WorldWideScience

Sample records for aff tuberosa caja-umbu

  1. Dicty_cDB: AFF490 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFF490 (Link to dictyBase) - - - Contig-U16512-1 AFF490P (Link to Original site) AFF4...90F 337 AFF490Z 728 AFF490P 1065 - - Show AFF490 Library AF (Link to library) Clone ID AFF4...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/AF/AFF4-D/AFF490Q.Seq.d/ Representative seq. ID AFF4...90P (Link to Original site) Representative DNA sequence >AFF490 (AFF490Q) /CSM/AF/AFF4-D/AFF4... Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value AFF490 (AFF490Q) /CSM/AF/AFF4-D/AFF4

  2. Dicty_cDB: AFF485 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFF485 (Link to dictyBase) - - - Contig-U16331-1 AFF485P (Link to Original site) AFF4...85F 591 AFF485Z 703 AFF485P 1294 - - Show AFF485 Library AF (Link to library) Clone ID AFF4...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/AF/AFF4-D/AFF485Q.Seq.d/ Representative seq. ID AFF4...85P (Link to Original site) Representative DNA sequence >AFF485 (AFF485Q) /CSM/AF/AFF4-D/AFF4...nificant alignments: (bits) Value AFF485 (AFF485Q) /CSM/AF/AFF4-D/AFF485Q.Seq.d/ 2405 0.0 VHD429 (VHD429Q) /

  3. Dicty_cDB: AFF405 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFF405 (Link to dictyBase) - - - Contig-U16540-1 AFF405P (Link to Original site) AFF4...05F 611 AFF405Z 652 AFF405P 1263 - - Show AFF405 Library AF (Link to library) Clone ID AFF4...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/AF/AFF4-A/AFF405Q.Seq.d/ Representative seq. ID AFF4...05P (Link to Original site) Representative DNA sequence >AFF405 (AFF405Q) /CSM/AF/AFF4-A/AFF4...-cDNA Score E Sequences producing significant alignments: (bits) Value AFF405 (AFF405Q) /CSM/AF/AFF4-A/AFF40

  4. Dicty_cDB: AFF111 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFF111 (Link to dictyBase) - - - Contig-U16495-1 AFF111P (Link to Original site) AFF1...11F 1054 AFF111Z 308 AFF111P 1352 - - Show AFF111 Library AF (Link to library) Clone ID AFF1...te URL http://dictycdb.biol.tsukuba.ac.jp/CSM/AF/AFF1-A/AFF111Q.Seq.d/ Representative seq. ID AFF1...11P (Link to Original site) Representative DNA sequence >AFF111 (AFF111Q) /CSM/AF/AFF1-A/AFF1...core E Sequences producing significant alignments: (bits) Value AFF111 (AFF111Q) /CSM/AF/AFF1-A/AFF111Q.Seq.

  5. Dicty_cDB: AFF103 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFF103 (Link to dictyBase) - - - Contig-U02481-1 AFF103P (Link to Original site) AFF1...03F 281 AFF103Z 667 AFF103P 948 - - Show AFF103 Library AF (Link to library) Clone ID AFF1... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/AF/AFF1-A/AFF103Q.Seq.d/ Representative seq. ID AFF1...03P (Link to Original site) Representative DNA sequence >AFF103 (AFF103Q) /CSM/AF/AFF1-A/AFF1...C*vkixlkkpfylxxe Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value AFF103 (AFF103Q) /CSM/AF/AFF1

  6. Dicty_cDB: AFF455 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFF455 (Link to dictyBase) - - - Contig-U16477-1 AFF455P (Link to Original site) AFF4...55F 910 AFF455Z 675 AFF455P 1575 - - Show AFF455 Library AF (Link to library) Clone ID AFF4...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/AF/AFF4-C/AFF455Q.Seq.d/ Representative seq. ID AFF4...55P (Link to Original site) Representative DNA sequence >AFF455 (AFF455Q) /CSM/AF/AFF4-C/AFF4...clamvcsnrketllsnifiirf* Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value AFF455 (AFF4

