ISDMD (83.59 vs. 86.65% and TDN (75.37 vs. 78.39 for BRS Umbu and BRS Tarumã genotypes were detected, respectively. The BRS Umbu genotype had a lower leaf blade proportion and forage nitrogen uptake. The dual-purpose wheat genotype BRS Tarumã was superior in nutritive value.

Morphological development of Corydoras aff. paleatus (Siluriformes, Callichthyidae and correlation with the emergence of motor and social behaviors

Directory of Open Access Journals (Sweden)

Daniel Rodríguez-Ithurralde

2014-06-01

Full Text Available Here we examine major anatomical characteristics of Corydoras aff. paleatus (Jenyns, 1842 post-hatching development, in parallel with its neurobehavioral evolution. Eleutheroembryonic phase, 4.3-8.8 days post-fertilization (dpf; 4.3-6.4 mm standard length (SL encompasses from hatching to transition to exogenous feeding. Protopterygiolarval phase (8.9-10.9 dpf; 6.5-6.7 mm SL goes from feeding transition to the commencement of unpaired fin differentiation, which marks the start of pterygiolarval phase (11-33 dpf; 6.8-10.7 mm SL defined by appearance of lepidotrichia in the dorsal part of the median finfold. This phase ends with the full detachment and differentiation of unpaired fins, events signaling the commencement of the juvenile period (34-60 dpf; 10.8-18.0 mm SL. Eleutheroembryonic phase focuses on hiding and differentiation of mechanosensory, chemosensory and central neural systems, crucial for supplying the larval period with efficient escape and nutrient detection-capture neurocircuits. Protopterygiolarval priorities include visual development and respiratory, digestive and hydrodynamic efficiencies. Pterygiolarval priorities change towards higher swimming efficacy, including carangiform and vertical swimming, necessary for the high social interaction typical of this species. At the end of the protopterygiolarval phase, simple resting and foraging aggregations are seen. Resting and foraging shoals grow in complexity and participant number during pterygiolarval phase, but particularly during juvenile period.

Modelización de la Estimulación Eléctrica Neuromuscular mediante un enfoque fisiológico y de caja negra

Directory of Open Access Journals (Sweden)

Elisa Piñuela-Martín

2016-07-01

Full Text Available Resumen: En el presente artículo se expone el diseño y validación de dos modelos de Estimulación Eléctrica Neuromuscular (E.E.N.M. para la relación entre parámetros de estimulación y características biomecánicas, siendo cada uno de ellos representativo de dos enfoques diferentes. Uno de ellos fisiológico simplificado, mientras que el otro es un modelo de caja negra basado en red neuronal, por lo que no incluye información sobre las características internas del sistema. En este artículo se exponen las características de cada uno, se describe el equipamiento utilizado y los experimentos para su identificación. Ambos modelos han sido identificados y validados en cinco sujetos sanos. El modelo fisiológico, a pesar de numerosas limitaciones encontradas, ha permitido el estudio en profundidad de los procesos internos y de la multitud de factores que involucran la activación muscular. El modelo en red neuronal, en cambio, presenta una buena precisión pero no proporciona conocimiento sobre los aspectos internos del sistema. Por ello, para una aplicación de control en la que sólo interesen las entradas y salidas del sistema, el modelo de caja negra es la mejor opción. Por otro lado, si se desea tener acceso a las variables internas del sistema neuromuscular bajo E.EN.M., es necesario realizar un análisis exhaustivo para la posterior mejora de las prestaciones del modelo fisiológico aquí presentado. Abstract: In this paper, a comparison and validation of two models of Neuromuscular Electrical Stimulation (NMES for the relationship between stimulation parameters and biomechanical characteristics is presented. Each model is representative of two opposite approaches: the first one is a physiological simplified model, while the second is a black-box model based on neural network, without information about the internal processes of muscle contraction under NMES. The features of each model, equipment used and the experiments are

Species of the Hoplias aff malabaricus complex (Characiformes: Erythrinidae: An investigation of coexistence in a Neotropical floodplain

Directory of Open Access Journals (Sweden)

Marília Hauser

2012-02-01

Full Text Available This study assessed the coexistence of three species of thraira present in the Upper Paraná River floodplain, using population structure as an investigation tool. The species were designated as: Hoplias sp. 1, introduced after the construction of the Itaipu reservoir, and Hoplias sp. 2 and Hoplias sp. 3, native species that have been identified as Hoplias aff. malabaricus. We tested the hypothesis that those species in fact differ from each other in respect of population abundance, sex ratio, relative frequency of adults and juveniles, length structure and weight-length relationship. Additionally, possible effects of the flood pulse on the first four of these parameters were investigated. Samples were collected quarterly from March 2006 to December 2007 from nine collection sites on the floodplain. Hoplias sp. 1 presented a greater balance of sex ratio and length structures over the seasons, as well as a higher allometric coefficient. The population attributes of Hoplias sp. 2 and Hoplias sp. 3 showed a high responsiveness to hydrological seasonality, indicating that these species exploit available resources in a conspicuous flood period with greater efficiency. These differences, beyond reflecting possible mechanisms that allow closely related species to coexist, indicate the importance of understanding the life strategies adopted by each species which, as part of a complex system, are considered key elements of the aquatic community structure in the region, providing important information for habitat management and biodiversity conservation.

A highly diverse trilobite fauna with Avalonian affinities from the Middle Cambrian Acidusus atavus Zone (Drumian Stage) of Bornholm, Denmark

DEFF Research Database (Denmark)

Weidner, Thomas; Nielsen, Arne Thorshøj

2014-01-01

? applanata, Acadagnostus aff. bulkurensis and Phalagnostus ovalis. A few faunal elements originally described from Bohemia and Australia are also present, viz. Hydrocephalus aff. carens, Phalagnostus nudus, Skryjagnostus pompeckji, Hypagnostus aff. clipeus, Euagnostus aff. interstrictus and Euagnostus? aff...

Mario Alberto Cajas Sarria (2015. La historia de la Corte Suprema de Justicia de Colombia, 1886-1991. Bogotá: Universidad de los Andes & Universidad ICESI

Directory of Open Access Journals (Sweden)

Michael Cruz Rodríguez

2017-06-01

Full Text Available El libro del profesor Mario Alberto Cajas Sarria, que es resultado de su tesis doctoral en derecho en la Universidad de los Andes, realiza una narración de la historia de la Corte Suprema de Justicia de Colombia desde su creación en 1886 hasta su validación a la Asamblea Nacional Constituyente de 1991. Para ello toma como elemento central decisiones judiciales que efectuaron control constitucional en cuatro temas que sirven de hilos conductores: los estados de excepción, las leyes por vicios de trámite, los tratados internacionales y las reformas a la constitución. Así, el trabajo no sólo se detiene en las categorías jurídicas que orbitan alrededor de estos tópicos sino que, a partir de las decisiones judiciales, de la prensa y de fuentes secundarias, ilumina el contexto político y los ambientes institucionales en los que la Corte Suprema ejerció el control de constitucionalidad en algunas coyunturas en la trayectoria del régimen político colombiano.

Estudio de factibilidad para la creación de una empresa dedicada a la producción y comercialización de cajas de cartón para calzado en los cantones de Gualaceo y Chordeleg en la provincia del Azuay

OpenAIRE

Peralta Sumba, Tatiana Priscila; Salazar Galarza, Edisson Javier

2015-01-01

En este proyecto se estudia la factibilidad para crear una empresa dedicada a la producción y comercialización de cajas de cartón para calzado y se determina la importancia que tendría la misma dentro de esta actividad en los cantones de Gualaceo y Chordeleg, además se desarrolla el punto de aporte que tiene la creación de empresas productivas para mejorar la matriz productiva del país. In this project we study the feasibility to create a company dedicated to the production and marketing o...

Tuberous Sclerosis

Science.gov (United States)

... National Institute of Neurological Disorders and Stroke (NINDS). Esclerosis tuberosa Order NINDS Publications Patient Organizations Child Neurology ... National Institute of Neurological Disorders and Stroke (NINDS). Esclerosis tuberosa Order NINDS Publications Definition Tuberous sclerosis (TSC) ...

Contribución al estudio cariológico del género Nepeta l. en la Península Ibérica

OpenAIRE

Ubera, Jose L.

1982-01-01

En el presente trabajo, se estudian cariológicamente 14 taxones del género Nepeta en la Península Ibérica. Son nuevos, al parecer, los siguientes números cromosómios: N. nepetella subsp. cordifolia, n = 17; N, nepetalla subsp. aragonensis, n = 17; N. amethystina subsp. mallophora, n= 17, 2n = 34; N. multibrateata, n = 9, 2n= 18; N. tuberosa subsp. tuberosa. n = 9,2n = 18; N. tuberosa subsp. reticulata, n = 9, 2n = 18; N. granatensis n = 18, 2n = 36; N. Latiha, n = 18; N. coerulea, n =...

Enhance performance of micro direct methanol fuel cell by in situ CO2 removal using novel anode flow field with superhydrophobic degassing channels

Science.gov (United States)

Liang, Junsheng; Luo, Ying; Zheng, Sheng; Wang, Dazhi

2017-05-01

Capillary blocking caused by CO2 bubbles in anode flow field (AFF) is one of the bottlenecks for performance improvement of a micro direct methanol fuel cell (μDMFC). In this work, we present a novel AFF structure with nested layout of hydrophilic fuel channels and superhydrophobic degassing channels which can remove most of CO2 from AFF before it is released to the fuel channels. The new AFFs are fabricated on Ti substrates by using micro photochemical etching combined with anodization and fluorination treatments. Performance of the μDMFCs with and without superhydrophobic degassing channels in their AFF is comparatively studied. Results show that the superhydrophobic degassing channels can significantly speed up the exhaust of CO2 from the AFF. CO2 clogging is not observed in the new AFFs even when their comparison AFFs have been seriously blocked by CO2 slugs under the same operating conditions. 55% and 60% of total CO2 produced in μDMFCs with N-serpentine and N-spiral AFF can be respectively removed by the superhydrophobic degassing channels. The power densities of the μDMFCs equipped with new serpentine and spiral AFFs are respectively improved by 30% and 90% compared with those using conventional AFFs. This means that the new AFFs developed in this work can effectively prevent CO2-induced capillary blocking in the fuel channels, and finally significantly improve the performance of the μDMFCs.

CONSTANT LEVERAGE AND CONSTANT COST OF CAPITAL: A COMMON KNOWLEDGE HALF-TRUTH

Directory of Open Access Journals (Sweden)

IGNACIO VÉLEZ-PAREJA

2008-01-01

Full Text Available Un enfoque típico para valorar flujos de caja finitos es suponer que el endeudamiento es constante (generalmente como un endeudamiento objetivo o deseado y que por tanto, el costo del patrimonio, Ke y el costo promedio ponderado de capital CPPC, también son constantes. Para los flujos de caja perpetuos, y con el costo de la deuda, Kd como la tasa de descuento para el ahorro en impuestos o escudo fiscal, Ke y el CPPC aplicado al flujo de caja libre FCL son constantes si el endeudamiento es constante. Sin embargo esto no es verdad para los flujos de caja finitos. En este documento mostramos que para flujos de caja finitos, Ke y por lo tanto el CPPC dependen de la tasa de descuento que se utiliza para valorar el ahorro en impuestos, AI y según lo esperado, Ke y el CPPC no son constantes con Kd como la tasa de descuento para el ahorro en impuestos, aunque el endeudamiento sea constante. Ilustramos esta situación con un ejemplo simple. Analizamos cinco métodos: el flujo de caja descontado, FCD, usando APV, el FCD y la formulación tradicional y general del CPPC, el valor presente del flujo de caja del accionista, FCA más deuda y el flujo de caja de capital, FCC.

New Host Record for Camponotophilus delvarei (Hymenoptera: Eurytomidae, a Parasitoid of Microdontine Larvae (Diptera: Syrphidae, Associated with the Ant Camponotus sp. aff. textor

Directory of Open Access Journals (Sweden)

Gabriela Pérez-Lachaud

2013-01-01

Full Text Available Microdontine syrphid flies are obligate social parasites of ants. Larvae prey on ant brood whereas adults live outside the nests. Knowledge of their interaction with their host is often scarce, as it is information about their natural enemies. Here we report the first case of parasitism of a species of microdontine fly by a myrmecophilous eurytomid wasp. This is also the first host record for Camponotophilus delvarei Gates, a recently described parasitic wasp discovered in Chiapas, Mexico, within the nests of the weaver ant, Camponotus sp. aff. textor Forel. Eleven pupal cases of a microdontine fly were found within a single nest of this ant, five of them being parasitized. Five adult C. delvarei females were reared from a puparium and 29 female and 2 male pupae were obtained from another one. The eurytomid is a gregarious, primary ectoparasitoid of larvae and pupae of Microdontinae, its immature stages developing within the protective puparium of the fly. The species is synovigenic. Adult females likely locate and parasitize their hosts within the ant nest. As some species of Microdontinae are considered endangered, their parasitoids are likewise threatened and in need of accurate and urgent surveys in the future.

The physical, chemical and functional characterization of starches from Andean tubers: oca (Oxalis tuberosa Molina, olluco (Ullucus tuberosus Caldas and mashua (Tropaeolum tuberosum Ruiz & Pavón

Directory of Open Access Journals (Sweden)

Beatriz Valcárcel-Yamani

2013-09-01

Full Text Available The physical, chemical, and functional properties of starches isolated from the Andean tubers oca (Oxalis tuberosa M., olluco (Ullucus tuberosus C. and mashua (Tropaeolum tuberosum R. & P. were studied. The tubers were obtained from a local grocery. The morphology of the starch granules (size and shape was studied with scanning electron microscopy (SEM, which revealed ellipsoid, oval, conical, pear-shaped and prismatic forms: ellipsoids and oval granules with lengths up to 54.30 µm in oca; with lengths up to 32.09 µm for olluco starch granules; and with predominantly truncated spherical or oval forms and smaller dimensions (up to 16.29 um for mashua starch granules. Amylose contents were similar among the samples: 27.60% (oca, 26.49% (olluco and 27.44% (mashua. Olluco starch had less swelling power, forming opaque, less firm gels. All three starch gels showed the same stability on refrigeration and presented high syneresis under freezing temperatures, with a variation of 40.28 to 74.42% for olluco starch. The starches cooked easily, with high peak viscosity. The low gelatinization temperatures and high stability during cooling make these starches suitable feedstock for use in formulations that require milder processing temperatures and dispense freezing storage.

The Incidence of Atypical Femoral Fractures in Patients with Rheumatic Disease: Yamagata Prefectural Committee of Atypical Femoral Fractures (YamaCAFe) Study.

Science.gov (United States)

Takakubo, Yuya; Ohta, Daichi; Ishi, Masaji; Ito, Juji; Oki, Hiroharu; Naganuma, Yasushi; Uno, Tomohiro; Sasaki, Akiko; Akabane, Takeru; Dairaku, Katsuyuki; Goto, Shinichi; Goto, Yasuo; Kanauchi, Yumiko; Kobayashi, Shinji; Nakajima, Taku; Masuda, Keiji; Matsuda, Michiharu; Mura, Nariyuki; Takenouchi, Kenji; Tsuchida, Hiroyuki; Onuma, Yasushi; Shibuya, Junichirou; Seino, Mitsuyoshi; Yamaguchi, Osamu; Hiragami, Ken; Urayama, Yasuhiro; Furukawa, Takashi; Okuda, Shouta; Ogura, Ken; Nakamura, Takeshi; Sasaki, Kan; Konta, Tsuneo; Takagi, Michiaki

2017-08-01

Atypical femoral fractures (AFFs) have been reported to occur with minimal or spontaneous subtrochanteric and femoral shaft fractures with a characteristic transverse pattern, compared with typical femoral fractures in young patients with high-energy trauma. AFFs are related to long-term use of bisphosphonates (BPs), glucocorticoids and rheumatic diseases. We have estimated a blind analysis of AFFs in rheumatic patients receiving BPs and glucocorticoids ordinary over a long time in all Yamagata prefectural area through radiographic examination. The 123 AFFs including suspected cases over six years were collected and reviewed by two independent orthopedic surgeons. We found 86 patients with a total of 99 AFFs between 2009 and 2014 (1.43 cases/100,000 person/year). Of these 99 AFFs, 11 were in 8 rheumatic patients including three patients with bilateral AFFs. The incidence of AFFs in rheumatic patients had trend to increase from 2012. The mean age of all 8 patients was 54.9 years. All 8 patients received BPs and 7/8 received prednisolone (PSL). The mean dose of PSL was 14 mg/day. Compared to patients with unilateral AFFs, those with bilateral AFFs in rheumatic patients were on a higher dose of PSL (20 mg/day vs. 7 mg/day) and had less femoral neck-shaft angle (129° vs. 136°, p rheumatic patients showed a trend to increase from 2012 to 2014 in Yamagata prefecture. Careful management of AFFs is of particular importance in rheumatic patients who have taken high doses of PSL and have small femoral neck-shaft angle.

Esker Ri Nursing Home, Kilnabinnia, Clara, Offaly.

LENUS (Irish Health Repository)

McKenna, Malachi

2017-03-01

Atypical femur fractures (AFFs) are associated with long-term bisphosphonate (BP) therapy. Early identification of AFF prior to their completion provides an opportunity to intervene, potentially reducing morbidity associated with these fractures. Single-energy X-ray absorptiometry (SE) is an imaging method recently shown to detect incomplete AFF (iAFF) prior to fracture completion.

Identifying Incomplete Atypical Femoral Fractures With Single-Energy Absorptiometry: Declining Prevalence

LENUS (Irish Health Repository)

McKenna, Malachi

2017-03-01

Atypical femur fractures (AFFs) are associated with long-term bisphosphonate (BP) therapy. Early identification of AFF prior to their completion provides an opportunity to intervene, potentially reducing morbidity associated with these fractures. Single-energy X-ray absorptiometry (SE) is an imaging method recently shown to detect incomplete AFF (iAFF) prior to fracture completion.

Isolation and biological activities of secondary metabolites from the sponges monanchora aff. arbuscula, aplysina sp. petromica ciocalyptoides and topsentia ophiraphidies, from the ascidian didemnum ligulum and from the octocoral carijoa riisei

International Nuclear Information System (INIS)

Kossuga, Miriam H.; Lira, Simone P. de; Nascimento, Andrea M.; Gambardella, Maria Teresa P.; Berlinck, Roberto G.S.; Torres, Yohandra R.; Nascimento, Gislene G.F.; Pimenta, Eli F.; Silva, Marcio; Thiemann, Otavio H.; Oliva, Glaucius; Tempone, Andre G.; Melhem, Marcia S.C.; Souza, Ana O. de; Galetti, Fabio C.S.; Silva, Celio L.; Cavalcanti, Bruno; Pessoa, Claudia O.; Moraes, Manoel O.; Hajdu, Eduardo; Peixinho, Solange; Rocha, Rosana M.

2007-01-01

The investigation of extracts from six species of marine invertebrates yielded one new and several known natural products. Isoptilocaulin from the sponge Monanchora aff. arbuscula displayed antimicrobial activity at 1.3 mg/mL against an oxacillin-resistant strain of Staphylococcus aureus. Five inactive known dibromotyrosine derivatives, 2 6, were isolated from a new species of marine sponge, Aplysina sp. The sponges Petromica ciocalyptoides and Topsentia ophiraphidites yielded the known halistanol sulfate A (7) as an inhibitor of the antileishmanial target adenosine phosphoribosyl transferase. The ascidian Didemnum ligulum yielded asterubin (10) and the new N,N-dimethyl-O-methylethanolamine (11). The octocoral Carijoa riisei yielded the known 18-acetoxypregna-1,4,20-trien-3-one (12), which displayed cytotoxic activity against the cancer cell lines SF295, MDA-MB435, HCT8 and HL60. (author)

Compromiso laboral y estrés en los empleados de Bancos y Cajas = Commitment and stress on employees in Banks

Directory of Open Access Journals (Sweden)

María Isabel Sánchez Hernández

2013-12-01

Full Text Available La crisis económica de los últimos años ha impactado especialmente en el sector financiero y se ha hecho sentir tanto en el estrés que soportan los empleados de las sucursales de bancos y cajas como en sus niveles de compromiso con la empresa. En este trabajo se analizan los componentes del compromiso laboral en una muestra de 102 trabajadores del sector de la banca confirmándose las dimensiones clásicas del modelo de Allen y Meyer (1996. La relación causal del compromiso con el estrés se testa con un modelo de ecuaciones estructurales dando por resultado que cuanto mayor es el compromiso de la plantilla, menores son los niveles de estrés. Como conclusión se señalan las medidas de gestión del capital humano que podrían mejorar los niveles de compromiso en este sector.The economic crisis of recent years has particularly impacted the financial sector. It has been felt in both, the stress endured by employees of banks and the levels of commitment to the company. In this paper the components of employee engagement are analyzed in a sample of 102 workers to confirm the classic dimensions from Allen y Meyer (1996 in banks workers. The causal relationship between employee engagement and stress is tested with a structural equation model. The result is that the higher the commitment of the workforce, the lower the stress levels. In conclusion, proper human capital management could improve engagement levels in the bank sector.

Compromiso laboral y estrés en los empleados de Bancos y Cajas = Commitment and stress on employees in Banks

Directory of Open Access Journals (Sweden)

María Isabel Sánchez Hernández

2014-07-01

Full Text Available Resumen La crisis económica de los últimos años ha impactado especialmente en el sector financiero y se ha hecho sentir tanto en el estrés que soportan los empleados de las sucursales de bancos y cajas como en sus niveles de compromiso con la empresa. En este trabajo se analizan los componentes del compromiso laboral en una muestra de 102 trabajadores del sector de la banca confirmándose las dimensiones clásicas del modelo de Allen y Meyer (1996. La relación causal del compromiso con el estrés se testa con un modelo de ecuaciones estructurales dando por resultado que cuanto mayor es el compromiso de la plantilla, menores son los niveles de estrés. Como conclusión se señalan las medidas de gestión del capital humano que podrían mejorar los niveles de compromiso en este sector. Abstract The economic crisis of recent years has particularly impacted the financial sector. It has been felt in both, the stress endured by employees of banks and the levels of commitment to the company. In this paper the components of employee engagement are analyzed in a sample of 102 workers to confirm the classic dimensions from Allen y Meyer (1996 in banks workers. The causal relationship between employee engagement and stress is tested with a structural equation model. The result is that the higher the commitment of the workforce, the lower the stress levels. In conclusion, proper human capital management could improve engagement levels in the bank sector.

Congruence between morphological and molecular markers inferred from the analysis of the intra-morphotype genetic diversity and the spatial structure of Oxalis tuberosa Mol.

Science.gov (United States)

Pissard, Audrey; Arbizu, Carlos; Ghislain, Marc; Faux, Anne-Michèle; Paulet, Sébastien; Bertin, Pierre

2008-01-01

Oxalis tuberosa is an important crop cultivated in the highest Andean zones. A germplasm collection is maintained ex situ by CIP, which has developed a morphological markers system to classify the accessions into morphotypes, i.e. groups of morphologically identical accessions. However, their genetic uniformity is currently unknown. The ISSR technique was used in two experiments to determine the relationships between both morphological and molecular markers systems. The intra-morphotype genetic diversity, the spatial structures of the diversity and the congruence between both markers systems were determined. In the first experience, 44 accessions representing five morphotypes, clearly distinct from each other, were analyzed. At the molecular level, the accessions exactly clustered according to their morphotypes. However, a genetic variability was observed inside each morphotype. In the second experiment, 34 accessions gradually differing from each other on morphological base were analyzed. The morphological clustering showed no geographical structure. On the opposite, the molecular analysis showed that the genetic structure was slightly related to the collection site. The correlation between both markers systems was weak but significant. The lack of perfect congruence between morphological and molecular data suggests that the morphological system may be useful for the morphotypes management but is not appropriate to study the genetic structure of the oca. The spatial structure of the genetic diversity can be related to the evolution of the species and the discordance between the morphological and molecular structures may result from similar selection pressures at different places leading to similar forms with a different genetic background.

Evaluation of physical parameters and implementation of quality control in mammography diagnosed for a pilot of breast cancer screening in the Caja Costarricense de Seguro Social (CCSS)

International Nuclear Information System (INIS)

Hernandez Angulo, Carolina Maria

2012-01-01

The purpose of mammography has been to provide the contrast between the lesion and adjacent healthy tissue of the breast. The quality control which should be performed in mammography services is essential to obtain the necessary contrast in mammography and thus achieve a prompt detection of breast lesions. The quality control program has helped to obtain exact diagnosis in mammography and has contributed to reduce mortality from breast cancer in Costa Rica. The Caja Costarricense de Seguro Social (CCSS) has sought to improve the quality of mammograms performed in the different health centers by implementing quality control programs in the services. The evaluation of the physical parameters has had as aim to perform an assessment of the equipment used in mammography facilities. The image quality, dosimetry, optical density, performance, accuracy and repeatability of voltage applied to the tube, filtration and Half-value layer in system of screen film mammography have been evaluated. The usefulness of quality control programs and needs of the services to implement a pilot plan for breast screening, can be seen when comparing the obtained results. The protocol of Mammography Quality Control, TECDOC 1517 from the International Atomic Energy Agency (IAEA), is implemented with this project and the associated software in four of the six hospitals evaluated in this study. (author) [es

La gestión de la calidad crediticia como alternativa de solución a los problemas de morosidad de la cartera de la micro y pequeña empresa y su efecto en los resultados económicos y financieros de la caja municipal de ahorro y crédito del santa - años 2014 y 2015.

OpenAIRE

Jiménez López, Nancy Raquel

2016-01-01

El presente trabajo de investigación ha sido realizado para entender que el problema de morosidad de la cartera de la micro y pequeña empresa genera resultados económicos financieros negativos en la Caja Municipal de Ahorro y Crédito del Santa, y que se requiere de una Gestión de Calidad para revertir esta situación para el mediano y largo plazo. Probablemente se puedan mencionar varios factores determinantes que influyen en la morosidad de las CMACS como consolidada y a la CMAC Santa en part...

Rescate arqueológico de restos óseos humanos en la quebrada del Río Cajas (Dpto. Yavi, Jujuy

Directory of Open Access Journals (Sweden)

Nieva, Luis F.

2001-01-01

Full Text Available Geológicamente la cuenca del río Yavi atraviesa por un período erosivo, que afecta especialmente las márgenes de los ríos provocando la formación de cárcavas y barrancos profundos. El área donde el río Cajas vuelca sus aguas al río Yavi es fértil en restos arqueológicos, el sitio más conocido es el Antigal de Yavi Chico, pero también se encuentran otros sitios menores, unos con arte rupestre y otros con hallazgos de artefactos líticos, y otros con restos cerámicos y óseos. Este sector de la cuenca está afectado por los procesos erosivos, es así que luego de los frecuentes derrumbes es posible ver los restos culturales en las escarpas expuestas. Se localizaron tres enterratorios: en urna, en el sitio denominado La Palca; otro en el antigal de Yavi Chico, y un tercero en Portillo. El análisis desde la antropología biológica, de restos humanos provenientes de sitios arqueológicos, aporta información importante acerca de las poblaciones que los habitaron, el estado sanitario en general, la alimentación, patologías, edad y sexo. De los análisis surge: una elevada incidencia de desgaste dental que afecta por igual a ambos sexos provocado probablemente por el tipo de alimentación, también se observan perdidas de piezas e indicios de periodontitis y en uno de los conjuntos óseos se advierte señas dejadas por enfermedades óseas (osteofitosis, deformación del esternón. Se espera poder contar en el futuro con una muestra más abundante para poder delinear de esta forma un panorama acerca de la salud de los pueblos prehispánicos de este sector de nuestra Puna.

Purification and characterization of a peroxidase present in ...

African Journals Online (AJOL)

Marcio Pinto

2015-02-22

Feb 22, 2015 ... present in xilopodium exsudates of umbu plants. (Spondias .... peroxide, 100 mM phosphate buffer pH 7.0 and 20 µL of xylopodium ... of enzyme which caused a change of 0.01 absorbance per minute. The staining of active ...

The fracture sites of atypical femoral fractures are associated with the weight-bearing lower limb alignment.

Science.gov (United States)

Saita, Yoshitomo; Ishijima, Muneaki; Mogami, Atsuhiko; Kubota, Mitsuaki; Baba, Tomonori; Kaketa, Takefumi; Nagao, Masashi; Sakamoto, Yuko; Sakai, Kensuke; Kato, Rui; Nagura, Nana; Miyagawa, Kei; Wada, Tomoki; Liu, Lizu; Obayashi, Osamu; Shitoto, Katsuo; Nozawa, Masahiko; Kajihara, Hajime; Gen, Hogaku; Kaneko, Kazuo

2014-09-01

Atypical femoral fractures (AFFs) are stress-related fractures that are speculated to associate with long-term treatment with bisphosphonates for osteoporosis. A history of AFF is a high risk factor for the development of a subsequent AFF in the same location of the contralateral femur, suggesting that a patient's individual anatomical factor(s) are related to the fracture site of AFFs. In this study, we investigated the radiographs of fourteen AFFs (four bilateral fractures among ten patients) treated at six hospitals associated with our university between 2005 and 2010. The fracture site and standing femorotibial angle (FTA), which reflects the mechanical axis of the lower limb, were measured on weight-bearing lower limb radiographs. The fracture site and FTA of patients with typical femoral fractures (TFF) were compared to those of patients with AFFs. The correlations were examined using Spearman's rank correlation coefficients. The fracture locations in the femora were almost the same in the patients with bilateral AFFs. There was a positive correlation between the fracture site and the standing FTA in the patients with AFFs (r=0.82, 95% confidence interval; 0.49 to 0.94), indicating that the larger the standing FTA (varus alignment), the more distal the site of the fracture in the femur. The FTA of the patients with atypical diaphyseal femoral fracture were significantly larger compared to that of those with not only atypical subtrochanteric fractures but also TFFs. In conclusion, the fracture sites of AFFs are associated with the standing lower limb alignment, while those of TFFs are not. Copyright © 2014 Elsevier Inc. All rights reserved.

Prebiotic Potential of Agave angustifolia Haw Fructans with Different Degrees of Polymerization

Directory of Open Access Journals (Sweden)

José Rodolfo Velázquez-Martínez

2014-08-01

Full Text Available Inulin-type fructans are the most studied prebiotic compounds because of their broad range of health benefits. In particular, plants of the Agave genus are rich in fructans. Agave-derived fructans have a branched structure with both β-(2→1 and β-(2→6 linked fructosyl chains attached to the sucrose start unit with a degree of polymerization (DP of up to 80 fructose units. The objective of this work was to assess the prebiotic potential of three Agave angustifolia Haw fructan fractions (AFF with different degrees of polymerization. The three fructan fractions were extracted from the agave stem by lixiviation and then purified by ultrafiltration and ion exchange chromatography: AFF1, AFF2 and AFF3 with high (3–60 fructose units, medium (2–40 and low (2–22 DP, respectively. The fructan profile was determined with high-performance anion exchange chromatography with pulsed amperometric detection (HPAEC-PAD, which confirmed a branched fructan structure. Structural elucidation was performed by Fourier Transform Infra-Red Spectroscopy. The AFF spectrum shows characteristic fructan bands. The prebiotic effect of these fractions was assessed in vitro through fermentation by Bifidobacterium and Lactobacillus strains. Four growth patterns were observed. Some bacteria did not grow with any of the AFF, while other strains grew with only AFF3. Some bacteria grew according to the molecular weight of the AFF and some grew indistinctly with the three fructan fractions.

Field and laboratory studies provide insights into the meaning of day-time activity in a subterranean rodent (Ctenomys aff. knighti, the tuco-tuco.

Directory of Open Access Journals (Sweden)

Barbara M Tomotani

Full Text Available South American subterranean rodents (Ctenomys aff. knighti, commonly known as tuco-tucos, display nocturnal, wheel-running behavior under light-dark (LD conditions, and free-running periods >24 h in constant darkness (DD. However, several reports in the field suggested that a substantial amount of activity occurs during daylight hours, leading us to question whether circadian entrainment in the laboratory accurately reflects behavior in natural conditions. We compared circadian patterns of locomotor activity in DD of animals previously entrained to full laboratory LD cycles (LD12:12 with those of animals that were trapped directly from the field. In both cases, activity onsets in DD immediately reflected the previous dark onset or sundown. Furthermore, freerunning periods upon release into DD were close to 24 h indicating aftereffects of prior entrainment, similarly in both conditions. No difference was detected in the phase of activity measured with and without access to a running wheel. However, when individuals were observed continuously during daylight hours in a semi-natural enclosure, they emerged above-ground on a daily basis. These day-time activities consisted of foraging and burrow maintenance, suggesting that the designation of this species as nocturnal might be inaccurate in the field. Our study of a solitary subterranean species suggests that the circadian clock is entrained similarly under field and laboratory conditions and that day-time activity expressed only in the field is required for foraging and may not be time-dictated by the circadian pacemaker.

Comparative histology in the liver and spleen of three species of freshwater teleost

Directory of Open Access Journals (Sweden)

Camila F. Sales

2017-03-01

Full Text Available ABSTRACT We describe and compare the histology of liver and spleen ofGeophagus brasiliensis (Perciformes, Hypostomus francisci (Siluriformes and Hoplias aff. malabaricus (Characiformes, tropical freshwater fishes. InG. brasiliensisandH. aff. malabaricusthe hepatocytes were arranged in tubular form whereas in H. franciscithey cord-like. In all species, hepatocytes presented glycogen, but in G. brasiliensis and H. aff. malabaricus they showed strong stained for hemossiderin in the cytoplasm. InG. brasiliensis and H. aff. malabaricus, melanomacrophage centres (MMCs were associated to hepatic structures and only in G. brasiliensis was observed intrahepatic exocrine pancreas. The spleen, in all species, was characterized by red and white pulp without boundary between the two regions, but only in H. francisci was recorded nodular organization in splenic parenchyma. The G. brasiliensisandH. aff. malabaricuspresented in the white pulp MMCs linked mainly to ellipsoids. Besides, we observed large MMCs in the spleen in relation to liver of G. brasiliensis and H. aff. malabaricus. In liver, highest values of reticular fibers and collagen were observed inG. brasiliensis. In spleen, highest values of reticular fibers and collagen were recorded inH. aff. malabaricusandH. francisci, respectively. Histological differences confirm the hypothesis that the phylogenetic distance is reflected in liver and spleen.

Stemcell Information: SKIP000387 [SKIP Stemcell Database[Archive

Lifescience Database Archive (English)

Full Text Available ent Phone: +81-75-256-8582, Fax: +81-75-256-6211, E-mail: このメールアドレスはスパムボットから保護されています。閲覧するにはJavaScriptを有効にする必要があります。 document.getElementById('cloak201790aff74261cafbb0c6a4917fdbf9').innerHTML = ''; var prefix = 'ma' + 'il' + 'to'; var path = 'hr' + 'ef' + '='; var addy201790aff74261cafbb0c6a4917fdbf9 = 'license' + '@'; addy201790aff74261cafbb0c6a4917fdbf9 = addy201790aff74261cafbb0c6a4917fdbf9 + 'ips-ac' + '.' + 'co' + '.' + 'jp'; var addy_text201790aff74261cafbb0c6a4917fdbf9 = 'license' + '@' + 'ips-ac' + '.' + 'co' + '.' + 'jp';document.getElementById('cloak201790aff74261cafbb0c6a4917fdbf9').innerHTML += ''+addy_text201790aff74261cafbb0c6a4917fdbf9+''; 非営利機関以外の利用者は事前にiPSアカデミアジャパン株式

Rhythmic 24 h variation of core body temperature and locomotor activity in a subterranean rodent (Ctenomys aff. knighti, the tuco-tuco.

Directory of Open Access Journals (Sweden)

Patricia Tachinardi

Full Text Available The tuco-tuco Ctenomys aff. knighti is a subterranean rodent which inhabits a semi-arid area in Northwestern Argentina. Although they live in underground burrows where environmental cycles are attenuated, they display robust, 24 h locomotor activity rhythms that are synchronized by light/dark cycles, both in laboratory and field conditions. The underground environment also poses energetic challenges (e.g. high-energy demands of digging, hypoxia, high humidity, low food availability that have motivated thermoregulation studies in several subterranean rodent species. By using chronobiological protocols, the present work aims to contribute towards these studies by exploring day-night variations of thermoregulatory functions in tuco-tucos, starting with body temperature and its temporal relationship to locomotor activity. Animals showed daily, 24 h body temperature rhythms that persisted even in constant darkness and temperature, synchronizing to a daily light/dark cycle, with highest values occurring during darkness hours. The range of oscillation of body temperature was slightly lower than those reported for similar-sized and dark-active rodents. Most rhythmic parameters, such as period and phase, did not change upon removal of the running wheel. Body temperature and locomotor activity rhythms were robustly associated in time. The former persisted even after removal of the acute effects of intense activity on body temperature by a statistical method. Finally, regression gradients between body temperature and activity were higher in the beginning of the night, suggesting day-night variation in thermal conductance and heat production. Consideration of these day-night variations in thermoregulatory processes is beneficial for further studies on thermoregulation and energetics of subterranean rodents.

EL ESTRÉS AGUDO INTERFIERE CON LA EVOCACIÓN Y PROMUEVE LA EXTINCIÓN DE LA MEMORIA ESPACIAL EN EL LABERINTO DE BARNES

Directory of Open Access Journals (Sweden)

Julieta Troncoso

2010-01-01

Full Text Available Para evaluar los efectos del estrés agudo sobre la recuperación y la extinción de la memoria espacial, se utilizaron ratas entrenadas en el laberinto circular de Barnes. El entrenamiento consistió de 8 ensayos de adquisición (intervalo entre ensayos, IEE, de 5 min en donde los animales debían aprender a encontrar una caja meta ubicada en uno de los 18 agujeros del laberinto. Todos los animales adquirieron el aprendizaje espacial, ya que invirtieron menos tiempo en encontrar la caja meta y cometieron menos errores a medida que se sucedían los ensayos de entrenamiento. Veinticuatro horas después del entrenamiento se evaluó la retención y extinción del aprendizaje espacial mediante una prueba con caja meta (PCC seguida de siete pruebas sin caja (PSC, con un IEE de 5 min. Una hora y media antes de la sesión de evaluación de la memoria un grupo de animales fue sometido a estrés por restricción de movimientos durante una hora, permitiéndoles un período de recuperación de 30 min y otro grupo permaneció en su caja hogar sin manipulación (control. Los resultados indican que el estrés deteriora el proceso de evocación de la memoria espacial, ya que los animales estresados cometieron un mayor número de errores y demoraron más tiempo en encontrar la caja meta durante la PCC, respecto de los controles. Además, el estrés facilita el proceso de extinción, ya que, durante las PSCs los animales estresados no mostraron una persistencia en la exploración del agujero que, en el entrenamiento, conducía a la caja meta.

Constant leverage and constant cost of capital : A common knowledge half-truth

OpenAIRE

Vélez Pareja, Ignacio; Ibragimov, Rauf; Tham , Joseph

2008-01-01

Un enfoque típico para valorar flujos de caja finitos es suponer que el endeudamiento es constante (generalmente como un endeudamiento objetivo o deseado) y que por tanto, el costo del patrimonio, Ke y el costo promedio ponderado de capital CPPC, también son constantes. Para los flujos de caja perpetuos, y con el costo de la deuda, Kd como la tasa de descuento para el ahorro en impuestos o escudo fiscal, Ke y el CPPC aplicado al flujo de caja libre FCL son constantes si el endeudamiento es co...

LOS LIBROS MANUAL Y MAYOR DE LA CAJA DE LA SACRISTÍA DE LA CATEDRAL DE VALENCIA: UNA ADAPTACIÓN DE LA PARTIDA DOBLE (1546-1555

Directory of Open Access Journals (Sweden)

Inmaculada Llibrer Escrig

2016-07-01

Full Text Available Este trabajo analiza dos libros de cuentas: un manual y un mayor, empleados para registrar las transacciones del efectivo depositado en la caja fuerte de la Catedral de Valencia. Siguiendo a de Roover, la mera existencia de los libros manual y mayor no es suficiente para afirmar su pertenencia a la partida doble, por lo que fue necesario revisar todos los elementos característicos de este método y compararlos con los que se encontraban en estos libros. También, se fijó como objetivo conocer los motivos que determinaron el modo de registro empleado, pretendiendo conocer la naturaleza de la información que este sistema aportaba y por qué no se respetaron algunas reglas de la partida doble. El sistema contable aprovechó las ventajas del método contable introduciendo varias innovaciones como: los asientos de ajuste sólo en el libro mayor, un doble asiento de apertura y la incorporación, previa a la apertura, del detalle de todas las transacciones que, consecuencia de los ajustes en los libros anteriores, conducían al saldo de apertura. El estudio permite inferir la concepción económica que el cabildo tenía de su organización y el rol que el sistema contable jugó dentro de la organización dado que la información era de carácter interno y confidencial.

Correlation, by multivariate statistical analysis, between the scavenging capacity against reactive oxygen species and the bioactive compounds from frozen fruit pulps Correlação, por análise estatística multivariada, entre desativação de espécies reativas de oxigênio e compostos bioativos de polpas de frutas congeladas

Directory of Open Access Journals (Sweden)

Lizziane Cynara Vissotto

2013-02-01

Full Text Available The contents of total phenolic compounds (TPC, total flavonoids (TF, and ascorbic acid (AA of 18 frozen fruit pulps and their scavenging capacities against peroxyl radical (ROO•, hydrogen peroxide (H2O2, and hydroxyl radical (•OH were determined. Principal Component Analysis (PCA showed that TPC (total phenolic compounds and AA (ascorbic acid presented positive correlation with the scavenging capacity against ROO•, and TF (total flavonoids showed positive correlation with the scavenging capacity against •OH and ROO• However, the scavenging capacity against H2O2 presented low correlation with TF (total flavonoids, TPC (total phenolic compounds, and AA (ascorbic acid. The Hierarchical Cluster Analysis (HCA allowed the classification of the fruit pulps into three groups: one group was formed by the açai pulp with high TF, total flavonoids, content (134.02 mg CE/100 g pulp and the highest scavenging capacity against ROO•, •OH and H2O2; the second group was formed by the acerola pulp with high TPC, total phenolic compounds, (658.40 mg GAE/100 g pulp and AA , ascorbic acid, (506.27 mg/100 g pulp contents; and the third group was formed by pineapple, cacao, caja, cashew-apple, coconut, cupuaçu, guava, orange, lemon, mango, passion fruit, watermelon, pitanga, tamarind, tangerine, and umbu pulps, which could not be separated considering only the contents of bioactive compounds and the scavenging properties.Os teores de compostos fenólicos totais (CFT, flavonoides totais (FT e ácido ascórbico (AA foram determinados em 18 polpas de frutas congeladas, assim como a capacidade antioxidante na desativação do radical peroxila (ROO•, peróxido de hidrogênio (H2O2 e radical hidroxila (•OH. De acordo com a Análise de Componentes Principais (ACP, CFT e AA apresentaram correlação positiva com a capacidade de desativar o ROO• e o teor de FT apresentou correlação positiva com a capacidade de desativar o •OH e ROO•. Entretanto, a

Valor nutritivo da forragem de genótipos de cereais de inverno de duplo propósito Nutritive value of forage of genotypes of double purpose winter cereals

Directory of Open Access Journals (Sweden)

Gilmar Roberto Meinerz

2011-06-01

Full Text Available Esta pesquisa foi conduzida com o objetivo de avaliar o valor nutritivo da forragem de 12 genótipos de seis espécies de cereais de inverno de duplo propósito (forragem e grãos, submetidos ao corte, na região da Depressão Central do Rio Grande do Sul. As espécies e genótipos testados foram: trigo (BRS 277, BRS Guatambu, BRS Tarumã, BRS Umbu; aveia-preta (Agro Zebu, UPFA 21 - Moreninha e Comum; aveia-branca (UPF 18; centeio (BR 1 e BRS Serrano; Cevada (BRS Marciana e triticale (BRS 148.Os genótipos foram distribuídos em 36 parcelas experimentais, num delineamento experimental inteiramente casualizado, com 12 tratamentos e três repetições. As análises de valor nutritivo e composição mineral foram feitas pelo método da reflectância do infravermelho proximal (NIRS, em amostras do estrato superior a 10 cm de altura da forragem. Os genótipos de aveia e o trigo BRS Umbu apresentaram os melhores resultados de valor nutritivo. A composição mineral apresentou pequena variabilidade entre os genótipos testados. Os resultados demonstram que os cereais de inverno produzem forragem de elevado valor nutritivo.The objective of this research was to evaluate the nutritive value of the forage of 12 genotypes of six double purpose (forage and grains winter cereal species submitted to harvest in the region of Depressão Central in Rio Grande do Sul state. The species and genotypes tested were: wheat (BRS 277, BRS Guatambu, BRS Tarumã and BRS Umbu; black oat (Agro Zebu, UPFA 21 - Moreninha and Commom black-oat; white-oat (UPF 18; rye (BR 1 and BRS Serrano; barley (BRS Marciana; and triticale (BRS 148. The genotypes were distributed in 36 experimental plots in completely randomized experimental design, with 12 treatments and three replications. Analysis of nutritive value and mineral composition were performed by the near infrared spectroscopy (NIRS in samples of stratum greater than 10 cm height of forage. Oat genotypes and BRS Umbu wheat

Atypische niedrig-traumatische Femurfrakturen – Zusammenhang mit Komorbiditäten, internistischen und knochenspezifischen Therapien // Atypical femoral fractures – comorbidities and association with bone-specific therapies

Directory of Open Access Journals (Sweden)

Muschitz Ch

2016-01-01

Full Text Available iIntroduction:/i Although atypical femoral fractures (AFF are generally rare events, several studies have indicated a potential link between AFF and long-term bone specific therapies (BST. The aim of this study was to analyze the frequency of AFF and potential associations with prior or ongoing BST. iMethods:/i 8.851 caucasian female and male patients with de novo hip fractures treated in the largest Austrian level 1 trauma center from 2000–2013 were selected. iResults:/i 194 patients with a de novo lowtraumatic subtrochanteric/shaft fractures were identified: 35 atypical and 159 typical fractures. Of these patients, concomitant diseases, medication, previous fractures and survival were retrieved and analyzed. Female patients in both groups were significantly older. The median survival was significantly shorter in patients with AFF (9 vs. 18 months; p 0.0001. Cardiovascular disease, sarcopenia, chronic kidney disease, type 2 diabetes, smoking (past or current history and prevalent fragility fractures were more frequent in AFF patients, as well as the concomitant use of phenprocoumon, furosemide, and sulfonylurea. Though the number of patients with current BST was low in (14.5% both groups, more patients in the AFF group were previously treated with BST (71% vs 49%; p = 0.016, and they received these therapies for a longer time period. iDiscussion:/i A combination of severe comorbidities, long-term pharmaceutical therapies and a history of previous or ongoing BST were associated with an increased individual risk for AFF. p bKurzfassung:/b iEinleitung:/i Atypische Femurfrakturen (AFF sind in der Regel seltene Ereignisse; mehrere Studien haben einen möglichen Zusammenhang zwischen AFF und langfristigen knochenspezifischen Therapien (KST angegeben. Das Ziel dieser Studie war es, die Häufigkeit der AFF und potentielle Assoziationen mit früheren oder laufenden KST zu analysieren. iMethoden:/i Analyse von 8.851 kaukasischen weiblichen und m

Efficacy of two synthetic food-odor lures for Mexican fruit flies (Diptera: Tephritidae) is determined by trap type.