  7. Dicty_cDB: AFF459 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFF459 (Link to dictyBase) - - - Contig-U14926-1 AFF459F (Link to Original site) AFF4...59F 230 - - - - - - Show AFF459 Library AF (Link to library) Clone ID AFF459 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/AF/AFF4-C/AFF459Q.Seq.d/ Representative seq. ID AFF45...9F (Link to Original site) Representative DNA sequence >AFF459 (AFF459Q) /CSM/AF/AFF4-C/AFF459Q.Seq.d/ AAAAT... CSM-cDNA Score E Sequences producing significant alignments: (bits) Value AFF459 (AFF459Q) /CSM/AF/AFF4-C/AFF4

  8. Dicty_cDB: AFF494 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFF494 (Link to dictyBase) - - - Contig-U08743-1 AFF494P (Link to Original site) AFF4...94F 598 AFF494Z 684 AFF494P 1282 - - Show AFF494 Library AF (Link to library) Clone ID AFF4...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/AF/AFF4-D/AFF494Q.Seq.d/ Representative seq. ID AFF4...94P (Link to Original site) Representative DNA sequence >AFF494 (AFF494Q) /CSM/AF/AFF4-D/AFF4...***yyyyynyhynfnynyynqnskxk*n Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value AFF494 (AFF4

  9. Dicty_cDB: AFF150 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFF150 (Link to dictyBase) - - - Contig-U13825-1 AFF150Z (Link... to Original site) - - AFF150Z 689 - - - - Show AFF150 Library AF (Link to library) Clone ID AFF150 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/AF/AFF1-C/AFF150Q.Seq.d/ Representative seq. ID AFF15...0Z (Link to Original site) Representative DNA sequence >AFF150 (AFF150Q) /CSM/AF/AFF1-C/AFF150Q.Seq.d/ XXXXX...D7-A/VFD715Q.Seq.d/ 1366 0.0 VFC622 (VFC622Q) /CSM/VF/VFC6-A/VFC622Q.Seq.d/ 1366 0.0 AFF150 (AFF150Q) /CSM/AF/AFF1-C/AFF1

  10. Dicty_cDB: AFF125 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFF125 (Link to dictyBase) - - - Contig-U16011-1 AFF125P (Link to Original site) AFF1...25F 157 AFF125Z 620 AFF125P 777 - - Show AFF125 Library AF (Link to library) Clone ID AFF1... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/AF/AFF1-B/AFF125Q.Seq.d/ Representative seq. ID AFF1...25P (Link to Original site) Representative DNA sequence >AFF125 (AFF125Q) /CSM/AF/AFF1-B/AFF1...nifpxk*lnsnfiivyy Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value AFF125 (AFF1

  11. Dicty_cDB: AFF422 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFF422 (Link to dictyBase) - G01389 DDB0216131 Contig-U11158-1 AFF4...22P (Link to Original site) AFF422F 629 AFF422Z 737 AFF422P 1366 - - Show AFF422 Library AF (Link to library) Clone ID AFF4...Contig-U11158-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/AF/AFF4-A/AFF4...22Q.Seq.d/ Representative seq. ID AFF422P (Link to Original site) Representative DNA sequence >AFF422 (AFF422Q) /CSM/AF/AFF4...-A/AFF422Q.Seq.d/ ACATCCACACCAATCCCAAACACAATGATTTCAAATCATAATAAAATAAATAATATTGAT AATAATA

  12. Dicty_cDB: AFF412 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFF412 (Link to dictyBase) - - - Contig-U16294-1 AFF412P (Link to Original site) AFF4...12F 635 AFF412Z 699 AFF412P 1334 - - Show AFF412 Library AF (Link to library) Clone ID AFF4...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/AF/AFF4-A/AFF412Q.Seq.d/ Representative seq. ID AFF4...12P (Link to Original site) Representative DNA sequence >AFF412 (AFF412Q) /CSM/AF/AFF4-A/AFF4...rsrfkcswsk*ilrysicqeiiklcylfircsfqvx*inkpxf Homology vs CSM-cDNA Score E Sequences producing significant ali

  13. Dicty_cDB: AFF426 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFF426 (Link to dictyBase) - - - Contig-U16408-1 AFF426Z (Link... to Original site) - - AFF426Z 732 - - - - Show AFF426 Library AF (Link to library) Clone ID AFF426 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/AF/AFF4-B/AFF426Q.Seq.d/ Representative seq. ID AFF42...6Z (Link to Original site) Representative DNA sequence >AFF426 (AFF426Q) /CSM/AF/AFF4-B/AFF426Q.Seq.d/ XXXXX...ytoplasmic 12.0 %: mitochondrial 4.0 %: cytoskeletal 4.0 %: plasma membrane >> prediction for AFF426 is nuc

  14. Affärsutveckling enligt Drivhusets metod

    OpenAIRE

    Lindqvist, Daniel

    2015-01-01

    Examensarbetet handlar om att utveckla en affärsmodell för ett företag som jag kommer att grunda tillsammans med en affärspartner. Syftet med examensarbetet är att utveckla affärsidén och -modellen enligt Drivhusets metod, som bygger på den senaste forskningen inom affärsutveckling. Samtidigt undersöker jag också om det finns behov i Pargas av ett företag i energibranschen. För att kunna utnyttja modellen maximalt har jag bekantat mig med de bakomliggande teorierna, formade av uppskattade...

  15. Dicty_cDB: AFF437 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFF437 (Link to dictyBase) - - - Contig-U16255-1 AFF437Z (Link... to Original site) - - AFF437Z 516 - - - - Show AFF437 Library AF (Link to library) Clone ID AFF437 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/AF/AFF4-B/AFF437Q.Seq.d/ Representative seq. ID AFF43...7Z (Link to Original site) Representative DNA sequence >AFF437 (AFF437Q) /CSM/AF/AFF4-B/AFF437Q.Seq.d/ XXXXX...267_7( AC117267 |pid:none) Dictyostelium discoideum chromosom... 44 0.003 T22274( T22274 )hypothetical protein F4

  16. Dicty_cDB: AFF287 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFF287 (Link to dictyBase) - - - Contig-U16368-1 AFF287P (Link... to Original site) AFF287F 527 AFF287Z 689 AFF287P 1216 - - Show AFF287 Library AF (Link to library) Clone ID AFF287 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16368-1 Original site URL http://dict...CRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPP QICGSVNCGPGYICTIINGHPTCIRGDGYLCNQTRCPHDYQCETIS...KHPVCVRNHVPPHPPPPP QICGSVNCGPGYICTIINGHPTCIRGDGYLCNQTRCPHDYQCETISTNIVKCSPK--- ---vhqrmtnvngivvhqvpaasivetvht

  17. Analysis list: Aff3 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Aff3 Embryonic fibroblast,Pluripotent stem cell + mm9 http://dbarchive.biosciencedb...c.jp/kyushu-u/mm9/target/Aff3.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Aff3.5.tsv http://...dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Aff3.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Aff...3.Embryonic_fibroblast.tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Aff

  18. Esclerosis Tuberosa. Revisión

    OpenAIRE

    Otman Fernández Concepción; Ariel Gómez García; Norberto Sardiñaz Hernández

    1999-01-01

    Se realiza una revisión actualizada sobre las peculiaridades clínicas, radiológicas y neuropatológicas de la esclerosis tuberosa, la más representativa de las enfermedades neurocutáneas que evolucionan con manchas hipocrómicas y segunda en frecuencia de las facomatosis. Las manchas hipocrómicas asociadas con espasmos infantiles o cardiomegalia en lactantes y la evidencia de crisis epilépticas y angiofibromas faciales en la infancia tardía, constituyen las formas habituales de presentación de ...

  19. Original Communications - Iridoid Glucosides from Turkish Phlomis tuberosa

    DEFF Research Database (Denmark)

    Calis, Ihsan; Kirmizibekmez, Hasan; Ersoz, Tayfun

    2005-01-01

    From the aerial parts of Phlomis tuberosa a new iridoid glucoside, chlorotuberoside was isolated together with five known iridoid glucosides, lamalbide, shanzhiside methyl ester, 7-epi-phlomiol (= phloyoside I), sesamoside and 5-deoxysesamoside. Two known phenylethanoid glycosides, forsythoside B...