Science.gov (United States)

Robacker, David C; Czokajlo, Darek

2005-10-01

Sterile mass-reared Mexican fruit flies, Anastrepha ludens (Loew), were trapped in a citrus orchard by using multilure traps and cylindrical sticky traps baited with Advanced Pheromone Technologies Anastrepha fruit fly (AFF) lures or Suterra BioLure two-component (ammonium acetate and putrescine) MFF lures (BioLures). The cylinder trap/AFF lure combination was the best trap over the first 6 wk, the multilure trap/BioLure combination was best during weeks 6-12, and the multilure trap/AFF lure combination was best during the last 6 wk. The multilure trap/BioLure combination was best overall by 36% over the cylinder trap/AFF lure combination, and 57% over the multilure trap/AFF lure combination. Cylinder traps with BioLures were the least effective trap/lure combination throughout the experiment, capturing only half as many flies as cylinder traps with AFF lures. Captures with cylinder traps baited with either lure and multilure traps with BioLures were female biased. For the most part, both lures remained highly attractive and emitted detectable amounts of attractive components under hot field conditions for the duration of the 18-wk experiment. Total emission of ammonia was 4 times greater and 1-pyrroline at least 10 times greater from AFF lures compared with BioLures. Correlations of trap and lure performance with ammonia emission and weather were determined, but no conclusions were possible. Results indicate that BioLures would be the lure of choice in multilure or other McPhail-type traps and AFF lures would be superior with most sticky traps or kill stations that attract flies to outer (not enclosed) surfaces.

Gametogenesis and reproductive cycle of Melanorivulus aff. punctatus (Boulenger, 1895 (Cyprinodontiformes, Rivulidae in Chapada dos Guimarães, Mato Grosso, Brazil

Directory of Open Access Journals (Sweden)

Monica Cassel

Full Text Available The comprehension of the reproductive cycle allows to understand which are the morphological changes that develop in the gonad during this interval. Thus, many studies have been undertaken in order to describe and classify the stages of gonadal development and reproductive status of Neotropical fishes. For this purpose, specimens of Melanorivulus aff. punctatus were collected in a permanent dam in Chapada dos Guimarães, Mato Grosso, Brazil. The gonads were prepared for analysis by light microscopy. The oogenesis and spermatogenesis have been described, characterizing the stages of gonadal development, together with assessments of the gonadosomatic ratio, germ cell count and verification of variation of mature oocytes in females. Throughout the year the male gonads presented themselves as capable of reproducing, characterized by the presence of undifferentiated and differentiated spermatogonia, spermatocytes organized into cysts, spermatids in cysts whose wall was thicker and the spermatozoa was free in the lumen and the duct. This can indicate a continuous reproductive cycle with split spermiation. The females had gonads in the development stage from May to September with undifferentiated and differentiated oogonias and early oocytes always facing the lumen, abundant pre-vitellogenic and vitellogenic oocytes and some atresias. In the phase capable of spawning, observed from October to March, the mature oocytes are abundant, there are many post-ovulatory complexes and some atresia in advanced stage. The regression, observed in some individuals from February to April, is characterized by ovaries with many atresias and post-ovulatory complexes. The same results were found in the quantitative assessments. Therefore, it may be characterized as discontinuous cycle with split spawning. Thus, the reproductive cycle of this species can be characterized as continuous for males and discontinuous for females, which have a most intense phase of reproduction

COMPARATIVO DE LOS ALGORITMOS DE DIMENSIÓN FRACTAL HIGUCHI, KATZ Y MULTIRESOLUCIÓN DE CONTEO DE CAJAS EN SEÑALES EEG BASADAS EN POTENCIALES RELACIONADOS POR EVENTOS

Directory of Open Access Journals (Sweden)

Santiago Fernández Fraga

Full Text Available La obtención de información por medio de la medición de señales registradas durante diferentes procesos o condiciones fisiológicas del cerebro es importante para poder desarrollar interfaces computacionales que traduzcan las señales eléctricas cerebrales a comandos computacionales de control. Un electroencefalograma (EEG registra la actividad eléctrica del cerebro en respuesta al recibir diferentes estímulos externos (potenciales por eventos. El análisis de estas señales permite identificar y distinguir estados específicos de la función fisiológica del cerebro. La Dimensión Fractal se ha utilizado como una herramienta para el análisis de formas de ondas biomédicas, en particular se ha utilizado para determinar la medida de la complejidad en series de tiempo generadas por EEG. El presente documento pretende analizar la base de datos HeadIT de series de tiempo biomédicas obtenidas por EEG a las cuales se obtendrán la FD por medio de los métodos Higuchi, Katz y Multi-resolución de Conteo de Cajas, que muestre la relación entre el método para la obtención de la Dimensión Fractal y la condición fisiológica de la señal basada en Potenciales Cerebrales Relacionados por Eventos.

Comparison of two synthetic food-odor lures for captures of feral Mexican fruit flies (Diptera: Tephritidae) in Mexico and implications regarding use of irradiated flies to assess lure efficacy.

Science.gov (United States)

Robacker, David C; Thomas, Donald B

2007-08-01

Feral Mexican fruit flies, Anastrepha ludens (Loew) (Diptera: Tephritidae), were trapped in a citrus orchard in Mexico by using two types of synthetic food-odor lures, the AFF lure (Anastrepha fruit fly lure, APTIV, Inc., Portland, OR) and the BioLure (two-component MFF lure, Suterra LLC, Inc., Bend, OR). In Multilure traps (Better World Manufacturing, Inc., Miami, FL) containing water, BioLures captured about the same numbers of flies as AFF lures. In Multilure traps containing antifreeze solution, BioLures captured 2 and 5 times more flies than AFF lures in two experiments. BioLures, and AFF lures did not differ in attractiveness when used on sticky traps (Intercept trap, APTIV, Inc.; and sticky cylinder trap). Multilure traps captured >4 times as many flies as sticky traps with the exception that captures of females did not differ between Multilure and sticky traps baited with AFF lures. The percentage of females captured in Multilure traps was greater when traps were baited with BioLures compared with AFF lures, but the reverse was true for sticky traps. Sticky cylinder traps captured a higher percentage of females than Multilure traps. The most effective trap/lure combination was the Multilure trap baited with BioLure and antifreeze. In comparison with tests of these two lures in Texas, results were similar for Multilure traps, but they differed for sticky cylinder traps in that AFF lures were consistently more attractive than BioLures in Texas, but not in Mexico.

Diversity and Distribution of Myrmecophytes in Bengkulu Province

Directory of Open Access Journals (Sweden)

Safniyeti Safniyeti

2017-07-01

Full Text Available Myrmecophyte is a common medicinal plant used by local people in Indonesia for treating various diseases especially in Papua. Bengkulu province is one of the Myrmecophyte habitats, but there has no report on its identity and distribution. The objectives of this research were to identify the diversity and analyze the Myrmecophytes distribution as well as factor affecting its presence. This study used purposive sampling method by exploring the area where Myrmecophytes commonly found. The Myrmecophyte distribution based on host tree was analyzed using Morishita index and the autecological analysis of abiotic factors was performed using Principal Component Analysis (PCA generated from Minitab 16. The results of this research showed that there were two species of Myrmecophytes in Bengkulu province, namely Hydnophytum formicarum and Myrmecodia tuberosa, as well as two variants of M. tuberosa i.e. M. tuberosa ‘armata’ and M. tuberosa ‘siberutensis’. The distribution of Myrmecophytes based on host tree was mostly randomly scattered in Central Bengkulu regency, Seluma, North Bengkulu, South Bengkulu, and Kaur. Their distributions were affected by light intensity and temperature. The data of this research can be used as basic information for carried out conservation efforts in Bengkulu province. The abundance of Myrmecophytes is also used as a source of additional income for local people in Bengkulu province.     

Environ: E00410 [KEGG MEDICUS

Lifescience Database Archive (English)

Full Text Available E00410 Homalomena rhizome Homalonemae rhizoma Crude drug ... Homalomena aff. Sagittaefolia, Homalomena... [TAX:174172] ... Araceae (arum family) Homalomena aff. sagittaefolia or assortative plants rhizome (dried) ...

Developmental plasticity and biomechanics of treelets and lianas in Manihot aff. quinquepartita (Euphorbiaceae): a branch-angle climber of French Guiana.

Science.gov (United States)

Ménard, Léa; McKey, Doyle; Rowe, Nick

2009-06-01

Most tropical lianas have specialized organs of attachment such as twining stems, hooks or tendrils but some do not. Many climbers also have an early self-supporting phase of growth and in some species this can produce treelet-sized individuals. This study focuses on how a liana can climb without specialized attachment organs and how biomechanical properties of the stem are modulated between self-supporting treelets and canopy-climbing lianas. Biomechanics and stem development were investigated in self-supporting to climbing individuals of Manihot aff. quinquepartita (Euphorbiaceae) from tropical rain forest at Saül, central French Guiana. Bending tests were carried out close to the site of growth. Mechanical properties, including Young's elastic modulus, were observed with reference to habit type and changes in stem anatomy during development. This liana species can show a remarkably long phase of self-supporting growth as treelets with stiff, juvenile wood characterizing the branches and main stem. During the early phase of climbing, stiff but unstable stem segments are loosely held in a vertical position to host plants via petiole bases. The stiffest stems--those having the highest values of Young's modulus measured in bending--belonged to young, leaning and climbing stems. Only when climbing stems are securely anchored into the surrounding vegetation by a system of wide-angled branches, does the plant develop highly flexible stem properties. As in many specialized lianas, the change in stiffness is linked to the development of wood with numerous large vessels and thin-walled fibres. Some angiosperms can develop highly effective climbing behaviour and specialized flexible stems without highly specialized organs of attachment. This is linked to a high degree of developmental plasticity in early stages of growth. Young individuals in either open or closed marginal forest conditions can grow as substantial treelets or as leaning/climbing plants, depending on the

Metodología de diseño para la recogida de residuos sólidos urbanos mediante factores punta de generación: sistemas de caja fija (SCF

Directory of Open Access Journals (Sweden)

Carlos Alfonso Zafra Mejía

2009-05-01

Full Text Available El desarrollo económico y de la sociedad de consumo implica una gran producción de residuos sólidos en una localidad, hecho que se constituye en un serio problema ambiental si no se cuenta con la infraestructura adecuada para su gestión integral. En este artículo se presenta un desarrollo metodológico para el diseño de la recogida de residuos sólidos urbanos con sistemas de caja fija (SCF, considerando la variación temporal en las cantidades generadas y recolectadas. La variación temporal se ha in- cluido mediante el análisis de tres factores punta de generación: coeficiente punta semanal (Cps, coeficiente punta diario (Cpd y coeficiente punta diario de distribución heterogénea (Cpdh. Esta consideración temporal permite realizar diseños razonables que se ajusten a las tasas máximas de generación y recolección. El modelo propuesto considera la producción per cápita (PPC, el coeficiente punta semanal (Cps y el coeficiente punta de distribución heterogénea (Cpdh. Finalmente, la metodología pro- puesta puede ser utilizada para la selección del equipamiento y tamaño de las unidades de gestión integral de los residuos sóli- dos urbanos.

Rabdomioma cardiaco como manifestación de esclerosis tuberosa: Presentación de dos casos y revisión de la literatura Cardiac rhabdomyoma as manifestation of tuberous sclerosis: Presentation of two cases and literature review

Directory of Open Access Journals (Sweden)

Rafael Lince

2009-10-01

Full Text Available Los rabdomiomas cardiacos son tumores benignos dependientes de las fibras musculares miocárdicas, los cuales usualmente son múltiples, pero tienden a disminuir tanto en número como en tamaño con el crecimiento, con una regresión espontánea en 90% de los casos. Hacen parte de los tumores cardiacos primarios, los cuales son poco frecuentes, con una incidencia que varía entre 0,0017% y 0,28%. El más frecuente de los tumores cardiacos primarios es el rabdomioma. Se describe asociación con esclerosis tuberosa hasta en 72% de los casos, razón por la cual ésta debe buscarse ante el hallazgo de rabdomioma cardiaco.Cardiac rhabdomyomas are benign tumors derived from cardiac muscle fibers. They are usually multiple, but tend to decrease both in number and size with growth, with spontaneous regression in 90% of cases. These lesions are part of the primary cardiac tumors, which are uncommon, and have a variable incidence between 0.0017 and 0.28%. The most common primary cardiac tumor is the rhabdomyoma. An association between rhabdomyoma and tuberous sclerosis has been described in up to 72% of cases. For this reason, a patient with cardiac rhabdomyoma should be investigated for tuberous sclerosis.

Critical differences between subtrochanteric and diaphyseal atypical femoral fractures: analyses of 51 cases at a single institution in Korean population.

Science.gov (United States)

Cho, Yoon-Je; Kang, Kyung-Chung; Chun, Young-Soo; Rhyu, Kee Hyung; Kim, Sang-Jun; Jang, Tae-Su

2018-05-03

There still remains controversy on the pathomechanism of atypical femoral fracture (AFF). The angle of lateral bowing and bone mineral density showed significant differences between subtrochanteric and diaphyseal atypical fracture groups. In addition to the use of bisphosphonate, mechanical factors might play important roles in the occurrence of AFFs. Although AFF could be divided into subtrochanteric and diaphyseal fracture according to the location of fractures, there is a lack of evidence regarding differences between two fractures and etiology of the occurrence. The aim of study is to determine differences between atypical subtrochanteric and diaphyseal fracture in Korean population. Between February 2010 and March 2015, 51 AFFs in 40 patients were included in this study. Their medical records were retrospectively reviewed. The AFF patients satisfied all the diagnostic criteria of the 2014 revised edition of the ASMBR. To analyze the differences according to the location of fracture, the AFFs were divided into subtrochanteric (n = 16) and diaphyseal (n = 35) fracture groups. The following factors were compared between two groups: patients' demographics, underlying diseases, laboratory findings (serum-25(OH) VitD3, osteocalcin, c-telopeptide, ALP, Ca, and P), bone mineral density (BMD), duration of bisphosphonate (BP) usage, and lateral bowing of the femur at time of the fracture. All AFFs happened in female patients (mean age, 73.8 years) who have received bisphosphonate treatments except three patients. The mean duration of bisphosphonate usage was 95.3 months. Between the two groups, demographic data (age, height, weight, and BMI), underlying diseases, laboratory findings, hip BMD, and duration of BP treatment were comparable to each other (p > 0.05). However, the subtrochanteric fracture group showed higher FNSBA (femoral neck shaft bowing angle, p group. Angle of lateral bowing (FNSBA) and spine BMD showed significant differences between

Gyrodactylus aff. mugili Zhukov, 1970 (Monogenoidea: Gyrodactylidae) from the gills of mullets (Mugiliformes: Mugilidae) collected from the inland waters of southern Iraq, with an evalutation of previous records of Gyrodactylus spp. on mullets in Iraq.

Science.gov (United States)

Kritsky, Delane C; Ali, Atheer H; Khamees, Najim R

2013-11-01

Gyrodactylus aff. mugili Zhukov, 1970 (Monogenoidea: Gyrodactylidae) is recorded and described from the gill lamellae of 11 of 35 greenback mullet, Chelon subviridis (Valenciennes) (minimum prevalence 31%), from the brackish waters of the Shatt Al-Arab Estuary in southern Iraq. The gyrodactylid was also found on the gill lamellae of one of eight Speigler's mullet, Valamugil speigleri (Bleeker), from the brackish waters of the Shatt Al-Basrah Canal (minimum prevalence 13%). Fifteen Klunzinger's mullet, Liza klunzingeri (Day), and 13 keeled mullet, Liza carinata (Valenciennes), collected and examined from southern Iraqi waters, were apparently uninfected. The gyrodactylids from the greenback mullet and Speigler's mullet were considered to have affinity to G. mugili Zhukov, 1970, and along with G. mugili may represent members of a species complex occurring on mullets in the Indo-Pacific Region. A single damaged gyrodactylid from the external surfaces of the abu mullet, Liza abu (Heckel), was insufficient for species identification. Previously identified species of Gyrodactylus recorded on L. abu in Iraq by various authors were considered possible misidentifications or accidental infections.

Experiment list: SRX573028 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ion of INTS11 || antibody=non-commercial rabbit anti-AFF4 Ref PMID 20159561 || source=IP with non-commerci...al rabbit anti-AFF4 Ref PMID 20159561 || sample type=ChIP-seq http://dbarchive.bios

Experiment list: SRX573031 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available INTS11 || antibody=non-commercial rabbit anti-AFF4 Ref PMID 20159561 || source=IP with non-commercial... || cell line=HeLa || treatment=AFF4 was profiled in a Hela cell clone upon EGF stimulation and depletion of

Experiment list: SRX573029 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available INTS11 || antibody=non-commercial rabbit anti-AFF4 Ref PMID 20159561 || source=IP with non-commercial... || cell line=HeLa || treatment=AFF4 was profiled in a Hela cell clone upon EGF stimulation and depletion of

Experiment list: SRX573033 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available INTS11 || antibody=non-commercial rabbit anti-AFF4 Ref PMID 20159561 || source=IP with non-commercial...|| cell line=HeLa || treatment=AFF4 was profiled in a Hela cell clone upon EGF stimulation and depletion of

Tuberous sclerosis: evaluation of myofibroblasts in cutaneous angiofibromas - case report

OpenAIRE

Perez, Erick Gomes; Paranaíba, Lívia Ribeiro; Bonan, Paulo Rogério; Orsi Júnior, Julian Miranda; Oliveira, Adriano Macedo de; Martelli Júnior, Hercílio

2010-01-01

Esclerose tuberosa é uma condição rara e autossômica dominante. Miofibroblastos são células que exibem fenótipo híbrido entre fibroblastos e células musculares lisas. O objetivo deste caso clínico é mostrar as características clínicas e histopatológicas da esclerose tuberosa e avaliar miofibroblastos nos angiofibromas cutâneos dessa condição. Lesões removidas foram coradas em HE e tricrômico de Masson. Para determinar a presença de miofibroblastos foi usada imunoistoquímica para α-SMA. E...

Aerial organ anatomy of Smilax syphilitica (Smilacaceae

Directory of Open Access Journals (Sweden)

João Marcelo Silva

2012-09-01

Full Text Available Smilax L. in Brazil is represented by 32 taxa and it is a taxonomically difficult genus because the plants are dioecious and show wide phenotypic variation. The analysis and use of leaf anatomy characters is recognized as a frequently successful taxonomic method to distinguish between individual taxon, when floral material is absent or minute differences in flowers and foliage exist such as in Smilax. The aim of this study was to characterize the anatomical features of the aerial organs in Smilax syphilitica collected from the Atlantic Rainforest, in Santa Teresa-ES and the Smilax aff. syphilitica from the Amazon Rainforest, in Manaus, Brazil. For this, a total of three samples of Smilax were collected per site. Sample leaves and stems were fixed with FAA 50, embedded in historesin, sectioned on a rotary microtome, stained and mounted in synthetic resin. Additionally, histochemical tests were performed and cuticle ornamentation was analyzed with standard scanning electron microscopy. S. syphilitica and S. aff. syphilitica differed in cuticle ornamentation, epidermal cell arrangement and wall thickness, stomata type and orientation, calcium oxalate crystal type, and position of stem thorns. Leaf blades of S. syphilitica from the Amazon Rainforest have a network of rounded ridges on both sides, while in S. aff. syphilitica, these ridges are parallel and the spaces between them are filled with numerous membranous platelets. Viewed from the front, the epidermal cells of S. syphilitica have sinuous walls (even more pronounced in samples from the Amazon; while in S. aff. syphilitica, these cells are also sinuous but elongated in the cross-section of the blade and arranged in parallel. Stomata of S. syphilitica are paracytic, whereas in S. aff. syphilitica, are both paracytic and anisocytic, and their polar axes are directed towards the mid-vein. Calcium oxalate crystals in S. syphilitica are prisms, whereas in S. aff. syphilitica, crystal sand. Thorns

Atypical femoral fracture in an osteogenesis imperfecta patient successfully treated with teriparatide

DEFF Research Database (Denmark)

Holm, Jakob; Eiken, Pia; Hyldstrup, Lars

2014-01-01

OBJECTIVE: We report a case of a successfully healed atypical femoral fracture (AFF) following treatment with teriparatide in a patient with osteogenesis imperfecta (OI). To our knowledge, no successful treatment of AFFs with teriparatide in this subpopulation has ever been described. METHODS...

in vitro production of virus free sweet potato [ipomoea batatas (l

African Journals Online (AJOL)

preferred customer

ABSTRACT: The phylogeny of the East African Hippopotamidae is problematic. A particularly controversial relationship is that between aff. Hippopotamus protamphibius and aff. .... ficient reconstruction of the symphysis, corpora, and canine processes has been completed to warrant a preliminary description of the fossil.

The relation between attitudes toward functional foods and satisfaction with food-related life

DEFF Research Database (Denmark)

Schnettler, Berta; Adasme-Berríos, Cristian; Grunert, Klaus G

2016-01-01

Purpose The purpose of this paper is to assess the effect of attitudes towards functional foods (AFF) on university students’ satisfaction with food-related life (SWFL) and to distinguish student typologies, considering that the AFF are not homogeneous among consumers. Design/methodology/approach...

On the Geological Age of the Sundyr Faunal Assemblage of Permian Tetrapods from the East European Platform

Directory of Open Access Journals (Sweden)

Golubev V.K.

2015-03-01

Full Text Available A new Sundyr faunal assemblage of Permian tetrapods was discovered in Eastern Europe. It includes dinocephalians Titanosuchia fam. indet., tapinocephalians aff. Ulemosauridae, anomodontians aff. Suminia, therocephalians, gorgonopians Burnetioidea fam. indet., diapsids ? Eosuchia, chroniosuchians Suchonica vladimiri Golubev, enosuchids aff. Enosuchus, seymouriamorphs Microphon exiguus Ivachnenko and Leptoropha aff. talonophora, batrachomorphs Dvinosaurus sp. The Sundyr assemblage is a transitional one from the Isheevo to Sokolki assemblages. It is described as the last stage of evolution undergone by the dinocephalian community of tetrapods in Eastern Europe. Based on the bio- and magnetostratigraphic data, the beds with Sundyr tetrapod fauna pertain to the lower part of the Upper Severodvinian (= Putyatinian regional stage. These strata were distinguished into a new Suchonica vladimiri tetrapod assemblage zone. In the Sukhona River basin, the beds with Sundyr tetrapod fossils were distinguished into a new Ustpoldarsa Member of the Poldarsa Formation.

MANAGEMENT OF ENDOCRINE DISEASE: Atypical femoral fractures: risks and benefits of long-term treatment of osteoporosis with anti-resorptive therapy.

Science.gov (United States)

Adler, Robert A

2018-03-01

Modern osteoporosis treatment began in the mid-1990s with the approval of amino-bisphosphonates, anti-resorptive agents that have been shown to decrease osteoporotic fracture risk by about half. In 2005, the first cases of atypical femoral fractures (AFF), occurring in the shaft of the femur, were reported. Since then, more cases have been found, leading to great concern among patients and a dramatic decrease in bisphosphonate prescribing. The pathogenesis and incidence of AFF are reviewed herein. Management and an approach to prevention or early detection of AFF are also provided. Denosumab, a more recently approved anti-resorptive medication has also been associated with AFF. Long-term management of osteoporosis and prevention of fracture are challenging in light of this serious but uncommon side effect, yet with an aging population osteoporotic fracture is destined to increase in frequency. © 2018 European Society of Endocrinology.

Placa fibrosa de la frente o del cuero cabelludo: Un marcador cutáneo temprano del complejo de la esclerosis tuberosa Forehead or scalp fibrous plaque: An earley cutaneous marker in tuberous sclerosis complex

Directory of Open Access Journals (Sweden)

A. E Saponaro

2010-09-01

Full Text Available El complejo de la Esclerosis tuberosa es una afección hereditaria, que se transmite en forma autosómica dominante. Se caracteriza por convulsiones, retraso mental y manifestaciones en diversos órganos. Los signos cutáneos suelen ser determinantes para el diagnóstico de la enfermedad. Entre éstos se destaca la placa fibrosa, la que se localiza más frecuentemente en la frente, pero puede observarse en cualquier área del cuero cabelludo. Cuando está presente, suele ser el signo cutáneo inicial de la enfermedad, como ocurrió en nuestro paciente, subdiagnosticado. Su importancia radica entonces en reconocerlo como un marcador precoz y patognomónico de la enfermedad.The complex of tuberous sclerosis is an hereditary disease that passes in the autosomal dominant way. It is characterized by convulsions, mental retardation and manifestations in different organs. The cutaneous signs are used to be determinant for the diagnosis of the illness. Among these, it is important the fibrous plaque, which is usually localized in the forehead, but it can also be observed in any area of the scalp.When it is presented, it is used to be the first cutaneous sign of the illness, and like it happened in our patient, underdiagnosed. So, the importance of the fibrous plaque lies in recognizing it as an early cutaneous marker and pathognomonic of the disease.

Verification of the light intensity from halogens curing lamps in comparison with the manufacturer's specifications

International Nuclear Information System (INIS)

Morales Ramirez, Elvis

2011-01-01

The light intensity emitted from halogens curing lamps is measured to determine if photoactivation units utilized in the Caja Costarricense de Seguro Social are complied with the manufacturer's specifications of the lamp and the resin. The light intensity mW/cm 2 from halogens curing lamps operated by odontologist of the Caja Costarricense de Seguro Social is compared with the manufacturer's specifications of the lamp. The light intensity is compared with the manufacturer's specifications of the resin. The results obtained are analyzed to specify that lamp or lamps have presented light intensities lower to indication of the manufacturer. A list of recommendations is performed for each Servicio de Odontologia of the Caja Costarricense de Seguro Social of the Region Central Sur of the results reported [es

Challenges Associated with Technological Aspects for Modernization of Alkaline-Fermented Foods

NARCIS (Netherlands)

Linnemann, A.R.; Hansen, E.B.; Lelieveld, H.L.M.; Heising, J.K.; Dekker, M.

2014-01-01

Among the new generations, the awareness and appreciation of indigenous healthy foods including alkaline-fermented foods (AFFs) needs to be enhanced. AFFs are considered to be old-fashioned. In fact, some of the food processing techniques are outdated with low hygiene and quality standards. Some

Tratamento dos angiofibromas múltiplos da face com radiofrequência Multiple facial angiofibromas treated with high-frequency equipment

Directory of Open Access Journals (Sweden)

Allysson Antonio Ribeiro Gomes

2011-08-01

Full Text Available Esclerose tuberosa é uma doença genética rara, com herança autossômica dominante, associada à formação de hamartomas múltiplos em vários órgãos, como cérebro, pele, pulmões, rins, coração e olhos. Os autores deste estudo apresentam um caso de uma paciente do sexo feminino, com 30 anos de idade, portadora de esclerose tuberosa, apresentando múltiplos angiofibromas em face, tratada com equipamento de alta frequência (radiofrequência, e discutem as opções terapêuticas para tratamento de indivíduos portadores de esclerose tuberosa com extenso envolvimento cutâneoTuberous sclerosis is a rare genetic disease with autosomal dominant inheritance, associated with multiple hamartomas in several organs, such as the brain, skin, lung, kidney, heart and eyes. The authors of this study report a case of a 30 years old female patient with tuberous sclerosis, presenting multiple angiofibromas on face treated with high frequency equipment (radiofrequency, and discuss the therapeutic options for treatment of individuals with extensive cutaneous involvement in tuberous sclerosis

OSMAN BİN AFFÂN (RA)’IN MUSHAFİ’L-İMÂM’ININ TANITIMI

OpenAIRE

Şahin, Şamil

2015-01-01

Bu makale, Raşit Halife Osman b. Affân (ra)’ınönemli şehirlere (Emsâr’a) gönderdiği Mushaflarile “mushafu’l-imâm” olarak bilinen Hz. Osman’ın özel mushafı incelemektedir.Makale şu dört bölümden oluşmaktadır. Birinci bölüm, Osman b. Affân (ra)’ınİslam merkezlerinegönderdiği Mushaflarla ilgilidir. İkinci bölüm, Osman b. Affân (ra)’ın “mushafu’l-imâm” olarakbilinen özel mushafıyla ilgilidir. Üçüncü bölüm, Kurtuba Mushafıyla ilgilidir. Dördüncü bölüm,Osman b. Affân (ra)’ın özel mushafı “Mushafu’l...

Affinity flow fractionation of cells via transient interactions with asymmetric molecular patterns

Science.gov (United States)

Bose, Suman; Singh, Rishi; Hanewich-Hollatz, Mikhail; Shen, Chong; Lee, Chia-Hua; Dorfman, David M.; Karp, Jeffrey M.; Karnik, Rohit

2013-07-01

Flow fractionation of cells using physical fields to achieve lateral displacement finds wide applications, but its extension to surface molecule-specific separation requires labeling. Here we demonstrate affinity flow fractionation (AFF) where weak, short-range interactions with asymmetric molecular patterns laterally displace cells in a continuous, label-free process. We show that AFF can directly draw neutrophils out of a continuously flowing stream of blood with an unprecedented 400,000-fold depletion of red blood cells, with the sorted cells being highly viable, unactivated, and functionally intact. The lack of background erythrocytes enabled the use of AFF for direct enumeration of neutrophils by a downstream detector, which could distinguish the activation state of neutrophils in blood. The compatibility of AFF with capillary microfluidics and its ability to directly separate cells with high purity and minimal sample preparation will facilitate the design of simple and portable devices for point-of-care diagnostics and quick, cost-effective laboratory analysis.

Auditory Vigilance and Working Memory in Youth at Familial Risk for Schizophrenia or Affective Psychosis in the Harvard Adolescent Family High Risk Study.

Science.gov (United States)

Seidman, Larry J; Pousada-Casal, Andrea; Scala, Silvia; Meyer, Eric C; Stone, William S; Thermenos, Heidi W; Molokotos, Elena; Agnew-Blais, Jessica; Tsuang, Ming T; Faraone, Stephen V

2016-11-01

The degree of overlap between schizophrenia (SCZ) and affective psychosis (AFF) has been a recurring question since Kraepelin's subdivision of the major psychoses. Studying nonpsychotic relatives allows a comparison of disorder-associated phenotypes, without potential confounds that can obscure distinctive features of the disorder. Because attention and working memory have been proposed as potential endophenotypes for SCZ and AFF, we compared these cognitive features in individuals at familial high-risk (FHR) for the disorders. Young, unmedicated, first-degree relatives (ages, 13-25 years) at FHR-SCZ (n=41) and FHR-AFF (n=24) and community controls (CCs, n=54) were tested using attention and working memory versions of the Auditory Continuous Performance Test. To determine if schizotypal traits or current psychopathology accounted for cognitive deficits, we evaluated psychosis proneness using three Chapman Scales, Revised Physical Anhedonia, Perceptual Aberration, and Magical Ideation, and assessed psychopathology using the Hopkins Symptom Checklist -90 Revised. Compared to controls, the FHR-AFF sample was significantly impaired in auditory vigilance, while the FHR-SCZ sample was significantly worse in working memory. Both FHR groups showed significantly higher levels of physical anhedonia and some psychopathological dimensions than controls. Adjusting for physical anhedonia, phobic anxiety, depression, psychoticism, and obsessive-compulsive symptoms eliminated the FHR-AFF vigilance effects but not the working memory deficits in FHR-SCZ. The working memory deficit in FHR-SZ was the more robust of the cognitive impairments after accounting for psychopathological confounds and is supported as an endophenotype. Examination of larger samples of people at familial risk for different psychoses remains necessary to confirm these findings and to clarify the role of vigilance in FHR-AFF. (JINS, 2016, 22, 1026-1037).

Extrinsic Repair of Injured Dendrites as a Paradigm for Regeneration by Fusion in Caenorhabditis elegans

Science.gov (United States)

Oren-Suissa, Meital; Gattegno, Tamar; Kravtsov, Veronika; Podbilewicz, Benjamin

2017-01-01

Injury triggers regeneration of axons and dendrites. Research has identified factors required for axonal regeneration outside the CNS, but little is known about regeneration triggered by dendrotomy. Here, we study neuronal plasticity triggered by dendrotomy and determine the fate of complex PVD arbors following laser surgery of dendrites. We find that severed primary dendrites grow toward each other and reconnect via branch fusion. Simultaneously, terminal branches lose self-avoidance and grow toward each other, meeting and fusing at the tips via an AFF-1-mediated process. Ectopic branch growth is identified as a step in the regeneration process required for bypassing the lesion site. Failure of reconnection to the severed dendrites results in degeneration of the distal end of the neuron. We discover pruning of excess branches via EFF-1 that acts to recover the original wild-type arborization pattern in a late stage of the process. In contrast, AFF-1 activity during dendritic auto-fusion is derived from the lateral seam cells and not autonomously from the PVD neuron. We propose a model in which AFF-1-vesicles derived from the epidermal seam cells fuse neuronal dendrites. Thus, EFF-1 and AFF-1 fusion proteins emerge as new players in neuronal arborization and maintenance of arbor connectivity following injury in Caenorhabditis elegans. Our results demonstrate that there is a genetically determined multi-step pathway to repair broken dendrites in which EFF-1 and AFF-1 act on different steps of the pathway. EFF-1 is essential for dendritic pruning after injury and extrinsic AFF-1 mediates dendrite fusion to bypass injuries. PMID:28283540

Sinergismo entre el cloruro de sodio, sacarosa y fosfato tricálcico en la deshidratación osmótica de oca (Oxalis tuberosa con y sin recubrimiento de Quitosano

Directory of Open Access Journals (Sweden)

José Arroyo Portal

2010-01-01

Full Text Available Se investigó el efecto sinérgico de tres solutos (cloruro de sodio, sacarosa, y fosfato tricálcico en distintas combi naciones de concentración, sobre la humedad, ganancia de sólidos y ganancia de calcio en la deshidratación osmótica de oca ( Oxalis tuberosa con y sin recubrimiento de quitosano (CR y SR. En ambos casos se aplicó un diseño de mezclas Simplex con Centroide Ampliado. Se utilizaron cilindros de oca de 0.9 cm de diámetro y 3.4 cm de longitud. S e evaluó la cinética de la humedad, ganancia de sólidos y ganancia de calcio durante 48 horas . S e determinó la difusividad efectiva del agua, sólidos y calcio. Se encont ró que en muestras CR hay mayor pérdida de agua y menor ganancia de sólidos comparado con las muestras SR, principalmente cuando el cloruro de sodio o sacarosa participa independientemente, en tanto que para la ganancia de calcio , en todos los casos, las m uestras CR ganan mayor cantidad de calcio que las muestras SR. L as difusividades efectivas encontradas fueron: para el agua, 1.19E - 09 m 2 /s en muestras CR y 1.34E - 09 m 2 /s en muestras SR; para los sólidos, 3.67E - 09 m 2 /s en muestras CR y 5.43E - 09 m 2 /s en mues tras SR ; y, para el calcio 3.32E - 11 m 2 /s en muestras CR y 1.57E - 09 m 2 /s en muestras SR.

OBTENCIÓN DE CEPAS Y PRODUCCIÓN DE INÓCULO DE CINCO ESPECIES DE HONGOS SILVESTRES COMESTIBLES DE ALTA MONTAÑA EN EL CENTRO DE MÉXICO

Directory of Open Access Journals (Sweden)

Yolanda Arana-Gabriel

2014-01-01

Full Text Available Se obtuvieron cepas de Psathyrella spadicea , Floccularia aff. luteovirens , Clitocybe squamulosa , Flammulina mexicana y Lyophyllum aff. shimeji , cuyos esporomas son recolectados y consumi - dos por habitantes del Nevado de Toluca, México. Las cepas se estudiaron in vitro en seis medios de cultivo (ACP: Agar croquetas de perro, AM: Agar maíz, PDA-PL: Agar papa dextrosa-pepto - na y levadura, EMA-PL: Agar extracto de malta-peptona y levadura, PDA y EMA a 18 °C y 25 °C. Las especies se desarrollaron satisfactoriamente a 18 °C , siendo F. mexicana y L . aff. shimeji las que tuvieron mayor velocidad de crecimiento y producción de biomasa. Flammulina mexicana solo se desarrolló a 18 °C, presentando mayor crecimiento y producción de biomasa en ACP. La cepa de L. aff. shimeji creció a 18 y 25 °C, la mayor velocidad de crecimiento se registró en medio PDA a 18 °C y la mayor producción de biomasa en EMA-PL a 18 °C. Considerando las mejores condiciones para el desarrollo de micelio in vitro, se produjo inóculo primario de F. mexicana y L . aff. shimeji en trigo y sorgo. La mayor densidad del micelio y porcentaje de grano cubierto se obtuvieron con el sustrato de trigo.

The Southern Divide: Testing morphological differences among bifacial points from southern and southeastern Brazil using geometric morphometrics

Directory of Open Access Journals (Sweden)

Mercedes Okumura

2016-03-01

Full Text Available Bifacial points have been used to characterize the “Umbu” tradition in southern and southeastern Brazil. This archaeological tradition has been related to sites dated from the late Pleistocene-early Holocene boundary to near historical times. Such a huge temporal range and vast territory have suggested the existence of greater diversity within this tradition that has been ignored thus far due to the lack of systematic regional studies of such points. Through geometric morphometric analysis, this article aims to test the hypothesis that there are substantial differences in the Holocene bifacial points associated with the Umbu tradition in southeastern Brazil. Five landmarks were digitized in standardized photographs from 658 points from the states of São Paulo, Paraná, Santa Catarina, and Rio Grande do Sul. The results show that points made by groups from southeastern Brazil (São Paulo state present a very distinct morphology (size and shape in comparison to  those made by the southern groups (Paraná, Santa Catarina and Rio Grande do Sul. This would indicate a regional identity shared only by some groups from São Paulo (at least regarding the projectile points. It is possible that Umbu tradition presents a more restricted range, both in chronological and spatial terms, than the one proposed so far.

Localized cortical thickening of the femoral diaphysis captured on an X-ray before alendronate therapy in two cases of atypical femoral fracture

Energy Technology Data Exchange (ETDEWEB)

Iizuka, Yoichi [Gunma University Graduate School of Medicine, Department of Orthopedic Surgery, Maebashi, Gunma (Japan); Shibukawa General Hospital, Department of Orthopedic Surgery, Shibukawa, Gunma (Japan); Takechi, Rumi [Gunma University Graduate School of Medicine, Department of Orthopedic Surgery, Maebashi, Gunma (Japan); Gunma Cardiovascular Center, Department of Orthopaedic Surgery, Maebashi, Gunma (Japan); Iizuka, Haku; Takagishi, Kenji [Gunma University Graduate School of Medicine, Department of Orthopedic Surgery, Maebashi, Gunma (Japan); Omodaka, Takuya [Gunma University Graduate School of Medicine, Department of Orthopedic Surgery, Maebashi, Gunma (Japan); Gunma Central Hospital, Department of Orthopedic Surgery, Maebashi, Gunma (Japan)

2016-10-15

We herein report two cases of atypical femoral fracture (AFF). X-ray examinations at the first visit of these two female patients showed a complete fracture of the femoral diaphysis diagnosed as an atypical femoral fracture (AFF). X-rays of these two cases also showed localized cortical thickening of the femoral diaphysis. Both patients had been taking alendronate for more than 3 years because of postmenopausal osteoporosis. We assumed that both of the fractures were associated with the long-term use of alendronate. However, we retrospectively identified localized cortical thickening of the femoral diaphysis on an X-ray taken before the alendronate therapy in both of these cases. Therefore, we suspected a pathogenesis of AFFs in which preexisting stress or an insufficient fracture unrelated to bisphosphonate (BP) therapy and subsequent suppression of bone turnover due to BP administration led to the occurrence of an AFF. The patient underwent surgery using intramedullary nails in both of these cases, followed by the administration of teriparatide, and they were able to walk without any support at the final follow-up examination. (orig.)

The Cova des Pas de Vallgornera (Llucmajor, Mallorca: a singular deposit bearing an exceptional well preserved Early Pleistocene vertebrate fauna

Directory of Open Access Journals (Sweden)

Pere Bover

2014-05-01

Full Text Available The Cova des Pas de Vallgornera is the longest cave of Mallorca (Balearic Islands, Western Mediterranean and one of the 30 longest caves in the world. The exploration of one of the galleries allowed the discovery of a fossiliferous deposit of vertebrate remains in a remarkable preservation state. The fossil faunal complex found in this gallery is composed of up to 5 mammalian species (Myotragus aff. kopperi, Hypnomys onicensis, Nesiotites aff. ponsi, Rhinolophus aff. mehelyi and Pipistrellus sp., at least 14 bird species (among them two Mallorcan endemic taxa: Pica mourerae and Athene vallgornerensis, one reptile (Podarcis aff. lilfordi and one amphibian (Discoglossus sp.. This faunal composition is similar to the one recorded in the Pedrera de s’Ònix, a well known deposit from the Early Pleistocene of Mallorca, and shared morphological characteristics between taxa of both deposits suggest that the chronology of the Cova des Pas de Vallgornera should be considered Early Pleistocene as well. Both taxonomical analysis and chronology of this fauna furnished information on some speleological aspects of the cave.