  20. Rcdisterona de Pfaffia tuberosa (Spreng. Hicken Ecdysterone from Pfaffia tuberosa (Spreng. Hicken

    Directory of Open Access Journals (Sweden)

    Nobushigue Nishimoto

    1986-12-01

    Full Text Available As raízes secas da espécie brasileira Pfaffia tuberosa (Spreng. Hicken foram submetidas a extração com metanol. Deste extrato metanólico foram isolados a ecdisterona e o ácido oleanólico, através de processos de separação por HPLC e cromatografia em coluna. Tanto a ecdisterona como o ácido oleanólico foram identificados comparativamenve com os respec­tivos padrões. Análise quantitativa por HPLC mostrou 0,23% de ecdisterona. Este teor foi corsiderado baixo em relação a outra espécie, também brasileira, a Pfaffia iresinoides.In this paper, we wish to report the isolation and identification of ecdysterone from Pfaffia tuberosa (Spreng. Hicken. The roots of Pfaffia tuberosa (Spreng. Hicken were colected in the Mato Grosso State - Brazil. The dried and sliced roots (197g were extracted with hot MeOH. A suspension of the resulting MeOH extract in the water was treated with n-BuOH. The n-BuOH layer was concentrated in vacuo to give a brown viscous oil (5g, wich was chromatographed on silicagel (65g using CHCl3 - MeOH - H2O (80:20:10 lower phase, and 15ml fractions were collected. Fractions 11-13 were concentrated and the residual solid was recrystallized from EtOH to afford oleanolic acid (65mg. The crystalline residue obtained from fractions 44-56 was recrystallized from EtOAC-MeOH to give ecdysterone (87mg. Each compound was identified by direct comparison with an authentic sample. Further HPLC quantitative analysis showed lower content of ecdysterone (0,23% compared with that of Pfaffia iresinoides Spreng.

  1. Esclerosis tuberosa: evaluación de las lesiones intracraneanas

    Directory of Open Access Journals (Sweden)

    J. Docampo

    2013-01-01

    El presente artículo tiene como propósito mencionar, describir y dar ejemplos de los hallazgos intracraneanos característicos de la esclerosis tuberosa, utilizando imágenes provenientes de nuestra casuística.

  2. Esclerosis Tuberosa. Revisión

    Directory of Open Access Journals (Sweden)

    Otman Fernández Concepción

    1999-09-01

    Full Text Available Se realiza una revisión actualizada sobre las peculiaridades clínicas, radiológicas y neuropatológicas de la esclerosis tuberosa, la más representativa de las enfermedades neurocutáneas que evolucionan con manchas hipocrómicas y segunda en frecuencia de las facomatosis. Las manchas hipocrómicas asociadas con espasmos infantiles o cardiomegalia en lactantes y la evidencia de crisis epilépticas y angiofibromas faciales en la infancia tardía, constituyen las formas habituales de presentación de le enfermedad, aunque no es raro observar formas paucisintomáticas en la adultez. Los nódulos subependimarios, las tuberosidades corticales y los astrocitomas de células gigantes son las manifestaciones neuropatológicas características de este proceso, identificables radiológicamente mediante tomografía axial computadorizada y resonancia magnética nuclear craneales. El diagnóstico precoz permite brindar consejo genético a los padres; y la evaluación periódica de los casos, la identificación temprana de posibles complicaciones.An updated review on the clinical, radiological and neuropathological pecularities of tuberous sclerosis is made. This is the most representative of the neurocutaneous diseases that evolve with hypochromic stains and is the second in frequency of pharcomatosis. The hypochromic stains associated with infantile spasms or cardiomegaly in infants and the evidence of epileptic seizures and facial angiofibromas in late childhood are the habitual forms of presentation of this disease, although it is not rare to observe oligosymptomatic forms in adults. The subepindemal nodules, the cortical tuberosities and the astrocytomas of giant cells are the characteristic neuropathological manifestations of this process that may be radiologically identified by CAT and cranial magnetic resonance imaging. The early diagnosis allows to give genetic counseling to parents, to periodically evaluate the cases, and to identify the

  3. Nootropic activity of tuber extract of Pueraria tuberosa (Roxb).

    Science.gov (United States)

    Rao, N Venkata; Pujar, Basavaraj; Nimbal, S K; Shantakumar, S M; Satyanarayana, S