Atypical subtrochanteric and diaphyseal femoral fractures

DEFF Research Database (Denmark)

Shane, Elizabeth; Burr, David; Abrahamsen, Bo

2014-01-01

Bisphosphonates (BPs) and denosumab reduce the risk of spine and nonspine fractures. Atypical femur fractures (AFFs) located in the subtrochanteric region and diaphysis of the femur have been reported in patients taking BPs and in patients on denosumab, but they also occur in patients with no exp......Bisphosphonates (BPs) and denosumab reduce the risk of spine and nonspine fractures. Atypical femur fractures (AFFs) located in the subtrochanteric region and diaphysis of the femur have been reported in patients taking BPs and in patients on denosumab, but they also occur in patients...... with no exposure to these drugs. In this report, we review studies on the epidemiology, pathogenesis, and medical management of AFFs, published since 2010. This newer evidence suggests that AFFs are stress or insufficiency fractures. The original case definition was revised to highlight radiographic features...... a minor to a major feature. The association with specific diseases and drug exposures was removed from the minor features, because it was considered that these associations should be sought rather than be included in the case definition. Studies with radiographic review consistently report significant...

Application of modified homotopy perturbation method and amplitude frequency formulation to strongly nonlinear oscillators

Directory of Open Access Journals (Sweden)

seyd ghasem enayati

2017-01-01

Full Text Available In this paper, two powerful analytical methods known as modified homotopy perturbation method and Amplitude Frequency Formulation called respectively MHPM and AFF, are introduced to derive approximate solutions of a system of ordinary differential equations appear in mechanical applications. These methods convert a difficult problem into a simple one, which can be easily handled. The obtained solutions are compared with numerical fourth order runge-kutta method to show the applicability and accuracy of both MHPM and AFF in solving this sample problem. The results attained in this paper confirm the idea that MHPM and AFF are powerful mathematical tools and they can be applied to linear and nonlinear problems.

Arquitectura y tecnología constructiva en los sitios arqueológicos El Obraje 01 y El Obraje 02, San Agustín de Cajas, Huancayo

Directory of Open Access Journals (Sweden)

Manuel Perales Mungía

2012-06-01

Full Text Available Objetivos: Describir las características de la arquitectura y tecnología constructiva presente en los sitios arqueológicos El Obraje 01 y El Obraje 02 (distrito de San Agustín de Cajas, Huancayo, así como su estado de deterioro y sus tipos de lesiones. Métodos: Investigación básica, de alcance exploratorio-descriptivo y diseño transversal; efectuada mediante reconocimientos de campo, relevamientos topográficos y levantamientos arquitectónicos, así como registros fotográficos, identificación petrográfica y ensayos químicos de laboratorio sobre muestras de argamasa arqueológica. En gabinete se procesó la información en computadoras, con el uso del software AutoCad, Microsoft Excel, entre otros. Resultados: La arquitectura estudiada se caracteriza por un sistema espacial basado en la planta circular, con edificios asociados a espacios abiertos, sin patrón claro de organización. El sistema de circulación se compone de un recorrido principal continuo y flexible, carente de patrón alguno, mientras que el sistema estructural es portante. El estado de deterioro es moderado en El Obraje 02 y malo en El Obraje 01. Se identificaron lesiones mecánicas y químicas, mas no de naturaleza física. Conclusiones:La arquitectura estudiada muestra conceptos y principios relacionados a una cosmovisión no occidental. La tecnología constructiva revela una organización laboral sencilla y conocimientos notables de materiales y técnicas. La ausencia de lesiones físicas sugiere la eficacia de la tecnología constructiva y el sistema estructural, mientras que la existencia de lesiones mecánicas se debe a recientes intervenciones de reconstrucción. Las lesiones químicas pueden ser consecuencia del paso del tiempo y la acción de la intemperie.

Interspecific variation within the genus Asclepias in response to herbivory by a phloem-feeding insect herbivore.

Science.gov (United States)

Zehnder, Caralyn B; Hunter, Mark D

2007-11-01

Induced plant responses to leaf-chewing insects have been well studied, but considerably less is known about the effects of phloem-feedings insects on induction. In a set of laboratory experiments, we examined density-dependent induction by the milkweed-oleander aphid, Aphis nerii, of putative defenses in four milkweed species (Asclepias incarnata, Asclepias syriaca, Asclepias tuberosa, and Asclepias viridis). We hypothesized that high aphid density would lead to increased cardenolide expression in species with low constitutive levels of cardenolides (e.g., A. tuberosa), but that there would be no induction in high constitutive cardenolide species (e.g., A. viridis). Based on previous studies, we did not expect cardenolide induction in A. incarnata. Contrary to our predictions, we observed feeding-induced declines of cardenolide concentrations in A. viridis. Cardenolide concentrations did not respond to aphid feeding in the other three milkweed species. Aphids also caused reductions in biomass accumulation by two of four Asclepias species, A. viridis and A. incarnata. High aphid density led to a decrease in A. viridis foliar nitrogen concentration. However, aphids had no effect on the defensive chemistry, growth, or nutritional quality of either A. syriaca or A. tuberosa. Our results highlight that congeneric plant species may respond differently to the same levels of herbivore damage.

Silagem de cereais de inverno submetidos ao manejo de duplo propósito Silage of winter cereals submitted to double purpose management

Directory of Open Access Journals (Sweden)

Gilmar Roberto Meinerz

2011-10-01

Full Text Available Esta pesquisa foi conduzida com o objetivo de avaliar a silagem de 12 genótipos de seis espécies de cereais de inverno de duplo propósito (forragem e grãos, submetidos ao corte na região da Depressão Central do Rio Grande do Sul. As espécies e os genótipos testados foram: trigo BRS 277, BRS Guatambu, BRS Tarumã, BRS Umbu; aveia-preta Agro zebu, UPFA 21 -Moreninha e Comum; aveia-branca UPF 18; centeio BR 1 e BRS Serrano; Cevada BRS Marciana; e triticale BRS 148. Os genótipos foram submetidos a três cortes com o objetivo de simular o pastejo, conforme manejo indicado para duplo propósito. Após o terceiro corte, permitiu-se o desenvolvimento das culturas para a ensilagem. As silagens foram feitas em silos experimentais de PVC quando as forrageiras atingiram o estádio fenológico de grão pastoso. O delineamento experimental foi o inteiramente casualizado, com 12 tratamentos (genótipos e três repetições (parcelas. Foram determinadas a produção de matéria seca e a composição estrutural do material ensilado, o valor nutritivo e os parâmetros fermentativos das silagens. O centeio BR 1 e a aveiabranca UPF 18 apresentaram as maiores produções de matéria seca. O trigo BRS Umbu produziu silagem com maior participação de grãos e valor nutritivo mais elevado. Todos os genótipos apresentaram condições satisfatórias para a ensilagemThe objective of this research was to evaluate the silage of 12 genotypes of six species of double purpose winter cereals (forage and grains submitted to harvest at Depressão Central region of Rio Grande do Sul state. Species and genotypes tested were: BRS 277, BRS Guatambu, BRS Tarumã and BRS Umbu wheat; Agro Zebu, UPFA 21 - Moreninha and Commom black-oat; UPF 18 white oat; BR 1 and BRS Serrano rye; BRS Marciana barley; and BRS 148 triticale. Genotypes were submitted to tree harvests with the objective to simulate grazing, according to double purpose management. After the third harvest, the

Dicty_cDB: Contig-U15795-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ... 60 2e-07 EF527414_1( EF527414 |pid:none) Aspergillus tubingensis strain V-0.....yces hygroscopicus strain... 59 5e-07 EF527413_1( EF527413 |pid:none) Aspergillus aff. tubingensis V-04-... ...00113_4409( CP000113 |pid:none) Myxococcus xanthus DK 1622, com... 59 7e-07 EF527412_1( EF527412 |pid:none) Aspergillus aff. tubing

Study of the optimal production process and application of apple fruit (malus domestica (l.) borkh) fermentation

International Nuclear Information System (INIS)

Zhang, J.; Shao, W.; Ziang, R.

2015-01-01

In orchard production, fruit abscission is common due to insect damage, disease, crop thinning and natural dropping. However, the utilization of these discarded plant resources has received little research attention. In this study, we used apple fruit from such plant resources, mainly young and mature dropped fruit, as materials and mixed them with a fermentation agent, brown sugar and water. The effects of the proportion of fermentation agent and the fermentation conditions (O2, temperature, fermenting time and fruit crushing degree) were studied using an orthogonal experimental design. We discovered a novel fermented fertilizer, apple fruit fermentation nutrient solution (AFF), for which the optimal fermentation formula and conditions were comminuted young apples: fermentation agent: brown sugar: water weight ratio of 5:0.1:1:4 and 45 days of aerobic fermentation. Analysis of the fermentation solutions showed that the supernatant obtained using these optimized parameters had the highest mineral element content among the fermentation formulas and conditions studied. The results of a spraying experiment with 200-, 500- and 800-fold dilutions showed that AFF significantly promoted the net photosynthetic rate, leaf area and thickness, specific leaf weight, and chlorophyll and mineral element content in the leaves of young apple trees relative to the control treatment. The effects of 200-fold diluted AFF on the photosynthetic rate, the developmental quality and mineral element contents were greater than those of the 500- and 800-fold dilutions. The results of the spraying of adult trees with 200-fold diluted AFF compared to a water control demonstrated that AFF significantly enhanced the average weight of a single fruit, the shape index, hardness, content of soluble solids, titratable acid content, vitamin C content, and aroma compound content of the fruit of the adult trees. This evidence suggests that the AFF obtained using the optimal production process could

Artrodesis cervical anterior mediante implante de tantalio: Resultados clínicos y radiológicos

OpenAIRE

Vicario, C.; Lopez-Oliva, F.; Sánchez-Lorente, T.; Zimmermann, M.; Asenjo-Siguero, J.J.; Ladero, F.; Ibarzábal, A.

2006-01-01

La discectomía cervical anterior con artrodesis intersomática (DCAA) es una técnica quirúrgica ampliamente aceptada en el tratamiento de la enfermedad discal cervical. Recientemente se han introducido con esta indicación las cajas de tantalio debido a sus excelentes propiedades mecánicas y biológicas. Presentamos los resultados iniciales clínicos y radiológicos de un estudio prospectivo de 24 pacientes intervenidos en nuestro servicio tras el empleo de cajas de tantalio en la DCAA. La evaluac...

Influence of tree species on the herbaceous understory and soil chemical characteristics in a silvopastoral system in semi-arid northeastern Brazil

Directory of Open Access Journals (Sweden)

R. S. C. Menezes

1999-12-01

Full Text Available Studies from some semi-arid regions of the world have shown the beneficial effect of trees in silvopastoral systems, by promoting the formation of resource islands and increasing the sustainability of the system. No data are available in this respect for tree species of common occurrence in semi-arid Northeastern Brazil. In the present study, conducted in the summer of 1996, three tree species (Zyziphus joazeiro, Spondias tuberosa and Prosopis juliflora: found within Cenchrus ciliaris pastures were selected to evaluate differences on herbaceous understory and soil chemical characteristics between samples taken under the tree canopy and in open grass areas. Transects extending from the tree trunk to open grass areas were established, and soil (0-15 cm and herbaceous understory (standing live biomass in 1 m² plots samples were taken at 0, 25, 50, 100, 150 and 200% of the average canopy radius (average radius was 6.6 ± 0.5, 4.5 ± 0.5, and 5.3 ± 0.8 m for Z. joazeiro, P. juliflora, and S. tuberosa , respectively. Higher levels of soil C, N, P, Ca, Mg, K, and Na were found under the canopies of Z. joazeiro and P. juliflora: trees, as compared to open grass areas. Only soil Mg organic P were higher under the canopies of S. tuberosa trees, as compared to open grass areas. Herbaceous understory biomass was significantly lower under the canopy of S. tuberosa and P. juliflora trees (107 and 96 g m-2, respectively relatively to open grass areas (145 and 194 g m-2. No herbaceous biomass differences were found between Z. joazeiro canopies and open grass areas (107 and 87 g m-2, respectively. Among the three tree species studied, Z. joazeiro was the one that presented the greatest potential for use in a silvopastoral system at the study site, since it had a larger nutrient stock in the soil without negatively affecting herbaceous understory biomass, relatively to open grass areas.

The clinical characteristics, therapy and outcome of 85 adults with acute lymphoblastic leukemia and t(4;11)(q21;q23)/MLL-AFF1 prospectively treated in the UKALLXII/ECOG2993 trial

Science.gov (United States)

Marks, David I.; Moorman, Anthony V.; Chilton, Lucy; Paietta, Elisabeth; Enshaie, Amir; DeWald, Gordon; Harrison, Christine J.; Fielding, Adele K.; Foroni, Letizia; Goldstone, Anthony H.; Litzow, Mark R.; Luger, Selina M.; McMillan, Andrew K.; Racevskis, Janis; Rowe, Jacob M.; Tallman, Martin S.; Wiernik, Peter; Lazarus, Hillard M.

2013-01-01

The biology and outcome of adult t(4;11)(q21;q23)/MLL-AFF1 acute lymphoblastic leukemia are poorly understood. We describe the outcome and delineate prognostic factors and optimal post-remission therapy in 85 consecutive patients (median age 38 years) treated uniformly in the prospective trial UKALLXII/ECOG2993. The immunophenotype of this leukemia was pro-B (CD10NEG). Immaturity was further suggested by high expression of the stem-cell antigens, CD133 and CD135, although CD34 expression was significantly lower than in t(4;11)-negative patients. Complete remission was achieved in 77 (93%) patients but only 35% survived 5 years (95% CI: 25–45%); the relapse rate was 45% (95% CI: 33–58%). Thirty-one patients underwent allogeneic transplantation in first remission (15 sibling donors and 16 unrelated donors): with 5-year survival rates of 56% and 67% respectively, only 2/31 patients relapsed. This compares with a 24% survival rate and 59% relapse rate in 46 patients who received post-remission chemotherapy. A major determinant of outcome was age with 71% of patients aged <25 years surviving. Younger patients had lower relapse rates (19%) but most received allografts in first complete remission. In conclusion, multivariate analysis did not demonstrate an advantage of allografting over chemotherapy but only five younger patients received chemotherapy. Prospective trials are required to determine whether poor outcomes in older patients can be improved by reduced-intensity conditioning allografts. NCT00002514 www.clinicaltrials.gov PMID:23349309

Isolation and biological activities of secondary metabolites from the sponges monanchora aff. arbuscula, aplysina sp. petromica ciocalyptoides and topsentia ophiraphidies, from the ascidian didemnum ligulum and from the octocoral carijoa riisei; Isolamento e atividades biologicas de produtos naturais das esponjas monanchora arbuscula, aplysina sp., petromica ciocalyptoides e topsentia ophiraphidites, da ascidia didemnum ligulum e do octocoral carijoa riisei

Energy Technology Data Exchange (ETDEWEB)

Kossuga, Miriam H.; Lira, Simone P. de; Nascimento, Andrea M.; Gambardella, Maria Teresa P.; Berlinck, Roberto G.S. [Universidade de Sao Paulo (USP), Sao Carlos, SP (Brazil). Inst. de Quimica]. E-mail: rgsberlinck@iqsc.usp.br; Torres, Yohandra R. [Universidade Estadual do Centro-Oeste, Guarapuava, PR (Brazil). Dept. de Quimica; Nascimento, Gislene G.F. [Universidade Metodista de Piracicaba (UNIMEP), SP (Brazil). Faculdade de Ciencias da Saude; Pimenta, Eli F.; Silva, Marcio; Thiemann, Otavio H.; Oliva, Glaucius [Universidade de Sao Paulo (USP), Sao Carlos, SP (Brazil). Inst. de Fisica; Tempone, Andre G.; Melhem, Marcia S.C. [Instituto Adolfo Lutz, Sao Paulo, SP (Brazil). Div. de Biologia Medica; Souza, Ana O. de; Galetti, Fabio C.S.; Silva, Celio L. [Universidade de Sao Paulo (USP), Ribeirao Preto, SP (Brazil). Faculdade de Medicina. Dept. de Bioquimica e Imunologia; Cavalcanti, Bruno; Pessoa, Claudia O.; Moraes, Manoel O. [Universidade Federal do Ceara (UFC), Fortaleza, CE (Brazil). Faculdade de Medicina. Dept. de Fisiologia e Farmacologia; Hajdu, Eduardo [Universidade Federal do Rio de Janeiro (UFRJ), RJ (Brazil). Museu Nacional; Peixinho, Solange [Universidade Federal da Bahia (UFBA), Salvador, BA (Brazil). Dept. de Biologia; Rocha, Rosana M. [Universidade Federal do Parana (UFPR), Curitiba, PR (Brazil). Setor de Ciencias Biologicas. Dept. de Zoologia

2007-09-15

The investigation of extracts from six species of marine invertebrates yielded one new and several known natural products. Isoptilocaulin from the sponge Monanchora aff. arbuscula displayed antimicrobial activity at 1.3 mg/mL against an oxacillin-resistant strain of Staphylococcus aureus. Five inactive known dibromotyrosine derivatives, 2 6, were isolated from a new species of marine sponge, Aplysina sp. The sponges Petromica ciocalyptoides and Topsentia ophiraphidites yielded the known halistanol sulfate A (7) as an inhibitor of the antileishmanial target adenosine phosphoribosyl transferase. The ascidian Didemnum ligulum yielded asterubin (10) and the new N,N-dimethyl-O-methylethanolamine (11). The octocoral Carijoa riisei yielded the known 18-acetoxypregna-1,4,20-trien-3-one (12), which displayed cytotoxic activity against the cancer cell lines SF295, MDA-MB435, HCT8 and HL60. (author)

Medical Surveillance Monthly Report. Volume 20, Number 10

Science.gov (United States)

2013-10-01

5. Sanderson WC, DiNardo PA, Rapee RM, Barlow DH. Syndrome comorbidity in patients diagnosed with DSM-III-R anxiety disorder. J Abnorm Psychol...anxiety becomes chronic and exaggerated, and aff ects the physi- cal and psychological health of the individual. Th e main types of anxiety dis- orders are...aff ect both physical and psychological health. Individuals with anxiety disorders commonly suff er from other mental disorders such as mood disor

Aerial organ anatomy of Smilax syphilitica (Smilacaceae

Directory of Open Access Journals (Sweden)

João Marcelo Silva

2012-09-01

Full Text Available Smilax L. in Brazil is represented by 32 taxa and it is a taxonomically difficult genus because the plants are dioecious and show wide phenotypic variation. The analysis and use of leaf anatomy characters is recognized as a frequently successful taxonomic method to distinguish between individual taxon, when floral material is absent or minute differences in flowers and foliage exist such as in Smilax. The aim of this study was to characterize the anatomical features of the aerial organs in Smilax syphilitica collected from the Atlantic Rainforest, in Santa Teresa-ES and the Smilax aff. syphilitica from the Amazon Rainforest, in Manaus, Brazil. For this, a total of three samples of Smilax were collected per site. Sample leaves and stems were fixed with FAA 50, embedded in historesin, sectioned on a rotary microtome, stained and mounted in synthetic resin. Additionally, histochemical tests were performed and cuticle ornamentation was analyzed with standard scanning electron microscopy. S. syphilitica and S. aff. syphilitica differed in cuticle ornamentation, epidermal cell arrangement and wall thickness, stomata type and orientation, calcium oxalate crystal type, and position of stem thorns. Leaf blades of S. syphilitica from the Amazon Rainforest have a network of rounded ridges on both sides, while in S. aff. syphilitica, these ridges are parallel and the spaces between them are filled with numerous membranous platelets. Viewed from the front, the epidermal cells of S. syphilitica have sinuous walls (even more pronounced in samples from the Amazon; while in S. aff. syphilitica, these cells are also sinuous but elongated in the cross-section of the blade and arranged in parallel. Stomata of S. syphilitica are paracytic, whereas in S. aff. syphilitica, are both paracytic and anisocytic, and their polar axes are directed towards the mid-vein. Calcium oxalate crystals in S. syphilitica are prisms, whereas in S. aff. syphilitica, crystal sand. Thorns

Valorización de la empresa Engie S.A.

OpenAIRE

Burgos Moquillaza, Augusto; Ángeles Sánchez, Ricardo; Montoya Roncal, Daniel

2017-01-01

El presente trabajo corresponde a la valorización de Engie a través del método de flujo de caja descontado, método de múltiplos y método de dividendos descontados. Cabe indicar que el input analizado para esta valorización corresponde a información disponible a diciembre de 2016, considerando las principales variables endógenas y exógenas que afectan directamente al flujo de caja libre de la compañía. Asimismo, se ha consultado y entrevistado a algunos de los especialistas claves del secto...

Series: Guía para no perderse nada

OpenAIRE

Cascajosa, Concepción

2013-01-01

Se dice que, desde hace años, el mejor cine está en la tele. Los guionistas americanos han abandonado a las estrellas de Hollywood para escribir el espectáculo audiovisual del siglo XXI: las ficciones por capítulos. Los productores han hecho otro tanto y hasta algunas de esas estrellas han recorrido el camino inverso al que solían hacer y han pasado de la gran pantalla a lo que un día se llamó la caja tonta. Ahora, esa caja se ha hecho inteligente y ha recuperado su prestigio gracias a las se...

Rediseño del sistema de empaque de zapatos para la marca Skechers

OpenAIRE

Roldan Vélez, Ana María; Ruiz Arenas, Santiago

2009-01-01

Tras analizar un poco la logística de la compañía, en cuanto a sus empaques, niveles de venta a nivel Colombia, cantidad de locales comerciales, etc. Los resultados mostraban que alrededor del 80% de las cajas de zapatos eran desechadas y nunca llegaban a manos de sus usuarios finales, ya que estos preferían llevar el producto en bolsas plásticas. Este hecho implica alrededor de 2500 cajas que iban a la basura cada mes y que debido a dicha cantidad se consideró como un factor problema en térm...

Kapitalstruktur och Affärsrisk

OpenAIRE

Eckerhall, Marc; Karlsson, Mårten

2001-01-01

During the past year it has been made possible to buy back a company’s outstanding stock. This is done in order to change the capital structure towards a situation with less equity. A change in capital structure means a change in the cost of capital for a company and by that a change in the value for the stockholder. This Master Thesis studies the relation between capital structure and business risk. Studying the debt to equity ratio in a company captures capital structure. Studying the volat...

Nuevos datos paleontológicos del Pleistoceno en el Valle del Manzanares (Madrid, España: Los micromamíferos del yacimiento del Arenero de Arriaga

Directory of Open Access Journals (Sweden)

Sesé, Carmen

2013-12-01

Full Text Available The micromammals from the archaeological site of the Arenero de Arriaga from the Manzanares Valley are here described. They are the Soricomorpha: Crocidura sp. and Talpa sp., the Rodentia: Eliomys quercinus quercinus, Apodemus sp., Microtus brecciensis, Microtus arvalis, Microtus duodecimcostatus and Arvicola aff. sapidus, and the Lagomorpha: Oryctolagus cuniculus. The faunal association and the evolutionary state of Microtus brecciensis and Arvicola aff. sapidus, suggest an age of the end of the Middle Pleistocene. It also indicates the existence of different biotopes: riparian, moist and dry meadows, and forest, and a temperate climate similar to the present-day climate of the Meseta.Se describe la asociación de micromamíferos del yacimiento achelense del Arenero de Arriaga del valle del Manzanares constituida por los soricomorfos: Crocidura sp. y Talpa sp., los roedores: Eliomys quercinus quercinus, Apodemus sp., Microtus brecciensis, Microtus arvalis, Microtus duodecimcostatus y Arvicola aff. sapidus, y el lagomorfo: Oryctolagus cuniculus. La asociación faunística y el estadio evolutivo de Microtus brecciensis y Arvicola aff. sapidus, indican una edad del final del Pleistoceno Medio. La asociación de micromamíferos sugiere la existencia de varios biotopos representados: ripícola, praderas húmedas y secas, y bosque, y un clima templado similar al actual de la Meseta.

Comparative study of Chalcone synthase promoters across plant families

Directory of Open Access Journals (Sweden)

Francisco Buitrago

2009-07-01

Full Text Available En la era post-genómica, el entendimiento de la regulación génica se ha convertido en un reto y una prioridad de investigación. En este trabajo realizamos un estudio comparativo de las secuencias reguladoras del gen de la chalcón sintetasa de varias familias botánicas. Veintidós secuencias de promotores de Chalcone Synthase fueron comparados teniendo en cuenta tres elementos Cis reguladores: Caja-G, Caja-H y Caja-TATA, que podrían estar actuando como una sola unidad cooperativa. Nuestra comparación muestra que estos elementos puede que se conserven en algunas especies e inclusive que se conserven a nivel de familia. Sin embargo, en algunas especies no todos los elementos Cis fueron encontrados, mostrando que no todas las especies se regulan bajo los mismos parámetros. Adicionalmente, una comparación entre promotores de una misma especie con una familia de multigenes Chs, mostró que los genes duplicados son variables en la composición del elemento Cis, sugiriendo que estos genes pueden estarse expresando de maneras diferentes.

Morfoanatomia da raiz tuberosa de Vernonia oxylepis Sch. Bip. in Mart. ex Baker - Asteraceae Morpho-anatomy of the tuberous root of Vernonia oxylepis Sch. Bip. in Mart. ex Baker - Asteraceae

Directory of Open Access Journals (Sweden)

Divina Aparecida Anunciação Vilhalva

2006-09-01

Full Text Available Várias espécies herbáceas e subarbustivas, nativas do Cerrado no Brasil, são geofitas, ou seja, sobrevivem ao período desfavorável de déficit hídrico e de baixas temperaturas, que muitas vezes coincide com incêndios, mantendo apenas a porção subterrânea. Vernonia oxylepis é uma dessas espécies e o objetivo desse estudo foi descrever a morfoanatomia da raiz tuberosa e a formação das gemas nessa raiz. Tal raiz é constituída de um eixo orientado perpendicularmente no solo, a partir do qual ramos aéreos são formados na porção proximal, situada ao nível do solo, ao longo do ciclo de vida da planta. Na porção proximal da raiz ocorre auto-enxertia da base dos ramos por ela emitidos. A raiz acumula lipídios e frutanos, apresenta ligeira contração e forma gemas reparativas; a formação das gemas adventícias se dá a partir do periciclo proliferado. Tais características poderiam ser associadas ao processo de adaptação da espécie às condições do Cerrado.Several native herbaceous and subshrub species native to the Cerrado in Brazil are geophytes, that is, they survive the unfavorable dry season and low temperatures, that sometimes coincide with fire, with only the underground system intact. Vernonia oxylepis is one of these species and the aim of this study was to describe the morpho-anatomy of the tuberous root and bud formation on this structure. The main axis of this root is perpendicular to the soil surface, and from which aerial shoots arise periodically throughout the life cycle. On the upper portion of the root, self-grafting of the shoots occurs. The root stores lipids and fructans, exhibits contraction and produces reparatory buds; adventitious buds arise from proliferated pericycle. These characteristics may be related to adaptation of this species to conditions in the Cerrado.

Metalogénesis de la veta Farallón Negro rama norte, Farallón Negro, provincia de Catamarca

OpenAIRE

Martínez, Facundo; Fogliata, Ana; Montenegro, Nicolás; Hagemann, Steffen

2014-01-01

La veta Farallón Negro Rama Norte forma parte del yacimiento Farallón Negro ubicado en Hualfín, Departamento Belén, Catamarca. Este yacimiento se encuentra dentro del Complejo Volcánico Farallón Negro de edad terciaria, que constituye la roca de caja de un sistema de vetas rico en oro. La veta Farallón Negro Rama Norte tiene rumbo general N40°O e inclinación de 65° NE, tiene una corrida de 600 m, y se extiende desde la superficie hasta unos 400 m en profundidad. La roca de caja es una monzoni...

Ethylene production and post-pollination development in Dendrobium flowers treated with foreign pollen

NARCIS (Netherlands)

Ketsa, S.; Bunya-Atichart, K.; Doorn, van W.G.

2001-01-01

Dendrobium ‘Pompadour’ flowers fade early following pollination. This is associated with increased ethylene production and early epinasty. These effects are also produced by application of 1-aminocyclopropane-1-carboxylic acid (ACC) on the stigma. Pollen (one anther each) from Ruellia tuberosa L.

Medical Surveillance Monthly Report (MSMR). Volume 18, Number 08, August 2011

Science.gov (United States)

2011-08-01

continue, and STI preven- tion eff orts should be reinforced. R E F E R E N C E S 1. Kuper H, Ye W, Broome U, et al. The risk of liver and bile duct ...hepatitis A virus (HAV) causes infl ammatory liver disease (hepatitis) in aff ected individu- als. Th e virus is spread through fecal-oral...ammatory liver disease (hepatitis B) in aff ected individ- uals. Th e virus is spread by percutaneous or mucous membrane exposure to infected blood or

A suite of microsatellite markers for genetic management of captive cracids (Aves, Galliformes).

Science.gov (United States)

Costa, M C; Camargo, C; Laganaro, N M; Oliveira, P R R; Davanço, P V; Azeredo, R M A; Simpson, J G P; Silveira, L F; Francisco, M R

2014-11-27

Cracids are medium to large frugivorous birds that are endemic to the Neotropics. Because of deforestation and overhunting, many species are threatened. The conservation of several species has relied on captive breeding and reintroduction in the wild, but captive populations may be inbred. Microsatellite tools can permit the construction of genetic pedigrees to reduce inbreeding, but only a few loci are available for this group of birds. Here, we present 10 novel polymorphic microsatellite loci and the cross-amplification of these and of 10 additional loci available in the literature in a panel of 5 cracid species, including 3 species with high conservation concern. We provide the first polymorphic loci for the jacutinga, Aburria jacutinga (N = 8), and red-billed curassow, Crax blumenbachii (N = 9), and additional loci for bare-faced curassow, C. fasciolata (N = 8), Alagoas curassow, Pauxi mitu (N = 5), and razor-billed curassow, P. tuberosa (N = 5). The average number of alleles was 2.9 for A. jacutinga, 2.7 for C. blumenbachii, 3.5 for C. fasciolata, 2.6 for P. mitu, and 5.7 for P. tuberosa. The mean expected heterozygosities were 0.42, 0.40, 0.48, 0.37, and 0.59, respectively. The average probabilities that the set of loci would not exclude a pair of parents of an arbitrary offspring were 2.9% in A. jacutinga, 1% in C. blumenbachii, 0.5% in C. fasciolata, 0.4% in P. mitu, and 0.002% in P. tuberosa suggesting that these loci may be adequate for parentage analysis and to implement ex situ genetic management plans.

Cultivo de beterraba em ambientes protegido e natural na época de verão

Directory of Open Access Journals (Sweden)

João A. Tullio

2013-10-01

Full Text Available Objetivou-se neste trabalho avaliar as respostas produtivas de beterraba cultivada em ambiente natural e sob túnel com malha de sombreamento durante a época de verão. O delineamento experimental foi blocos ao acaso com quatro repetições e os tratamentos arranjados em parcela sub-subdividida tendo, como fator primário, os ambientes de cultivo (protegido e natural, como fator secundário, as cultivares (Itapuã 202 e Tall Top Early Wonder além das épocas de colheita (13, 26, 39, 52 e 65 dias após o transplante como fator terciário. Foram avaliados número de folhas, fitomassas fresca e seca da parte aérea, fitomassa fresca da raiz tuberosa, índice de área foliar, altura da planta e presença ou não de aneis esbranquiçados na raiz tuberosa. Em cada ambiente de cultivo foram instalados sensores para medidas da radiação fotossinteticamente ativa e temperatura do ar. O cultivo de beterraba sob túnel resultou em menor fitomassa fresca da raiz tuberosa e maior fitomassa fresca da parte aérea quando comparadas àquelas do cultivo em ambiente natural. O cultivo de beterraba sob túnel coberto com telado preto 70% não apresentou vantagens em relação ao cultivo em ambiente natural no que diz respeito às características de produção e à qualidade da raiz de beterraba.

Food-resource partitioning among fish species from a first-order stream in northwestern Paraná, Brazil

Directory of Open Access Journals (Sweden)

Jislaine Cristina da Silva

2012-01-01

Full Text Available This study addressed the feeding ecology of fish fauna from a first-order stream located in a rural area. The purposes were to evaluate the influence of interspecific, seasonal and spatial factors on the diet, examine the dietary overlap, and determine the predominant food sources. Sampling was conducted in December 2007, September 2008, and March 2009, in three 50-m stretches of Itiz stream (upstream, intermediate, and downstream, through electrofishing. A total of 1,102 stomach contents were analyzed from 14 species, by the volumetric method. In general, allochthonous resources were predominant in the diets. Astyanax aff. fasciatus, Astyanax aff. paranae, Astyanax bockmanni, and Bryconamericus aff. iheringi consumed a higher proportion of plant remains, and Bryconamericus stramineus consumed predominantly Hymenoptera. The diets of Cetopsorhamdia iheringi, Characidium aff. zebra, Imparfinis schubarti, and Trichomycterus sp. consisted of aquatic insects, especially immature forms of Trichoptera, Ephemeroptera, Plecoptera, and Diptera. Hypostomus ancistroides, Hisonotus sp., Poecilia reticulata, and Rineloricaria aff. pentamaculata exploited mainly detritus, while Rhamdia quelen used a variety of items, predominantly terrestrial insects. Detrended Correspondence Analysis (DCA showed a clear distinction among the species, with different morphology and feeding tactics. The Multi-Response Permutation Procedure (MRPP supported this differentiation, and also indicated significant spatial and temporal variations in the dietary composition; the Indicator Value Method (IndVal indicated the main items that contributed to these differences. The diet overlap among species was low (Este estudo abordou a ecologia alimentar da ictiofauna de um riacho de primeira ordem situado em área rural. Os objetivos foram verificar a influência dos fatores interespecíficos, sazonais e espaciais sobre a dieta, avaliar a sobreposição alimentar, além de determinar os

The advantages of tomosynthesis for evaluating bisphosphonate-related atypical femur fractures compared to radiography.

Science.gov (United States)

Petraszko, Andrew; Siegal, Daniel; Flynn, Michael; Rao, Sudhaker D; Peterson, Ed; van Holsbeeck, Marnix

2016-05-01

To investigate the advantages of using tomosynthesis (TS) compared to radiographs in the detection, characterization, and follow-up of bisphosphonate-related atypical femur fractures (BP-AFF). Eight patients were identified retrospectively who underwent TS for radiographic findings suspicious for BP-AFF. Two radiologists independently interpreted 15 radiographs and 16 TS examinations, indicating the presence or absence of the following: (1) cortical "beaking" on radiographs, (2) radiolucent fracture line on radiographs, and (3) fracture lucency on TS corresponding to the site of radiographic abnormality. Radiation dose data were calculated for radiographs and TS using Monte Carlo analysis. There was agreement on 100 % of radiographs regarding the presence or absence of a cortical beak. Regarding the presence or absence of a fracture lucency, there was agreement on 100 % of TS examinations (Kappa = 1.0) and 73 % of radiographs (Kappa = 0.40 ± 0.24). For the 46 % of radiographs in which one or both radiologists did not visualize a fracture line, there was 100 % agreement for the presence of a fracture line on the corresponding TS. The interobserver agreement for fracture line detection was significantly higher for TS than for radiographs (p = 0.012). The effective radiation dose using TS was approximately 96 % lower compared to radiography. TS outperformed radiographs in the detection and characterization of BP-AFF. TS may also have advantages over radiography for BP-AFF follow-up through its unique ability to visualize fracture healing with lower effective radiation doses to the patient.

Entering behavior of Gasteruption brachychaetum Schrottky (Hymenoptera, Gasteruptiidae into a nest of Hylaeus Fabricius (Hymenoptera, Colletidae Comportamento de entrada de Gasteruption brachychaetum Schrottky (Hymenoptera, Gasteruptiidae em um ninho de Hylaeus Fabricius (Hymenoptera, Colletidae

Directory of Open Access Journals (Sweden)

Antonio Carlos Cruz Macedo

2012-09-01

Full Text Available Nests of Hylaeus aff. guaraniticus (Schrottky, 1906 were parasited by females of Gasteruption brachychaetum Schrottky, 1906 in trap nests in São Paulo (Brazil. This is thefirst host record of a Gasteruptiidae in the Neotropical Region. The behavior of a G.brachychaetum female entering a host's nest is described as follows: an inquiline female hovered near the host's nest, landed and detected that a female of H. aff. guaraniticus was inside the nest, waited for the host female to fly out, entered backwards into the nest, remained there for almost six minutes, and then went out the nest. The development time of immature stages of G.brachychaetum varied between 16 and 299 days.Ninhos de Hylaeus aff. guaraniticus (Schrottky, 1906foram parasitados por fêmeas de Gasteruption brachychaetum Schrottky, 1906 em ninhos-armadilha em São Paulo (Brasil. Este é o primeiro registro de hospedeiro de um Gasteruptiidae na região Neotropical. O comportamento de uma fêmea entrando no ninho do hospedeiro é descrito: a fêmea inquilina pairou sobre o ninho do hospedeiro, pousou e detectou que a fêmea de H. aff. guaraniticus estava dentro do ninho, esperou a fêmea hospedeira voar para fora do ninho, entrou de costas no ninho, permanecendo no local por quase seis minutos, em seguida, partiu voando. O tempo de desenvolvimento dos imaturos de G.brachychaetum variou entre 16 e 229 dias.

MANEJO POSTCOSECHA DE ZAPOTE MAMEY (Pouteria sapota (Jacq. H. E. Moore and Stearn Y SU IMPACTO EN LA CALIDAD DE LA FRUTA

Directory of Open Access Journals (Sweden)

Rafael Gómez-Jaimes

2012-01-01

Full Text Available En México, la mayoría de los árboles de mamey (Pouteria sapota (Jacq. H. E. Moore and Stearn tienen una altura mayor a 10 m, lo que dificulta la operación de cosecha, por lo que es frecuente el daño en los frutos. Asimismo, su conservación en distintos empaques causa deterioro en grado diferente. Cinco técnicas postcosecha de fruto se evaluaron para medir su efecto en la calidad durante el almacenamiento: T1, cosechados sin daño alguno, empacados individualmente en cajas de cartón; T2, lanzados desde 10 m de altura, capturados en costal de yute y empacados a granel en caja de plástico; T3, lanzados desde 10 m de altura a un colchón y empacados a granel en caja de plástico; T4, lanzados desde 4 m de altura a suelo húmedo y empacados a granel en caja de plástico; y T5, lanzados desde 10 m de altura, capturados en costal de yute y empacados en un costal de yute. Los frutos se almacenaron a temperatura ambiente (25 ± 1 °C; su calidad se evaluó a 1, 3, 5, 7 y 9 días después de la cosecha (DDC. El tratamiento T1 comparado con T4 y T5 (7 y 9 DDC registró la mayor firmeza, menor actividad de pectinmetilesterasa y contenido de sólidos solubles totales (°Brix; así como los menores cambios en brillo (L* y croma (C. En ángulo de tono (H se presentaron diferencias a los 9 DDC, donde T1 mostró valores mayores que T5. No hubo diferencias en porcentaje de ácido málico y pérdida de peso entre tratamientos.

A case of incomplete atypical femoral fracture with histomorphometrical evidence of osteomalacia.

Science.gov (United States)

Tsuchie, Hiroyuki; Miyakoshi, Naohisa; Nishi, Tomio; Abe, Hidekazu; Segawa, Toyohito; Shimada, Yoichi

2015-01-01

Roughly half of the femoral fracture patients diagnosed with AFF according to the criteria suggested by a task force of the American Society for Bone and Mineral Research (ASBMR) have not undergone bisphosphonate (BP) therapy. One suspected cause of such fractures is severe bone loss due to osteomalacia, but the pathogenesis remains unknown. We report a case of an 84-year-old woman with AFF not treated by BP therapy, in whom underlying osteomalacia was histologically diagnosed. The involvement of femoral curvature and spino-pelvic malaligment in the fracture in the present case was considered.

Food-resource partitioning among fish species from a first-order stream in northwestern Paraná, Brazil

Directory of Open Access Journals (Sweden)

Jislaine Cristina da Silva

Full Text Available This study addressed the feeding ecology of fish fauna from a first-order stream located in a rural area. The purposes were to evaluate the influence of interspecific, seasonal and spatial factors on the diet, examine the dietary overlap, and determine the predominant food sources. Sampling was conducted in December 2007, September 2008, and March 2009, in three 50-m stretches of Itiz stream (upstream, intermediate, and downstream, through electrofishing. A total of 1,102 stomach contents were analyzed from 14 species, by the volumetric method. In general, allochthonous resources were predominant in the diets. Astyanax aff. fasciatus, Astyanax aff. paranae, Astyanax bockmanni, and Bryconamericus aff. iheringi consumed a higher proportion of plant remains, and Bryconamericus stramineus consumed predominantly Hymenoptera. The diets of Cetopsorhamdia iheringi, Characidium aff. zebra, Imparfinis schubarti, and Trichomycterus sp. consisted of aquatic insects, especially immature forms of Trichoptera, Ephemeroptera, Plecoptera, and Diptera. Hypostomus ancistroides, Hisonotus sp., Poecilia reticulata, and Rineloricaria aff. pentamaculata exploited mainly detritus, while Rhamdia quelen used a variety of items, predominantly terrestrial insects. Detrended Correspondence Analysis (DCA showed a clear distinction among the species, with different morphology and feeding tactics. The Multi-Response Permutation Procedure (MRPP supported this differentiation, and also indicated significant spatial and temporal variations in the dietary composition; the Indicator Value Method (IndVal indicated the main items that contributed to these differences. The diet overlap among species was low (< 0.4 to around 78% of pairs, and the mean value did not vary significantly among the sites or between hydrological periods within each site. According to the null model of Pianka’s index, the values for dietary overlap were significantly higher than expected at random, showing

Neuropsychological correlates of cognitive, emotional-affective and auto-activation apathy in Alzheimer's disease.

Science.gov (United States)

Perri, Roberta; Turchetta, Chiara Stella; Caruso, Giulia; Fadda, Lucia; Caltagirone, Carlo; Carlesimo, Augusto Giovanni

2018-01-31

Apathy symptoms include different dimensions: cognitive (C), emotional-affective (E-Aff) and auto-activation; they have been related to dysfunctions of the dorsolateral, orbito-basal prefrontal cortex and the subcortical frontal connections to the basal ganglia, respectively. In Alzheimer's disease (AD), an association has been found between apathy severity and both executive deficits and atrophy of the dorso-lateral prefrontal cortex; however, it is not clear whether these associations concern only the cognitive aspects of apathy. Furthermore, whether there is an association in AD between E-aff apathy and theory of mind (ToM),the cognitive functions subsumed by the orbito-basal prefrontal cortex, has not been investigated. Aim of the study was to investigate the relationship between C, E-Aff and auto-activation apathy and performance on tasks investigating executive and ToM cognitive functions in AD. For this purpose, 20 AD patients with apathy and 20 matched controls were submitted to an executive and ToM neuropsychological assessment. Apathy was assessed with a weekly diary (ApD) created specifically to assist caregivers in quantifying the C, E-Aff and auto-activation symptomatology of apathy. Correlational analyses showed that AD patients' scores on the Modified Card Sorting Test (MCST) and Emotion Attribution tasks were correlated with most ApD scores. However, regression analyses showed that C diary scores were predicted by MCST performance, E-Aff diary scores by performance on the E-Attribution task and ApD scores measuring auto-activation apathy were predicted by both the MCST and the Emotion Attribution scores. These results confirm the co-occurrence of apathy and executive-function deficits in AD and suggest a specific association between AD patients' executive deficits and the cognitive component of apathy. Furthermore, they document, for the first time, an association between poor performance on tests assessing ToM abilities and the emotional

Lateral Cortical Thickening and Bone Heterogeneity of the Subtrochanteric Femur Measured With Quantitative CT as Indicators for Early Detection of Atypical Femoral Fractures in Long-Term Bisphosphonate Users.

Science.gov (United States)

Lee, Seung Hyun; Lee, Young Han; Suh, Jin-Suck

2017-10-01

The objective of our study was to compare subtrochanteric femur bone mineral density (BMD) and bone quality of long-term bisphosphonate (BP) users who sustained an atypical femoral fracture (AFF) with BP users who did not sustain a femoral fracture and BP-naïve patients with no history of femoral fracture using quantitative CT (QCT). Fourteen female BP users with an AFF (mean age, 72.6 years; mean duration of BP use, 6.2 years; mean body mass index, 21.9) who had undergone QCT before fracture events were sex-, age-, BP use duration-, and body mass index-matched to 14 BP users who did not sustain a fracture and 14 BP-naïve patients. The lateral cortical thickness index (CTI) and the mean BMD (BMD mean ) and SD of the BMD (BMD SD ) within the lateral cortex and within the entire cross-sectional area of the subtrochanteric femur were measured on axial QCT. Femoral neck-shaft angles were measured on the QCT scout image. Parameters were analyzed using the Kruskal-Wallis test. Lateral CTIs were greater in the BP users with an AFF (median, 0.28) than in the BP users without a femoral fracture (median, 0.21) (p = 0.038) and the BP-naïve group (median, 0.21) (p = 0.009). The lateral cortex BMD SD was significantly higher in the BP users with an AFF (median, 59.59 mg/cm 3 ) than the BP users without a femoral fracture (median, 39.27 mg/cm 3 ; p = 0.049) and the BP-naïve group (median, 31.02 mg/cm 3 ; p = 0.037). There was no significant difference among groups in lateral cortex BMD mean , BMD mean and BMD SD of the entire cross-sectional area, and femoral neck-shaft angle. Long-term BP users with a subsequent AFF had a thicker lateral cortex and higher lateral cortex BMD SD at the subtrochanteric area before the fracture on QCT than BP users who did not sustain a femoral fracture and BP-naïve patients.

Overcoming seed dormancy and early growth of seedlings of Spondias tuberosa, Arr. CâmaraSuperação de dormência de sementes e crescimento inicial de plântulas de umbuzeiro

Directory of Open Access Journals (Sweden)

Janete Motta da Silva Gonzaga

2012-08-01

Full Text Available Pre-germination treatments such as scarification and the use of growth regulators can provide the dormancy breaking in seeds and enhance the emergence and development of seedlings. The aim of this study was to determine appropriate treatments to overcome seed dormancy and enhance the initial growth of seedlings of Spondias tuberosa. We used a randomized design in factorial 2 x 4, with the following factors: seeds scarified or not scarified and then soaked in water or aqueous solutions of gibberellin, cytokinin and ethylene, with 4 replicates and 15 seeds. There was no significant interaction between scarification treatments and use of growth regulators. Mechanical scarification and soaking seeds in solutions containing umbuzeiro growth regulators does not increase the percentage of seedling emergence, however soaking in a solution of Ethrel at 100 ppm provides higher speed of emergence and root development. Tratamentos pré-germinativos, como a escarificação e o uso de reguladores de crescimento, podem proporcionar a superação de dormência em sementes e incrementar a emergência e o desenvolvimento de plântulas. O objetivo da presente pesquisa foi determinar tratamentos adequados para a superação da dormência de sementes e potencialização do crescimento inicial de plântulas de umbuzeiro. Utilizou-se o delineamento inteiramente casualizado, em fatorial 2 x 4, sendo os fatores: sementes escarificadas ou não escarificadas e, posteriormente, imersas em água ou soluções aquosas de giberelina, citocinina ou etileno, com 4 repetições de 15 sementes. Não houve interação significativa entre os tratamentos escarificação e uso de reguladores de crescimento. A escarificação mecânica e a embebição de sementes de umbuzeiro em soluções contendo reguladores de crescimento não aumenta a percentagem de emergência de plântulas, entretanto a embebição em solução de Ethrel a 100 ppm proporciona maior velocidade de emergência e

Application of MSSIP-2 nutrient in marine phytoplankton culture to support the production of biomass for biofuel industry

Science.gov (United States)

Taba, Paulina; Kasim, S.; Raya, I.

2018-03-01

A research on the application of MSSIP-2 nutrient in marine phytoplankton culture has been conducted to produce biomass to be used as raw material for biofuel. Marine phytoplankton was cultivated using the nutrient media and the growth rates were studied by measuring the cell solidity at various growth times. Seven phytoplanktons; Isochrysis aff galbana, Spirulina sp., Thalassiosira sp., and Nitzchia sp., Chlorella vulgaris, Chaetoceros calcitrans and Isochrysis tahiti were used in the research. The experimental temperature, salinity, and pH of the media were measured and the specific growth rates of phytoplanktons were determined using the first order rate equation. Results showed that the highest specific growth rate was given by Chlorella vulgaris (0.0322 cells/hour) and the lowest one was by Thalassiosira sp. (0.0277 cells/hour). The highest biomass weight was obtained from Isochrysis aff galbana (0.329 g), whereas the lowest one (0.27 g) was from Nitzchia sp. The carbohydrate content was various, the highest content was 34.07% found in Isochrysis aff galbana and the lowest was 28.16% in Thalassiosira sp.

PRODUÇÃO DE BEBIDA LÁCTEA TIPO UMBUZADA COMO ALTERNATIVA DE RENDA PARA O PEQUENO AGRICULTOR DO SUDOESTE BAIANO

OpenAIRE

Rezende, Adriano Alves de; Guimaraes, Gislaine Fernandes; Miyaji, Mauren; Fontan, Gabrielle Cardoso Reis; Bonomo, Renata Cristina Ferreira

2007-01-01

Este trabalho tem como objetivo apresentar os resultados obtidos por meio da pesquisa desenvolvida no sudoeste baiano para integrar a produção extrativista do umbu com o aproveitamento de subprodutos do leite, na qual se utiliza o soro dequeijo para a produção de uma bebida láctea tipo umbuzada. São abordados, ainda, o aspecto financeiro com o intuito de demonstrar a viabilidade econômica da produção da bebida e o aspecto sócio econômico do projeto, que tem um como foco a geração de renda ext...

What is the importance of open habitat in a predominantly closed forest area to the dung beetle (Coleoptera, Scarabaeinae assemblage?

Directory of Open Access Journals (Sweden)

Fábio C. Costa

2013-09-01

Full Text Available What is the importance of open habitat in a predominantly closed forest to the dung beetle assemblage? The Atlantic Forest in Brazil is one of the most highly disturbed ecosystems and is mainly represented by fragmented areas. However, in places where human disturbances have ceased, certain areas are showing a natural regeneration pattern. The aim of the present study was to determine how the dung beetle assemblage responds to distinct habitat structures in a fragment of Atlantic Forest. For such, open and closed forest areas were sampled in a fragment of the Atlantic Forest in the northeastern region of Brazil. Pitfall traps baited with excrement and carrion were used to collect the beetles. A total of 7,267 individuals belonging to 35 species were captured. Canthon chalybaeus and C. mutabilis were restricted to open areas. Nearly 90% of the individuals of C. aff. simulans and Deltochilum aff. irroratum were identified in these areas. A higher percentage (> 50% of Canthon staigi, Dichotomius aff. depressicolis and D. aff. sericeus occurred in closed areas. Abundance differed between areas, with higher values in closed areas. Richness was not influenced by the habitat structure. NMDS ordination exhibited the segregation of areas and ANOSIM confirmed that this variable explained the assemblage of dung beetle species. The findings of the present study validate that open areas are associated to more restrictive conditions, limiting a higher abundance of dung beetle. Although situated near preserved fragments, the studied open areas increase the heterogeneity of the general landscape.

Population structure and sexual maturity of the calico box crab Hepatus epheliticus Linnaeus (Brachyura, Hepatidae from Yucatan Peninsula, Mexico Estructura poblacional y madurez sexual en el cangrejo caja moteado Hepatus epheliticus Linnaeus (Brachyura, Hepatidae procedente de la Península del Yucatán, México

Directory of Open Access Journals (Sweden)

Patricio Hernáez

2012-07-01

Full Text Available The calico box crab Hepatus epheliticus is an abundant species from shallow and continental shelf waters of the Atlantic coast of USA and Mexico. Information about population structure and sexual maturity is absent, even though this crab is caught to be used as bait for the octopus fishery in the Campeche Bank, Mexico. In order to achieve such information, a total of 768 individuals were collected from January to March 2010 through baited traps installed in the Yucatan Peninsula, Mexico. Our results showed that sex ratio is biased towards more males than females (1:0.55, contradicting to that reported in other brachyuran crabs. The absence of ovigerous females suggests that they did not enter into the traps during embryogenesis. Males reached a larger maximum size than females (64.0 ± 6.15 and 58.4 ± 5.60 mm carapace width, respectively. The general scheme of growth being positive allometric throughout ontogeny of both sexes. Males presented a transition phase from juveniles to adult corresponding to the puberty moult. The estimation of the onset of functional sexual maturity revealed a steady situation for the population, with 21.5 and 13.8% of males and females, respectively, morphologically immature at the time of catch. This study constitutes the first report on population structure and sexual maturity in a population of the calico box crab H. epheliticus.El cangrejo caja moteado Hepatus epheliticus es un abundante braquiuro perteneciente a la familia Hepatidae, distribuido desde aguas someras hasta la plataforma continental en la costa atlántica de Estados Unidos y México. La información sobre su demografía poblacional y madurez sexual es actualmente inexistente, aun cuando esta especie es intensamente capturada como carnada en la pesquería del pulpo del estado de Campeche, México. Entre enero y marzo de 2010, se colectaron 768 especímenes usando trampas instaladas en la Península de Yucatán, México. Los resultados mostraron una

Franchising i den svenska fastighetsmäklarbranschen : Franchising in the Swedish real estate industry

OpenAIRE

Narkander, Christoffer; Ilchishina, Elena

2010-01-01

Sammanfattning Bakgrund Idag blir det allt mer vanligt att mindre enskilda mäklarbyråer ansluter sig till de stora franchisekedjorna. Anslutningen innebär att den tidigare enskilde aktören lämnar sitt varumärke och sin tidigare affärsidé för att istället ta del av ett välkänt varumärke och ett framgångsrikt affärskoncept. Syfte & metod Syftet med uppsatsen är att studera vilka positiva och negativa effekter franchising bidrar med i den svenska fastighetsmäklarbranschen samt vilka ekonom...

Dermatologia comparativa Comparative Dermatology

Directory of Open Access Journals (Sweden)

Hiram Larangeira de Almeida Jr

2005-06-01

Full Text Available Demonstra-se o quadro exuberante dos angiofibromas faciais em paciente do sexo masculino, de 32 anos, com esclerose tuberosa, os quais podem ser comparados com amoras.The impressive facial angiofibromas, from a 32 year-old male paciente, with the classical features of tuberous sclerosis, were compared with mulberries.

Novel synthetic products from the common milkweed (Asclepias syriaca L) and their potential in the rural farm economy

Science.gov (United States)

The common milkweed is of the family Asclepiadaceae which comprises over 200 genera and 2500 species including Asclepias syriaca L and its near relatives, A. speciosa and A. tuberosa. Asclepias syriaca, or the common milkweed, is a perennial that is native to the Americas and is so named because of...

LA EXPANSIÓN TERRITORIAL COMO FACTOR MOTIVADOR DE LA REESTRUCTURACIÓN DEL SISTEMA FINANCIERO ESPAÑOL: EL CASO DE LAS CAJAS DE AHORROS Y LAS COOPERATIVAS DE CRÉDITO / THE TERRITORIAL EXPANSION AS A MOTIVATING FACTOR OF THE RESTRUCTURING OF THE SPANISH FINANCIAL SYSTEM: THE CASE OF SAVING BANKS AND CREDIT COOPERATIVES

Directory of Open Access Journals (Sweden)

Milagros GUTIÉRREZ FERNÁNDEZ

2012-01-01

Full Text Available La actual crisis financiera internacional está actuando como catalizador de un profundo proceso de cambio en el sector bancario español que está afectando también a las entidades de crédito de la Economía Social: cajas de ahorros y cooperativas de crédito. Su modelo de banca “minorista”, centrada en la cercanía al cliente, se ha visto acompañado en los últimos años de un fuerte proceso de expansión geográfica que ha supuesto un sobredimensionamiento de su red de sucursales. Sin embargo, como consecuencia de las actuales circunstancias de la economía española en general, y del sistema bancario en particular, dicha estrategia de desarrollo interno no parece sostenible, siendo necesario que se produzca un redimensionamiento del sector, para ver recuperada la confianza en el sistema y para que éste vuelva a ser considerado como uno de los más solventes del mundo. Bajo este enfoque, el objetivo de este trabajo es analizar las distintas estrategias de expansión territorial desarrolladas por dichas entidades con el objetivo de plasmar su situación actual y comprender por qué es necesaria la reestructuración del sector. Para ello se ha empleado tanto el análisis descriptivo como el econométrico, utilizando en todo momento los datos que presentan la Confederación Española de Cajas de Ahorros (CECA y la Unión Nacional de Cooperativas de Crédito (UNACC en sus anuarios estadísticos. / The current financial international crisis is acting as catalyst of a deep process of change in the Spanish banking sector which is affecting also the credit institutions of the Social Economy: saving banks and credit cooperatives. These entities share a model of "retail" banking, centered on the nearness to the client, that has been accompanied in the last years of a strong process of geographical expansion which has supposed an oversizing of its network of branches. Nevertheless, as a consequence of the current circumstances of the Spanish

PODER RELATIVO DO LUCRO CONTÁBIL E DO FLUXO DE CAIXA DAS OPERAÇÕES PARA PREVER FLUXOS DE CAIXA FUTUROS: UM ESTUDO EMPÍRICO NO BRASIL

Directory of Open Access Journals (Sweden)

PAULO ROBERTO B. LUSTOSA

2007-01-01

Full Text Available Este artículo evalúa la eficacia de la previsión de flujos futuros, para uno y dos años más adelante, de cuatro medidas de desempeño de la empresa, siendo dos de flujo de caja y dos de beneficio, desde medidas ex post del Flujo de Caja de las Operaciones (FCO, separado y en conjunto con la variación de las ubicaciones (accruals de corto plazo ( ∆ AcB - cpB, y del Beneficio Líquido contable (LL. La metodología de previsión es del tipo externo a la muestra. Son hechas varias previsiones anuales y bianuales transversales para las 92 empresas que componen la muestra, a lo largo de los años de 1996 a 2004. Los desvíos (errores medios absolutos de previsión, la Mediana de los errores y las correlaciones medias entre los valores reales y proyectados de las variables son apurados y comparados entre sí para fines de verificación de la eficacia de previsión de los flujos futuros de cada un0 de los tres modelos. Los resultados revelan que: (1 LL es superior al FCO para prever el Beneficio Líquido del año siguiente, pero, al contrario, FCO es superior al LL para prever el Beneficio Líquido dos años hacia adelante; (2 la combinación de las ubicaciones de cor-to plazo (∆AcBcpB con el FCO no mejoran las previsiones que son hechas apenas con el FCO, indicando que el Flujo de Caja de las Operaciones es más eficaz para prever flujos futuros de caja y de beneficio que el capital circulante líquido; y (3 el Beneficio Operacional (LEO, como es definido en la legislación societaria brasileña, es de difícil previsión.

Atypical Femur Fractures in Patients Treated with Bisphosphonates: Identification, Management, and Prevention

Directory of Open Access Journals (Sweden)

Judith Sarah Bubbear

2016-10-01

Full Text Available Osteoporosis is a common condition with significant health care costs. First-line therapy is with bisphosphonates, which have proven anti-fracture efficacy. Around 10 years after the introduction of bisphosphonates reports began to be published of atypical femoral fractures (AFFs that may be associated with this therapy. These fractures are associated with significant morbidity although lower mortality than the more common osteoporotic neck-of-femur fractures. A case definition has been described to allow identification of this class of fracture. Further work has established a high relative risk of AFFs in patients treated with bisphosphonates, but a low absolute risk in comparison to that of osteoporotic fractures. Proposed pathological mechanisms include low bone turnover states leading to stress/insufficiency fractures. Clinicians should be aware of the risk of AFFs and in particular the high rate of prodromal thigh/groin pain that warrants investigation in a patient receiving a bisphosphonate. If an incomplete fracture is diagnosed then bisphosphonate therapy needs to be stopped and prophylactic surgery may be considered. Due to these rare side effects patients on bisphosphonates require regular review, and this is particularly advised after 5 years of oral or 3 years of intravenous therapy.

Descubrimiento de mamíferos fósiles de edad Lujanense (Pleistoceno tardío en el "Desierto" de La Tatacoa (Huila, Colombia Descubrimiento de mamíferos fósiles de edad Lujanense (Pleistoceno tardío en el "Desierto" de La Tatacoa (Huila, Colombia

Directory of Open Access Journals (Sweden)

Villaroel A. Carlos

1989-09-01

Full Text Available A small sedimentary basin, at the Los Hoyos locality, has been discovered with in the Tatacoa "desert". Taxonomic studies are not yet complete but at least two forms related to living species have been identified: Sylvilagus aff. floridanus and Tayassu aft. tajacu. A third form is referred to family Gomphotheriidae. Based on this small fauna, the locality can be correlated with the Lujanian Land Mammal "Age". Aspects of the paleoecology and paleogeography of the locality are also brieflydiscussed. Se da a conocer el descubrimiento de una pequeña cuenca sedimentaria con mamíferos fósiles, en el lugar denominado Los Hoyos, dentro del ámbito del "desierto" de La Tatacoa. Aunque los estudios taxonómicos de los fósiles no están aún completos, no cabe duda de que se trata, de dos formas afines a especies vivientes, identificadas como Sylvilagus aff. floridanus y Tayassu aff. tajacu , y una tercera forma, referida a la familia Gomphotheriidae. Con base en esta pequeña fauna, se data el yacimiento como de edad Lujanense, además se anotan brevemente aspectos paleoecológicos y paleogeográficos.

Comparative anthelmintic activity investigation of selected ethno-medicinal weeds

Science.gov (United States)

Pueblos, Kirstin Rhys S.; Bajalla, Mark; Pacheco, Dixie; Ganot, Sheila; Paig, Daisy; Tapales, Radyn; Lagare, Jeanne; Quimque, Mark Tristan J.

2017-01-01

Helminth infections are one of the seriously neglected potent diseases in many parts of the world. The problems of parasitic helminthes becoming resistant to currently available anthelmintic drugs pose a challenge for the search - relying on natural products - for new and better anthelmintics. In this paper, four abundant Philippine weeds: Chrysopogon aciculatus Trin. Cyperus brevifolius Rottb., Ruellia tuberosa Linn. and Saccharum spontaneum Linn. were investigated for their anthelmintic activities to establish basis of their folkloric claim. The hexane-soluble and chloroform-soluble extracts were obtained through sequential solvent partitioning of the crude ethanolic extract of the air-dried aerial part of each plant sample. Meanwhile, the decoction was obtained from fresh aerial part of the plant samples. All extracts were then subjected to in vitro anthelmintic screening at different concentration as per method of Ghosh, et al. against African nightcrawler earthworms (Eudrillus euginiae) in which the activity of the extracts was determined by correlation with time. The anthelmintic bioassay results revealed a dose-dependent toxicity relationship. It indicated relatively low anthelmintic activities of the decoction of the four plant samples as compared to their corresponding crude ethanol extracts. Among the crude ethanol extracts, C. brevifolius (CBE) gave fastest time to bring about paralysis and death to the test organisms at all concentrations tested. For the hexane extracts, R. tuberosa (RTH) gave better activity among other plant samples. Lastly, among the chloroform-soluble extracts, both that of C. brevifolius (CBC) and R. tuberosa (RTC) comparably showed strongest anthelmintic activities at all tested concentrations, thus, exhibited best anthelmintic activity that is remarkably comparable to the positive control, Mebendazole at the highest concentration tested. In fact, CBC and RTC showed highest anthelmintic potential compared to all extracts tested in

Effect of diesel generator exhaust pollutants on growth of Vinca ...

African Journals Online (AJOL)

The effects of exhaust pollutants of generator on root and shoot length, root and shoot weight, number of leaflets and leaf area, leaf and total plant dry weight of Vinca rosea and Ruellia tuberosa were studied. The treatment of exhaust pollutants produced significant effects on root, shoot growth, number of leaflet and leaf ...

Diffusa spänningar eller spännande tillväxt? : Företagsledning i tider av snabb förändring

OpenAIRE

Netz, Joakim

2013-01-01

Ibland påstås snabba förändringar i omvärlden utmana storföretagens överlevnad mer än någonsin tidigare. I studien undersöks hur stora teknikbaserade företag förnyas genom utveckling av nya affärsområden. Sådana förnyelseprocesser har aktualiserats av informationsteknologiers snabba utveckling, en utveckling som fått till följd att etablerade handlingsmönster i affärsutveckling behöver omprövas. I snabbföränderliga miljöer utvecklas spänningar i organisationer, något som tongivande teori anta...

El flujo de caja como determinante de la estructura financiera de las empresas españolas. Un análisis en tiempos de crisis || Cash flow as determinant of financial structure of Spanish firms. Analysis in a crisis period

Directory of Open Access Journals (Sweden)

Rodríguez-Masero, Natividad

2016-06-01

Full Text Available Este trabajo propone el uso de la variable Flujo de Caja Contable de la Explotación (FCE como un factor con incidencia significativa en la estructura financiera de la empresa española en un periodo (2008-2012 caracterizado por dificultades para la financiación empresarial. En la literatura previa son escasos los trabajos que tienen en cuenta esta variable, midiendo la liquidez en la mayoría de los casos con datos obtenidos del Balance y la Cuenta de Resultados y no del Estado de Flujos de Efectivo (EFE. Metodológicamente se usa un análisis multivariante con datos de panel aplicados a una muestra de grandes empresas españolas no cotizadas. Adicionalmente, este trabajo se inserta en el debate teórico existente en la literatura acerca de los factores determinantes de la estructura financiera de las empresas. Los resultados indican que un modelo basado en datos del EFE, principalmente el FCE tiene capacidad predictiva de dicha estructura financiera. || This paper proposes the use of the Cash Flow from Operations (CFO obtained from Cash Flow Statement (CFS as a factor with significant impact on the financial structure of the Spanish firms in a period (2008-2012 that was characterized by dificulties in business finance. In the previous literature, there are few studies that consider this variable, since liquidity in most cases was measured with data obtained from the Balance Sheet and the Income Statement. Methodologically, we have used a multivariate panel data analysis applied to a sample of large Spanish companies not quoted on the stock exchange. Additionally, this work embeds into the theoretical debate existing in the literature about the determinants of the financial structure of firms. The results indicate that a data model based on figures from CSF, mainly the CFO, has predictive ability of the financial structure.

LAS CAJAS DE AHORRO Y LAS COOPERATIVAS DE CRÉDITO ANTE LA CRISIS: EVOLUCIÓN EN SU PRESENCIA TERRITORIAL Y EN SU OPERATIVA / SAVING BANKS AND CREDIT CO-OPERATIVES FACED WITH THE CRISIS: THE CHANGES IN THEIR LOCALIZATION AND PERFORMANCE

Directory of Open Access Journals (Sweden)

Jesús PAÚL GUTIÉRREZ

2010-01-01

Full Text Available El artículo estudia el impacto que la crisis económica y financiera está teniendo en las entidades bancarias de carácter social, en especial en sus estrategias de financiación y de localización territorial. En primer lugar, se analizan las crecientes necesidades de financiación de la economía española durante el pasado ciclo expansivo y el decisivo papel de las instituciones financieras en la canalización del ahorro externo. Posteriormente, se analiza la evolución de la presencia territorial de las cajas de ahorro y de las cooperativas de crédito, así como la distribución de sus operaciones activas y pasivas. El análisis se realiza diferenciando dos períodos, uno desde el inicio de los noventa hasta el verano de 2007, momento en el que se inicia la crisis, y un segundo período, desde el cuarto trimestre de 2007 hasta la actualidad. / This paper examines the impact that the international economic and financial crisis is having on the behaviour of Spanish social banking institutions, particularly in their funding and localization strategies. First of all, we analyse the growing net borrowing of the Spanish economy in the former economic expansion cycle and how the national financial institutions were the primary source of foreign financing. Secondly, we analyse the evolution of territorial localization of saving banks and credit co-operatives, and of their lending and borrowing transactions. In this analysis we are going to difference two periods: since the beginning of nineties until August 2007, the start of the international financial, and a second period since the fourth quarter 2007 until now.

Habitat use by a tree frog species of Scinax (Amphibia, Hylidae at an urban forest fragment from south-eastern Brazil Uso do hábitat por uma espécie de Scinax (Amphibia, Hylidae em um fragmento florestal urbano no sudeste do Brasil

Directory of Open Access Journals (Sweden)

Conrado A. B. Galdino

2008-09-01

Full Text Available We studied the pattern of habitat use by the tree frog Scinax aff. perereca. Fieldworks were performed from August 1996 to August 1997 at Parque das Mangabeiras, Belo Horizonte, State of Minas Gerais, southeastern Brazil. Calling males were observed in September, October and December 1996, February to April and June 1997. Females were found only in October 1996. Specimens were found perched on vegetation, on the ground or on stones near waterfall. At Parque das Mangabeiras, S. aff. perereca occupied nine types of substrata. The most frequently used substrata were shrubs, stones at the stream edges, and fallen trunks. The pattern of spatial occupation varied among months. Males were found calling in aggregations on the vegetation and spatial niche breadth was related to species abundance.No presente estudo é tratado o uso do hábitat por Scinax aff. perereca, durante o período de agosto de 1996 a agosto de 1997 em uma área de mata urbana em Belo Horizonte, Minas Gerais, sudeste do Brasil. Machos em atividade de vocalização foram encontrados em setembro, outubro e dezembro de 1996 e de fevereiro a abril e junho de 1997. As fêmeas foram capturadas apenas em outubro de 1996. Os indivíduos foram encontrados em galhos da vegetação no solo ou em pedras próximas a quedas de água. Na área estudada, S. aff. perereca usa nove tipos de substratos, sendo os mais freqüentes a vegetação herbácea, pedras na margem do riacho e troncos caídos. O padrão de ocupação espacial variou ao longo dos meses. Os machos foram encontrados vocalizando em agregados e a largura de nicho espacial foi diretamente relacionada a abundância da espécie.

Bovidae (artiodactyla, mammalia del mioceno medio de Tarazona de Aragon (depresión del Ebro, provincia de Zaragoza

Directory of Open Access Journals (Sweden)

Pereda-Suberbiola, X.

2001-04-01

Full Text Available In this paper cranial, dental and postcraneal fossil remains of the Bovidae family from Tarazona de Aragón are described. There are two forms in this Middle Miocene paleontological site of the Ebro Basin according to the metric and morphological characteristics of the dentition and hom cores. One form is referred to Eotragus and classified as E. aff. sansaniensis, showing more developed features than the other Iberian forms of the same genus. The other form is classified provisionally as aff. Tethytragus because it is quite similar to the Iberian Tethytragus langai and differs from Eotragus. The two bovids from Tarazona show differences in size, hypsodoncy and dental morphology, especially the differences of development and prominence of the styles/stylideds and ribs are obvious.Se describen restos fósiles dentarios, craneales y postcraneales pertenecientes a la familia Bovidae del yacimiento de Tarazona de Aragón. Según las características morfológicas y métricas de la dentición y los núcleos óseos, existen dos formas en este yacimiento del Mioceno medio de la Cuenca del Ebro. Una ha sido atribuida al género Eotragus y clasificada como E. aff. sansaniensis, mostrando características más derivadas que el resto de las formas ibéricas del mismo género. La otra se clasifica, provisionalmente, como aff. Tethytragus, ya que guarda similitudes con la especie ibérica Tethytragus langai y diferencias evidentes con respecto a Eotragus. Los dos taxones se diferencian netamente respecto a la talla, hipsodoncia y morfología de la dentición; sobre todo, las diferencias de desarrollo y prominencia de los estilos/estílidos y costillas mismos son evidentes.

Floral traits driving reproductive isolation of two co-flowering taxa that share vertebrate pollinators

Science.gov (United States)

Queiroz, Joel A.; Quirino, Zelma G. M.; Machado, Isabel C.

2015-01-01

Floral attributes evolve in response to frequent and efficient pollinators, which are potentially important drivers of floral diversification and reproductive isolation. In this context, we asked, how do flowers evolve in a bat–hummingbird pollination system? Hence, we investigated the pollination ecology of two co-flowering Ipomoea taxa (I. marcellia and I. aff. marcellia) pollinated by bats and hummingbirds, and factors favouring reproductive isolation and pollinator sharing in these plants. To identify the most important drivers of reproductive isolation, we compared the flowers of the two Ipomoea taxa in terms of morphometry, anthesis and nectar production. Pollinator services were assessed using frequency of visits, fruit set and the number of seeds per fruit after visits. The studied Ipomoea taxa differed in corolla size and width, beginning and duration of anthesis, and nectar attributes. However, they shared the same diurnal and nocturnal visitors. The hummingbird Heliomaster squamosus was more frequent in I. marcellia (1.90 visits h−1) than in I. aff. marcellia (0.57 visits h−1), whereas glossophagine bats showed similar visit rates in both taxa (I. marcellia: 0.57 visits h−1 and I. aff. marcellia: 0.64 visits h−1). Bat pollination was more efficient in I. aff. marcellia, whereas pollination by hummingbirds was more efficient in I. marcellia. Differences in floral attributes between Ipomoea taxa, especially related to the anthesis period, length of floral parts and floral arrangement in the inflorescence, favour reproductive isolation from congeners through differential pollen placement on pollinators. This bat–hummingbird pollination system seems to be advantageous in the study area, where the availability of pollinators and floral resources changes considerably throughout the year, mainly as a result of rainfall seasonality. This interaction is beneficial for both sides, as it maximizes the number of potential pollen vectors for plants and

Medio ambiente, comportamento y aprendizaje en ratones adultos

Directory of Open Access Journals (Sweden)

Luis Miguel Garcia-Segura

1977-03-01

Full Text Available Se analiza el efecto que tiene sobre el ratón adulto el ser sometido a diferentes situaciones ambientales. Para ello se colocan ratones adultos en grupos de 12 en cajas que contienen rampas, pasarelas, pasadizos y objetos diversos, que se cambiaban de posición relativa varias veces por semana. Otros ratones se colocaron en grupos de 4 en cajas más pequenas y sin ninguno de estos objetos. Despues de estar 60 dias en estas condiciones se estúdio el comportamiento explorador de los ratones y su capacidad de aprendizaje de un laberinto complejo. Se observó una diferencia significativa entre los dos grupos de ratones ,tanto en su comportamiento explorador como en el tiempo empleado en resolver el laberinto y el número de ratones que lo resolvian en cada una de 10 pruebas sucesivas.

Entering behavior of Gasteruption brachychaetum Schrottky (Hymenoptera, Gasteruptiidae into a nest of Hylaeus Fabricius (Hymenoptera, Colletidae

Directory of Open Access Journals (Sweden)

Antonio Carlos Cruz Macedo

2012-09-01

Full Text Available Nests of Hylaeus aff. guaraniticus (Schrottky, 1906 were parasited by females of Gasteruption brachychaetum Schrottky, 1906 in trap nests in São Paulo (Brazil. This is thefirst host record of a Gasteruptiidae in the Neotropical Region. The behavior of a G.brachychaetum female entering a host's nest is described as follows: an inquiline female hovered near the host's nest, landed and detected that a female of H. aff. guaraniticus was inside the nest, waited for the host female to fly out, entered backwards into the nest, remained there for almost six minutes, and then went out the nest. The development time of immature stages of G.brachychaetum varied between 16 and 299 days.

Download this PDF file

African Journals Online (AJOL)

RAYAN_

'pay now, argue later' rule, and proposes practical legal reforms through which the analytical .... Standard Bank Plc. [2008] EWCA Civ. 819. 20 Gold Coast v. Caja de ..... rules in Nigeria which addresses the problem of abusive calls on demand.

Ostracoda (Arthropoda, Crustacea from the Riachuelo Formation, Sergipe-Alagoas Basin, Brazil, Upper Aptian-Albian

Directory of Open Access Journals (Sweden)

Lucas Silveira Antonietto

2016-11-01

Full Text Available The Sergipe-Alagoas Basin has one of the most complete, exposed lithological successions of the Cretaceous period in the continental margin of Brazil. It captures several phases of the evolution of the South Atlantic Ocean, including rift, gulf and drift. The upper Aptian–Albian Riachuelo Formation corresponds to the first stages of the southern proto-Atlantic Ocean invasion in that basin. The present study reviews the taxonomic identification and ecology of 39 ostracod species of this formation, proposing a new genus – Gabonorygma gen. nov. – and three new species – Praebythoceratina deltalata sp. nov., Gabonorygma sergipana gen. et sp. nov. and Brachycythere smithsoniana sp. nov. Other taxa include Conchoecia? sp. 1, Cytherella sp. 1, C. besrineensis comb. nov., Cytherelloidea aff. globosa, C. btaterensis, Bairdoppilata sp. 1, Bairdoppilata sp. 2, B. comanchensis comb. nov., B. pseudoseptentrionalis, Robsoniella falklandensis, Cetacella sp. 1, Paracypris eniotmetos, Harbinia sinuata?, H. crepata, Liasina sp. 1, Praebythoceratina amsittenensis comb. nov., P. trinodosa comb. nov., Patellacythere sp. 1, P. shimonensis comb. nov., Xestoleberis? sp. 1, Xestoleberis? sp. 2, Apatocythere? sp. 1, Neocythere? aff. pseudovanveeni, N. (Physocythere tenuis, Aracajuia antiqua comb. nov., A. benderi, A. fragilis comb. nov., Eocytheropteron sp. 1, Metacytheropteron aff. minuta, Microceratina? sp. 1, M. azazoulensis, Veenia guianensis, Algeriana? sp. 1, Quasihermanites? sp. 1 and Sergipella viviersae.

Crisis Bancarias Recientes en Argentina: Un Modelo y Evidencia Empírica Asociada

Directory of Open Access Journals (Sweden)

Flavio Ernesto Buchieri

2009-12-01

Full Text Available El documento presenta la validación econométrica del modelo expuesto en la revista Ciencias Económicas nº 6. Vol. 2, UNL, que intenta explicar el comportamiento del sistema bancario argentino en la pasada la década del ’90. En dicho sistema, el BCRA contaba con un margen acotado para actuar como Prestamista de Última Instancia –PUI– al generarse una crisis bancaria, situación dada por la propia conformación de la Caja de Conversión de nuestro país. Anta la ocurrencia de dichos sucesos, la hipótesis de trabajo expresa que el sistema bancario padece de una inestabilidad endógena ante la ocurrencia de una corrida, dado que al BCRA puede quedar atrapado en la disyuntiva de tener que salvar al sistema financiero ó a la Caja de Conversión.

Activity of Medicinal Plant Extracts on Multiplication of Mycobacterium tuberculosis under Reduced Oxygen Conditions Using Intracellular and Axenic Assays

Directory of Open Access Journals (Sweden)

Purva D. Bhatter

2016-01-01

Full Text Available Aim. Test the activity of selected medicinal plant extracts on multiplication of Mycobacterium tuberculosis under reduced oxygen concentration which represents nonreplicating conditions. Material and Methods. Acetone, ethanol and aqueous extracts of the plants Acorus calamus L. (rhizome, Ocimum sanctum L. (leaf, Piper nigrum L. (seed, and Pueraria tuberosa DC. (tuber were tested on Mycobacterium tuberculosis H37Rv intracellularly using an epithelial cell (A549 infection model. The extracts found to be active intracellularly were further studied axenically under reducing oxygen concentrations. Results and Conclusions. Intracellular multiplication was inhibited ≥60% by five of the twelve extracts. Amongst these 5 extracts, in axenic culture, P. nigrum (acetone was active under aerobic, microaerophilic, and anaerobic conditions indicating presence of multiple components acting at different levels and P. tuberosa (aqueous showed bactericidal activity under microaerophilic and anaerobic conditions implying the influence of anaerobiosis on its efficacy. P. nigrum (aqueous and A. calamus (aqueous and ethanol extracts were not active under axenic conditions but only inhibited intracellular growth of Mycobacterium tuberculosis, suggesting activation of host defense mechanisms to mediate bacterial killing rather than direct bactericidal activity.

Cost minimization analysis at the Hospital Mexico in the Caja Costarricense de Seguro Social for the accommodation of patients with radiotherapy with linear accelerator: shelter vs transfers

International Nuclear Information System (INIS)

Cespedes Quiros, Yehudi; Pereira Barrantes, Edgar

2010-01-01

Patients with oncological pathology have attended daily in sessions for several weeks in the linear accelerator radiation therapy. Persons subject to this intervention have moved to the Hospital Mexico of the social security of Costa Rica, place that centralizes this treatment. The Caja Costarricense de Seguro Social (CCSS) has considered two options depending on the place of origin of users: bear the costs of commuting from the area of habitual residence, or place them temporarily in a shelter provided by the institution; the CCSS has chosen the first alternative. This research has consisted of a cost-minimization analysis between these two alternatives. The study population are patients with oncological pathology attending sessions of radiotherapy with linear accelerator at the Hospital Mexico in the first half of 2009 using ambulances of Cruz Roja Costarricense. The size of the study population is 107 persons, the total number of transferred recorded in the Fondo Rotatorio de Operaciones of Hospital Mexico is 998. Patients came from five regions and twenty areas of health according to the geographical division of the CCSS. The variables included have been: cost per day by way of transfer, which involves the distance to the radiotherapy center of Hospital Mexico and the cost of the rate at Cruz Roja ambulance per Km (326.86 colons, according to the agreement CCSS-Cruz Roja in June 2009) estimated daily cost of lodging in a shelter, and the reason daily cost of relocation / daily cost of shelter. The cost of shelter includes food and were used data from the company International Medical Suppliers S. A. as a basis for estimating the daily cost, the price fixed by the company was 65 dollars a day, and the conversion into colons exchange rate as established by the Banco Central de Costa Rica; dated April 30, 2010, the amount has been 33.542.60 colons. The reason for each area of health was given by the ratio of the average daily cost in colons by way of ambulance of

Assistive Free-Flyers with Gecko-Inspired Adhesive Appendages for Automated Logistics in Space

Data.gov (United States)

National Aeronautics and Space Administration — Gecko-inspired adhesives provide a new capability for assistive free fliers (AFF) in space. In comparison with conventional grippers, they make it possible to attach...

“Shifting in” migration control. Universalism and immigration in Costa Rica

NARCIS (Netherlands)

K. Voorend (Koen)

2013-01-01

textabstractWhen the Caja Costarricense de Seguro Social (CCSS), the flagship institution of Costa Rica’s ‘exceptional’ -solidary and universal- social policy regime, entered in financial crisis in 2011, the already difficult social integration of Nicaraguan immigrants in Costa Rica became even more

Efeito de bioestimulante no crescimento inicial e na produtividade de plantas de batata-doce

Directory of Open Access Journals (Sweden)

Amarílis Beraldo Rós

2015-10-01

Full Text Available RESUMOO uso de bioestimulantes na agricultura tem apresentado efeitos positivos sobre a produtividade de determinadas culturas. No entanto, são escassos os estudos com o uso desses produtos em culturas cuja porção comercial é composta por raízes. Neste trabalho, objetivou-se avaliar a influência de diferentes concentrações do bioestimulante Stimulate(rsobre o crescimento inicial de plantas de batata-doce e sobre a produtividade de raízes tuberosas. Foram conduzidos dois experimentos, nos quais segmentos de ramas de batata-doce foram parcialmente imersos em soluções com bioestimulante. Na casa de vegetação, o delineamento experimental foi inteiramente ao acaso, em esquema fatorial 6 x 6, sendo seis concentrações de biofertilizante (0, 3, 6, 9, 12 e 15 mL L-1e seis épocas de coleta (10, 19, 28, 37, 46 e 55 dias após o plantio de raízes e folhas. No campo, o delineamento experimental foi em blocos ao acaso, sendo os tratamentos seis concentrações de bioestimulante (0, 3, 6, 9, 12 e 15 mL L-1. A percentagem de segmentos enraizados não variou entre os tratamentos. O bioestimulante influenciou o número de raízes adventícias e de folhas por planta, mas não sua massa seca. A produtividade de raízes tuberosas não diferiu entre os tratamentos, sendo os valores médios de 25,5 e 22,3 t ha-1para produtividades total e comercial, respectivamente. Assim, a utilização do bioestimulante interfere no número de raízes e de folhas de plantas de batata-doce, mas não favorece a produtividade de raízes tuberosas até a concentração de 15 mL L-1.

Extração de ecdisterona em raízes de ginseng brasileiro Extraction of ecdysterone from roots of Brazilian ginseng

Directory of Open Access Journals (Sweden)

Rejane Flores

2009-07-01

Full Text Available Este estudo teve como objetivo otimizar a extração de ecdisterona em raízes de ginseng brasileiro. Primeiramente, para se avaliar a eficiência do solvente extrator, amostras de raízes dois acessos (BRA e JB-UFSM de P. glomerata foram extraídas em Soxhlet com metanol e clorofórmio, separadamente, durante 4 horas. No segundo ensaio, com o intuito de se escolher o método extrator, a extração foi conduzida em Soxhlet e em ultrassom, utilizando metanol como solvente. Em P. tuberosa, as amostras foram extraídas com metanol, e a extração foi conduzida em Soxhlet e em banho ultrasônico. O conteúdo de ecdisterona foi determinado em Cromatógrafo Líquido de Alta Eficiência (CLAE. Em ambas as espécies, um maior conteúdo de ecdisterona foi detectado nas amostras extraídas com metanol e em Soxhlet. A metodologia proposta mostrou-se eficaz para a quantificação da ecdisterona a partir das raízes de P. glomerata e P. tuberosa, podendo ser aplicada no controle de qualidade de drogas vegetais e/ou fitoterápicos.This study aimed at optimizing the extraction method from ecdysterone of Brazilian ginseng. Root samples of two accessions (BRA and JB-UFSM of P. glomerata were extracted in a Soxhlet with methanol or chloroform for 4h. In the second trial, the extration was conduced in a Soxhlet or ultrasonic using metanol as a solvent. In P. tuberosa, the roots samples were extracted with methanol in a Soxhlet or in ultrasonic. The ecdysterone content was determinated using high efficiency liquid chromatography methods. In both studied species, the highest ecdisterone content was detected from samples extracted in a Soxhlet and using methanol as a solvent. This extration method has been successfully applied for determination of ecdysterone content from roots of Brazilian ginseng, and could be useful for the quality control of drugs and pharmaceutical formulations.

Diagnóstico Tardio de Esclerose Tuberosa

Directory of Open Access Journals (Sweden)

Catarina Oliveira

2016-03-01

Full Text Available Tuberous sclerosis (also referred to as Tuberous Sclerosis Complex is an autosomal dominant neurocutaneous syndrome that can involve multiple organs such as the brain, heart, kidney, lung, liver, skin and eye. The diagnosis is clinical and most patients are identified during childhood, in the context of a severe epileptic or neuropsychiatric disorder. Here we report a case of TSC diagnosed in an adult woman with dermatological and vascular involvement that were only recognized as manifestations of TSC after the diagnosis of her infant daughter. This case highlights how important it is that physicians recognize the full spectrum of manifestations of TSC, including the most unusual, so not to miss the diagnosis

Versatile Manipulation for Assistive Free-Flyers

Data.gov (United States)

National Aeronautics and Space Administration — Assistive Free-Flyers (AFFs) are flying robots designed to share the living space with human astronauts in orbit. These robots have shown the potential to assist...

Punição corporal aplicada por funcionários de duas escolas públicas brasileiras: prevalence in two public schools

Directory of Open Access Journals (Sweden)

Ana Carina Stelko-Pereira

2011-12-01

Full Text Available Esse estudo identificou casos de alunos vítimas de agressões físicas por parte de funcionários de escolas brasileiras e verificou sua relação com características demográficas, depressão e engajamento escolar. Responderam ao Questionário de Investigação de Prevalência de Violência Escolar, ao Inventário de Depressão Infantil e à Escala de Engajamento Escolar 396 estudantes de duas escolas públicas. No total, 21 alunos foram agredidos fisicamente por funcionários (AFF. Houve diferenças significativas entre o grupo AFF e o dos que não foram agredidos fisicamente (NAFF. No primeiro houve maior proporção de alunos do sexo feminino, de alunos violentos com os pares e de alunos vítimas de colegas, e maior índice de depressão. Não houve diferenças significativas entre os grupos quanto aos aspectos idade, escolaridade, reprovação e engajamento escolar. Supõe-se que o aluno AFF apresente comportamentos de agressão aos colegas e funcionários da escola e que por isso seja agredido, o que o levaria a continuar sendo agressivo com os outros. Tal hipótese deve ser investigada em estudos futuros.