    2008-08-01

    Nootropic effect of alcoholic (ALE; 50, 75, 100 mg/kg) and aqueous (AQE; 100, 200, 400 mg/kg) extracts of P. tuberosa was evaluated by using Elevated Plus Maze (EPM), scopolamine-induced amnesia (SIA), diazepam-induced amnesia (DIA), clonidine-induced (NA-mediated) hypothermia (CIH), lithium-induced (5-HT mediated) head twitches (LIH) and haloperidol-induced (DA- mediated) catalepsy (HIC) models. Piracetam was used as the standard drug. A significant increase in inflexion ratio (IR) was recorded in EPM, SIA and DIA models. A significant reversal effect was observed on rectal temperature in CIH model, reduction of head twitches in LIH models. However no significant reduction in catalepsy scores in HIC models were observed with test extracts and standard piracetam. The results indicate that nootropic activity observed with ALE and AQE of tuber extracts of P. tuberosa could be through improved learning and memory either by augmenting the noradrenaline (NA) transmission or by interfering with 5-hydroxytryptamine (5-HT) release. Further, the extracts neither facilitated nor blocked release of the dopamine (DA). Thus ALE and AQE elicited significant nootropic effect in mice and rats by interacting with cholinergic, GABAnergic, adrenergic and serotonergic systems. Phytoconstituents like flavonoids have been reported for their nootropic effect and these are present in both ALE and AQE extracts of tubers of P. tuberosa (Roxb) and these active principles may be responsible for nootropic activity.

  4. Dicty_cDB: AFF590 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available c*nrl Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value AFF590 (AFF590Q)...ore E Sequences producing significant alignments: (bits) Value N BQ074732 |BQ074732.1 fz25c01.x1 Gong zebraf...ducing significant alignments: (bits) Value (Q54SZ8) RecName: Full=Putative phosphatidylglycerol/phosphatidy

  5. Esclerosis tuberosa y manifestaciones orales. Caso clínico

    OpenAIRE

    López López, José, 1958-; Rodríguez de Rivera Campillo, Ma Eugenia; Marques Soares, Maria Sueli; Finestres Zubeldia, Fernando; Chimenos Küstner, Eduardo; Roselló Llabrés, Xavier

    2004-01-01

    La esclerosis tuberosa (ET) es una anomalía congénita del desarrollo embrionario que se transmite de forma autosómica dominante y tiene diferentes formas de expresión clínica. Se clasifica dentro de las denominadas facomatosis (phakos "mancha" y oma "tumor"), que son anomalías del desarrollo, susceptibles de originar tumores y/o hamartomas del sistema nervioso. Es importante destacar que las lesiones del sistema nervioso se acompañan, prácticamente siempre, de anomalías cutáneas. En este trab...

  6. Esclerosis tuberosa y manifestaciones orales: caso clínico

    OpenAIRE

    López López, José, 1958-; Rodríguez de Rivera Campillo, M.E.; Marques Soares, Maria Sueli; Finestres, Fernando; Chimenos Küstner, Eduardo

    2004-01-01

    La esclerosis tuberosa (ET) es una anomalía congénita del desarrollo embrionario que se transmite de forma autosómica dominante y tiene diferentes formas de expresión clínica. Se clasifica dentro de las denominadas facomatosis (phakos 'mancha' y oma 'tumor'), que son anomalías del desarrollo, susceptibles de originar tumores y/o hamartomas del sistema nervioso. Es importante destacar que las lesiones del sistema nervioso se acompañan, prácticamente siempre, de anomalías c...

  7. Esclerosis tuberosa y manifestaciones orales. Caso clínico

    OpenAIRE

    López López, José; Rodríguez de Rivera Campillo, Ma Eugenia; Marques Soares, Maria Sueli; Finestres Zubeldia, Fernando; Chimenos Küstner, Eduardo; Roselló Llabrés, Xavier

    2004-01-01

    La esclerosis tuberosa (ET) es una anomalía congénita del desarrollo embrionario que se transmite de forma autosómica dominante y tiene diferentes formas de expresión clínica. Se clasifica dentro de las denominadas facomatosis (phakos "mancha" y oma "tumor"), que son anomalías del desarrollo, susceptibles de originar tumores y/o hamartomas del sistema nervioso. Es importante destacar que las lesiones del sistema nervioso se acompañan, prácticamente siempre, de anomalías cutáneas. En este trab...

  8. File list: Oth.EmF.10.Aff3.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.EmF.10.Aff3.AllCell mm9 TFs and others Aff3 Embryonic fibroblast SRX823731,SRX8...23732 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.EmF.10.Aff3.AllCell.bed ...

  9. File list: Oth.ALL.50.Aff3.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.50.Aff3.AllCell mm9 TFs and others Aff3 All cell types SRX823726,SRX823724,...SRX823725,SRX823730,SRX823723,SRX823728,SRX823729,SRX823727,SRX823731,SRX823732 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.ALL.50.Aff3.AllCell.bed ...