Design of a costing system and valuation for the production of radiopharmaceutical FDG and the provision of radiology service with PET-CT to Caja Costarricense del Seguro Social, for the Centro de Investigacion en Ciencias Atomicas, Nucleares y Moleculares of the Universidad de Costa Rica

International Nuclear Information System (INIS)

Gonzalez Cabezas, Gabriel; Jarquin Arguedas, Daniela; Salas Solorzano, Bonnie; Solano Morales, Josue; Zuniga Soto, Karol

2013-01-01

The cost of the radiopharmaceutical FDG and of the service of diagnostic studies with PET-CT technology are determined through the design of a costing system. The aim has been to provide to the Centro de Investigacion en Ciencias Atomicas, Nucleares y Moleculares (Cicanum), an appropriate decision making as to definition of sale prices in the CCSS-Cicanum Project. This project has arisen of the partnership between the Cicanum and Caja Costarricense del Seguro Social (CCSS), in order to satisfy the needs in the area of oncology; specifically, the acquisition of PET-CT technology. Diagnostic studies can be performed with this technology to detect and measure the evolution of different types of cancer. Additionally, the realization of these studies have required the acquisition of a cyclotron for the production of the radiopharmaceutical called FDG by Cicanum. The theoretical and conceptual aspects relating to atomic, nuclear and molecular sciences are defined, as well as the contribution of the Universidad de Costa Rica for research in these areas and perspectives of costing systems. The administrative-accounting area of Cicanum is described and diagnosed, as well as of the CCSS-Cicanum Project, to know its scope, management and allocation of costs. The situation diagnosed in the administrative-accounting area of Cicanum and the CCSS-Cicanum Project are analyzed, through the tool Swotr (strengths, opportunities, weaknesses, threats and risks). A costing system is elaborated for Cicanum, based on work orders. The system has been developed in a series of electronic work sheets that have allowed to obtain costs associated with the production of the radiopharmaceutical FDG and the rendering of diagnostic services with PET-CT technology to the CCSS, as well as the definition of sales price. As a complement to the above, a master budget is done, which provides a financial vision of the project in its first ten years of operation [es

Distracted Driving and Associated Crash Risks : Research Project Capsule

Science.gov (United States)

2012-10-01

Factors aff ecting the : cognitive tasks : associated with : driving are becoming : increasingly critical to : the overall roadway : safety performance. : Therefore, more research is needed in order to understand the complexity and : impact of distra...

In vitro populations of rotifer Brachionus plicatilis Müller demonstrate inhibition when fed with copper-preaccumulating microalgae.

Science.gov (United States)

Moreno-Garrido, I; Lubián, L M; Soares, A M

1999-10-01

Four marine microalgal species (Chlorella autotrophyca, Nannochloropsis gaditana, Tetraiselmis chuii, and Isochrysis aff. galbana) were exposed for 24 h to 1 mg L(-1) dissolved copper and then transferred to fresh medium. After that, a group of 10 neonate rotifers were fed with these four microalgal species. The levels of accumulated copper in cellular concentrations of the microalgae were checked, with the result of around 40% of original concentration, with the exception of I. aff. galbana (25% of original concentration). In all cases, cells with preaccumulated metal caused a delay of 1 or 2 days in populational development of rotifers (increase in "lag phase"). The microalgae that were not fed to rotifers (disposed in parallel series) did not significantly transfer metal to the medium after the first day.

Resultados clínicos e radiológicos en serie de artrodesis cervical anterior con caja de fusión intersomática y placa Resultados clínicos e radiológicos em série de artrodese cervical anterior com dispositivo de fusão intersomática e placa Clinical and radiologica outcomes in series of anterior cervical fusion with intersomatic cage and plate

Directory of Open Access Journals (Sweden)

Lyonel Beaulieu Lalanne

2012-06-01

Full Text Available OBJETIVOS: Analizar los resultados clínicos e radiológicos de una serie de pacientes sometidos a artrodesis cervical anterior con caja de fusión intersomática (CAGE y placa. MÉTODOS: Análisis retrospectivo de serie de pacientes sometidos a artrodesis cervical anterior con caja de fusión intersomática y placa entre los años 2004 y 2009. Revisión de fichas clínicas y radiografías, registro de edad, sexo, diagnósticos, nivel operado, complicaciones, evolución clínica y radiológica. Técnica quirúrgica de Smith-Robinson. Las cajas de fusión intersomática fueron llenadas con sustitutos de huesos. Deambulación 12 horas después de la cirugía, alta a las 48 horas, collar cervical intermitente por 2 semanas. Evaluación clínica mediante criterios de Odom. Seguimiento 17 a 78 meses. RESULTADOS: Diagnósticos: Hernia del núcleo pulposo (HNP cervical, 44 (71%, mielopatía, 11 (17,7%, fracturas, 7 (11,3%. Nivel 1: 44 (71%, Nivel 2: 15 (24,2%, Nivel 3: (4,8%. El nivel C5-C6 incluyó 92% de los casos. Alivio del dolor radicular: 60 (97%. Recuperación del déficit neurológico: 59 (95,2%. Alivio de la mielopatía: 8/11 pacientes (73%. Alivio del dolor cervical: 56 (90%. Resultados clínicos: 91,9% excelentes y buenos. Complicaciones (12,9%: 4 disfagias transitorias (6,5%, 1 disfagia permanente (1,6%, 2 disfonías transitorias (3,3%, 1 subcidencia con aflojamiento del implante y fractura asintomática de placa (1,6%. No hubo pseudoartrosis. CONCLUSIONES: Esta serie presenta buenos resultados clínicos, com alivio del dolor y recuperación neurológica comparables con los hallazgos en la literatura. El uso de la caja de fusión intersomática evita complicaciones de la zona dadora y, cuando es asociado a placa cervical anterior permite fijación intersomática inmediata, dando soporte estructural adecuado, con buenos resultados y sin complicaciones a largo plazo.OBJETIVOS: Analisar os resultados clínicos e radiológicos de uma série de

STEM CELL RESEARCH-CONCEPT AND CONTROVERSIES

African Journals Online (AJOL)

Dr. E. P. Gharoro

cells, heart cells, brain cells, etc.). Some researchers regard them as offering the greatest potential for the .... anaemia, heart damage, corneal damage, etc. To be useful for transplant purposes, stem cells must ... activity in the brain was demonstrated contradicting caja's “no new neurons” dogma. However, research into.

El lenguaje de la caja mágica

OpenAIRE

Maffioni, María Florencia

2012-01-01

El lenguaje expresivo en los niños es utilizado como un instrumento liberador que les permite interactuar en la sociedad de hoy. Quienes lean el siguiente trabajo se encontrarán con la temática, la televisión y el lenguaje expresivo, en la que nos propusimos establecer la existencia de relación entre la cantidad de horas que los niños de 5 años miran de televisión y el nivel madurativo del lenguaje oral. Para llevar a cabo esta investigación se utilizó una muestra poblaciona...

Complejo nódulo subependimario-astrocitoma subependimario gigantocelular en niños con esclerosis tuberosa Subependymal nodules-subependymal giant cell astrocytoma complex in children with tuberous sclerosis

Directory of Open Access Journals (Sweden)

Lucas Bongiorni

2009-01-01

Full Text Available El objetivo fue describir las características clínico imagenológicas de niños con esclerosis tuberosa que presentaron el complejo Nódulo Subependimario (NS-Astrocitoma Subependimario Gigantocelular(ASGC y analizar el comportamiento evolutivo de dicho "complejo" para detectar precozmente su crecimiento y evitar las complicaciones de la hipertensión endocraneana (HTE. Evaluamos 22 pacientes con diagnóstico anátomo patológico de ASGC. El diagnóstico del tumor se realizó a una media de 10.1 años. Pudimos observar la evolución de NS a ASGC; estos NS se ubicaron adyacentes al agujero de Monro y con el tiempo tuvieron un importante crecimiento con intensa captación de contraste e hidrocefalia. La aceleración en el crecimiento de estos NS y su "transformación" en ASGC se produjo a los 10 años de edad promedio, con un diámetro medio de 9 mm. Ningún NS alejado de los forámenes de Monro evolucionó a ASGC. Quince pacientes (68% fueron operados con síntomas de hipertensión endocraneana. La edad media de la cirugía fue 10.8 años. Seis pacientes presentaron déficit visual. En estos últimos, el diámetro medio mayor del tumor fue 31.5 mm, mayor que los 18.7 mm del grupo de pacientes que no presentó secuela visual. El seguimiento clínico imagenológico periódico de toda lesión subependimaria próxima a los agujeros de Monro, permitiría en etapa presintomática anticipar un tratamiento quirúrgico, que reduciría la incidencia de HTE. Estudios prospectivos podrían determinar si el complejo NS-ASGC corresponde a una misma entidad en distinta etapa evolutiva, o son dos lesiones con diferente potencial de crecimiento.The object of this paper is to describe the imaging and clinical characteristics of subependymal nodule (SN - subependymal giant cell astrocytoma (SGCA complex in tuberous sclerosis and analyze its evolution in order to attempt early detection and the prevention of intracranial hypertension. We evaluated 22 patients with

Clinical and technical guide on prostate cancer proposal treated with radiotherapy

International Nuclear Information System (INIS)

Loria Ruiz, Rolando Alberto

2013-01-01

New treatment schemes with radiotherapy in prostate cancer are reviewed. The different modalities for the treatment of prostate cancer are described, such as surgery, chemotherapy and radiotherapy. Hypofractionated treatments and intensity-modulated radiotherapy are studied. The benefit of implementing these schemes in the Caja Costarricense del Seguro Social is analyzed [es

Bilateral Incomplete Atypical Femoral Fracture due to Long-Term Bisphosphonate Use: A Case Report

Directory of Open Access Journals (Sweden)

Sibel Başaran

2017-08-01

Full Text Available Although the overall safety profile of bisphosphonates (BP is favorable, adverse effects associated with long-term use have came up during recent years. In this report, a case of bilateral incomplete atypical femoral fracture (AFF due to prolonged BP use was presented. A 69-year-old patient, who has been in surgical menopause for 20 years and was started on BP following vertebral fracture almost 10 years ago, was admitted with thigh pain, which was increased two weeks ago. On physical examination, she had antalgic gait, increased thoracic kyphosis and tenderness to percussion over the thoracolumbar region. Lateral cortical thickness in the subtrochanteric region of both femurs and cortical radiolucency on the left femur were observed on plain radiography. Loss of height in L3 and L4 vertebrae was detected on vertebral radiography. Serum 25-hydroxy vitamin D [25(OHD], parathyroid hormone, alkaline phosphatase and calcium levels, along with osteoporosis markers were all within the normal ranges. As the patient was diagnosed with AFF, BP therapy was terminated and vitamin D-calcium supplementation was continued. Since she did not have severe pain, conservative management (limited weight bearing, using a walking stick was recommended for 3 months. Teriparatide therapy was started and she was discharged with recommendations. AFF, which is a rare disorder, should be kept in mind in patients on long-term BP treatment who are admitted with thigh pain and, necessary interventions should be tailored before the occurrence of complete fracture.

Hemiparásitas en la franja subandina del Departamento de Cundinamarca, Colombia

Directory of Open Access Journals (Sweden)

Berrera Torres Eduardo

1997-06-01

Full Text Available The hemiparasites studied are grouped in 3 families: Loranthaceae, Viscaceae and Eremolepidaceae. 30 species belonging to 7 genera are reported in this work. Phoradendron of the Viscaceae family is the genus best represented with 15 species. The species Phoradendron aft. aequatoris, P. balslevií, P. Brittonianum y P. cymosum are reported for the first time to Colombia. Four hiperparasitic species are registered: Ixocactus hutchisonií, Phoradendron aff. aequatoris, P. dipterum and Struthanthus orbicularis. The taxa studied are distributed in altitudinal ranges from the lower montane forest. The diversity of hemiparasitic species is greater in the western slope of the Eastern Andean mountain ranga. This flora correspond to 33 % of the species registered for Colombia.Las hemiparásitas estudiadas se agrupan en 3 familias: Loranthaceae, Viscaceae y Eremolepidaceae. Se registran 30 especies pertenecientes a 7 géneros: el mejor representado es Phoradendron de la familia Viscaceae, con 15 especies. Las especies Phoradendron aff. aequatoris, P. balslevií, P. brittonianum y P. cymosum se reportan por primera vez para Colombia. Además se destacan 4 especies hiperparásitas: Ixocectus hutchisonii; Phoradendron aff. aequatoris, P. dipterum y Struthanthus orbicularis. Los taxa estudiados se distribuyen en gradientes altitudinales del Bosque Subandino. La diversidad de especies hemiparásitas en el flanco occidental de la Cordillera Oriental es mayor. La comparación de los registros obtenidos con los provenientes de otros lugares, en el territorio colombiano, indica que esta flora constituye aproximadamente el 33%.

Quiver Varieties and Branching

Directory of Open Access Journals (Sweden)

Hiraku Nakajima

2009-01-01

Full Text Available Braverman and Finkelberg recently proposed the geometric Satake correspondence for the affine Kac-Moody group Gaff [Braverman A., Finkelberg M., arXiv:0711.2083]. They conjecture that intersection cohomology sheaves on the Uhlenbeck compactification of the framed moduli space of Gcpt-instantons on $R^4/Z_r$ correspond to weight spaces of representations of the Langlands dual group $G_{aff}^{vee}$ at level $r$. When $G = SL(l$, the Uhlenbeck compactification is the quiver variety of type $sl(r_{aff}$, and their conjecture follows from the author's earlier result and I. Frenkel's level-rank duality. They further introduce a convolution diagram which conjecturally gives the tensor product multiplicity [Braverman A., Finkelberg M., Private communication, 2008]. In this paper, we develop the theory for the branching in quiver varieties and check this conjecture for $G = SL(l$.

Dicty_cDB: AFF294 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available map 14, *** SEQUENCING IN PROGRESS ***, 18 unordered pieces. 46 0.60 1 U92221 |U92221.1 Legionella shakes...pearei macrophage infectivity potentiator (mip) gene, complete cds. 46 0.60 1 AF022

Dicty_cDB: AFF743 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Sequences producing significant alignments: (bits) Value N AF305060 |AF305060.1 Dictyostelium discoideum Wiscott...oducing significant alignments: (bits) Value AF305060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott

Defining obstructive ventilatory defect in 2015 | Affes | Libyan ...

African Journals Online (AJOL)

% vs. 78+17%) and FVC (71+15% vs. 93+19%). Conclusion: The frequency of OVD much depends on the criteria used for its definition. Keywords: obstructive ventilatory defect; FEV1/FVC; fixed threshold; lower limit of normal; spirometry; ...

Dicty_cDB: AFF321 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available *illwikyvncicrcsiyfgyshylfigksrkkvylc*ncifpkmvg*tk ynnakyc*gfg*kwsigihkwwvlye**gyyll*ryy*pndigpsiplgefrsyakdrla hrsiwp*cnts...kwsigihkwwvlye**gyyll*ryy*pndigpsiplgefrsyakdrla hrsiwp*cntssylwsirircihyrsyglsryrssfre*angvhveidpkytressfhi

Automated Aerial Refueling Hitches a Ride on AFF

Science.gov (United States)

Hansen, Jennifer L.; Murray, James E.; Bever, Glenn; Campos, Norma V.; Schkolnik, Gerard

2007-01-01

The recent introduction of uninhabited aerial vehicles [UAVs (basically, remotely piloted or autonomous aircraft)] has spawned new developments in autonomous operation and posed new challenges. Automated aerial refueling (AAR) is a capability that will enable UAVs to travel greater distances and loiter longer over targets. NASA Dryden Flight Research Center, in cooperation with the Defense Advanced Research Projects Agency (DARPA), the Naval Air Systems Command (NAVAIR), the Naval Air Force Pacific Fleet, and the Air Force Research Laboratory, rapidly conceived and accomplished an AAR flight research project focused on collecting a unique, high-quality database on the dynamics of the hose and drogue of an aerial refueling system. This flight-derived database would be used to validate mathematical models of the dynamics in support of design and analysis of AAR systems for future UAVs. The project involved the use of two Dryden F/A-18 airplanes and an S-3 hose-drogue refueling store on loan from the Navy. In this year-long project, which was started on October 1, 2002, 583 research maneuvers were completed during 23 flights.

Dicty_cDB: AFF372 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ll*tra*r clsfeilfrfpfpylfiresip*lsigfpnhl*kypfkik*kfnwlfrnyklsngis Frame C: tnntn...lsk*vwsklchfnplgq**wsk*yggfpsi*sst*igenrrippnst*snqm*ik itsf*rrh*nyqcryllfhryrsiegkrr*ihl*hlfpsgk*ntckyplgfg

Assessing Installation Ethnobotanical Resources Using Land Condition Trend Analysis (LCTA) Data: A Fort Riley, Kansas, Case Study

Science.gov (United States)

1998-07-01

incarnata S F Carya illinoensis G L Asclepias stenophylla S B Ceanothus herbaceus S B Asclepias syriaca S B Ceanothus oliganthus S L Asclepias tuberosa S...cannabinum S B Carex retroflexa G F Argemone polyanthemos S F Carex vulpinoidea S F Artemisia ludoviciana S B Carya cordiformis S B Asclepias...longipilum G B Descurainia pinnata S F Hordeum pusillum G F Descurainia sophia S F Hymenopappus scabiosaeus G B Desmanthus illinoensis S B Hypericum

NEUROTROPHIN RECEPTOR BLOCKADE ATTENUATES DIESEL EXHAUST PARTICULATE MATTER (DEP) ENHANCEMENT OF ALLERGIC RESPONSES

Science.gov (United States)

ABSTRACT BODY:Recent investigations have linked neurotrophins including NGF, NT-3, and BDNF to allergic airways diseases. Antibody blockade of NGF attenuates airway resistance associated with allergic airway responses in mice. Mice administered an antibody against the low aff...

Bisphenol A activates EGFR and ERK promoting proliferation, tumor spheroid formation and resistance to EGFR pathway inhibition in estrogen receptor negative inflammatory breast cancer cells

Science.gov (United States)

Background: Inflammatory breast cancer (IBC) is a distinct and the deadliest breast cancer variant, which shows a rapid rate of progression and acquired therapeutic resistance. Epidemiological studies suggest that chemical exposure in the environment and consumer products can aff...

EXPANSIóN Y CRECIMIENTO DE LAS COOPERATIVAS DE CRéDITO DURANTE EL PERIODO 1993-2007 EN LA COMUNIDAD VALENCIANA/EXPANSION AND GROWTH OF THE CREDIT COOPERATIVES BETWEEN 1993 AND 2007 IN THE COMMUNITY OF VALENCIA

Directory of Open Access Journals (Sweden)

Amparo MELIÁN NAVARRO

2009-05-01

Full Text Available La Comunidad Valenciana es junto con Andalucía y el País Vasco, las Comunidades Autónomas donde más imbricadas se hallan las cooperativas de crédito; estas se han vinculado al sector agrario vía cajas rurales en las dos primeras, y al sector industrial, vía cajas populares, en la tercera. En este trabajo se analiza la evolución en los últimos quince años, período 1993-2007, del crédito cooperativo en la Comunidad Valenciana, materializado en el estudio de las cajas rurales con sede social en la misma. En él destacamos la experiencia de concentración de algunas entidades, así como la reciente creación de otras a partir de secciones de crédito de cooperativas agrarias. El estudio se efectúa con base en el análisis del balance y otros indicadores de gestión./The Community of Valencia, together with Andalusia and the Basque Country, are the autonomous communities where credit cooperatives are more involved; these have been linked to the agricultural sector through rural savings banks in the first two, and the industrial sector, via popular savings banks in the third case. This paper analyses the evolution over the past fifteen years, 1993-2007 of the credit cooperatives in Valencia, focusing in the study of the rural savings banks that have their headquarters there. We highlight the experience of concentration of some entities, as well as the recent establishment of others arising from credit sections of agricultural cooperatives. The study is based on an analysis of the balance sheet and other management indicators.

Design, modeling and dynamic simulation of three double stage gearboxes with different module, mesh stiffness fluctuation and different level tooth breakage

Directory of Open Access Journals (Sweden)

Jairo Alberto Ruiz-Boter

2015-01-01

Full Text Available Este artículo utiliza el valor RMS de la señal residual de vibración como indicador estadístico que permita detectar la falla en ruedas dentadas. En el análisis se consideran tres modelos de caja de engranajes de doble etapa diseñados con diferentes módulos buscando conservar semejanzas geométricas. En este trabajo se muestra la variación de la rigidez de engrane para diferentes tamaños de daño. Se desarrolla un modelo para simular la respuesta de vibración de la caja de engranajes de dos etapas para condiciones de buen estado y con falla. En la simulación dinámica se considera la rigidez de engrane variante en el tiempo y el coeficiente de amortiguamiento se considera proporcional a la rigidez de engrane. Los resultados obtenidos de la simulación dinámica para los dientes en buen estado y con falla son acordes con los reportados en la literatura.

Nanosilver pathophysiology in earthworms: Transcriptional profiling of secretory proteins and the implication for the protein corona

DEFF Research Database (Denmark)

Hayashi, Yuya; Miclaus, Teodora; Engelmann, Péter

2016-01-01

Previously we have identified lysenin as a key protein constituent of the secretome from Eisenia fetida coelomocytes and revealed its critical importance in priming interactions between the cells and the protein corona around nanosilver. As alterations of the protein environment can directly affe...

The micromammals (Lagomorpha, Eulipotyphla and Rodentia) from the Middle Pleistocene site of Cuesta de la Bajada (Teruel, Spain): Systematic study and paleoenvironmental considerations

Energy Technology Data Exchange (ETDEWEB)

Sese, C.; Soto, E.; Santonja, M.; Perez-Gonzalez, A.; Dominguez-Rodrigo, M.

2016-07-01

The micromammal association established in this work is the following: Lagomorpha: Oryctolagus cuniculus; Eulipotyphla: Crocidura cf. russula, cf. Sorex sp., Neomys sp., Soricidae indet. and Talpa sp.; and Rodentia: Eliomys quercinus, Apodemus cf. sylvaticus, Cricetulus (Allocricetus) bursae, Arvicola aff. sapidus, Microtus (Iberomys) brecciensis and Microtus (Terricola duodecimcostatus. This association is characteristic of the Middle Pleistocene. The morphological state of Cricetulus (A.) bursae, Arvicola aff. sapidus and Microtus (I.) brecciensis allows to place it in the advanced, but not final, Middle Pleistocene, which agrees with the numerical data of the site (243–337 ka) that places it in the MIS 8 or 9. The micromammals indicate the predominance of the open spaces with abundant vegetation mainly of herbaceous and bushes but also with some areas with trees. The climate would be of Mediterranean type, similar to the actual or perhaps a little milder and more humid. (Author)

Original Communications - Iridoid Glucosides from Turkish Phlomis tuberosa

DEFF Research Database (Denmark)

Calis, Ihsan; Kirmizibekmez, Hasan; Ersoz, Tayfun

2005-01-01

, and decaffeoylacteoside and three known neolignan glycosides, dehydrodiconiferyl alcohol 9'-O-beta-D-glucopyranoside, dihydrodehydrodiconiferyl alcohol 9-O-beta-D-glucopyranoside and dihydrodehydrodiconiferyl alcohol 9'-O-beta-D-glucopyranoside, one flavone glycoside, luteolin 7-O-beta-D-glucopyranoside, as well as b...

77 FR 74916 - Unblocking of Specially Designated Nationals and Blocked Persons Pursuant to the Foreign...

Science.gov (United States)

2012-12-18

..., Baja California, Mexico; c/o OPERADORA DE CAJA Y SERVICIOS, S.A. DE C.V., Tijuana, Baja California..., Baja California, Mexico; c/o QUINTA REAL JARDIN SOCIAL Y DE EVENTOS, S.A. DE C.V., Tijuana, Baja... QUINTA REAL JARDIN SOCIAL Y DE EVENTOS S.A. DE C.V., Tijuana, Baja California, Mexico; DOB 28 Oct 1974...

Environmental radiological Monitoring to the Pb-210 in waters and soils in the Boquete region in Panama Republic

International Nuclear Information System (INIS)

Gibbs, E.; Scotland, E.E.; De Infante, M.; Fernandez, M.A.

1998-01-01

Natural water samples were analyzed in Brazil Institutes and shows activities high to 1000 mBq/I in Polonium 210. Later on samples were analyzed in the Departamento de Salud Radiologica de la Caja de Seguro Social to Panama Republic and the results reported to 16.08 mBq/I and 2.4 Bq/Kg respectively

Physical and psychological determinants of injury in Ontario forest firefighters.

Science.gov (United States)

Gordon, H; Larivière, M

2014-12-01

Forest firefighters are faced with multiple physical and psychological challenges as a result of their duties. Little is known about the determinants of injury among these workers. The Ontario Ministry of Natural Resources (OMNR) Aviation, Forest Fire and Emergency Services (AFFES) records detailed information on two mutually exclusive types of workplace injury: First aid (self-reported) and Workplace Safety Insurance Board (WSIB, i.e. received medical attention). To identify the contributions of physical and psychological factors on the likelihood of injury among forest firefighters. Participants were male and female forest firefighters aged between 18 and 65. Data were collected using two self-administered instruments: The NEO Personality Inventory and the Job Stress Survey. Secondary data were collected from the OMNR AFFES and data were analysed by way of multivariate statistical procedures. There were 252 participants. Those who were older, had a history of injury, had high scores for the personality construct of Neuroticism or low scores for the Openness construct were significantly more likely to incur a first aid injury, while those with high experience levels were significantly less likely to incur injury (P First aid and WSIB injuries in the OMNR AFFES were quite distinct phenomena and different factors need consideration in their prediction. It is recommended that managers and decision-makers in this field consider factors such as job stress, personality and the prior occurrence of injuries in their assessment of risk. © The Author 2014. Published by Oxford University Press on behalf of the Society of Occupational Medicine. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

ELEMENTI DI GEOMETRIE FINITE

Directory of Open Access Journals (Sweden)

Stefania Ferri

1996-02-01

Full Text Available Si fa vedere come si può costruire la geometria analitica su un piano affìne finito. Vengono riportati risultati classici che però sono stati esposti in modo da essere compresi dagli alunni delle Scuole Medie Secondarie.

MOSCAS-DAS-FRUTAS (DIPTERA: TEPHRITIDAE EM POMARES DA ÁREA URBANA NO NORTE DE MINAS GERAIS

Directory of Open Access Journals (Sweden)

CLARICE DINIZ ALVARENGA

2010-01-01

Full Text Available The aim this work was know the species of fruit fly and host plants in orchards in the urban area in the north of Minas Gerais. Were selected 10 orchards with wide variety of fruit species, which were distributed in equidistant way in the urban area of Janaúba, MG. Weekly, were collected systematically fruit flies through trap type McPhail and ripe fruit and in ripening one, on those orchards. Were collected 7.016 tephritid obtained from trap (5.226 and fruit (1.790, from which 1.044 belonged to genus Anastrepha and 5.972 were Ceratitis capitata. The specimens number of C. capitata (85.1% was around six times superior to Anastrepha spp. (14.9%, demonstrating the preference of this species for urban orchards. Eight species of Anastrepha occur in urban orchards of Janaúba, MG. Ceratitis capitata was found infesting 10 species of host fruits, being the main S. purpurea and guava. In fruits were collected three species of Anastrepha (A. obliqua, A. sororcula and A. zenildae which were associated with five species of fruit (Malpighia glabra L, Psidium guayava L, S. dulcis, S. purpurea and S. tuberosa. The predominant species of Anastrepha was A. obliqua, and S. tuberosa and S. purpurea being the main hosts of this species in the urban area of Janaúba, MG.

Modelagem geoestatística da distribuição de carbono do solo e biomassa de herbáceas em sistema silvopastoril.

OpenAIRE

Marystella Duarte Correia

2013-01-01

Estudos de algumas regiões semiáridas têm apontado o efeito benéfico de certas espécies de árvores em sistemas silvopastoris, por promoverem a formação de fertilidade do solo e aumentarem a sustentabilidade da produtividade agrícola. Neste trabalho, foram selecionadas três espécies arbóreas encontradas em pastagens de Capim buffel (Cenchrus ciliaris), juazeiro (Zyziphus joazeiro), umbuzeiro (Spondias tuberosa) e algaroba (Prosopis juliflora) da caatinga, bioma exclusivamente brasileiro,...

Stability of merons in gravitational models

International Nuclear Information System (INIS)

Akdeniz, K.G.; Hacinliyan, A.; Kalayci, J.

1982-11-01

The stability properties of merons are investigated in gravitational models by taking the DeAFF model as a theoretical laboratory. We find that in gravitational models containing Yang-Mills fields merons are unstable. Stability might be possible in N=4 supergravity models with Asub(μ)=0. (author)

Original Researc Original Research

African Journals Online (AJOL)

RAGHAVENDRA

Practices. Problems. Supervision. Primary School. *Corresponding Author: Asrat Dagnew. E-mail: asratboza@yahoo.com tructional support. The relevant and ... vision is one of indispensable system pment. Supervision is a system of that directly concerned on the aff members in a school or other. Original Research ...

Loss of Meaning Seen from Philosophy

DEFF Research Database (Denmark)

Klausen, Søren Harnow

2011-01-01

Artiklen argumenter for at man kan tale om ét fælles "meningsproblem" som optog filosoffer og intellektuelle omkring år 1900, selv om problemet med at sikre den videnskabelig praksis' og det videnskabelige sprogs meningsfuldhed (og de deraf affødte sprogfilosofiske og meningsteoretiske problemsti...

Migraine Trainers as Models: the effectiveness of Lay trainerswith migraine for behavioural attack prevention

NARCIS (Netherlands)

S.Y.M. Mérelle (Saskia)

2008-01-01

textabstractMigraine is a chronic brain disorder, characterized by attacks of severe headache accompanied by nausea, vomiting and sensitivity to light, sound and smell. Attacks can be preceded by premonitory symptoms such as fatigue, muscular stiff ness or negative aff ect. It has been shown that

E-Orbit Functions

Directory of Open Access Journals (Sweden)

Jiri Patera

2008-01-01

Full Text Available We review and further develop the theory of $E$-orbit functions. They are functions on the Euclidean space $E_n$ obtained from the multivariate exponential function by symmetrization by means of an even part $W_{e}$ of a Weyl group $W$, corresponding to a Coxeter-Dynkin diagram. Properties of such functions are described. They are closely related to symmetric and antisymmetric orbit functions which are received from exponential functions by symmetrization and antisymmetrization procedure by means of a Weyl group $W$. The $E$-orbit functions, determined by integral parameters, are invariant withrespect to even part $W^{aff}_{e}$ of the affine Weyl group corresponding to $W$. The $E$-orbit functions determine a symmetrized Fourier transform, where these functions serve as a kernel of the transform. They also determine a transform on a finite set of points of the fundamental domain $F^{e}$ of the group $W^{aff}_{e}$ (the discrete $E$-orbit function transform.

Effect of soy lecithin on total cholesterol content, fatty acid composition and carcass characteristics in the Longissimus dorsi of Hanwoo steers (Korean native cattle).

Science.gov (United States)

Li, Xiang Zi; Park, Byung Ki; Hong, Byuong Chon; Ahn, Jun Sang; Shin, Jong Suh

2017-06-01

This study aims to investigate the effect of soy lecithin on the total cholesterol content, the fatty acid composition and carcass characteristics in the Longissimus dorsi in Hanwoo steers. Hanwoo steers (24 head) were fed two diets: Control (CON) (concentrate + alcohol-fermented feed (AFF)) and soy lecithin treatment (CON + soy lecithin at 0.5% of the AFF). Soy lecithin treatment increased average daily gain, serum concentrations of triglyceride, total cholesterol and high-density lipoprotein-cholesterol in the blood. A lower cholesterol concentration was found in the Longissimus dorsi for the soy lecithin diet compared to the CON diet. With respect to the marbling score and quality grade of Longissimus dorsi, soy lecithin supplementation significantly increased the C20:5n3, C22:4 and polyunsaturated fatty acids contents compared to the CON diet. Soy lecithin supplementation would alter the total cholesterol content, polyunsaturated fatty acid profile and meat quality of Longissimus dorsi. © 2016 Japanese Society of Animal Science.

Bleaching and recovery of a phototrophic bioeroding sponge

Science.gov (United States)

Marlow, Joseph; Davy, Simon K.; Shaffer, Megan; Haris, Abdul; Bell, James J.

2018-06-01

In the Wakatobi region of Indonesia, a prolonged period of elevated water temperature in 2016 caused extensive coral bleaching and mortality. Unusually, bleaching was also observed in the bioeroding sponge Cliona aff. viridis, with affected sponges expelling 99% of their Symbiodinium. Bleaching surveys of C. aff. viridis were conducted 6 weeks apart, coinciding with a 0.8 °C drop in water temperature. Over this period, bleaching prevalence dropped from 73.9% (± 9.9 SE) to 25.7% (± 5.8 SE), and bleaching severity dropped from 25.95% (± 4.5 SE) to 11.54% (± 1.9 SE) of sponge tissue. Over the same period, monitored bleached sponges showed an 81% drop in bleaching severity, but also a 13% reduction in overall sponge size. Our results show that while the clionaid- Symbiodinium relationship is susceptible to break down under thermal stress, rapid recovery can occur, although incurring some partial host mortality.

Barreras y facilitadores para el uso de los servicios de primer nivel de atención de la Caja Costarricense de Seguro Social (CCSS por parte de la población de uno a menos de 6 años en los sitios centinela de Costa Rica

Directory of Open Access Journals (Sweden)

Tatiana Martínez Jaikel

2014-01-01

Full Text Available Objetivos: Determinar las barreras y facilitadores para el uso de los servicios de primer nivel de atención de la Caja Costarricense de Seguro Social (CCSS por parte de la población de uno a menos de 6 años en las comunidades de Damas de Desamparados, San Antoni o de Nicoya y territorio indígena de L a Casona de Coto Brus. Métodos: Metodología cualitativa. La información se obtuvo de tres fuentes de datos: entrevistas semi - estructuradas, tanto con las madres o encargadas de los niños, como con los funcionarios a c argo de las consultas en los Equipos Básicos de Atención en Salud (EBAIS , y observaciones de las consultas en los EBAIS. Resultados: Las razones de uso están relacionadas , en los tres sitios, con los beneficios que les trae a las usuarias la consulta, el buen trato de l personal y la comodidad de las instalaciones de los EBAIS. Mientras que las razones de no uso comunes están asociadas al concepto de salud ligado a ausencia de enfermedad, la falta de información y problemas económicos de las usuarias, la n o asignación de citas después del año de edad y la calidad de la atención recibida. Las razones relacionadas con el contexto, como las largas distancias, las limitaciones en cuanto a medios de transporte, cobran gran relevancia principalmente en la zona ru ral y en el territorio indígena. Conclusiones: El colocar la asistencia a cita control de esta población dentro de los compromisos de gestión de la CCSS, asignar la cita previamente y designar el equipo de atención en los EBAIS tomando en cuenta no una no rma general, sino las condiciones particulares de cada sitio, son medidas que garantizarían el aumento de la cobertura de la atención integral a esta población.

La caja real de Popayán 1738-1800

Directory of Open Access Journals (Sweden)

Oscar Rodríguez Salazar

1987-01-01

extraída del Archivo General de Indias y complementada con los registros que reposan en el Archivo Histórico Nacional, se pretende explicar el régimen impositivo y su conexión con las estructuras sociales y económicas; enmarcando este análisis en el período del ascenso político y la posterior crisis de la dinastía de los Borbones.

Inflation Targeting and Quantitative Tightening: Effects of Reserve Requirements in Peru

OpenAIRE

Adrián Armas; Paul Castillo; Marco Vega

2014-01-01

This paper provides an overview of the reserve requirement measures undertaken by the Central Bank of Peru. It provides a rationale for the use of these instruments as well as empirical evidence of their effectiveness. In general, the results show that tightening reserve requirements has the desired effects on interest rates and credit levels at both banks and smaller financial institutions (cajas municipales).

Pulmonary manifestations of rheumatoid arthritis: a review | Biomdo ...

African Journals Online (AJOL)

Rheumatoid arthritis can aff ect the lung parenchyma, airways and pleura. Pulmonary complications are directly responsible for 10-20% of all mortality in RA patients. Objective: To highlight the common and important manifestations of rheumatoid lung disease and discuss the recent studies on each.Data source: Articles on ...

75 FR 24828 - Promoting a Competitive Market for Capacity Reassignments

Science.gov (United States)

2010-05-06

... part and remanded in part sub nom. Interstate Natural Gas Ass'n of America v. FERC, 285 F.3d 18, 350 U... ] 61,088 (2004), aff'd sub nom. American Gas Ass'n v. FERC, 428 F.3d 255, 368 U.S. App. DC 176 (DC Cir...

Revisorlovgivningens Uafhængighedsregler

DEFF Research Database (Denmark)

Langsted, Lars Bo

Papiret beskriver uafhængighedskravet til revisor, de grundliggende betingelser herfor, samt den gældende danske regulering. Herefter beskrives de problemer, det gældende regelsæt afføder i forhold til brugere, samfundet og revisorerhvervet selv. Notatet beskriver herefter en række reguleringsmod...

Antioxidant activity, total phenols and flavonoids of lichens from Venezuelan Andes.

Directory of Open Access Journals (Sweden)

Claudia M. Plaza

2014-10-01

Full Text Available Context:The biological potential of lichens has been documented through their use in traditional medicine. Secondary lichen metabolites exert a wide variety of biological actions, including their use as antioxidants. Aims:To evaluate the antioxidant activity, total phenol content, and flavonoids of four lichen fungal taxa collected in Mérida (Venezuela, and statistically evaluate the correlation between the antioxidant activity and the amount of phenols and flavonoids in the samples. Methods: Extracts were prepared with water, ethanol and dichloromethane from Cladonia aff. rappii, Cora aff. glabrata, Peltigera laciniata and Thamnolia vermicularis. The antioxidant capacity assessment was determined using DPPH• radical method and reducing power, with ascorbic acid as control. Total phenols were determined by means of the Folin-Ciocalteu method with gallic acid. Total flavonoids were estimated according to the modified Dowd method, using quercetin as standard. Results:The ethanolic extracts of the tested lichens showed the highest scavenging activity and reducing power compared to water and dichloromethane extracts at 4 mg/mL. The highest antiradical power value was found in ethanolic extract of Peltigera laciniata (2.28 mL/mgand the lowest in dichloromethane extract of Cora aff. glabrata (0.30 mL/mg. The correlation between antioxidant activity and total phenolic content was moderate. The flavonoids content of ethanolic extracts was highly significant but negative (p < 0.05. There was good correlation in dichloromethane extracts. The ethanolic extract of P. laciniata exhibited the highest antiradical activity despite showing the lowest flavonoid content. Conclusions: The ethanolic extracts of lichens tested showed to have the higher antioxidant activity and may be used as natural sources of new antioxidants.

Evaluating the potential of housekeeping genes, rRNAs, snRNAs, microRNAs and circRNAs as reference genes for the estimation of PMI.

Science.gov (United States)

Tu, Chunyan; Du, Tieshuai; Shao, Chengchen; Liu, Zengjia; Li, Liliang; Shen, Yiwen

2018-04-24

The precise estimation of postmortem interval (PMI) is a critical step in death investigation of forensic cases. Detecting the degradation of RNA in tissues by real time quantitative polymerase chain reaction (RT-qPCR) technology provides a new theoretical basis for estimation of PMI. However, most commonly used reference genes degrade over time, while previous studies seldom consider this when selecting suitable reference genes for the estimation of PMI. Studies have shown microRNAs (miRNAs) are very stable and circular RNAs (circRNAs) have recently emerged as a novel class of RNAs with high stability. We aimed to evaluate the stability of the two kinds of RNAs and normal reference genes using geNorm and NormFinder algorithms to identify tissue-specific reference genes for PMI estimation. The content of candidate RNAs from mouse heart, liver and skeletal muscle tissues were dynamically examined in 8 consecutive days after death. Among the 11 candidate genes (β-actin, Gapdh, Rps18, 5S, 18S, U6, miR-133a, miR-122, circ-AFF1, LC-Ogdh and LC-LRP6), the following genes showed prioritized stability: miR-122, miR-133a and 18S in heart tissues; LC-Ogdh, circ-AFF1 and miR-122 in liver tissues; and miR-133a, circ-AFF1 and LC-LRP6 in skeletal muscle tissues. Our results suggested that miRNAs and circRNAs were more stable as reference genes than other kinds of RNAs regarding PMI estimation. The appropriate internal control genes were not completely the same across tissue types.

Análisis de las entidades financieras comunitarias del ecuador

Directory of Open Access Journals (Sweden)

Olga Maritza Rodríguez Ulcuango

2016-12-01

Full Text Available La presente investigación  analiza al conjunto de instituciones financieras comunitarias cobijados bajo la Unión de Cajas Solidarias y Bancos Comunales del Ecuador, que vienen fortaleciéndose a través de los años por la política pública enfocada en principios solidarios y eficiencia en el manejo de recursos financieros en función de la confianza mutua de los socios que actualmente capitalizan 7000.000 millones de dólares y una recuperación de cartera efectiva, beneficiando de forma directa e indirecta a más de 12900 personas que invierten sus créditos en la tierra productiva de la zona rural del país, empleando mano de obra familiar y levantando el autoestima al no formar parte del rubro de pobreza extrema por limitación al acceso a créditos en el sistema financiero formal ecuatoriano. El tipo de estudio es exploratorio, a nivel cuantitativo y cualitativo, con aplicación de encuestas y entrevistas a presidentes y tesoreros. Palabras clave: Cajas comunitarias, finanzas,  economía social.

The bivalve Anopaea (Inoceramidae) from the Upper Jurassic-lowermost Cretaceous of Mexico

Science.gov (United States)

Zell, Patrick; Crame, J. Alistair; Stinnesbeck, Wolfgang; Beckmann, Seija

2015-07-01

In Mexico, the Upper Jurassic to lowermost Cretaceous La Casita and coeval La Caja and La Pimienta formations are well-known for their abundant and well-preserved marine vertebrates and invertebrates. The latter include conspicuous inoceramid bivalves of the genus Anopaea not formally described previously from Mexico. Anopaea bassei (Lecolle de Cantú, 1967), Anopaea cf. stoliczkai (Holdhaus, 1913), Anopaea cf. callistoensis Crame and Kelly, 1995 and Anopaea sp. are rare constituents in distinctive Tithonian-lower Berriasian levels of the La Caja Formation and one Tithonian horizon of the La Pimienta Formation. Anopaea bassei was previously documented from the Tithonian of central Mexico and Cuba, while most other members of Anopaea described here are only known from southern high latitudes. The Mexican assemblage also includes taxa which closely resemble Anopaea stoliczkai from the Tithonian of India, Indonesia and the Antarctic Peninsula, and Anopaea callistoensis from the late Tithonian to ?early Berriasian of the Antarctic Peninsula. Our new data expand the palaeogeographical distribution of the high latitude Anopaea to the Gulf of Mexico region and substantiate faunal exchange, in the Late Jurassic-earliest Cretaceous, between Mexico and the Antarctic Realm.

Espécies de Gorybia Pascoe (Coleoptera, Cerambycidae, Piezocerini ocorrentes na Bolívia

Directory of Open Access Journals (Sweden)

Maria Helena M. Galileo

2013-03-01

Full Text Available Species of Gorybia Pascoe (Coleoptera, Cerambycidae, Piezocerini occurring in Bolivia. The genus Gorybia (Cerambycinae, Piezocerini consists of 45 described species with seven species recorded from Bolivia. Nine new species are described herein from Bolivia: G. abnormalis sp. nov.; G. alveolata sp. nov.; G. asyka sp. nov.; G. florida sp. nov.; G. inarmata sp. nov.; G. longithorax sp. nov.; G. guenda sp. nov.; G. tuberosa sp. nov. and G. wappesi sp. nov. A key to the species now known to occur in Bolivia is included.

Respostas metabólicas em camundongos submetidos à dieta indutora de obesidade e alimentados com iogurtes probióticos e yacon (Smallanthus sonchifolius)

OpenAIRE

Pereira, Juciane de Abreu Ribeiro

2013-01-01

Muitas pesquisas têm sido realizadas na busca de terapias alternativas para a obesidade, a qual caracteriza-se por estado inflamatório que interfere em vários processos metabólicos, modificando perfil lipídico e glicêmico, podendo causar dislipidemias e resistência à insulina. Os alimentos com alegação de propriedades funcionais se destacam nesse contexto, a exemplo de iogurtes probióticos e raiz tuberosa de yacon (Smallanthus sonchinfolius). O presente trabalho objetivou avaliar os efeitos d...

Micofagia por roedores en un bosque templado del centro de México Mycophagy by rodents in a temperate forest of Central Mexico

Directory of Open Access Journals (Sweden)

Citlalli Castillo-Guevara

2012-09-01

Full Text Available La micofagia por roedores en hongos hipogeos ha sido documentada en diversos ecosistemas del mundo; sin embargo, el estudio del consumo de hongos epigeos por este grupo ha sido insuficiente. En el presente trabajo se evaluó de manera experimental la micofagia de 2 especies de ratones silvestres (Neotomodon alstoni y Peromyscus maniculatus en el hongo epigeo ectomicorrizógeno Russula aff. cuprea y la posible preferencia de estos ratones por consumir alguna estructura específica del hongo (píleo, himenio o estípite. Asimismo, se analizó si el paso del hongo a través del tracto digestivo afectaba la actividad metabólica esporal. Los resultados indican que aunque el esporoma entero puede ser consumido, el himenio (parte fértil es la primera estructura seleccionada por ambas especies. Además, se encontró que el paso por el tracto digestivo de las 2 especies de ratones no tiene efecto significativo (p= 0.067 en la actividad metabólica esporal de R. aff. cuprea, sugiriendo que estos ratones silvestres podrían ser dispersores efectivos de las esporas del hongo epigeo en el Parque Nacional La Malinche.The mycophagy by rodents in hypogeous fungal species has been widely documented in different ecosystems around the world. However, the consumption of epigeos fungi by this group has been poorly studied. In this study we evaluated the mycophagy by 2 mice species (Neotomodon alstoni and Peromyscus maniculatus in the epigeous ectomycorrhizal fungi Russula aff. cuprea. Experimentally tests were carried out to see if these mice species have a preference to consume a specific structure of the fungus (pileus, hymenium or stipe. Also, we analyzed if the passage of this fungus through the digestive tract has an effect on the sporal metabolic activity. Our results indicate that although the whole sporocarp can be consumed, the hymenium (fertile part of the sporocarp was the first structure selected by both mice species. Furthermore, we found that the

Duchenne muscular dystrophy - a molecular service

African Journals Online (AJOL)

In 1987 a carrier detection and prenatal diagnostic service for. Duchenne muscular dystrophy using molecular technology was instituted at the Department of Human Genetics, Uni- versity of Cape Town, to serve affe.cted families in southern. Africa. DNA samples from 100 affected male subjects and. 350 of their relatives ...

Erratum to

NARCIS (Netherlands)

He, Shuangyan; He, Mingxia; Fischer, Jürgen; Yuan, Dongliang; Xu, Peng; Xu, Tengfei; Yang, Xianping; Sokoletsky, Leonid; Wei, Xiaodao; Shen, Fang; Zou, Juhong; Guo, Maohua; Cui, Songxue; Zhou, Wu; Gao, Dalu; Jin, Guangzhen; Lü, Xianqing; Qiu, Fuwen; Fang, Wendong; Pan, Aijun; Cha, Jing; Zhang, Shanwu; Huang, Jiang; Wang, Tao; Cheng, Yongzhou; Chen, Xiaoyan; Liu, Zhaopu; Long, Xiaohua; Hou, Zhishuai; Wen, Haishen; Li, Jifang; He, Feng; Liu, Qun; Wang, Jinhuan; Guan, Biao; Wang, Qinglong; Shahjahan, Md; Kabir, Md Farajul; Sumon, Kizar Ahmed; Bhowmik, Lipi Rani; Rashid, Harunur; Li, Shu; Yu, Kefu; Zhao, Jianxin; Feng, Yuexing; Chen, Tianran; Zhou, Shun; Ren, Yichao; Pearce, Christopher M.; Dong, Shuanglin; Tian, Xiangli; Gao, Qinfeng; Wang, Fang; Liu, Liming; Du, Rongbin; Zhang, Xiaoling; Dong, Shuanglin; Sun, Shichun; Feng, Song; Lin, Jianing; Sun, Song; Zhang, Fang; Zhang, Zhipeng; Tang, Xuexi; Tang, Haitian; Song, Jingjing; Zhou, Jian; Liu, Hongjun; Wang, Qixiang; Qian, Kuimei; Liu, Xia; Chen, Yuwei; Sun, Chengjun; Jiang, Fenghua; Gao, Wei; Li, Xiaoyun; Yu, Yanzhen; Yin, Xiaofei; Wang, Yong; Ding, Haibing; Sun, Zhongmin; Wang, Yongqiang; Yan, Pengcheng; Guo, Hui; Yao, Jianting; Tanaka, Jiro; Kawai, Hiroshi; Song, Na; Chen, Muyan; Gao, Tianxiang; Yanagimoto, Takashi; Lu, Xia; Luan, Sheng; Kong, Jie; Hu, Longyang; Mao, Yong; Zhong, Shengping; Liu, Yan; Zhao, Weihong; Li, Caiyan; Miao, Hui

2017-01-01

Unfortunately for all articles of Vol. 35 No. 1 the future journal title “Journal of Oceanology and Limnology” was used instead of the current journal title “Chinese Journal of Oceanology and Limnology”. All articles in the issue are aff ected. Please make sure to cite the articles with the

76 FR 58716 - Interpretation of Transmission Planning Reliability Standard

Science.gov (United States)

2011-09-22

..., Western Public Agencies Group, Western Montana Electric G&T Cooperative, Inc., Oregon Municipal Electric... Enforcement of Electric Reliability Standards, Order No. 672, FERC Stats. & Regs. ] 31,204, order on reh'g... FERC ] 61,062, order on reh'g & compliance, 117 FERC ] 61,126 (2006), aff'd sub nom. Alcoa, Inc. v...

The presence of Ursus ex gr. minimus-thibetanus in the late villányian and its position among the Pliocene and Pleistocene black bears in Europe

Czech Academy of Sciences Publication Activity Database

Wagner, Jan; Čermák, Stanislav; Horáček, I.

-, č. 4 (2011), s. 39-58 ISSN 1771-1150 R&D Projects: GA ČR GA205/09/0184 Institutional research plan: CEZ:AV0Z30130516 Keywords : Black bear * MN17 * Ursus aff. thibetanus * Villány 3 * Central Europe - Hungary * Ursus * Pleistocene * Pliocene Subject RIV: DB - Geology ; Mineralogy

Effect of forage on the content of phyto-oestrogens in bovine milk

DEFF Research Database (Denmark)

Andersen, Charlotte; Weisbjerg, Martin Riis; Hansen-Møller, Jens

2009-01-01

Phyto-oestrogens are believed to have a range of beneficial effects on predominant Western diseases. A few studies on phyto-oestrogens in milk exist and show that the composition can be affected by feeding. Therefore, the aim was to study how feeding of lucerne and grass/clover silages (GCSs) aff...

Valuation: From The Discounted Cash Flows (DCF Approach To The Real Options Approach (ROA Valuation: From The Discounted Cash Flows (DCF Approach To The Real Options Approach (ROA

Directory of Open Access Journals (Sweden)

Cecilia Maya Ochoa

2004-12-01

Full Text Available There exists an abysm between market prices and traditional valuation approaches such as Discounted Cash Flows (DCF, a fact that neither academics nor practitioners could continue ignoring. Recently, a complementary approach has taken a foothold into the valuation world. Building on the DCF approach yet going further in the sense of incorporating flexibility in management investment decisions, and taking advantage of the advances in option pricing theory, the real options approach (ROA has become the alternative to capital budgeting and, lately, to corporate valuation. Empirical evidence shows that ROA explains actual prices better than DCF approaches and nowadays there is no question that from a theoretical point of view, ROA is a much more appealing concept than passive NPV. However, its acceptance by practitioners has been very slow due to the complexity of real options pricing.Existe un abismo entre precios de Mercado y la valoración estimada por métodos tradicionales tales como Flujos de Caja Descontados, un hecho que ni académicos ni practicantes pueden continuar ignorando. Recientemente, una metodología complementaria ha tomado gran fuerza. Partiendo de los Flujos de Caja Descontados, pero incorporando flexibilidad en las decisiones de inversión y aprovechando los avances en la teoría de valoración de opciones, el enfoque de opciones reales (ROA se ha convertido en la alternativa para presupuestación de capital y valoración de empresas. La evidencia empírica muestra que ROA explica los precios de mercado mejor que los enfoques basados en flujos de caja descontados y, hoy en día, no hay discusión de que es más atractivo desde un punto de vista teórico; sin embargo, su utilización en la práctica ha sido muy limitada debido a las dificultades que presenta la valoración de las opciones reales.

Tumor intracardiaco en el recién nacido

Directory of Open Access Journals (Sweden)

Yanett Sarmiento Portal

2014-02-01

Full Text Available Introducción: los tumores primarios cardiacos son raros durante la infancia y en su mayoría benignos, siendo los rabdomiomas los más comunes, asociándose en más del 60% de los casos con esclerosis tuberosa. La mayoría de ellos tienden a involucionar, pero algunos, según su localización y manifestaciones clínicas, requerirán tratamiento quirúrgico. Caso clínico: recién nacido del sexo femenino, hija de madre de 34 años. Nace producto de cesárea iterada a las 40 semanas, Apgar 9-9 y peso al nacer 2800 gramos. Tuvo seguimiento por Genética Clínica durante el embarazo por detectarse en ultrasonido prenatal la presencia de tumoración intracardiaca, la cual se confirma al realizar ecografía postnatal, con un área tumoral de 3,5mm. Se diagnostica Rabdomioma intracardiaco que no obstruye el tracto de salida, con seguimiento clínico y ecocardiográfico mensual y evolución favorable. Conclusiones: los tumores cardiacos fetales son extraordinariamente raros. Se pueden diagnosticar por ecografía desde la vida intrauterina. La actitud recomendada es expectante por la posibilidad de regresión espontánea, excepto en aquellos casos con repercusión clínica. En el seguimiento se debe descartar la presencia de esclerosis tuberosa por su elevada asociación con esta entidad.

Salt damage and RH changes: The case of the Waag Building in Amsterdam

NARCIS (Netherlands)

Hees, R.P.J. van; Lubelli, B.A.

2007-01-01

Changes in the air MM can cause damage to building materials contaminated with hygroscopic saus, even in the absence of any other moishwe source. This phenomenon has been observed in the case of the iflag build ing in Amsterdam, affècted by severe salt decay. The investigation, canied out by means

The Antiaircraft Journal. Volume 92, Number 5, September-October 1949

Science.gov (United States)

1949-10-01

philosophical reflections on the subject of po’werand those to whom it should be entrusted. Recall the words of much-studied Machiavelli , than whom...Leavenworth. Kan. Rauch. A. R, Comm. of Basic Phys. Sc.• Res. & Dev. Board, Pentagon. \\Vash. 25. D. C. Rawls . J. W., Jr.. AFF Liaison Off.. Boeing Aircraft

78 FR 78508 - Quarterly Rail Cost Adjustment Factor

Science.gov (United States)

2013-12-26

... (ICC) outlined the procedures for calculating the all-inclusive index of railroad input prices [[Page... Association of American Railroads (AAR) is required to calculate the index on a quarterly basis and submit it... Procedures--Productivity Adjustment, 5 I.C.C.2d 434 (1989), aff'd sub nom. Edison Electric Institute v. ICC...

Bagaço e fécula de mandioca na elaboração de farinhas cruas e pré-gelatinizadas, snacks e macarrões instantâneos com amaranto

OpenAIRE

FIORDA, Fernanda Assumpção

2011-01-01

A mandioca é uma tuberosa amilácea de grande potencial energético, podendo ser utilizada tanto para o consumo in natura como para industrialização, gerando quantidades significativas de bagaço, que apresenta potencialidade de uso como fonte de fibra alimentar. A tecnologia de extrusão vem sendo explorada nos últimos anos para o desenvolvimento de novos produtos alimentícios como massas alimentícias que estão incorporadas à cozinha brasileira, servindo como prato principal ou complemento, em m...

Integrated watershed analysis: adapting to changing times

Science.gov (United States)

Gordon H. Reeves

2013-01-01

Resource managers are increasingly required to conduct integrated analyses of aquatic and terrestrial ecosystems before undertaking any activities. Th ere are a number of research studies on the impacts of management actions on these ecosystems, as well as a growing body of knowledge about ecological processes that aff ect them, particularly aquatic ecosystems, which...

75 FR 81152 - Interpretation of Protection System Reliability Standard

Science.gov (United States)

2010-12-27

..., generation and transmission (G&T) cooperative or similar organization to accept compliance responsibility on... Reliability Standards, Order No. 672, FERC Stats. & Regs. ] 31,204, order on reh'g, Order No. 672-A, FERC... reh'g & compliance, 117 FERC ] 61,126 (2006), aff'd sub nom. Alcoa, Inc. v. FERC, 564 F.3d 1342 (DC...

Resten i Vesten

DEFF Research Database (Denmark)

Moberg, Bergur Rønne

på formelle elementer ved ikke at privilegere det radikalt nye efter et vestligt-avantgardistisk mønster. Forskellen bliver tydelig i kraft af den ballast af geografi, kultur, historie og politik som de færøske forfattere tænker med, og som afføder en anden udviklings- og originalitetsopfattelse end...

Rural Utopi i Urban Tidsalder

DEFF Research Database (Denmark)

Bagger-Petersen, Mai Corlin

2015-01-01

Den kinesiske filmskaber, redaktør, kurator og kunstner Ou Ning udformede i 2010 notesbogen Hvordan man laver sin egen utopi; en forestilling om en intellektuel genoplivning af et tabt, ruralt fællesskab i landsbyen Bishan i den østlige del af Centralkina. Notesbogen er et montageværk, som afføde...

75 FR 42134 - United States v. Keyspan Corporation; Public Comments and Response on Proposed Final Judgment

Science.gov (United States)

2010-07-20

... rewards of discounting (selling a greater volume of capacity) while simultaneously mitigating the price... its remedy. See generally United States v. Microsoft Corp., 56 F.3d 1448, 1458-62 (D.C. Cir. 1995... (S.D.N.Y. 1997) (quoting Microsoft, 56 F.3d at 1460) (emphasis in original), aff'd sub nom, United...

Comercialização de frutas exóticas

Directory of Open Access Journals (Sweden)

Hélio Satoshi Watanabe

2014-03-01

Full Text Available Nas Centrais de Abastecimento - CEASAs, a fruta é considerada exótica quando comercializada em menor volume. Apesar do aumento significativo da demanda de algumas frutas exóticas nos últimos anos, o volume total ainda é pequeno em relação ao volume total das demais frutas. Em 2012, na Companhia de Entrepostos e Armazéns Gerais de Säo Paulo - CEAGESP, as frutas exóticas representaram 0,65% do volume total de frutas comercializadas e 2,09% do volume financeiro do setor de frutas. A oferta de algumas frutas exóticas na CEAGESP teve crescimentos surpreendentes nos últimos 5 anos, como foi o caso da lichia, romä, mangostäo, pitaya, physalis e das frutas vermelhas- amora e framboesa. Por outro lado, carambola, abiu e umbu tiveram o volume comercializado diminuído nos últimos 3 anos.

Work-related motives and self-esteem in American women.

Science.gov (United States)

Bedeian, A G; Touliatos, J

1978-05-01

Acknowledging the need for additional research on work-related motives and self-esteem in American women, this study investigated the hypothesis that women with a favorable self-esteem would score high in n Ach, in Pow, and n Auto, whereas women with a less favorable self-esteem would score high in n Aff, n Agg, and n Def. Eighty-five female college students completed Gough and Heilbrun's Adjective Check List and Form B of the Coopersmith Self-Esteem Inventory. Data were analyzed by means of chi square tests in conjunction with the coefficient of association asymmetric lambda. The results indicated that, as predicted, women with a favorable self-esteem scored high in n Ach (p less than .001) and n Pow (p less than .001), while contrary to expectation, they also scored high in n Aff (p less than .05). All other relationships were found to be nonreliable. These findings were interpreted as stressing the importance of the relationship between self-esteem and work-related motives in women.

Antifungal activity of extracts from three species of lichens in Cuba

International Nuclear Information System (INIS)

Vaillant-Flores, Daymara Idonay; Romeu-Carballo, Carlos Rafael; Ramirez-Ochoa, Rebeca; Porras-Gonzalez, Angela; Gomez-Peralta, Marlene

2015-01-01

The antifungal activity of the three lichens extracts was evaluated in this work. Extracts from Leptogium cyanescens, Physcia americana and Pyxine aff. cocoes were collected extracts from the lichens thallus in 2009 in areas fromo the Jardin Botanico Cienfuego, Cuba. The fungicide activity was evaluated against phytopathogens fungi of potato: Rhizoctonia solani and Phytophthora nicotianae var parasitica. The study was conducted from 2009 to 2011. The compounds were extracted with acetone, concentrated by rotoevaporation, and evaluated at concentrated of 0,01 and 0,07% in potato dextrose agar (PDA) culture medium; stock solution was made of 5% dimethilsufoxide. These extracts were classified by their toxicity as: toxic, slight and moderately toxic and harmless. The extracts from P. americana of 0,07% inhibited P. nicotianae 100%, and it showed values over 50% for R. solani. L. cyanescens only showed fungicide activity in both phytopathogens at the maximum concentration studied; similar results were obtained with the extract from P. aff. cocoes. The lichens extracts were classified as lightly toxic at the maximun concentration, and harmless at the minimum concentration. (author) [es

Snakes of the genus Oxyrhopus (Colubridae: Squamata in Colombia: taxonomy and geographic variation

Directory of Open Access Journals (Sweden)

John D. Lynch

2009-01-01

Full Text Available Four species of Oxyrhopus occur in Colombia, one (O. leucomelas of which is Andean and the other three occur in lowlands. No geographic variation was detected in O. occipitalis but there is marked geographic variation in color pattern and scutellation for the widely distributed O. petola. Recognition of subspecies within O. petola is possible but appears to obscure more than it illuminates. The snake previously reported as O. melanogenys or O. aff. melanogenys is diagnosed as a previously unrecognized species.Cuatro especies del género Oxyrhopus se encuentran en Colombia. De las cuatro especies, una (O. leucomelas es una especie andina y las otras tres son especies de las tierras bajas. Variación geográfica no fue detecta en O. occipitalis pero mucha variación se encuentra en O. petola, en términos de patrón y de conteos de escamas. Se posible de reconocer subespecies pero tal reconocimiento oscura mas que ilumina. La serpiente conocida antes como O. melanogenys o O. aff. melanogenys está descrita como especie nueva.

Los peligros volcánicos asociados al complejo del Teide y los Rifts activos de Tenerife

OpenAIRE

Carracedo, Juan Carlos; Fra-Paleo, U.; Rodríguez Badiola, Eduardo; Pérez Torrado, Francisco José; Paris, Raphael; Guillou, Hervé; Scaillet, Stéphane; Hansen Machín, Álex

2006-01-01

Estos trabajos geológicos no habrían podido realizarse sin la oportuna y generosa financiación de Obra Social y Cultural de la Caja General de Ahorros de Canarias y el Laboratoire des Sciences du Climat et de l’Environnement (CEA-CNRS), Francia. Posteriormente, por la financiación dentro del marco del Plan Nacional de I+D, del proyecto de investigación CGL2005-00239.

Erupciones freatomagmáticas del complejo volcánico Teide-Pico Viejo

OpenAIRE

Pérez Torrado, Francisco José; Carracedo, Juan Carlos; Paris, Raphael; Rodríguez Badiola, Eduardo; Hansen Machín, Álex

2006-01-01

Estos trabajos geológicos no habrían podido realizarse sin la oportuna y generosa financiación de Obra Social y Cultural de la Caja General de Ahorros de Canarias y el Laboratoire des Sciences du Climat et de l’Environnement (CEA-CNRS), Francia. Posteriormente, por la financiación dentro del marco del Plan Nacional de I+D, del proyecto de investigación CGL2005-00239.

Geocronología e historia volcánica del complejo volcánico del Teide y las dorsales de Tenerife

OpenAIRE

Carracedo, Juan Carlos; Rodríguez Badiola, Eduardo; Guillou, Hervé; Scaillet, Stéphane; Paterne, Martine; Pérez Torrado, Francisco José; Paris, Raphael; Fra-Paleo, U.; Hansen Machín, Álex

2006-01-01

Estos trabajos geológicos no habrían podido realizarse sin la oportuna y generosa financiación de Obra Social y Cultural de la Caja General de Ahorros de Canarias y el Laboratoire des Sciences du Climat et de l’Environnement (CEA-CNRS), Francia. Posteriormente, por la financiación dentro del marco del Plan Nacional de I+D, del proyecto de investigación CGL2005-00239.

Accelerating our Second Transformation. 2010 Annual Report

Science.gov (United States)

2010-01-01

a global learning environment to support a mission-ready Defense Acquisition Workforce that develops, delivers, and sustains eff ective and aff...Procurement Conference • International eLearning Conference • Knowledge Advisors Conference • NAVAIR Strategic Planning Conference • Naval Postgraduate...Ogden, UT Stevens Institute of Technology, Hoboken, NJ Strayer University, Woodbridge, VA* Thunderbird School of Global Management, Glendale, AZ

Assessment of reproductive and growth performances of pig breeds ...

African Journals Online (AJOL)

AFF), weight at first farrowing (WtFF) and litter size (LS) of gilts were 179.97 ± 25.40 days; 1.76 ± 0.77; 100 ± 0.00; 350.47 ± 40.58 days; 107.26 ± 31.85 kg and 7.18 ± 1.93 piglets, respectively. In sows, the FI, fecundity, LS and farrowing interval ...

78 FR 59093 - Quarterly Rail Cost Adjustment Factor

Science.gov (United States)

2013-09-25

... (ICC) outlined the procedures for calculating the all-inclusive index of railroad input prices and the... American Railroads (AAR) is required to calculate the index on a quarterly basis and submit it to the...--Productivity Adjustment, 5 I.C.C. 2d 434 (1989), aff'd sub nom. Edison Electric Institute v. ICC, 969 F.2d 1221...

Medical Surveillance Monthly Report. olume 22, Number 1, January 2015

Science.gov (United States)

2015-01-01

Bragg, NC . . 1 . . 1 2.3 Fort Bliss , TX . 1 . . . 1 2.3 Fort Hood, TX . . 1 . . 1 2.3 Joint base Langley-Eustis, VA 1 . . . . 1 2.3 Fort Lewis, WA...seasons in temperate climates but depends more on other factors aff ect- ing mosquito breeding such as the tim - ing of the rainy season and altitude (below

Remote management and programmable automata; Telegestion et automate programmable

Energy Technology Data Exchange (ETDEWEB)

NONE

2000-07-01

This document is the proceedings of the meeting organized by the French association of refrigeration (AFF) during the ELEC 2000 exhibition about the measurement, recording, data transmission, automation, diagnosis and management of refrigeration systems. An example of the energy saving made in a supermarket context thanks to the operation control of a refrigerating machinery is presented. (J.S.)

Growth and yield considerations and implications for alternative density management objectives and approaches

Science.gov (United States)

David. Marshall

2013-01-01

Density management through thinning is the most important tool foresters have to aff ect stand development and stand structure of existing stands. Reducing stand density by thinning increases the growing space and resource availability (e.g., light, water, and nutrients) for the remaining trees. Th is can result in increased average tree growth. More available site...

Uso de nuevas herramientas para el control de triatominos en diferentes situaciones entomológicas en el continente americano

Directory of Open Access Journals (Sweden)

Oliveira Filho Alfredo M.

1997-01-01

Full Text Available Se relatan los resultados obtenidos en el terreno seis meses y dos años post-tratamiento con las nuevas herramientas para el control de triatominos desarrolladas con apoyo de la OMS/TDR, o sea, a pinturas insecticidas, una suspensión emulsionable de lenta liberación conteniendo el 8,3% de malathion, aplicada por rociamiento; b potes fumígenos que, después de encendidos, echan humos que contienen cypermetrina y DDVP; c cajas sensoras para detección de triatominos. Los ensayos en el terreno fueron realizados en Chile, Honduras y Paraguay contra tres especies principales de vectores de la enfermedad de Chagas - Triatoma infestans, T. dimidiata y Rhodnius prolixus, según el protocolo elaborado por un comité de expertos de la OMS. Los resultados indican que las pinturas insecticidas constituyen un eficaz medio de control de estos vectores en cualquiera de las condiciones estudiadas, sea en el domicilio, sea en el peridomicilio, manteniendo los porcentajes de infestación muy próximos a cero. Comparaciones preliminares de la técnica de cajas sensoras para detección de casas infestadas por triatominos, con la búsqueda hecha por personal entrenado (hora/hombre indican esta última como la mas apropiada.

Implementation of a Centro de Produccion de Radio Farmacos con Ciclotron y Sistema de Diagnostico por Imagenes PET in the Universidad de Costa Rica: draft

International Nuclear Information System (INIS)

2012-01-01

A Centro de Produccion de Radio Farmacos de Aplicaciones en Sistemas PET will be implemented in Costa Rica. Universidad de Costa Rica will have technology that allows you to help with early detection of tumors in a much more rapid and painless. The development of PET technology in the Caja Costarricense de Seguro Social and private health sector, has been delayed by the lack of definition in the supply of radiopharmaceuticals; due to the high cost of a cyclotron system and ensuring its profitability, being here where the Universidad de Costa Rica come to play a key role as an impartial figure in the scheme of national implementation. Therefore, a bilateral agreement is exposed for the daily supply of radiopharmaceuticals in place at a cost inversely proportional to the volume of consumption and enabling financial sustainability of the project. This agreement must be established between the Universidad de Costa Rica and the Caja Costarricense de Seguro Social, and then seek expansion of marketing with the private sector nationwide. A SWOT (Strengths, Weaknesses, Opportunities and Threats) is developed on the project. Also, the geographical location of the project facilities is showed, the architecture of the project cost without operations. Finally, the architectural design of the building is presented [es

Uso del indicador del retorno total del negocio como alternativa para optimizar la inversión en unidades de negocio en condiciones de incertidumbre

Directory of Open Access Journals (Sweden)

Hernán Herrera Echeverri

2007-04-01

Full Text Available En este artículo se hace un análisis sobre la validez de la TBR (Total Bussines Return como medida de rentabilidad de unidades de negocio que pertenecen a un portafolio corporativo. Se establecen cuáles son sus debilidades y en qué casos es posible aceptarlas como medida de rentabilidad asociada con la creación de valor. Se expone la coincidencia matemática entre la TBR y el WACC (costo promedio ponderado de capital a partir del descuento de flujos de caja proyectados y entre el CAV (creación adicional de valor y la diferencia entre el ingreso económico obtenido y el ingreso económico esperado en un periodo determinado. También se evidencia la equivalencia entre el CAV y la variación del valor de las operaciones más la variación del flujo de caja del periodo. Posteriormente se realiza una aplicación para mostrar cómo puede utilizar la TBR y la teoría moderna de portafolio para que un gerente corporativo pueda controlar la relación rendimiento-riesgo existente entre las distintas unidades de negocio a cargo de su corporación.

en condiciones de incertidumbre

Directory of Open Access Journals (Sweden)

Hernán Herrera Echeverri

2007-01-01

Full Text Available En este artículo se hace un análisis sobre la validez de la TBR (Total Bussines Return como medida de rentabilidad de unidades de negocio que pertenecen a un portafolio corporativo. Se establecen cuáles son sus debilidades y en qué casos es posible aceptarlas como medida de rentabilidad asociada con la creación de valor. Se expone la coincidencia matemática entre la TBR y el WACC (costo promedio ponderado de capital a partir del descuento de flujos de caja proyectados y entre el CAV (creación adicional de valor y la diferencia entre el ingreso económico obtenido y el ingreso económico esperado en un periodo determinado. También se evidencia la equivalencia entre el CAV y la variación del valor de las operaciones más la variación del flujo de caja del periodo. Posteriormente se realiza una aplicación para mostrar cómo puede utilizar la TBR y la teoría moderna de portafolio para que un gerente corporativo pueda controlar la relación rendimiento-riesgo existente entre las distintas unidades de negocio a cargo de su corporación.

Saving and credit cooperatives in Mexico

Directory of Open Access Journals (Sweden)

Martha E. Izquierdo Muciño

2015-11-01

Full Text Available The Saving service and Credit Popular (Cajas de Ahorro y Credito Popular first appeared in Mexico in 1951 at the initiative of the priest Pedro Velazquez, similar to the popular savings banks that existed in Canada, which had been founded by Alphonse Desjardins in the early XX century.These savings service (Cajas de Ahorro were developing successfully in almost all Mexican communities, most of them remained faithful to the principles and ordinances of the church that gave rise to them, without the government participate in this activity and without policies encouraging or regulatory actions. It was not until 1991 when the General Law of Organizations and Auxiliary Credit Activities (Ley General de Organizaciones y Actividades was enacted. However in 2000 they began to emerge problems arising from fraudulent activities by some people taking advantage of loopholes established irregular saving services. Consequently and in order to solve these problems was changing the law. The last of the fraud occurred with the popular financial called FICREA (2015, to which was amended regulatory law again and while thus sought to avoid another fraud, who really was affected is a large amount very poor indigenous and peasants.Received: 03.06.2015Accepted: 17.07.2015

Compendio de las cajas de cambios DSG (Direct Shift Gearbox)

OpenAIRE

Roche Intriago, Carlos Wladimir; Salamea Merchán, Juan Pablo

2007-01-01

En la actualidad las transmisiones automáticas están dominando en Europa, Estados Unidos y Japón, debido a su alto grado de rendimiento, así como su robustez y progresividad de sus cambios, lo cual se realiza sin interrumpir la fuerza de tracción. Esto se da debido a su construcción de embregues multidiscos y diferentes programas de cambios automáticos que vienen a satisfacer un alto nivel de exigencia de conducción teniendo en cuenta el alto índice de confort que sienten los conductores a...

La infravaloración publicitaria del medio radio

Directory of Open Access Journals (Sweden)

Lic. Montserrat Vázquez Gestal

2001-01-01

Full Text Available La creatividad publicitaria es, en palabras de González Martín, la "elaboración del mensaje". Una elaboración cuidadosa y laboriosa presidida por la originalidad, de tal modo que nos permita dar lugar a campañas publicitarias exitosas que tengan como resultado hacer sonar la caja registradora, aumentar las ventas, que es a lo que aspira cualquier anunciante que se muestra al público.

Astrocitoma subependimário de células gigantes em pacientes com esclerose tuberosa: achados em ressonância magnética de dez casos Subependymal giant cell astrocytoma in patients with tuberous sclerosis: magnetic resonance imaging findings in ten cases

Directory of Open Access Journals (Sweden)

Karina Takata

2007-06-01

Full Text Available OBJETIVO: Relatar os achados de ressonância magnética (RM em 10 casos de astrocitoma subependimário de células gigantes (ASCG em pacientes com esclerose tuberosa (ET. MÉTODO: Foram estudados de forma retrospectiva 10 pacientes com ET e diagnóstico histológico comprovado de ASCG. Quatro pacientes eram do sexo masculino e seis do feminino, com idade média de 15,7 anos. Todos os pacientes foram investigados com RM, sendo os exames revisados por dois radiologistas, havendo decisão por consenso sobre os achados de imagem. Foram analisados os seguintes achados: localização, dimensões, intensidade de sinal em T1/T2, realce pós-contraste e outros achados associados. RESULTADOS: Todos os pacientes apresentaram lesão única sugestiva de ASCG, medindo entre 1,5 cm e 8 cm em seu maior diâmetro. Oito lesões foram encontradas junto ao forame de Monro (80% e duas adjacentes ao corpo do ventrículo lateral (20%. Os tumores apresentavam nas imagens pesadas em T1 médio sinal (70% e em T2 alto sinal (100%, com realce intenso após a administração do gadolínio (100%. CONCLUSÃO: Os astrocitomas subependimários de células gigantes em pacientes com ET em geral apresentam-se como lesão única próxima ao forame de Monro, com médio sinal nas imagens ponderadas em T1, alto sinal em T2 e realce intenso após a administração de contraste.OBJECTIVE: To report the magnetic resonance imaging (MRI findings in 10 patients with subependimal giant cell astrocytoma (SGCA and tuberous sclerosis (TS. METHOD: Ten patients were retrospectively studied, presenting TS and histologically proven SGCA. Four patients were male and six female, with mean age 15.7 years. All patients underwent MRI, which was analyzed by two radiologists, final diagnosis was reached by consensus. The following findings were studied: topography, size, signal intensity on T1/T2-weighted images, contrast enhancement and associated findings. RESULTS: All patients presented a single lesion

Changes in electrophoretic profiles of Ipomoea batatas (sweet potato induced by gamma radiation

Directory of Open Access Journals (Sweden)

Celso Luiz Salgueiro Lage

2002-06-01

Full Text Available The ability of nodal segments of Ipomoea batatas to differentiate shoots and roots was evaluated after gamma irradiation. Shoot differentiation was less sensitive to irradiation than roots. However, at 90 Gy, no shoot was able to regenerate a new plant; in contrast 76 % of the roots from irradiated nodal segments continued to grow. The gamma radiation also induced changes in electrophoretic profiles of peroxidases of storage roots. Plants originated from irradiated storage roots presented changes in leaf peroxidase profiles very similar to those produced by leaves directly irradiated. The peroxidase profile of absorbent roots from irradiated storage roots was different from that obtained from directly irradiated absorbent roots.A capacidade de Ipomoea batatas diferenciar parte aérea e raízes foi avaliada após irradiação com raios gama. A diferenciação da parte aérea foi menos sensível que a das raízes. Contudo, na dose de 90 Gy nenhum broto diferenciado regenerou planta, enquanto 76 % das raízes diferenciadas dos segmentos nodais irradiados manteve o crescimento. A radiação também induziu mudanças no perfil elotroforético de isoperoxidases. Plantas originadas de raízes tuberosas irradiadas apresentaram alteração no perfil de isoperoxidases foliares semelhantes ao perfil de folhas diretamente irradiadas. O perfil de isoperoxidases de raízes absorventes irradiadas diretamente não apresentou o mesmo padrão do perfil das raízes absorventes desenvolvidas de raízes tuberosas irradiadas.

Conditions additionnelles régissant l'octroi de la subvention de voyage

International Development Research Centre (IDRC) Digital Library (Canada)

en transit. Les indemnités versées en vertu de la présente subvention ne comprennent aucune disposition afférente à l'observation des législations nationales des pays que le participant pourrait visiter (y compris le Canada). Le Centre ne considérera aucune demande de remboursement relative à la délivrance de permis ...

Public perceptions of west-side forests: improving visual impact assessments and designing thinnings and harvests for scenic integrity

Science.gov (United States)

Robert G. Ribe

2013-01-01

Perceptions of public forests’ acceptability can be infl uenced by aesthetic qualities, at both broad and project levels, aff ecting managers’ social license to act. Legal and methodological issues related to measuring and managing forest aesthetics in NEPA and NFMA decision-making are discussed. It is argued that conventional visual impact assessments—using...

76 FR 59953 - Designation of Agent To Receive Notification of Claimed Infringement

Science.gov (United States)

2011-09-28

..., 1057-1058 (C.D. Cal. 2002), aff'd in part and rev'd in part and remanded, 357 F.3d 1072 (9th Cir. 2004... and remanded, 357 F.3d 1072 (9th Cir. 2004). A fax number may be provided, but is optional information.../browse/app (definition of ``app''). While it is the Office's impression that as a general proposition...

Defense Acquisition Research Journal. Volume 23, Number 3, Issue 78, July 2016

Science.gov (United States)

2016-07-01

Gansler University of Maryland RADM James Greene, USN (Ret.) Naval Postgraduate School Dr. Mike Kotzian Defense Acquisition University Dr. Craig Lush...environment included Taliban attacks that killed or injured workers and destroyed equipment (Aff leck, Seman, Deegan , Freeman, & Sargand, 2011...transaction cost analysis dimensions: Do contract types differ? Journal of Applied Business Research, 15, 65–80. Affleck, R., Seman, P., Deegan , M

Tro og Viden

DEFF Research Database (Denmark)

Pedersen, Jens Olaf Pepke

2015-01-01

tid at være forskere og troende kristne. Georges Lemaître kunne således som professor i astronomi udvikle Big Bang teorien, samtidig med at han var katolsk præst.Det har affødt en kritisk kommentar (den 24. juli) fra Torben Smith Sørensen, der har opfattet det, som om Lemaître blandede naturvidenskab...

Administration des subventions aux institutions Dépenses de projet ...

International Development Research Centre (IDRC) Digital Library (Canada)

IDRC CRDI

Consultants. Cette catégorie comprend toutes les dépenses engagées pour retenir les services d'un consultant aux ... déplacement, d'hébergement et de subsistance, ainsi qu'aux services de soutien retenus directement ... le transport aérien et les autres dépenses afférentes aux déplacements du personnel du projet à.

Extraction of ecdysterone from roots of Brazilian ginseng

OpenAIRE

Flores, Rejane; Nicoloso, Fernando Teixeira; Brondani, Daniela; Maldaner, Joseila; Cezarotto, Verciane; Giacomelli, Sandro Rogério

2009-01-01

Este estudo teve como objetivo otimizar a extração de ecdisterona em raízes de ginseng brasileiro. Primeiramente, para se avaliar a eficiência do solvente extrator, amostras de raízes dois acessos (BRA e JB-UFSM) de P. glomerata foram extraídas em Soxhlet com metanol e clorofórmio, separadamente, durante 4 horas. No segundo ensaio, com o intuito de se escolher o método extrator, a extração foi conduzida em Soxhlet e em ultrassom, utilizando metanol como solvente. Em P. tuberosa, as amostras f...

Extração de ecdisterona em raízes de ginseng brasileiro

OpenAIRE

Flores,Rejane; Nicoloso,Fernando Teixeira; Brondani,Daniela; Maldaner,Joseila; Cezarotto,Verciane; Giacomelli,Sandro Rogério

2009-01-01

Este estudo teve como objetivo otimizar a extração de ecdisterona em raízes de ginseng brasileiro. Primeiramente, para se avaliar a eficiência do solvente extrator, amostras de raízes dois acessos (BRA e JB-UFSM) de P. glomerata foram extraídas em Soxhlet com metanol e clorofórmio, separadamente, durante 4 horas. No segundo ensaio, com o intuito de se escolher o método extrator, a extração foi conduzida em Soxhlet e em ultrassom, utilizando metanol como solvente. Em P. tuberosa, as amostras f...

Diseño y aplicación de un modelo de remuneración variable para una empresa del sector de las telecomunicaciones

OpenAIRE

Mosquera Sánchez, Jorge Andrés

2016-01-01

Actualmente encontramos una fuerte presión en las organizaciones por adaptarse a un mundo competitivo con un descenso en las utilidades y una incertidumbre constante en su flujo de caja. Estas circunstancias obligan a las organizaciones al mejoramiento continuo buscando nuevas formas de gestionar sus procesos y sus recursos. Para las organizaciones de prestación de servicios en el sector de telecomunicaciones una de las ventajas competitivas más importantes de obtener es la productividad debi...

Physical mapping of the 5S and 18S rDNA in ten species of Hypostomus Lacépède 1803 (Siluriformes: Loricariidae): evolutionary tendencies in the genus.

Science.gov (United States)

Bueno, Vanessa; Venere, Paulo César; Thums Konerat, Jocicléia; Zawadzki, Cláudio Henrique; Vicari, Marcelo Ricardo; Margarido, Vladimir Pavan

2014-01-01

Hypostomus is a diverse group with unclear aspects regarding its biology, including the mechanisms that led to chromosome diversification within the group. Fluorescence in situ hybridization (FISH) with 5S and 18S rDNA probes was performed on ten Hypostomini species. Hypostomus faveolus, H. cochliodon, H. albopunctatus, H. aff. paulinus, and H. topavae had only one chromosome pair with 18S rDNA sites, while H. ancistroides, H. commersoni, H. hermanni, H. regani, and H. strigaticeps had multiple 18S rDNA sites. Regarding the 5S rDNA genes, H. ancistroides, H. regani, H. albopunctatus, H. aff. paulinus, and H. topavae had 5S rDNA sites on only one chromosome pair and H. faveolus, H. cochliodon, H. commersoni, H. hermanni, and H. strigaticeps had multiple 5S rDNA sites. Most species had 18S rDNA sites in the telomeric region of the chromosomes. All species but H. cochliodon had 5S rDNA in the centromeric/pericentromeric region of one metacentric pair. Obtained results are discussed based on existent phylogenies for the genus, with comments on possible dispersion mechanisms to justify the variability of the rDNA sites in Hypostomus.

Physical Mapping of the 5S and 18S rDNA in Ten Species of Hypostomus Lacépède 1803 (Siluriformes: Loricariidae: Evolutionary Tendencies in the Genus

Directory of Open Access Journals (Sweden)

Vanessa Bueno

2014-01-01

Full Text Available Hypostomus is a diverse group with unclear aspects regarding its biology, including the mechanisms that led to chromosome diversification within the group. Fluorescence in situ hybridization (FISH with 5S and 18S rDNA probes was performed on ten Hypostomini species. Hypostomus faveolus, H. cochliodon, H. albopunctatus, H. aff. paulinus, and H. topavae had only one chromosome pair with 18S rDNA sites, while H. ancistroides, H. commersoni, H. hermanni, H. regani, and H. strigaticeps had multiple 18S rDNA sites. Regarding the 5S rDNA genes, H. ancistroides, H. regani, H. albopunctatus, H. aff. paulinus, and H. topavae had 5S rDNA sites on only one chromosome pair and H. faveolus, H. cochliodon, H. commersoni, H. hermanni, and H. strigaticeps had multiple 5S rDNA sites. Most species had 18S rDNA sites in the telomeric region of the chromosomes. All species but H. cochliodon had 5S rDNA in the centromeric/pericentromeric region of one metacentric pair. Obtained results are discussed based on existent phylogenies for the genus, with comments on possible dispersion mechanisms to justify the variability of the rDNA sites in Hypostomus.

Marine sponges (Porifera: Demospongiae) from the Gulf of México, new records and redescription of Erylus trisphaerus (de Laubenfels, 1953).

Science.gov (United States)

Ugalde, Diana; Gómez, Patricia; Simões, Nuno

2015-01-19

Marine sponges usually constitute the most diverse group of the benthic community in coral reefs. Although they are reasonably well studied at the northern Gulf of Mexico (GMx), the southern GMx is poorly known and lacks records from many major reef systems that lie off the Mexican coast. The present taxonomic study is the first sponge account from Alacranes reef, the largest coral reef system in the GMx, and from the shallow reef banks of Sisal, both in the northwest Yucatan Peninsula. The 19 species herein described represent the first sponge fauna records from these reefs. Among these, seven species represent new record for GMx: Erylus formosus, Cliona flavifodina, Spirastrella aff. mollis, Strongylacidon bermuda, Topsentia bahamensis, Agelas tubulata and Chelonaplysilla aff. erecta. Twelve species are new records for the Southern GMx: Erylus trisphaerus, Cliona amplicavata, Chondrilla caribensis, Halichondria lutea, Hymeniacidon caerulea, Axinella corrugata, Dragmacidon reticulatum, Chalinula molitba, Amphimedon caribica, A. complanata, Hyatella cavernosa and Dysidea variabilis. Additionally, a redescription of Erylus trisphaerus is presented which had not been reviewed since its original description in 1953 off Western Florida, except that it was listed for north La Habana, Cuba. 

Cytogenetic and Molecular Findings in Children with Acute Lymphoblastic Leukemia: Experience of a Single Institution in Argentina

Science.gov (United States)

Coccé, Mariela C.; Alonso, Cristina N.; Rossi, Jorge G.; Bernasconi, Andrea R.; Rampazzi, Maria A.; Felice, Maria S.; Rubio, Patricia L.; Eandi Eberle, Silvia; Medina, Adriana; Gallego, Marta S.

2015-01-01

The purpose of the current study was to evaluate the cytogenetic findings in 1,057 children with acute lymphoblastic leukemia (ALL) referred to the cytogenetics laboratory at the Hospital de Pediatría Dr. Juan P. Garrahan, between 1991 and 2014. Chromosomal abnormalities were evaluated by G-banding and FISH. Since December 2002, RT-PCR determinations were systematically carried out for BCR-ABL1, KMT2A-AFF1, ETV6-RUNX1, and TCF3-PBX1 rearrangements in children, adding KMT2A-MLLT3 and KMT2A-MLLT1 in infants. The percentage of abnormalities detected by cytogenetics was 70.1%. Four novel abnormalities, t(2;8)(p11.2;p22), inv(4)(p16q25), t(1;7)(q25;q32), and t(5;6)(q21;q21), were found in this cohort. We compared cytogenetic and RT-PCR results for BCR-ABL1, KMT2A-AFF1 and TCF3-PBX1 rearrangements in 497 children evaluated by both methods. The results were highly concordant (p cytogenetic findings in children with ALL reported in Argentina. PMID:26648836

Health properties of oca (Oxalis tuberosa) and yacon (Smallanthus sonchifolius).