  10. File list: Oth.PSC.05.Aff3.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.PSC.05.Aff3.AllCell mm9 TFs and others Aff3 Pluripotent stem cell SRX823725,SRX...823724,SRX823726,SRX823723,SRX823730,SRX823728,SRX823727,SRX823729 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.PSC.05.Aff3.AllCell.bed ...

  11. File list: Oth.EmF.20.Aff3.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.EmF.20.Aff3.AllCell mm9 TFs and others Aff3 Embryonic fibroblast SRX823731,SRX8...23732 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.EmF.20.Aff3.AllCell.bed ...

  12. File list: Oth.PSC.20.Aff3.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.PSC.20.Aff3.AllCell mm9 TFs and others Aff3 Pluripotent stem cell SRX823726,SRX...823724,SRX823725,SRX823730,SRX823723,SRX823728,SRX823729,SRX823727 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.PSC.20.Aff3.AllCell.bed ...

  13. Iridoid Glucosides from Phlomis tuberosa L. and Phlomis herba-ventis L

    DEFF Research Database (Denmark)

    Alipieva, Kalina A.; Jensen, Søren Rosendal; Franzyk, Henrik

    2000-01-01

    A new iridoid glucoside, 5-deoxysesamoside, was isolated from Phlomis tuberosa together with three known iridoid glucosides sesamoside, shanzhiside methyl ester and lamalbid. Lamiide was found in Ph. herba-ventis ssp. pungens. in high concentrations....

  14. Spondias tuberosa Arruda (Anacardiaceae), a threatened tree of the Brazilian Caatinga?

    Science.gov (United States)

    Mertens, J; Germer, J; Siqueira, J A; Sauerborn, J

    2016-10-24

    Spondias tuberosa Arr., a fructiferous tree endemic to the northeast Brazilian tropical dry forest called Caatinga, accounts for numerous benefits for its ecosystem as well as for the dwellers of the Caatinga. The tree serves as feed for pollinators and dispersers as well as fodder for domestic ruminants, and is a source of additional income for local smallholders and their families. Despite its vantages, it is facing several man-made and natural threats, and it is suspected that S. tuberosa could become extinct. Literature review suggests that S. tuberosa suffers a reduced regeneration leading to population decrease. At this juncture S. tuberosa cannot be considered threatened according to the International Union for Conservation of Nature Red List Categories and Criteria, as it has not yet been assessed and hampered generative regeneration is not considered in the IUCN assessment. The combination of threats, however, may have already caused an extinction debt for S. tuberosa. Due to the observed decline in tree density, a thorough assessment of the S. tuberosa population is recommended, as well as a threat assessment throughout the entire Caatinga.

  15. Spondias tuberosa Arruda (Anacardiaceae, a threatened tree of the Brazilian Caatinga?

    Directory of Open Access Journals (Sweden)

    J. Mertens

    Full Text Available Abstract Spondias tuberosa Arr., a fructiferous tree endemic to the northeast Brazilian tropical dry forest called Caatinga, accounts for numerous benefits for its ecosystem as well as for the dwellers of the Caatinga. The tree serves as feed for pollinators and dispersers as well as fodder for domestic ruminants, and is a source of additional income for local smallholders and their families. Despite its vantages, it is facing several man-made and natural threats, and it is suspected that S. tuberosa could become extinct. Literature review suggests that S. tuberosa suffers a reduced regeneration leading to population decrease. At this juncture S. tuberosa cannot be considered threatened according to the International Union for Conservation of Nature Red List Categories and Criteria, as it has not yet been assessed and hampered generative regeneration is not considered in the IUCN assessment. The combination of threats, however, may have already caused an extinction debt for S. tuberosa. Due to the observed decline in tree density, a thorough assessment of the S. tuberosa population is recommended, as well as a threat assessment throughout the entire Caatinga.