Science.gov (United States)

Jimenez, María Eugenia; Rossi, Analia; Sammán, Norma

2015-10-01

Andean roots and tubers are underexploited crops; many contain compounds beneficial to health, so a greater knowledge of their properties is important for encouraging their consumption. The aim of this work was to study the content of bioactive compounds of yacon and oca and their effect on intestinal health using as a model rats of the Wistar strain. Two varieties of ocas (Overa and Rosada) and yacon, which contain significant amounts of fructooligosaccharides and phenolic compounds, were chosen. Rats of the Wistar strain were fed for two months with diets containing these foods in amounts sufficient to provide 8% of fiber. A significant decrease in pH values and an increment in lactobacilli and bifidobacteria counts in the cecum of rats fed with inulin, oca Rosada and Overa were observed; there was no significant decrease in enterobacteriaceae and enterococci counts. The cecum antioxidant activity was incremented in rats fed with the experimental foods with respect to the control diets. The components of dietary fiber and phenolic compound contents in yacon and oca produce effects that contribute to the intestinal health of the experimental animals.

Non-Host Plant Volatiles Disrupt Sex Pheromone Communication in a Specialist Herbivore

OpenAIRE

Wang, Fumin; Deng, Jianyu; Schal, Coby; Lou, Yonggen; Zhou, Guoxin; Ye, Bingbing; Yin, Xiaohui; Xu, Zhihong; Shen, Lize

2016-01-01

The ecological effects of plant volatiles on herbivores are manifold. Little is known, however, about the impacts of non-host plant volatiles on intersexual pheromonal communication in specialist herbivores. We tested the effects of several prominent constitutive terpenoids released by conifers and Eucalyptus trees on electrophysiological and behavioral responses of an oligophagous species, Plutella xylostella, which feeds on Brassicaceae. The non-host plant volatile terpenoids adversely affe...

USAF Aircraft Maintenance Officer Knowledge, Skills and Abilities and Commonalities among the Logistics Officer Corps

Science.gov (United States)

2013-02-01

distribution managemen t operations to include managing cargo distribution functions such as receiving, inspecting, tracing, tracking, packaging, and...Production Management DE CDE ABCDEFG Scheduling DE ADEF ABCDEF T ie r 2 Flightline Operations E BDE Systems Engineering D ABDEG Table 19: 21R...logistics units/ elements and as members of general or executive s t affs in t he operating forces, supporting establishment, and joint staffs . They

The first recorded bloom of Pseudochattonella farcimen (Dictyochophyceae, Heterokonta, (Riisberg I., 2008 in the Gulf of Gdańsk

Directory of Open Access Journals (Sweden)

Maria Łotocka

2009-03-01

Full Text Available In April 2001 a local bloom of the heterokont phytoflagellate Pseudochattonella farcimen (Riisberg I., 2008 (initially named Chattonella aff. verruculosa was observed for the first time in the southern part of the Gulf of Gdańsk.The species occurred in high cell densities: the count was 11.5 × 106 cells dm-3 and the biomass 927.5 µgC dm-3.

BRAC and Crime: Examining the Effects of an Installation’s Closure on Local Crime

Science.gov (United States)

2017-12-01

Community Survey AFF American Fact Finder BLS Bureau of Labor Statistics BJS Bureau of Justice Statistics BRAC Base Realignment and Closure CJIS...Criminal Justice Information Services CPI Consumer Price Index DD Difference-in-Differences DOD Department of Defense DOJ Department of Justice FBI...at the Naval Postgraduate School. The education received here will prove invaluable. I also want to acknowledge the unwavering support of my advisors

Dicty_cDB: Contig-U04396-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available rbcL intergenic spac... 44 5.3 1 ( DQ209842 ) Maxillaria lepidota atpB-rbcL inter...pacer, p... 44 5.3 1 ( DQ209656 ) Maxillaria molitor atpB-rbcL intergenic spacer, p... 44 5.3 1 ( DQ209650 ) Maxillaria lepidota...Q209568 ) Maxillaria cf. rufescens Whitten 1669 atpB-rbcL i... 44 5.3 1 ( DQ209566 ) Maxillaria aff. lepidota

FUNGI ASSOCIATED WITH THE DECLINE OF THE MANZANITA (ARCTOSTAPHYLOS PUNGENS HBK. IN THE SIERRA FRIA FROM AGUASCALIENTES STATE, MEXICO

Directory of Open Access Journals (Sweden)

O. Moreno-Rico

2015-11-01

Full Text Available La manzanita (Arctostaphylos pungens es un arbusto que se encuentra con regularidad en la Sierra Fría del estado de Aguascalientes, México. Este arbusto, al igual que otras plantas silvestres, es afectado por factores bióticos, como las enfermedades, que pueden causar desde daños insignificantes hasta la muerte de las plantas. Los objetivos de este trabajo fueron: 1 identificar los hongos relacionados con el declinamiento de la manzanita en la Sierra Fría de Aguascalientes y 2 conocer la incidencia y severidad de las enfermedades causadas por hongos que afectan tallos y ramas de la manzanita. En cada uno de los sitios visitados se realizó un transecto, de dimensiones variables, en una dirección determinada al azar, que incluyó 100 arbustos, para revisar y estimar: a el porcentaje de plantas sanas, enfermas y muertas, y b la incidencia, severidad y distribución de las enfermedades. Los fitopatógenos se identificaron con base en los síntomas y signos que causan comparándolos con lo reportado en la bibliografía. Las enfermedades más importantes resultaron las causadas por los hongos basidiomicetosInonotus aff. jamaicensisyPhellinus arctostaphyli,que causan pudrición blanca de la madera y cancrosis en la base del tallo y en ramas.Inonotus aff. jamaicensisse encontró en 20 de los 21 sitios muestreados variando su incidencia de 3 a 25%, mientras queP. arctostaphylise encontró en 17 de los 21 sitios muestreados variando su incidencia de 1 a 25%. La severidad de las cancrosis varió de 2 a 44 %. También, se identificaron manchas foliares causadas porHarknessia arctostaphyli,Coccomyces spp., yPassalora spp. Se reporta por primera ocasión la presencia dePhellinus arctostaphylien Aguascalientes. Se reporta por primera vez en México la presencia deInonotus aff. jamaicensis,Harknessia arctostaphyli,Coccomyces spp.yPassalora spp.

Variation of the ichthyofauna along the Goioerê River: an important tributary of the Piquiri-Paraná basin

Directory of Open Access Journals (Sweden)

Claudenice Dei Tos

2014-03-01

Full Text Available The construction of reservoirs is considered an important source of impacts on the fish fauna, severely altering the structure of the assemblage. This paper aimed to describe the structure of the fish assemblage of the Goioerê River, determining its longitudinal distribution and patterns of species dominance. The evaluation of its longitudinal variation in the diversity and abundance of the fish assemblage was conducted in July and October 2004 and January and May 2005. The collections were carried out near the headwaters (Gurucaia, middle stretch (Olaria, just above the falls (Paiquerê and downstream (Foz. Forty-four species were captured. The Gurucaia fish assemblages differed significantly from Olaria, Paiquerê and Foz. The Olaria assemblages differed significantly from the Foz. Gurucaia showed the lowest diversity and abundance of species. Astyanax aff paranae Eigenmann,1914 (78% of the total was found to be dominant at this site. Almost the same species richness was found at Olaria and Paiquerê, although Olaria had the greatest abundance of individuals. Astyanax aff paranae, Cyphocharax modestus (Fernández-Yépez, 1948 and Astyanax altiparanae Garutti & Britski, 2000 were the top three dominants and comprised over 71% of the total number of fish caught. At Paiquerê, Astyanax altiparanae, Hypostomus aff ancistroides (Ihering, 1911 and Loricariichthys platymetopon Isbrücker & Nijssen, 1979 composed 58% of the catches. Thirty-one species were recorded at Foz, which presented the greatest richness. The most abundant species were Apareiodon affinis (Steindachner, 1879, Galeocharax knerii (Steindachner, 1879 and A.altiparanae, which contributed to 50% of the total catches in this environment.These results record the fish biodiversity and how the community is longitudinally structured in the Goioerê River, and also demonstrate how this type of evaluation is important to understanding the fish community patterns and finding solutions to

Production and nutritional value of the wheat silage managed with different cutting systems

Directory of Open Access Journals (Sweden)

Rodolfo Carletto

2017-03-01

Full Text Available Winter cereals are mainly used for human and animal nutrition and several studies are now exploring their potential as conserved forage (hay and silage. Among the winter cereal species available for cultivation in the south of Brazil, which is major winter cereals producer in the country, the wheat cv. BRS Umbu has attracted special attention. However, few studies have investigated the potential of this cultivar for silage production. The aim of this study was to evaluate the production and quality of silage from the dual-purpose wheat, BRS Umbu, subjected to different cut managements treatments: T1 - without cut (control, T2 - one cut and T3 - two cuts. Each plot represented an experimental unit in a randomized block design, with 5 replicates per treatment. Two representative samples were collected from each plot to determine morphological segmentation (stem, leaf and ear and dry matter (DM content of the whole plant and its morphological components. At the time of opening of the silos, food chemical analysis and pH determination were performed. Forage mass production decreased by 26.88% and 67.82%, respectively, with one and two cuts, compared to control. The DM content of the ensiled plant was 49.9 g kg-1 for the control, 54.7 g kg-1 with one cut and 63.2 g kg-1 with two cuts, at the time of ensiling. Management cuts changed the morphological components of the plants, with a lower proportion of stem (28% in plants subjected to two cuts. The control treatment showed fewer leaves in ensiled plant (9.6% and intermediate amount of stalk (52.8%, and was significantly different (p 0.05 was observed for mineral matter (MM, crude protein (CP and hemicellulose (HEM between the different cutting regimens. However, neutral detergent fiber (NDF and acid detergent fiber (ADF decreased (p < 0.05 as the number of cuts increased. The control treatment showed higher NDF and ADF content (563.2 and 357.9 g kg-1 DM, respectively and lower amount of total

BEBERAPA ASPEK PERILAKU NYAMUK Anopheles barbirostris DI KABUPATEN SUMBA TENGAH TAHUN 2011

Directory of Open Access Journals (Sweden)

Monika Noshirma

2013-02-01

Full Text Available Abstract Some aspects of Anopheles barbirostris behavior in Central Sumba Regency was conducted in July– October in District Umbu Ratu Nggai (Village Padira Tana which represents in mountain ecology and the district of Mamboro (Manu Wollu Village representing the coastal ecology. Both villages are selected to have high malaria cases during the past year. The objective of the study is to determine Some aspect of Anopheles barbirostris behavior in Central Sumba Regency. The result showed that the characteristics of  breeding habitats of Anopheles barbirostris in the padira tana village is in fields (both in use, not use or ready for planting and in kobakan. in Manu Wolu Village the breeding habitats are in former ponds, puddles an kobakan. The bitting activity of Anopheles barbirostris the in Padira Tana Village highest in July (MBR = 0.08 outside the house,  while in Manu Wolu Village bite out of the house in July and October (MBR = 0.04. in the Padira Tana Village and Manu Wollu village the Anopheles barbirostris is most prevalent in the cage with peak hours 11.00 pm to 04.00 am. Keyword: some aspect of vector behavior, Anopheles barbirostris Abstrak Studi beberapa aspek perilaku vektor malaria Anopheles barbirostris di Kabupaten Sumba Tengah dilaksanakan pada bulan Juli – Oktober di 2 Kecamatan yaitu Kecamatan Umbu Ratu (Desa Padira Tana yang mewakili ekologi pegunungan dan Kecamatan Mamboro (Desa Manu Wolu yang mewakili ekologi pantai. Kedua desa yang dipilih mempunyai kasus malaria tinggi selama satu tahun terakhir. Tujuan penelitian ini untuk mengetahui beberapa aspek perilaku vektor Anopheles barbirostris di Kabupaten Sumba Tengah. Hasil penelitian menunjukan bahwa karakteristik habitat perkembangbiakan Anopheles barbirostris di desa Padira Tana adalah sawah (baik yang terpakai, tidak dipakai maupun siap tanam dan di kobakan. Sedangkan di desa Manu Wolu ditemukan di bekas kolam, kubangan dan kobakan.    Kepadatan nyamuk An

Valoración ENKA de Colombia S.A.

OpenAIRE

Furque Quintero, Uriel Alejandro; Umbacia Pinzón, Daniel Giovanni

2014-01-01

La acción de ENKA ha tenido una satisfactoria valorización dentro del mercado bursátil colombiano, impulsado en un alto porcentaje por los inicios de operación de la nueva planta de PET con un costo total de USD 50MM1, sin embargo se observa oportunidad en la optimización en el manejo del capital de trabajo, rubro que erosiona la capacidad de generación de caja operativa en la compañía

Una caja de ritmos llamada cerebro: Moviendo objetos con la mente.

Directory of Open Access Journals (Sweden)

Ángel Correa Torres

2008-01-01

Full Text Available El cerebro genera ritmos sin parar. Los ritmos cerebrales constituyen un lenguaje de comunicación entreneuronas mientras procesan información. La investigación dedicada a descifrar este lenguaje está revolucionando tanto teorías neurocientíficas como aplicaciones clínicas y tecnológicas. Hoy se piensa que los ritmos cerebrales cumplen un papel crucial en funciones cognitivas como percibir, recordar o moverse. El control a través del pensamiento de objetos electrónicos reales o virtuales ha dejado de ser una ficción gracias al desarrollo de la interfaz cerebro-computadora.

La caja negra de la prensa sensacionalista. Caso Q'hubo - Cali

Directory of Open Access Journals (Sweden)

Meneses, Lorena

2014-07-01

Full Text Available With headlines that give the human tragedy an air of playfulness and everyday life, the Q'Hubo, owned the house newspaper Editorial El País has strengthened as one of the best-selling tabloid in the country and therefore in Cali and Palmira , managing to catch their readers with news warrants, local histories and ordinary citizens; newspaper reports that a popular slang attention-grabbing around family dramas. But why a reporter dyes the pain of death or catastrophic event with a humorous slang and double meanings? Why convert judicial cover news events isolated in a mass circulation newspaper?

Genetic diversity and germplasm conservation of three minor Andean tuber crop species

Directory of Open Access Journals (Sweden)

Malice M.

2009-01-01

Full Text Available In traditional Andean agrosystems, three minor tuber crop species are of regional or local importance: oca (Oxalis tuberosa Molina, ulluco (Ullucus tuberosus Caldas and mashua (Tropaeolum tuberosum Ruiz and Pav.. Genetic diversity within these species is very large and could result from the high ecological and cultural variability that characterizes the Andean area. Nowadays, many anthropic or ecological factors cause the loss of diversity and contribute to genetic erosion. The development of conservation strategies for genetic resources of Andean tubers, in situ as well as ex situ, includes a better knowledge of diversity in addition to the study of Andean farming strategies linked to this genetic diversity.

Características descriptivas de la raíz de wereke (Ibervillea sonorae Greene) y generalidades bioquímicas de su extracto acuoso

OpenAIRE

Sinagawa-García, SR; Gutiérrez-Díez, A; Mora-Olivo, A; Juárez-Aragón, MC; Torres-Castillo, JA

2015-01-01

En el presente trabajo se determinó la descripción general de un extracto acuoso obtenido de la raíz de Ibervillea sonorae; además, se incluyó una descripción histológica de la misma raíz. Un análisis bromatológico general efectuado indicó que la raíz posee valores nutrimentales similares a los reportados para raíces tuberosas comestibles incluyendo al camote, yuca, jícama y arracacha. Por primera vez en la raíz de wereke se reportó la presencia de una proteasa activa a pH alcalino y la activ...

Evaluación químico bromatológica de las variedades Yurac Llajum, Gello Llajum y Yurac Checche de Smallanthus Sonchifolius (Poepp & Endl).H. Robinson (Yacón) procedente de Puno

OpenAIRE

Ramos Zapana, Rubén; Arias Arroyo, Gladys

2014-01-01

Las variedades Yurac llajum, Qello llajum y Yurac checche de la especie Smallanthus sonchifolius (Poepp & Endl) (Yacón), procedente de la provincia de Sandia del Departamento de Puno, se desarrollan entre 1500 a 3000 msnm. Conocidas como “yacón”, “yakuma”, “llaqón”, “llacun” o “llacuma” en quechua; en aymara “aricoma” o “aricuma“; en español “Yacón”, “Jacón”, “llacón”, “arboloco”, “Puhe”, “jicama”, “jíquima”, “jikima” o “jiquimilla”. Estas raíces tuberosas de sabor dulce y refrescante, de asp...

Sterility Maintenance Assessment of Moist/Wet Material After Steam Sterilization and 30-day Storage Evaluación de la manutención de la esterilidad de materiales húmedos/mojados después de esterilizados con vapor y almacenados por 30 días Avaliação da manutenção da esterilidade de materiais úmidos/molhados após a esterilização por vapor e armazenamento por 30 dias

Directory of Open Access Journals (Sweden)

Giovana Abrahão de Araújo Moriya

2010-08-01

Full Text Available Moist/wet materials stored after autoclaving are considered contaminated and not recommended for use. This study evaluates the maintenance of sterility in moist/wet material after being submitted to steam sterilization and stored for a period of 30 days. Aiming to support decision-making in emergency situations, 40 surgical boxes packed in nonwoven cloth covering Spunbound, Metblouwn, Spunbound (SMS: half (the experimental group were placed in an autoclave but the drying phase was interrupted, yielding moist/wet materials and the other half (the negative control group underwent the complete cycle. The external parts of each surgical box were deliberately contaminated with Serratia marcescens and subsequently stored for 30 days. After this period, the boxes' contents were submitted to sterility tests and no growth was observed. The presence of moisture inside the surgical boxes did not interfere with maintaining their sterility.Se consideran como contaminados los objetos mojados/húmedos almacenados después de ser esterilizados en autoclave, no siendo recomendados para uso. El objetivo del estudio fue evaluar la manutención de la esterilidad de los materiales mojados/húmedos después de sometidos al proceso de esterilización por vapor y almacenados por un intervalo de 30 días. Con la finalidad de auxiliar en la toma de decisiones en situaciones de emergencia, fueron preparadas 40 cajas quirúrgicas embaladas en SMS, siendo la mitad (experimental sometidas a un proceso de esterilización en autoclave, con fase de secado interrumpida, liberando material mojado/húmedo y otras 20 (control con el ciclo completo. Las partes externas de cada caja fueron intencionalmente contaminadas con Serratia marcescens y posteriormente almacenadas por 30 días. Después ese período, los contenidos de las cajas fueron sometidos a pruebas de esterilidad, acusando ausencia total de crecimiento. La presencia de humedad dentro de las cajas no interfirió en la

Milk drink with goat milk and goat serum is alternative for exploitation of pulp umbu

Directory of Open Access Journals (Sweden)

Nkarthe Guerra Araújo

2015-09-01

Full Text Available This research aimed to develop and evaluate the acceptance and intention to purchase two dairy beverages formulations prepared with fermented umbus, goat serum and goat milk in order to add greater economic value to the three raw materials. The treatments consisted of the variation in serum concentrations goat (28,5% and 44% and goat milk (44% and 28,5%, respectively. The pulp has previously been analyzed and showed 15,21mg/100g of ascorbic acid. The fermented dairy beverages showed microbiological characteristics within the established by the legislation. It was found that there was no significant difference (p > 0,05 for color attributes, flavor and consistency of both, however, the flavor attributes and global acceptance have been significantly affected. The formulation with 28,5% of goat serum and 44% goat milk had the best average from 10 days, and acceptances up to 25 days of storage.

Measuring the Effectiveness of Border Security Between Ports of Entry

Science.gov (United States)

2010-01-01

ts of migration. Massey, Durand, and Malone (2003) argue that neoclassical theory has limited explanatory power and, in fact, that immigration is...interpreted in the context of dif- ferent theories of how and why immigration occurs. Various theories explain immigration— for example, as a migrant’s...Durand, and Malone, 2003). One theory of how border security aff ects migration is that migrants employ a cost-benefi t calculation when deciding

Research

African Journals Online (AJOL)

ebutamanya

17 mars 2015 ... l´accès aux soins, le type de patients, le plateau technique et les ressources .... expliquerait un taux élevé de prise de médicaments y afférent. 342(98 %). .... En effet, ces faibles poids de naissance sont le plus souvent rencontrés soient chez des prématurés, soient chez des nouveau-né dont l'évolution.

Pengaruh Deferensiasi Motivasi Sosial Terhadap Perilaku Profesional Guru

OpenAIRE

Subandowo, M

2009-01-01

Research on professional behavior (professional competence, personal, social, and pedagogic) related to social motivation as factors are very important, considering the teacher's role is key in improving the quality of learning. Therefore this study aims to determine the influence of differentiation of social motivation (achievement, affiliation and power) to the professional competence of teachers and also to assess how the level of social motivation relationship motivation (achievement, aff...

Targeting Transcription Elongation Machinery for Breast Cancer Therapy

Science.gov (United States)

2016-05-01

Luo CONTRACTING ORGANIZATION: University of California, Berkeley Berkeley, CA 94704 REPORT DATE: May 2016 TYPE OF REPORT: Annual PREPARED FOR...ORGANIZATION NAME(S) AND ADDRESS(ES) 8. PERFORMING ORGANIZATION REPORT NUMBER University of California, Berkeley BERKELEY, CA 94704 9. SPONSORING...molecules. We have employed the CRISPR /Cas9 genome-editing tool to knock out the gene encoding the SEC component AFF4 or knock in a mutant cyclin T1 (AAG

The Transforming Maternity Care Project: Goals, Methods, and Outcomes of a National Maternity Care Policy Initiative, With Construction of a Theoretical Model to Explain the Process

Science.gov (United States)

2011-03-21

although typically unaccounted for in the calculus of risks of VBAC versus repeat cesarean, the literature documents heightened risk of many short and...cessation and other behav- ioral interventions, aI!d dental care. • Within hospitals and health sys\\ ems, use person- nel policies to remove incentives...Cruel calculus : why saving premature babies is better business than helping them thrive. Health Aff (Millwood), 29(11), 2114-2117. Lawrence, P. R

Low VHF Channel Measurements and Simulations in Indoor and Outdoor Scenarios

Science.gov (United States)

2015-05-01

Transactions on. 2002;50(5):591-599. 22. Nerguizian C, Despins C, Affes S, Djadel M. Radio-channel characterization of an underground mine at 2.4 ghz...INTENTIONALLY LEFT BLANK. viii 1. Introduction Reliable wireless communication is of paramount importance for many important civilian and military...report, we study near-ground, wireless channel modeling in the lower VHF band for indoor and indoor/outdoor scenarios, drawing from extensive propagation

Atmospheric Profiles, Clouds and the Evolution of Sea Ice Cover in the Beaufort and Chukchi Seas: Atmospheric Observations and Modeling as Part of the Seasonal Ice Zone Reconnaissance Surveys

Science.gov (United States)

2017-06-04

conditions in the SIZ affeCt changes in cloud properties and cover, • develop novel instrumentation including low cost , expendable, air-deployed micro...hour per response, induding the time for reviewing instructions, searching existing data sources, gathering and maintaining the data needed, and...From- To) 04 - 06 - 2017 Final Technical 0/1/01/2012 - 12/31/2016 4. TITLE AND SUBTITLE Sa. CONTRACT NUMBER Atmospheric Profiles , Clouds and the

Molecular and cellular parameters of ageing: an overview

OpenAIRE

Himanshu Thukral; Sumeet Soin; Ritu Rani; Aparna Sarkar

2016-01-01

Ageing is characterized by a progressive loss of physiological integrity, leading to impaired function and increased propensity to death. Ageing is an actively regulated metabolic process. This wear and tear is the primary risk factor for major human pathologies including diabetes, cancer, cardiovascular disorders, and neurodegenerative diseases. Approximately worldwide 1 lakh people die each day of age related causes. Ageing, which we define as the time-dependent functional decline that affe...

Three new records of Desmodorids (Nematoda, Desmodoridae) from sandy seabeds of the Canary islands

OpenAIRE

Riera, Rodrigo; Núñez, Jorge; Brito, María del Carmen

2012-01-01

In an ecological study of meiofaunal assemblages in two locations (Los Abrigos and Los Cristianos) of Tenerife (Canary Islands, NE Atlantic Ocean), several desmodorid species were found throughout the study period. Three species belonging to the family Desmodoridae were collected in intertidal and shallow subtidal sandy seabeds. These species were Desmodorella aff. tenuispiculum Allgen, 1928, Metachromadora sp. and Spirinia parasitifera Bastian, 1865. Descriptions, figures and tables with mer...

Effect of pregnancy on plasma phenobarbital concentrations in rats.

OpenAIRE

Moriyama, Masahiro; Domoto, Haruyo; Yamashita, Syoichi; Furuno, Katsushi; Oishi, Ryozo; Kawasaki, Hiromu; Gomita, Yutaka

1995-01-01

We examined the pharmacokinetics of phenobarbital before and during pregnancy in rats. Animals were divided into four groups: (a) control, (b) pregnant, (c) phenobarbital-treated, and (d) phenobarbital-treated pregnant groups. The increase in body weight of nonpregnant or pregnant rats was not influenced by long-term phenobarbital treatment. Plasma phenobarbital concentrations during the period of long-term phenobarbital treatment with a fixed dosage by body weight were not significantly affe...

The "institutional factor" in the theory of international trade: new vs. old trade theories

OpenAIRE

Parrinello, Sergio

2000-01-01

Abstract The New Trade Theory presents novel perspectives compared to the Old Theories of international trade. Increasing returns and different institutional arrangements can explain the international specialization and trade flows even between countries which are identical in terms of factor endowments, technology and preferences for private goods. In this context the pattern of trade cannot be determined by a price/cost comparison of isolated countries. Comparative advantages can be affe...

Creatine supplementation and exercise as possible therapeutic treatments in Parkinson’s Disease: A review

OpenAIRE

Graham, S. M..; Baird, M..; Boyd, G. W..

2014-01-01

Parkinson’s disease (PD) is the second most common progressive neurodegenerative condition after Alzheimer’s Disease. It is characterized by a progressive loss of dopaminergic neurons inthe substantia nigra region of the brain. Symptoms and signs manifest as motor disorders affecting balance and physical capacity, and non-motor symptoms such as cognitive decline and mood disorders. People with PD face considerable difficulties coping with associated physical and psychological changes that aff...

Factors that aff ect the learning process of a foreign language

Directory of Open Access Journals (Sweden)

Elsa Vula

2017-11-01

Full Text Available Learning as a complicated process and very significant one is followed by different influencers that cause different problems due to students’ performance in learning a foreign language. In order to work and try to eliminate such factors we have to detect which are the factors that we as teachers, professors, assistants, have to carry on during the process of teaching. This theoretical research paper will provide scientific data due to different factors that affect learning process of foreign language that were conducted in different places among the world. The researches that are selected are coherently linked with the aim of this scientific c paper and have ensured results from cases studies, quantitative research, and empirical research.

Caminata del robot humanoide RH-2 en la plataforma de simulación OpenHRP

OpenAIRE

Torre Doblas, Carlos de

2010-01-01

En primer lugar, en este proyecto se trabajará con el simulador OpenHRP3, intentando comprender su funcionamiento interno (carga de archivos, lenguajes, funcionalidades, etc.). También se adaptará el modelo del robot humanoide Rh-2 al entorno del mismo, pudiendo así realizar simulaciones. La verdadera finalidad de este proyecto, y en lo que se ha hecho especial incapié, es simular el robot sosteniendo una caja, validando así las fuerzas que sienten las distintas partes del cuerpo en los momen...

Rendimiento de los radiofármacos en el servicio de medicina nuclear del Hospital México, durante el periodo, de junio del 2005 a diciembre del 2006

OpenAIRE

Azofeifa Villalobos, Alejandra; F lores Campos, Marisol

2013-01-01

La Caja Costarricense de Seguro Social como institución de bienestar social, desde su creación se ha preocupado por otorgar más y mejores servicios a la población costarricense, para lo que ha debido adaptarse con el tiempo a los procesos de cambio, tanto económicos, como sociales que ha venido sufriendo el país. Procesos que obligaron a la institución a incrementar la eficiencia, mejorar la calidad de la atención, promover la equidad,...

Valoración de una empresa no cotizada: Vías y Construcciones S. A.

OpenAIRE

Rendo Taniñe, Asier

2014-01-01

En este trabajo fin de grado se determina el valor de la empresa no cotizada “Vías y Construcciones S. A.”, cuya actividad principal es la construcción ferroviaria (código CNAE 4211). En primer lugar, se analiza la estrategia competitiva de la empresa constructora analizando su posición relativa dentro del sector. En segundo lugar, utilizando datos pasados se proyectan los flujos de caja libres. Finalmente, se realiza un análisis de sensibilidad sobre los resultados para d...

Primera cita del desarrollo de Aleyrodes proletella (Linnaeus, 1758) en plantas de tomate bajo condiciones controladas

OpenAIRE

Alonso, D.; Gómez, Azahara A.; Nombela, Gloria; Muñiz, Mariano

2007-01-01

La mosca blanca de la col, Aleyrodes proletella, causa graves daños en cultivos de brassicas pero no existen referencias hasta la fecha sobre su desarrollo eficaz y continuado en tomate. Tras la observación de la presencia accidental de adultos de esta especie en plantas de tomate (cv Moneymaker), se realizaron dos experimentos en condiciones controladas de laboratorio para analizar su desarrollo en estas plantas. En uno de ellos se introdujeron hembras fértiles de A. proletella en "cajas-pin...

Comentarios Bibliográficos nº 24

Directory of Open Access Journals (Sweden)

Fernando Gutiérrez Hidalgo

2016-07-01

Full Text Available COMENTARIO SOBRE LOS LIBROS DE: SÁNCHEZ SANTIRÓ, ERNEST, CORTE DE CAJA. LA REAL HACIENDA DE NUEVA ESPAÑA Y EL PRIMER REFORMISMO FISCAL DE LOS BORBONES (1720-1755. ALCANCES Y CONTRADICCIONES. MÉXICO, INSTITUTO DE INVESTIGACIONES D. JOSÉ MARÍA LUIS MORA, COL. HISTORIA ECONÓMICA, 2013. SÁNCHEZ SANTIRÓ, ERNEST, RELACIONES DE VALORES Y DISTRIBUCIÓN DE LA REAL HACIENDA DE NUEVA ESPAÑA, 1744-1748. MÉXICO, INSTITUTO DE INVESTIGACIONES D. JOSÉ MARÍA LUIS MORA, COL. HISTORIA ECONÓMICA, 2014.

Effects of Stingless Bee Propolis on Experimental Asthma

Directory of Open Access Journals (Sweden)

José Hidelbland Cavalcante de Farias

2014-01-01

Full Text Available Bee products have been used empirically for centuries, especially for the treatment of respiratory diseases. The present study evaluated the effect of treatment with a propolis hydroalcoholic extract (PHE produced by Scaptotrigona aff. postica stingless bee in a murine asthma model. BALB/c mice were immunized twice with ovalbumin (OVA subcutaneously. After 14 days, they were intranasally challenged with OVA. Groups P50 and P200 received PHE by gavage at doses of 50 and 200 mg/kg, respectively. The DEXA group was treated with intraperitoneal injection of dexamethasone. The OVA group received only water. The mice were treated daily for two weeks and then they were immunized a second time with intranasal OVA. The treatment with PHE decreased the cell number in the bronchoalveolar fluid (BAL. Histological analysis showed reduced peribronchovascular inflammation after treatment with PHE especially the infiltration of polymorphonuclear cells. In addition, the concentration of interferon-γ (IFN-γ in the serum was decreased. These results were similar to those obtained with dexamethasone. Treatment with S. aff postica propolis reduced the pathology associated with murine asthma due an inhibition of inflammatory cells migration to the alveolar space and the systemic progression of the allergic inflammation.

Digital Forensics Formats: Seeking a Digital Preservation Storage Container Format for Web Archiving

Directory of Open Access Journals (Sweden)

Yunhyong Kim

2012-12-01

Full Text Available In this paper we discuss archival storage container formats from the point of view of digital curation and preservation, an aspect of preservation overlooked by most other studies. Considering established approaches to data management as our jumping off point, we selected seven container format attributes that are core to the long term accessibility of digital materials. We have labeled these core preservation attributes. These attributes are then used as evaluation criteria to compare storage container formats belonging to five common categories: formats for archiving selected content (e.g. tar, WARC, disk image formats that capture data for recovery or installation (partimage, dd raw image, these two types combined with a selected compression algorithm (e.g. tar+gzip, formats that combine packing and compression (e.g. 7-zip, and forensic file formats for data analysis in criminal investigations (e.g. aff – Advanced Forensic File format. We present a general discussion of the storage container format landscape in terms of the attributes we discuss, and make a direct comparison between the three most promising archival formats: tar, WARC, and aff. We conclude by suggesting the next steps to take the research forward and to validate the observations we have made.

Sedimentary paleoenvironments of the Candeleros Formation(Rio Limay Subgroup)upper cretaceous, Ezequiel Ramos Mexia, Neuquen, Argentina daming west, Argentina

International Nuclear Information System (INIS)

Sanchez, M.

2004-01-01

Sedimentary facies from the Candeleros Formation (Rio Limay Subgroup), cropping out at the El Escondido creek, at the Ezequiel Ramos Mexia dam, are analyzed and interpreted in this paper. A sedimentological detailed section was measured to get the main goal of this paper which is the sedimentary paleoenvironment. The outcroppings were pictured and a section was measured, geometries and espacial relation between them were analyzed. Eight lithofacies were identified which are: coarse sandstone facies (Se), sandstones (Sm, St, Sp, Sh t Sr), siltstones and shales (Fl and Fr). These lithofacies were agrupated into eight facies associations (FA). AFA constitutes the registration of multiepisodic events of sheet floods; AFB, C and D are product of the depositation in a braided channel belt, AFE represents units of lateral accretion, AFF is assigned deposits of crevasse splay and AFG and H are assigned to plain of flood. The distribution of these associations in the column defines an terminal fan paleoenvironment where is represented of base to top: distal (AFA, B and G) and proximal area (AFD and G) of the distributary plain; zone of feeding of the system (AFC, And, F and G), media-proximal distributary plain (AFD and F), proximal distributary plain (AFC, And, F and G); and flood basin (AFF, G and H) [es

EARLY MIOCENE INSULAR VERTEBRATES FROM LAERRU (SARDINIA, ITALY): PRELIMINARY NOTE

OpenAIRE

DANIEL ZOBOLI; GIAN LUIGI PILLOLA

2017-01-01

A new vertebrate assemblage was discovered in an Early  Miocene lacustrine deposit near the village of Laerru (northern Sardinia, Italy). The assemblage is composed by mammals, reptiles and a bird. The mammals are represented by three ruminants (cf. Sardomeryx oschiriensis, Pecora indet. small size and Pecora indet. very small size) and one dormouse (Peridyromys aff. murinus) while reptiles are represented by turtles (Trionychidae?) and crocodiles (cf. Diplocynodon sp.). A bird bone fragment ...

Finding Bureaucracy

OpenAIRE

Rønningstad, Chris Andre

2015-01-01

This thesis will use survey data from Norwegian managers to answer the following research question: Are managers in public administrations more bureaucratic in their attitudes toward structure and values than managers in private enterprises? I will argue that the classical bureaucracy, as described by Max Weber, can be understood as defined by structure and values. One often disparages the structural elements of bureaucracy and forgets about the bureaucratic values. The mean scores from AFF's...

Cluster (Viridiplantae) - PGDBj - Ortholog DB | LSDB Archive [Life Science Database Archive metadata

Lifescience Database Archive (English)

Full Text Available 0”. This cluster ID is uniquely-assigned by the PGDBj Ortholog Database. Cluster size Number of proteins aff...r About This Database Database Description Download License Update History of This Database Site Policy | Contact Us Cluster (Viridiplantae) - PGDBj - Ortholog DB | LSDB Archive ... ...List Contact us PGDBj - Ortholog DB Cluster (Viridiplantae) Data detail Data name Cluster (Viridiplantae) DO...switchLanguage; BLAST Search Image Search Home About Archive Update History Data

Supporting smoking cessation in older patients: a continuing challenge for community nurses

OpenAIRE

Phillips, A.

2016-01-01

Tobacco smoking continues to pose negative health consequences for smokers and their families, and is the single greatest cause of health inequalities in the UK. Older people are particularly vulnerable to the negative health impacts of smoking and therefore, supporting older smokers to quit remains an important public health goal. Community nurses are required to help patients to lead healthier lifestyles and have ideal opportunities to encourage smoking cessation in older people who are aff...

Description and molecular characterization of a new species of tarantula, Pamphobeteus verdolaga , from Colombia (Araneae: Mygalomorphae: Theraphosidae)

OpenAIRE

Cifuentes, Yeimy; Estrada-Gomez, Sebastián; Vargas-Muñoz, Leidy Johana; Perafán, Carlos

2016-01-01

ABSTRACT A new species of Pamphobeteus Pocock, 1901, is described from the Colombian Andes, Medellín, Antioquia. The biochemistry and molecular characteristics of the venom of this new species (previously identified as Pamphobeteus aff. nigricolor ) has been already described. A detailed taxonomic study, comparing this species with holotypes and additional material of Pamphobeteus species, allowed us to recognize it as new, and to describe it here as Pamphobeteus verdolaga sp. nov. The male o...

Pengaruh Pembelanjaan Periklanan Dan Promosi Harga Pada Ekuitas Merek

OpenAIRE

Killa, Maklon Felipus

2008-01-01

This study aimed to examine the effect of perceived advertising spending and price deal on brand equity's dimension, and the effect of brand equity's dimension onbrand equity based on consumer's perspective. University students in Yogyakarta were taken for the sample, those who owned and used notebook. Meanwhile thepurposive sampling was used for sampling technique. 350 questionnaires were distributed and 328 were used. The finding showed that brand loyalty was positivelyand significantly aff...

Special Inspector General for Iraq Reconstruction. Quarterly Report to the United States Congress

Science.gov (United States)

2011-04-30

powerful allies they have cultivated . Th e highest levels of the In late January, Deputy Prime Minister (DPM) for Energy Aff airs Hussein al...skills to combat criminal gangs and maintain the peace. General Jassam com- mented favorably on USF-I’s ability to learn from its mistakes and cultivate ...SPECIAL INSPECTOR GENERAL FOR IRAQ RECONSTRUCTION FOCUS ON ANBAR • potato, mushroom , and strawberry fi elds In addition to these programs, Inma

地上波広告放送市場をめぐる実証分析の展望

OpenAIRE

春日, 教測; 宍倉, 学

2005-01-01

In this paper, we will survey recent papers on empirical economic analysis with respect to terrestrial broadcasting industry. There are four related markets; (a) contents, (b) advertiser's goods, (c) TV (or radio) advertisement, (d) program supply. Here, we focus on two markets, (c) and (d). When we analyze determinants of profit in terrestrial broadcasting industry, we must pay attention to two characteristics; (i) oligopoly structure in each market, (ii) cost-saving advantage by network aff...

Analysis of the Vocational and Residential Preferences of a Rural Population: Application of an Experimental Technique to Rural Slovenia

OpenAIRE

Zanni, Alberto; Bailey, Alastair; Davidova, Sophia M.

2008-01-01

This study applies Choice Experiments to the analysis of the relative importance of both monetary and non-monetary determinants of vocational choice and spatial labour supply. It identifies the determinants of individuals’ choice of jobs and places of residence, and provides a better understanding of how rural labour adjustments might be managed in a country in transition. The results indicate that while wages are the most important factor influencing employment choice, other determinants aff...

Impacto de la Convergencia a las Normas Contables Internacionales en el Brasil Sobre el Contenido Informacional de la Contabilidad

Directory of Open Access Journals (Sweden)

Marcelo Alvaro da Silva Macedo

2013-01-01

Full Text Available Este artículo tiene como objetivo analizar el impacto del proceso de convergencia a las normas contables internacionales en el Brasil sobre el contenido informacional de la Contabilidad, teniendo como foco alteraciones en los principales índices contable- financieros y en la relevancia de las informaciones contables. Para esto, fueron analizadas empresas no financieras de capital abierto, considerando informaciones del ejercicio de 2009 divulgadas en el inicio de 2010 (BRGAAP – estándar parcialmente IFRS y en el inicio de 2011 ( full IFRS. El análisis de datos del ejercicio de 2009 tuvo como propósito aislar toda y cualquier otra influencia encontrada en las demostraciones contables que no fuese proveniente de las alteraciones de estándar contable. Los resultados apuntaron que los indicadores Endeudamiento (END, Giro del Activo (GA, Margen Bruto (MB, Flujo de Caja Operacional sobre Activo Total (FSA y Flujo de Caja Operacional sobre Patrimonio Líquido (FSPL se mostraron menores, cuando utilizados datos de las demostraciones en full IFRS. Analizada la capacidad informacional del Lucro Líquido, por medio de regresión, fue posible detectar que, al reflejar el estándar full IFRS, el Lucro Líquido aumenta su poder explicativo sobre el comportamiento de los precios de las acciones. En relación al contenido informacional del Patrimonio Líquido, los resultados apuntaron que no hubo alteración significativa en su poder explicativo del comportamiento de los precios de las acciones.

Leaf Litterfall and Decomposition of Polylepis reticulata in the Treeline of the Ecuadorian Andes

Directory of Open Access Journals (Sweden)

Juan Pinos

2017-02-01

Full Text Available Leaf litterfall contributes significantly to carbon fluxes in forests. A crucial open question for the sustainability of mountain forests is how climate change will affect this and other carbon fluxes (eg photosynthesis and respiration. Leaf litterfall and decomposition of Polylepis reticulata, an endemic species of the Andes, were analyzed during a period of 1 year at 6 experimental plots located in the Andean páramo between 3700 and 3900 m above sea level in Cajas National Park, Ecuador. Litterfall was collected in each plot using 5 randomly distributed traps. Every trap had a 40-cm diameter (0.125 m2 and was suspended 0.8 to 1.0 m above the ground. The decomposition rate of the leaf litter was analyzed using litter bags. Eighteen bags with approximately 20 g of dry litter were placed in the litter layer in each experimental plot and collected 30, 60, 90, 150, 210, 300, and 365 days after they were installed. The mean annual litterfall recorded was 3.77 Mg ha−1, representing 51% of the leaf biomass present in the canopy, so the leaf life span of P. reticulata in Cajas National Park is 1.98 years. Litterfall occurred all year, with no significant seasonal pattern. The mean decomposition rate (k obtained for this study period was 0.38 year−1. This study contributes to the information gap on litterfall and decomposition in natural forests located at the highest elevations in the world.

Características de qualidade do suco polposo de cajá (Spondias lutea L. obtido por extração mecânico-enzimática Quality characteristics of pulpy caja fruit juice (Spondias lutea L. obtained by enzymatic-mechanical extration

Directory of Open Access Journals (Sweden)

Antônio de Pádua Valença DA SILVA

1997-12-01

Full Text Available Cajás (Spondias lutea L., oriundas do município de Maranguape (CE - Brasil, em estádio de plena maturação foram processadas em escala-piloto para obtenção de suco integral através do processo de extração mecânico-enzimática. O produto final foi analisado com relação as suas características físico-químicas bem quanto ao perfil sensorial após estocagem de 120 dias à temperatura ambiente (28°C. A polpa foi tratada com 120 ppm de enzimas pectinolíticas (Pectinex Ultra SP-L por 30 min, à temperatura de 25°C, o pH natural (2,98, seguido o processo mecânico de extração. Foi empregado como processo de preservação do suco integral o método "hot-fill" + aditivos. Segundo o ponto de vista estatístico as características físico-químicas permaneceram inalteradas ao longo de 120 dias, apresentando os seguintes valores médios: pH (2,78, sólidos solúveis (11,19 °Brix, acidez titulável total (1,46 g% de ácido cítrico, açúcares redutores (6,91 g% em glicose, taninos (77,36 mg% de ácido tânico, cor (0,125 em leitura de absorbância a 440 nm, pectina (0,12 g% em pectato de cálcio e viscosidade (10,8 cps. A análise sensorial classificou o suco polposo como de "boa" e "muito boa", sendo que as maiores médias couberam aos parâmetros aparência, cor e sabor.Caja fruit (Spondias lutea L. from Maranguape (Ceará-Brazil obtained at the full maturity stage were processed at a pilot-scale level with the purpose to obtain pulpy juice through enzymatic-mechanical process. The final product was analysed regarding physical-chemical characteristics as well as in relation to sensorial profile after 120 days of storage at room temperature (28°C. The pulp was treated by 120 ppm of pectinolytics enzymes (Pectinex Ultra SP-L during 30 minutes at 25°C, keeping natural pulp pH (2,98. The "hot-fill " + aditives were used as a preservation process for the pulpy juice. At a statistical point of view physical-chemical characteristics

Validation of the plan of handling of hospital accustomed to waste of the Costa Rica Box of the Public Health; Validacion del plan de manejo de desechos solidos hospitalarios de la Caja Costarricense del Seguro Social

Energy Technology Data Exchange (ETDEWEB)

Salazar Monge, F J

1999-07-01

, vehiculos de transporte y recipientes, equipo de proteccion personal, horario y ruta de recoleccion y recicle. Esta situacion representa un grave peligro para la salud de la poblacion y el medio ambiente pues se le expone a agentes infecciosos sustancias toxicas e incluso productos radiactivos que se generan en los residuos de los centros de salud. En este trabajo se proponen mejoras al sistema de manejo de desechos solidos del hospital Calderon Guardia, y se evaluo cada uno de los puntos mencinados anteriormente. Se hizo una revision acerca de las propiedades, la calidad y la cantidad de los desechos solidos producidos y un diagnostico de la situacion actual en este centro de salud. Las mejoras propuestas se basan en el prograna regional de desechos solidos hospitalarios, convenio ALA 91/33 (este fue elaborado en 1997 por una iniciativa de cooperacion entre la Union Europea y los Gobiernos de Costa Rica, El Salvador, Guatemala, Honduras, Nicaragua y Panama) y las Normas para el Manejo de Desechos Solidos Peligrosos en Establecimientos de Salud (elaborado por la Caja Costarricense del Seguro Social). Ademas se exponen sus ventajas y desventajas y se realiza un analisis comparativo entre el plan de manejo propuesto en estos documentos y el que se utiliza actualmente en el hospital Calderon Guardia. Algunos de los problemas detectados son: falta de equipo de proteccion personal, no se utilizan los recipientes adecuados, almacenamiento de desechos dentro del hospital, los vehiculos utilizados en el transporte interno no son los mas adecuados, mala organizacion del centro de acopio, entre otros. (author)

Cytotoxic and Apoptosis-Inducing Activity of Plants from the Family Asparagaceae in Relation to Human Alveolar Adenocarcinoma Cells

Directory of Open Access Journals (Sweden)

Y.N. Kamalova

2016-06-01

Full Text Available Cancer is known as the second major mortality cause. The number of new cases is increasing every year. Thus, it is urgent for scientists to search for alternative drugs with selective antitumor action and minimal side effects. It is known that some plant metabolites exhibit antioxidant, cytotoxic, and antitumor activity, while at the same time being less toxic than modern allopathic drugs. In this work, we have investigated the cytotoxic and apoptosis-inducing effects of extracts obtained from plants of the family Asparagaceae on A549 human lung adenocarcinoma cells. The analysis has been performed using flow cytofluorometry. If extracts showed cytotoxicity, the apoptosis-inducing action has been evaluated at the concentration of 50 μg/mL; in other cases, the analyzed concentration range was 50–300 μg/mL. On the basis of the experiments carried out, the following conclusions have been made. Extracts of the leaves and rhizomes of Sansevieria cylindrica and Sansevieria trifasciata do not possess antitumor activity. Extracts of the leaves of Polianthes tuberosa and Furcraea gigantea, which were cytotoxic at high concentrations, cause cell death at 50 μg/mL in the amount of 21.35 ± 1.86 and 15.6 ± 3.23, respectively. Extracts of Polianthes tuberosa bulbs and Yucca filamentosa leaves are able to induce apoptosis at higher concentrations. When the concentration reaches 100 μg/mL, the proportion of apoptotic cells for these plants is 45.76 ± 1.34 and 11.33 ± 0.07, respectively. The number of dead cells at the concentration of 300 μg/mL increased up to 73.33 ± 3.05 and 81.75 ± 4.07. The results have great importance for development of new drugs based on metabolites from these plant extracts.

Citogenética de Angiospermas coletadas em Pernambuco: V Cytogenetics of Angiosperms collected in the State of Pernambuco: V

Directory of Open Access Journals (Sweden)

Andrea Pedrosa

1999-04-01

Full Text Available Foram analisadas 33 espécies, entre nativas e introduzidas, pertencentes a 20 famílias de angiospermas ocorrentes no Estado de Pernambuco. A caracterização cariotípica da maioria das espécies foi baseada no número e morfologia cromossômica, padrão de condensação de cromossomos profásicos e estrutura de núcleo interfásico. Cinco espécies tiveram seus números cromossômicos determinados pela primeira vez, sendo elas: Cereus jamacaru (2n=22, Clitoria fairchildiana (2n=22, Eugenia luschnathiana (2n=22, Licania tomentosa (2n=22 e Spondias tuberosa (n=16. No caso de Licania tomentosa esta é a primeira citação de número cromossômico para o gênero. Das outras 28 espécies, três (Cecropia cf. palmata, 2n=26; Crinum erubescens, 2n=70; e Schinus terebentifolius, 2n=28 apresentaram números cromossômicos diferentes dos registrados previamente na literatura.Thirty three native and introduced species from 20 families of angiosperms collected in the State of Pernambuco were analysed. The karyotype description of the majority of the species was based on chromosome number and morphology, condensation pattern of prophase chromosomes as well as interphase nuclear structure. In five species (Cereus jamacaru, 2n=22; Clitoria fairchildiana, 2n=22; Eugenia luschnathiana, 2n=22; Licania tomentosa, 2n=22; and Spondias tuberosa, n=16 the chromosome number is reported here for the first time. In the case of Licania tomentosa, this is also the first report for the genus. Among the other 28 species, three (Cecropia cf. palmata, 2n=26; Crinum erubescens, 2n=70; and Schinus terebentifolius, 2n=28 showed chromosome numbers different from what has previously been reported.

Marantaceae: novidades taxonômicas e nomenclaturais III: tipificações, sinonímias e uma nova combinação em Calathea Marantaceae: taxonomic and nomenclatural novelties III: typifications, synonyms and a new combination in Calathea

Directory of Open Access Journals (Sweden)

João Marcelo Alvarenga Braga

2005-12-01

Full Text Available Dando continuidade ao levantamento dos táxons de Marantaceae ocorrentes no Brasil, propõe-se novidades taxonômicas e nomenclaturais envolvendo algumas espécies de Marantaceae descritas e ilustradas na Flora Fluminensis de Frei José Mariano da Conceição Vellozo. Maranta monophylla, M. prolifera e M. tuberosa são circunscritas aqui a partir das informações morfológicas e fitogeográficas contidas nas descrições e nos comentários existentes nas obras originais, além da análise das estampas publicadas em contribuições subseqüentes e que ilustram com detalhamento as espécies. A partir dos dados coligidos e da comparação com coleções recentes e tipos nomenclaturais é proposta uma nova combinação, dada a necessidade de se transferir M. prolifera para o gênero Calathea. São propostos como sinônimos algumas espécies de Calathea comumente citadas nos levantamentos florísticos realizados no domínio da Floresta Atlântica.To continue the survey on Marantaceae taxa being carried out in Brazil, new taxonomic and nomenclatural proposals are made involving some species of Marantaceae described and illustrated in Flora Fluminensis by Friar José Mariano da Conceição Vellozo. Maranta monophylla, M prolifera and M. tuberosa are circumscribed here from morphologic and phytogeographic information contained in descriptions and commentaries from Vellozo's originals, as well as from analysis of prints which were published subsequently that illustrate the species in detail. From the gathered data and the comparison with recent collections and nomenclatural types, a new combination is proposed, due to the necessity of transferring M. prolifera to the genus Calathea. Some Calathea species commonly cited in floristic surveys at the Atlantic Forest are proposed as synonyms.

Adultos mayores pensionados, situación de endeudamiento por créditos sociales y propuestas de mejora del sistema.

OpenAIRE

Salgado Aguilera, Alex Andrés

2011-01-01

En el presente trabajo, se aborda la situación de los adultos mayores pensionados del antiguo y nuevo Sistema, que mantienen deudas con Cajas de Compensación de Asignación Familiar por créditos sociales. En el primer capítulo se presenta el problema de investigación, los objetivos generales, específicos y las hipótesis planteadas.Es una investigación de carácter cuantitativa, que se desarrolla considerando teorías del envejecimiento y del ahorro y desahorro en etapas de adultez.Se pr...

Documento: Conocimientos sobre VIH/SIDA de la población costarricense.

OpenAIRE

Vargas Ruíz, Rodrigo

2005-01-01

En el marco del desarrollo del Proyecto Integrado "La salud sexual y la salud reproductiva de la población estudiantil de la Universidad Nacional", que se lleva a cabo en el Instituto de Estudios Sociales en Población (IDESPO), se conjuntaron esfuerzos con el Programa de Prevención y Control del VIH/SIDA de la Caja Costarricense de Seguro Social y el Departamento de Educación Integral de la Sexualidad Humana (DEISH) del Ministerio de Educación Pública, para realizar la encuesta telefónica "Co...

Reacciones en América Latina

Directory of Open Access Journals (Sweden)

Sen Amartya

1998-12-01

Full Text Available Julio Boltvinik, publicado en La Jornada, México, 28 y 29 de octubre de 1998. / Bernardo Kliksberg, profesor Honorario de la UBA, coordinador del Instituto Interamericano de Desarrollo Social-INDES-BID. / Mildred Largaespada, tomado de Confidencial, Nicaragua, primera semana de noviembre de 1998. de 1998. / David Montoya, tomado de Caretas, 22 de octubre de 1998, Perú. / Carlos Medina de Rebolledo, tomado de El Diario, Bolivia. / Libardo Sarmiento A., tomado de Caja de herramientas 59, noviembre / Mildred Largaespada, tomado de Confidencial, Nicaragua, primera semana de noviembre de 1998. de 1998.

Administración de la cadena de abasto de productos de consumo repetitivo en el hogar en Colombia. Aproximación a un marco histórico y teórico.

OpenAIRE

Ricardo Acevedo Trujillo

2013-01-01

Este trabajo intenta una primera aproximación teórico-histórica a la administración de la cadena de abasto en Colombia en el área de los almacenes que proveen bienes de consumo repetitivo en el hogar. El tema es pertinente puesto que el sector se encuentra en este momento en transformación, debido a la entrada de grandes capitales de la industria multinacional.   Desde la perspectiva del autor, los “superetes” entendidos como: “tiendas de barrio con caja de salida”, son una oportunida...

Mejoramiento de Vivienda como Estrategia de Control de la Enfermedad de Chagas.

OpenAIRE

Victor Manuel Ángulo; F. Michaels; N. Aguilar

2000-01-01

El Proceso en Colombia.

La Constitución Política de 1991 en el artículo 51 estableció que todos los colombianos tienen derecho a una vivienda digna. Para dar cum-plimiento a este mandato se instituyó la ley 3 de 1991 que creó el subsidio de vivienda y el sistema SISBEN. El desarrollo estatutario de esta ley dejó en manos de la Red de Solidaridad Social (RSS) y la Caja Agraria (CA) la metodología para que las comunidades de los diferentes...

Consideraciones geológico-paleontológicas del hallazgo de un vertebrado en dedimentos del jurásico tardío en una localidad en el norte del estado de San Luis Potosí, México

OpenAIRE

Flores Castillo, Cesio Menahén

2012-01-01

En el presente trabajo se realiza una investigación de carácter sedimentológico- paleontológico en rocas sedimentarias calcáreo-arenosas de la Formación La Caja (Jurásico Tardío), que contienen los restos de un vertebrado fosilizado, localizado en el cañón denominado San Nicolás, perteneciente a la localidad de Las Lajas, Municipio de Charcas, San Luis Potosí. Los estudios realizados para su identificación manifiestan que se trata de un organismo marino. En el presente trabajo...

Evaluación de la estructura de capital de empresas del sector papel y cartón en el Valle del Cauca

OpenAIRE

Londoño Balcázar, Heidy Dayira; Morales Parra, Diana Carolina

2016-01-01

El presente trabajo tiene como objetivo presentar los resultados del estudio de evaluar la estructura de capital de empresas del sector papel y cartón en el Valle del Cauca (Colombia) -- Se utilizarán las diferentes teorías de estructura de capital como marco conceptual, recurriendo a la metodología de valoración, que permite a través del método de flujos de caja identificar su valor razonable, analizando de qué manera se ve afectado el valor de la empresa, partiendo de su estructura de capit...

Repatriando capital sin plata. Redes de paisanaje, comercio de frutos y giro de letras entre Venezuela y España, 1785-1796

OpenAIRE

Lana Berasain, José Miguel

2018-01-01

El texto ofrece algunas noticias acerca del movimiento de capitales a gran y pequeña escala entre Venezuela y España a partir de un estudio de caso apoyado sobre fondos documentales privados. La disponibilidad del libro de caja número 1 del indiano montañés Esteban González de Linares (1751-1802) y la correspondencia de éste con el armador y comerciante santanderino Francisco de Gibaja y otros particulares (335 cartas) ofrecen una rica variedad de fórmulas y vías de transfer...

Cooperativas de ahorro y crédito de Argentina

OpenAIRE

Montes, Verónica L.; Iglesias, Leandro Ariel; Coppini, Viviana; Martí, Juan Pablo

2008-01-01

El siguiente informe sobre el sector cooperativo de crédito se compone de un desarrollo cualitativo y cuantitativo con datos al año 2006. De acuerdo al análisis realizado para el sector, encontramos que el mayor caudal de información, tanto cualitativa como cuantitativa proviene del Banco Credicoop Cooperativo Limitado (BCCL). También se observa, que en el rango de elementos a estudiar, es mayor el volumen de información que se desprende de las cooperativas crédito abiertas –bancos y cajas de...

Reparto de utilidades en las sociedades cooperativas de ahorro y préstamo ¿por qué son gravadas? un análisis sobre la aplicación de la carga fiscal

OpenAIRE

Ramos Andrade, Zahyra del Rocío

2015-01-01

En síntesis en la presente investigación se realizó un minucioso análisis en torno a las sociedades cooperativas de ahorro y préstamo, basándose la autora en una entidad denominada caja popular San Rafael. Llegando a la conclusión de que dichas empresas son personas morales lucrativas pues obtienen un beneficio económico a cambio de los servicios que presta, son generadoras de riqueza y obtienen utilidades; sin embargo, dichas utilidades no son gravadas debido a que la legislación determina q...

Toxicidad in vitro de los herbicidas atrazina y paraquat sobre el crecimiento vegetativo y la esporulación de hongos saprobios del suelo

OpenAIRE

CHAN CUPUL, Wilberth; HEREDIA ABARCA, Gabriela; RODRÍGUEZ VÁZQUEZ, Refugio; ARIAS MOTA, Rosa María

2014-01-01

El objetivo de este estudio fue evaluar la toxicidad in vitro de los herbicidas atrazina y paraquat sobre el crecimiento vegetativo y la esporulación de hongos saprobios del suelo. Se realizaron bioensayos dosis-respuesta en trece especies con cuatro concentraciones de atrazina (468, 937, 1875 y 3750 mg/L) y paraquat (93, 187, 375 y 750 mg/L). Los hongos fueron inoculados con 2 μL de una suspensión de 1.0 x 10(6) esporas/mL en cajas de Petri con agar papa dextrosa (APD) adicionado con atrazin...

Efecto de la fuente de nitrógeno en la distribución de asimilados y composición de savia en ajipa (Pachyrhizus ahipa (Wedd.) Parodi)

OpenAIRE

Leidi, Eduardo O.; Sarmiento Solís, Rafael; Mazuelos Vela, Carmen; Rodríguez- Navarro, Dulce N.

1997-01-01

7 páginas, 4 figuras, 1 tabla y 17 referencias. Trabajo presentado en el VI Simposium Nacional - II Ibérico sobre nutrición mineral de las plantas, Sevilla, del 12 al 15 de Noviembre de 1996. Entidades colaboradoras Junta de Andalucía, Universidad de Sevilla, Consejo Superior de Investigaciones Científicas, Sociedad Española de Fisiología Vegetal, El Monte, Caja de Huelva y Sevilla y Gat Fertiliquidos. Editores Científicos: Rafael Sarmiento Solís, Eduardo O. Leidi Montes y Antonio Troncos...

La Dimensión pedagógica de la virtualidad

OpenAIRE

Suárez Guerrero, Cristóbal

2013-01-01

La pedagogía no es una novedad para la educación, Internet sí. Sin embargo, si en este preciso instante preguntamos qué tecnología en red podemos emplear para aprender algo específico, seguro que abriremos la Caja de Pandora a un amplio número de aplicaciones tan sofisticadas, pero también efímeras, con los que aprender en red. Para cada necesidad de aprendizaje, con mayor o menor acierto, encontrar una respuesta tecnológica es relativamente sencillo gracias a nternet.

Experiencia de trabajo interdisciplinario en alfabetización básica con mujeres, promoción de su salud y derechos.

OpenAIRE

Sanabría Hernández, Marcela; Castro Carmiol, Evelyn; Sanabría Hernández, Gabriela

2015-01-01

El artículo presenta una experiencia de trabajo interinstitucional e interdisciplinaria, entre la Caja Costarricense de Seguro Social- Área de Salud Goicoechea 2, Servicio de Trabajo Social con la Universidad Estatal a Distancia, Cátedra de Psicopedagogía, realizada en el Área de Salud Goicoechea 2, referente a la alfabetización básica con mujeres adultas, vecinas de los cantones de Moravia y Goicoechea, San José, Costa Rica. El proceso se llevó a cabo a partir de una metodología grupal socio...

Análisis técnico de ingresos y egresos de una empresa distribuidora de celulares para obtener la utilidad operacional. localidad p. icaza. año 2007

OpenAIRE

Fuentes Aucancela, Rosa; Ramos, Pedro; Merchan, Roberto

2009-01-01

Con los datos de ventas, costo de ventas y gastos se ha realizado un análisis estadístico para elaborar una proyección de utilidades, el mismo que es de vital importancia para los directivos de la empresa porque les permite tomar decisiones de mercadotecnia, producción, aprovisionamiento y flujo de caja. Por tanto, debe ser elaborada con sumo cuidado. En el primer capítulo se ha detallado los conceptos de las herramientas y técnicas estadísticas utilizadas en el desarrollo de la proyecció...

¿Cómo afectó la apertura y el MERCOSUR al comercio industrial argentino?

OpenAIRE

Carrera, Jorge Eduardo; Bellingi, Guillermo; Saavedra, Osvaldo Marcelo

2002-01-01

En los noventa la economía argentina vivió un proceso de reformas que afectaron la inserción internacional y el perfil industrial del país. Este proceso tuvo tres grandes pilares: la estabilización de las variables nominales mediante un sistema de caja de conversión, un cambio en el rol del sector público basado en la desregulación y las privatizaciones y la apertura e internacionalización de la economía en términos financieros y comerciales. Instituto de Integración Latinoamericana...

Impuesto diferido bajo NIIF: impacto en empresas intensivas en propiedades, planta y equipos

OpenAIRE

Gil Henao, Marisol; Ochoa Flórez, Jhon Wilson

2014-01-01

En Colombia ha sido poco frecuente el registro en los estados financieros del impuesto diferido, a pesar de la obligatoriedad como mecanismo de asignación y reconocimiento de impuestos, establecida en los decretos 2649 y 2650 de 1993 y que incide en los resultados, asignación real de utilidades y flujos de caja futuros; sin embargo, se espera que esto cambie a partir de la adopción de las Normas Internacionales de Información Financiera -- El objetivo del trabajo es determinar el impacto que ...

Fundus autofluorescence in blunt ocular trauma

Directory of Open Access Journals (Sweden)

Ricardo Luz Leitão Guerra

2014-06-01

Full Text Available Objetivo: Descrever os achados do exame de autofluorescência do fundo de olho (AFF em pacientes vítimas de trauma ocular contuso. Métodos: Estudo retrospectivo, não intervencionista, realizado através da revisão de prontuários e exames de imagem. Os dados analisados foram: sexo, idade, lateralidade, etiologia do trauma, tempo decorrente entre o trauma e a realização do exame, acuidade visual, alterações na periferia da retina, diagnóstico fundoscópico e achados ao exame de AFF (realizada no aparelho Topcon TRC-50DX Retinal Camera. Resultados: Oito olhos de 8 pacientes foram estudados. A idade média foi de 27,6 anos (de 19 a 43 anos, o sexo masculino (n=7 foi mais acometido do que o feminino (n=1, agressão física foi a etiologia mais comum do trauma (n=3, seguido de acidente com fogos de artifício (n=2. Outras causas foram acidente automobilístico (n=1, trauma ocupacional com lixadeira (n=1 e pedrada (n=1. A acuidade visual variou de 20/80 a percepção luminosa. Epiteliopatia pigmentar traumática (EPT foi identificada em 5 casos, rotura de coroide em 3, hemorragia subretiniana em 3 e retinopatia de Purtscher em 1 caso. Hipoautofluorescência foi observada nos casos de rotura de coroide, hemorragia subretiniana recente, hemorragia intrarretiniana e em 2 casos de EPT. Hiperautofluorescência foi visualizada nos casos de hemorragia subretiniana em degradação, na borda de 2 casos de roturas de coroide e discretamente no polo posterior na retinopatia de Purtcher. Três casos de EPT apresentaram hipoautofluorescência com pontos hiperautofluorescentes difusos. Conclusão: O exame de AFF permite avaliar as alterações do segmento posterior do olho decorrentes do trauma ocular contuso de forma não invasiva, somando informações valiosas. Foram descritos achados do exame em casos de epiteliopatia pigmentar traumática, rotura de coroide, hemorragia sub-retiniana e retinopatia de Purtscher.

The gsdf gene locus harbors evolutionary conserved and clustered genes preferentially expressed in fish previtellogenic oocytes.

Science.gov (United States)

Gautier, Aude; Le Gac, Florence; Lareyre, Jean-Jacques

2011-02-01

The gonadal soma-derived factor (GSDF) belongs to the transforming growth factor-β superfamily and is conserved in teleostean fish species. Gsdf is specifically expressed in the gonads, and gene expression is restricted to the granulosa and Sertoli cells in trout and medaka. The gsdf gene expression is correlated to early testis differentiation in medaka and was shown to stimulate primordial germ cell and spermatogonia proliferation in trout. In the present study, we show that the gsdf gene localizes to a syntenic chromosomal fragment conserved among vertebrates although no gsdf-related gene is detected on the corresponding genomic region in tetrapods. We demonstrate using quantitative RT-PCR that most of the genes localized in the synteny are specifically expressed in medaka gonads. Gsdf is the only gene of the synteny with a much higher expression in the testis compared to the ovary. In contrast, gene expression pattern analysis of the gsdf surrounding genes (nup54, aff1, klhl8, sdad1, and ptpn13) indicates that these genes are preferentially expressed in the female gonads. The tissue distribution of these genes is highly similar in medaka and zebrafish, two teleostean species that have diverged more than 110 million years ago. The cellular localization of these genes was determined in medaka gonads using the whole-mount in situ hybridization technique. We confirm that gsdf gene expression is restricted to Sertoli and granulosa cells in contact with the premeiotic and meiotic cells. The nup54 gene is expressed in spermatocytes and previtellogenic oocytes. Transcripts corresponding to the ovary-specific genes (aff1, klhl8, and sdad1) are detected only in previtellogenic oocytes. No expression was detected in the gonocytes in 10 dpf embryos. In conclusion, we show that the gsdf gene localizes to a syntenic chromosomal fragment harboring evolutionary conserved genes in vertebrates. These genes are preferentially expressed in previtelloogenic oocytes, and thus, they

Investigating domain-general short-term memory for order versus specific item memory in developmental dyslexia

OpenAIRE

Hachmann, Wibke Maria

2012-01-01

Recent findings suggest that people with dyslexia experience difficulties with the learning of serial order information during the transition from short- to long-term memory. At the same time, models of short-term memory increasingly incorporate a distinction of order and item processing. This work aims to investigate whether serial order processing deficiencies in dyslexia can be traced back to a selective impairment of short-term memory for serial order, and whether this impairment also aff...

BRAND EXPERIENCE – HOW IT RELATES TO BRAND PERSONALITY, CONSUMER SATISFACTION AND CONSUMER LOYALTY. AN EMPIRICAL ANALYSIS OF THE ADIDAS BRAND.

OpenAIRE

Thomas Cleff; Silvia Dörr; Andrew Vicknair; Nadine Walter

2013-01-01

Brand experience has attracted a lot of attention in the Marketing practice. With consumers seeking not only functional benefits of a brand but also emotional experiences, brand experience theory attempts to provide answers on how brand experience can be measured and how it effects consumer behavior. Th is article examines the relationship between Brakus et al.’s (2009) four brand experience dimensions – sensory, aff ective, intellectual and behavioral – and customer satisfaction and loyalty ...

Characterization of the main Iberian Peninsula and French Atlantic turbid plumes using MODIS satellite data

OpenAIRE

Fernandez Novoa, Diego

2018-01-01

A river plume can be defined as a water mass with different properties than surrounding ocean water, in terms of salinity, temperature, composition and color, due to the influence of a river discharge. This is because river inputs provide fresh water, nutrients, sediments, organic and inorganic material and/or contaminants, among others, into the ocean, modifying the physical, chemical and biological conditions of the coastal areas under influence. Therefore, plumes play a key role in the aff...

PENGARUH PEMBELANJAAN PERIKLANAN DAN PROMOSI HARGA PADA EKUITAS MEREK

OpenAIRE

Killa, Maklon Felipus

2015-01-01

This study aimed to examine the effect of perceived advertising spending and price deal on brand equity’s dimension, and the effect of brand equity’s dimension onbrand equity based on consumer’s perspective. University students in Yogyakarta were taken for the sample, those who owned and used notebook. Meanwhile thepurposive sampling was used for sampling technique. 350 questionnaires were distributed and 328 were used. The finding showed that brand loyalty was positivelyand significantly aff...

How Bank Capital Structure Affects Business Performance---- Empirical evidence from Chinese Commercial banks

OpenAIRE

Luo, Ting

2010-01-01

In the end of 2006, China realizes the opening of financial market, thus Chinese commercial banks have to face the global competitors. How to exist and develop in the market with fierce competition has been more and more significant to Chinese commercial banks. Because commercial banks’ business performance is the overall reflection of banks’ competence, so they should consider improving the bank business performance. Thus this study aims to discuss how commercial banks’ capital structure aff...

Absolute and Relative Morbidity Burdens Attributable to Various Illnesses and Injuries, U.S. Armed Forces, 2011

Science.gov (United States)

2012-04-01

were aff ected by unspecifi ed (“all other”) musculoskeletal disorders (e.g., disorders of “other” joints, muscles , tendons, soft tissues) than by...2012 Vol. 19 No. 4 M S M R Page 7 Endocrine disorders Other endocrine dis 17,565 (66) 7,362 (70) 240 (89) Hypothyroidism 14,147 (71) 7,521 (69...foot/ankle), and two musculoskeletal disorders (back and disorders of “other” joints, muscles , ten- dons, soft tissues). Th roughout military history

Patterns of cross-sensitivity in the responses of clonal subpopulations isolated from the RIF-1 mouse sarcoma to selected nitrosoureas and nitrogen mustards.

OpenAIRE

Reeve, J. G.; Wright, K. A.; Workman, P.

1984-01-01

The response of clonal subpopulations isolated from the RIF-1 mouse sarcoma to melphalan treatment is independent of cell ploidy, whereas a clear relationship exists between ploidy and cell sensitivity to CCNU treatment. In the present study RIF-1 clones have been exposed to nitrogen mustard, aniline mustard and chlorambucil, and to nitrosoureas BCNU, MeCCNU and chlorozotocin, in order to evaluate whether or not the different physiochemical and biological activities of these agents would affe...

Silk and Sakoku : a simulation analysis of industrial location in Edo period Japan

OpenAIRE

ATSUMI, Toshihiro

2012-01-01

Japan closed itself to international trade from the 17^ century to the mid-19^ century during the Edo period, known as the Sakoku. After the closure, industries dispersed from western coastal cities to inland areas in western and eastern Japan. This paper investigates how the Sakoku may have aff ected industrial locations within Japan by applying a footloose entrepreneur type geography model to an economy with agricultural raw materials in a continuous space setting. The simulations based on ...

Avaliação de macro e microminerais em frutas tropicais cultivadas no nordeste brasileiro Evaluation of macro and micro-mineral content in tropical fruits cultivated in the northeast of Brazil

Directory of Open Access Journals (Sweden)

Maria Mozarina Beserra Almeida

2009-09-01

Full Text Available O Brasil tem grande importância no mercado de frutas; porém há escassez de dados acerca da composição das frutas tropicais brasileiras, principalmente daquelas produzidas no nordeste. No presente estudo, determinaram-se macro e microminerais de 11 frutas tropicais cultivadas no nordeste brasileiro: abacaxi, ata, graviola, jaca, mamão, mangaba, murici, sapoti, seriguela, tamarindo e umbu. As amostras foram desidratadas e mineralizadas em HNO3/HClO4 (3:1. Os minerais Ca, Mg, Mn, Zn, Fe, Co, Se e Ni foram analisados por espectrofotometria de absorção atômica, Na e K por fotometria de chama e P por método colorimétrico. Os resultados indicaram que o tamarindo pode ser considerado excelente fonte de Mg, Cu e K; além de boa fonte em Ca, P, Fe e Se. Dentre os minerais avaliados nas frutas estudadas, K apresentou o maior conteúdo, seguido pelo Ca e Mg. Ata, graviola, sapoti e murici são boas fontes de dois ou mais minerais. Correlações elevadas foram obtidas entre K e os minerais P, Co e Fe; e entre Co e Fe. Portanto, sugere-se o consumo dos frutos tropicais estudados, como auxiliares na reposição de nutrientes minerais.Brazil has great importance in the fruits market; however, data on the composition of Brazilian tropical fruits, mainly of those produced in the Northeast region, is scarce. In the present study, it was determined the macro- and micro-minerals of 11 tropical fruits cultivated in the Northeast of Brazil: pineapple, sweetsop, soursop, jackfruit, papaya, mangaba, murici, sapodilla, ciruela, tamarind, and umbu. The samples were dehydrated and mineralized in HNO3/HClO4 (3:1 solution. The minerals Ca, Mg, Mn, Zn, Fe, Co, Se and Ni were analyzed by atomic absorption spectrophotometry; Na and K by flame photometry; and P by the colorimetric method. The results indicated that tamarind is a rich source of all minerals available, especially of Mg, Cu and K, in addition to being a good source of Ca, P, Fe, and Se. Among the

Noninvasive prediction of left ventricular end-diastolic pressure in patients with coronary artery disease and preserved ejection fraction.

Science.gov (United States)

Abd-El-Aziz, Tarek A

2012-01-01

The aim of this study was to compare 3 different available methods for estimating left ventricular end-diastolic pressure (LVEDP) noninvasively in patients with coronary artery disease and preserved left ventricular ejection fraction (EF). We used 3 equations for noninvasive estimation of LVEDP: The equation of Mulvagh et al., LVEDP(1) = 46 - 0.22 (IVRT) - 0.10 (AFF) - 0.03 (DT) - (2 ÷ E/A) + 0.05 MAR; the equation of Stork et al., LVEDP(2) = 1.06 + 15.15 × Ai/Ei; and the equation of Abd-El-Aziz, LVEDP(3) = [0.54 (MABP) × (1 - EF)] - 2.23. ( A, A-wave velocity; AFF, atrial filling fraction; Ai, time velocity integral of A wave; DT, deceleration time; E, E-wave velocity; Ei, time velocity integral of E wave; IVRT, isovolumic relaxation time; MABP, mean arterial blood pressure; MAR, time from termination of mitral flow to the electrocardiographic R wave; Ti, time velocity integral of total wave.) LVEDP measured by catheterization was correlated with LVEDP(1) (r = 0.52, P Aziz, LVEDP = [0.54 MABP × (1 - EF)] - 2.23, appears to be the most accurate, reliable, and easily applied method for estimating LVEDP noninvasively in patients with preserved left ventricular ejection fraction and an LVEDP < 20 mm Hg. Copyright © 2012 Canadian Cardiovascular Society. Published by Elsevier Inc. All rights reserved.

The Early Burdigalian (MN3; Miocene large mammals from Estrepouy (Aquitaine basin, France: an updated faunal list

Directory of Open Access Journals (Sweden)

Ginsburg, L.

2011-12-01

Full Text Available The purpose of the present work is to describe the mammals from the Early Miocene locality of Estrepouy, Gers, France. We have identified 17 species belonging to 3 orders; Carnivora; Amphicyon lanthanicus, Cynelos helbingi, Plithocyon bruneti, Hemicyon gargan, Palaeogale hyaenoides, Semigenetta elegans y Pseudaelurus turnauensis. Perissodactyla; Anchitherium aurelianense, Protaceratherium minutum y Diaceratherium cf. aurelianense. Arctiodactyla; Aureliachoerus aurelianensis, Xenohyus venitor, Caenotherium aff. lintillae, Andegameryx andegaviensis, Oriomeryx willii, Procervulus praelucidus, Lagomeryx parvulus y Procervulus praelucidus. The Estrepouy mammal assemblage seems older than that represented in Wintershof-West (Alemania, MN 3 reference locality.

[fr] Des grands mammifères sont determines pour le Miocène inférieur (MN3 de Etrepouy, Gers, France. 17 taxons appartenant à trois déterminés ont été identifies: Carnivora; Amphicyon lanthanicus, Cynelos helbingi, Plithocyon bruneti, Hemicyon gargan, Palaeogale hyaenoides, Semigenetta elegans et Pseudaelurus turnauensis. Perissodactyla; Anchitherium aurelianense, Protaceratherium minutum et Diaceratherium cf. aurelianense. Arctiodactyla; Aureliachoerus aurelianensis, Xenohyus venitor, Caenotherium aff. lintillae, Andegameryx andegaviensis, Oriomeryx willii, Procervulus praelucidus, Lagomeryx parvulus et Procervulus praelucidus. L’association des mammifères Estrepouy regarde un peu plus âgé que celui représenté à la localité de référence du MN3 á Wintershof-Ouest (Allemagne.

Habitat preferences of common native fishes in a tropical river in Southeastern Brazil

Directory of Open Access Journals (Sweden)

Marcus Rodrigues da Costa

Full Text Available We determined in this study the habitat preferences of seven native fish species in a regulated river in Southeastern Brazil. We tested the hypothesis that fishes differ in habitat preference and that they use stretches of the river differing in hydraulic characteristics and substrate type. We surveyed fishes in four 1-km long river stretches encompassing different habitat traits, where we also measured water depth, velocity, and substrate type. We investigated preference patterns of four Siluriformes (Loricariichthys castaneus, Hoplosternum littorale, Pimelodus maculatus, and Trachelyopterus striatulus and three Characiformes (Astyanax aff. bimaculatus, Oligosarcus hepsetus, and Hoplias malabaricus, representing approximately 70% of the total number of fishes and 64% of the total biomass. We classified fishes into four habitat guilds: (1 a slow-flowing water guild that occupied mud-sand substrate, composed of two Siluriformes in either shallow ( 8 m, L. castaneus waters; (2 a run-dwelling guild that occurs in deep backwaters with clay-mud substrate, composed of the Characiformes A. aff. bimaculatus and O. hepsetus; (3 a run-dwelling guild that occurs in sandy and shallow substrate, composed of T. striatulus; and (4 a fast-flowing guild that occurs primarily along shorelines with shallow mud bottoms, composed of H. malabaricus and P. maculatus. Our hypothesis was confirmed, as different habitat preferences by fishes appear to occur in this regulated river.

Efectos de la crisis financiera sobre la innovación en la reorganización de los sistemas bancarios: los sistemas institucionales de protección en las entidades financieras de ámbito territorial

Directory of Open Access Journals (Sweden)

Ricardo Palomo

2011-03-01

Full Text Available La crisis financiera internacional ha actuado como catalizador de un profundo proceso de cambio en la supervisión financiera y en su modelo de negocio. Este trabajo pretende analizar los recientes procesos de reorganización bancaria iniciados en las entidades de ámbito territorial (cajas de ahorros y cooperativas de crédito que, a su vez, son identificadas como entidades financieras de economía social. Su especial arraigo territorial ha llevado a la posibilidad de aplicación de una innovadora fórmula legal propuesta por la Unión Europea denominada Sistema Institucional de Protección (SIP, surgida meses antes del estallido de la crisis financiera internacional. Con este propósito, se contempla, primeramente, el entorno configurado por las consecuencias de la crisis en el sector, para, a continuación, presentar los SIP realizados o iniciados hasta la fecha, haciendo especial referencia al sector del crédito cooperativo europeo, con un análisis econométrico centrado en España. Este análisis pretende determinar en qué medida los factores de mayor influencia en la constitución de un SIP están relacionados con la homogeneidad en el modelo de negocio. Del análisis realizado se ha podido demostrar que los criterios de homogeneidad en variables relacionadas con el modelo de negocio pesan más en las cooperativas de crédito que en las cajas de ahorros

Análisis de eficiencia relativa de hospitales públicos de Costa Rica.

Directory of Open Access Journals (Sweden)

Melvin Morera-Salas

2015-01-01

Full Text Available El análisis de eficiencia relativa hospitalaria resulta un tema trascendental para la Caja Costarricense de Seguro Social, dado que le permite determinar cuáles de los hospitales presentan un mejor desempeño relativo y cuáles podrían mejorar el uso de los recursos. El objetivo es analizar la eficiencia técnica hospitalaria en Costa Rica. Se utilizaron datos del 2012-2013 para los hospitales generales de la Caja Costarricense de Seguro Social. Para determinar la eficiencia hospitalaria se utiliza el análisis envolvente de datos con dos insumos: gasto en hospitalización y las camas y tres productos: actividad hospitalaria ajustada por casuística, índice de funcionamiento e índice de mortalidad intrahospitalaria ajustada por riesgo. Los resultados muestran que el nivel de eficiencia varía sustancialmente entre los 23 hospitales analizados. En 2013, un 30% de los hospitales resultó ser eficiente técnicamente, situación que mejoró levente respecto a 2012. Este trabajo es una primera aproximación del análisis de eficiencia de los hospitales públicos de Costa Rica. Se realizó un esfuerzo para homogenizar los datos, al ajustar las variables para considerar la complejidad y el riesgo de los casos que maneja cada hospital, de tal forma que los resultados sean comparables entre centros de diferentes tamaño y complejidad. Como conclusión se tiene que el 70% de los hospitales puede mejorar el uso de los recursos.

Análisis de eficiencia relativa de hospitales públicos de Costa Rica

Directory of Open Access Journals (Sweden)

Melvin Morera-Salas

2015-01-01

Full Text Available El análisis de eficiencia relativa hospitalaria resulta un tema trascendental para la Caja Costarricense de Seguro Social, dado que le permite determinar cuáles de los hospitales presentan un mejor desempeño relativo y cuáles podrían mejorar el uso de los recursos. El objetivo es analizar la eficiencia técnica hospitalaria en Costa Rica. Se utilizaron datos del 2012-2013 para los hospitales generales de la Caja Costarricense de Seguro Social. Para determinar la eficiencia hospitalaria se utiliza el análisis envolvente de datos con dos insumos: gasto en hospitalización y las camas y tres productos: actividad hospitalaria ajustada por casuística, índice de funcionamiento e índice de mortalidad intrahospitalaria ajustada por riesgo. Los resultados muestran que el nivel de eficiencia varía sustancialmente entre los 23 hospitales analizados. En 2013, un 30% de los hospitales resultó ser eficiente técnicamente, situación que mejoró levente respecto a 2012. Este trabajo es una primera aproximación del análisis de eficiencia de los hospitales públicos de Costa Rica. Se realizó un esfuerzo para homogenizar los datos, al ajustar las variables para considerar la complejidad y el riesgo de los casos que maneja cada hospital, de tal forma que los resultados sean comparables entre centros de diferentes tamaño y complejidad. Como conclusión se tiene que el 70% de los hospitales puede mejorar el uso de los recursos.

Pilot experiment to control Medfly, Ceratitis capitata (Wied.) (Diptera: Tephritidae) using mass trapping technique in a custard apple (Annona cherimolia Mill.) orchard

International Nuclear Information System (INIS)

Ros, J.P.; Escobar, I.; Garcia Tapia, F.J.; Aranda, G.

2000-01-01

Recently, as a result of assays coordinated by the International Atomic Energy Agency (and participated by Spain), it was decided that ammonium acetate, putrescine and trimethylamine be included in low release polyetilene bag dispensers (Biolure, Consep, Co) as the Mediterranean fruit fly (Medfly) females were greatly attracted by them. These synthetic substances are placed in traps at the frequency of one and a half months to two months. If Tephry traps are used, one DDVP wafer (containing Vapona or a similar substance) is enough to kill the flies that enter them. These attractants make it unnecessary to replenish the liquids in the Mcphail traps and remain effective throughout the entire fruit season. The Caja Rural de Granada (a bank of farmers) encourages all techniques that increase crop profits for farmers. It is even more desirable if such crop profitability can be achieved without the application of insecticides which may result in the likely presence of toxic residues. In the light of the results achieved by the attractants with regard to female Medflies, the Caja Rural de Granada, together with the National Institute of Agricultural Research Counselling (Agricultural Department), performed an experiment on mass trapping to confirm whether it is possible to protect a fruit plantation with the application of this biotechnical method. Due to the great risk of this initial experiment, the farmers were free to use insecticides as often as they deemed necessary so that no damages due to any plague could be blamed on the experiment

A Study on Influence of Trust, Social identity, Perceived Risk and EWOM on Consumer Decision-Making Process in the context of Social Network Sites

OpenAIRE

Loh, Aizhen

2011-01-01

With the advent of Web 2.0 applications, social network sites enable customers to actively participate as market players and reach out to the mass population within a short span of time. The tremendous impact of the rise of social network sites not just shifted the way businesses work, it also changed the manner consumers behave. The objective of this thesis is to investigate the influence of social identity, EWOM (Electronic word-of-mouth), perceived risks, trust and purchase intentions affe...

Worldwide trends in diabetes since 1980: A pooled analysis of 751 population-based studies with 4.4 million participants

OpenAIRE

Zhou, Bin; Lu, Yuan; Hajifathalian, Kaveh; Bentham, James; Di Cesare, Mariachiara; Danaei, Goodarz; Bixby, Honor; Cowan, Melanie J; Ali, Mohammed K; Taddei, Cristina; Lo, Wei-Cheng; Reis-Santos, Barbara; Stevens, Gretchen A.; Riley, Leanne M.; Miranda, J. Jaime

2016-01-01

Source: doi: 10.1016/S0140-6736(16)00618-8 Background:One of the global targets for non-communicable diseases is to halt, by 2025, the rise in the agestandardised adult prevalence of diabetes at its 2010 levels. We aimed to estimate worldwide trends in diabetes, how likely it is for countries to achieve the global target, and how changes in prevalence, together with population growth and ageing, are aff ecting the number of adults with diabetes. Methods:We pooled data from popu...

Rapid transfer of DNA from agarose gels to nylon membranes.

OpenAIRE

Reed, K C; Mann, D A

1985-01-01

The unique properties of nylon membranes allow for dramatic improvement in the capillary transfer of DNA restriction fragments from agarose gels (Southern blotting). By using 0.4 M NaOH as the transfer solvent following a short pre-treatment of the gel in acid, DNA is depurinated during transfer. Fragments of all sizes are eluted and retained quantitatively by the membrane; furthermore, the alkaline solvent induces covalent fixation of DNA to the membrane. The saving in time and materials aff...

Body weight has no impact on self-esteem of minority children living in inner city, low-income neighborhoods: a cross-sectional study

OpenAIRE

Wong, William W; Mikhail, Carmen; Ortiz, Christina L; Lathan, Debra; Moore, Louis A; Konzelmann, Karen L; Smith, E O’Brian

2014-01-01

Background The relationship between body weight and self-esteem among underserved minority children is not well documented. Methods We measured the self-esteem profile using the Self-Perception Profile for Children among 910 minority children at 17 Houston community centers. Results Weight status had no effect on any of the self-esteem scores among the minority children (P ≥ 0.21). Black children had higher scholastic competence than Hispanic children (P = 0.05). Social acceptance was not aff...

Level of radiation exposure to staff in X-ray diagnosis

International Nuclear Information System (INIS)

Zol'nikova, N.I.; Moisejtsev, P.I.; Trunov, B.V.

1976-01-01

In modern radiological service departments the dose rates at working placesof medical aff directly engaged in diagnostic work were found to range from 7 to 100 mR/h during fuoroscopand up to 1,200 mR/h during roentgenoscopy and ray inematography, respectively. Durig fluocopic work in the operating theatre the monthly doses to staff ranged from 100 to 380 mRfor sugeos and anaesthesists, from 110 to 225 mR for surgical nurses, and from5to 30 roranhesia nurses. AUTHOR)