  16. Chemical composition of umbu (Spondias tuberosa Arr. Cam seeds

    Directory of Open Access Journals (Sweden)

    Soraia Vilela Borges

    2007-02-01

    Full Text Available The umbu tree (Spondias tuberosa Arr. Cam is an important fruit tree the economy of the semi-arid northeastern region of Brazil. With the objective of finding use for the seeds, physical and chemical characterizations of the seeds from 2 cultivars in 2 maturation stages were carried out and their fatty acid and mineral profiles determined. The results showed no differences between the seeds analyzed. The yield was about 10% and the dimensions as follows: length from 1.48 to 2.11 cm and width from 0.76 to 1.16 cm. The average lipid content was 55% of which 69% was unsaturated and the average protein content was 24%. The seeds were a good source of the following minerals: P, K, Mg, Fe and Cu. The overall results indicated that the oil or the seeds could be used for food stuffs if no toxic agents were found.

  17. SUPPLEMENTAL IRRIGATION THE IMBU TREE (Spondias tuberosa Arruda

    Directory of Open Access Journals (Sweden)

    Nilton de Brito Cavalcanti

    2011-07-01

    Full Text Available The imbu (Spondias tuberosa Arruda is a native tree of the semi-arid region of the Brazilian Northeast, whose fruit is of great importance for complementing the family income of small farmers. However, its reproductive cycle is still not very well known, especially a function to irrigation supplemental. This work was carried out to help follow the evolution of the reproductive cycle of the imbu, from the emission of the beginning of the floral bud to the ripening of the depending on the application of irrigation. This work was carried the Caatinga Experimental Station, Semiarid Embrapa of 8 plants. In each plant, 100 branches were randomly chosen from different parts of the crown and labelled for phenological data annotation. In the data obtained were determined averages standard deviations and coefficients of variation. The application of supplemental irrigation in imbuzeiro plants can significantly contribute to increase in fruit production.

  18. HPTLC Fingerprint Profile and Isolation of Marker Compound of Ruellia tuberosa

    Directory of Open Access Journals (Sweden)

    Daya L. Chothani

    2012-01-01

    Full Text Available The present study was aimed to identification, isolation, and quantification of marker in R. tuberosa (Acanthaceae. HPTLC fingerprinting was carried out for various extract of root, stem, and leaf of R. tuberosa. From the HPTLC fingerprint the florescent band (under 366 nm at : 0.56 (mobile phase chloroform : toluene : ethyl acetate (6 : 3 : 1, v/v was found in leaf, root, and stem of R. tuberosa. So, the florescent band (under 366 nm at : 0.56 was isolated as marker compound RT-F2 from root of R. tuberosa. The marker compound RT-F2 was quantified by using HPTLC technique. The percentage (W/W amount of RT-F2 was found to 40.0% and 44.6% in petroleum ether and ethyl acetate extract of R. tuberosa roots, respectively. Further study is suggested to characterization and biological nature of marker compound.

  19. FCJ-150 AffeXity: Performing Affect with Augmented Reality

    Directory of Open Access Journals (Sweden)

    Susan Kozel

    2012-01-01

    Full Text Available This discussion of affect and performance is based on early research for an artistic project called AffeXity exploring the use of augmented reality to embed affective choreographies in urban spaces. Affect is understood in terms of intensities and contingency, while performance is defined as a triangulation of bodily movement, emergence and shimmering. After a brief reflection on how technical development and artistic processes impact each other, the middle section of this article contains ‘an inventory of shimmers’ which are words from the processes of dance improvisation, video capture and editing. A methodological perspective is proposed. It is called affective sensibility.

  20. Potential antifungal activity of Cladonia aff. rappii A. Evans

    Directory of Open Access Journals (Sweden)

    Claudia M. Plaza

    2017-10-01

    Full Text Available Context: Lichen is a self-supporting symbiotic organism composed of a fungus and an algal partner. They have manifold biological activities like antiviral, antibiotic, antioxidant, antitumor, allergenic and inhibition of plant growth. Species of Cladonia, have been studied by its antifungal activity. Aims: To evaluate the antifungal activity determination of Cladonia aff. rappii against five yeasts, four of genus Candida and one Cryptococcus, using water, ethanol and dichloromethane extracts. Methods: The evaluation of the antifungal activity was developed by three diffusion methods such as spot-on-a-lawn, disc diffusion and well diffusion. Additionally, the values of minimal inhibitory concentration (MIC and the minimum fungicidal concentration (MFC were determined. Results: Based on the experimental results obtained, the best antifungal activity was using ethanol extract at 20 mg/mL against Candida albicans, applying the three diffusion methods above mentioned. With ethanol extract, the lower MIC was against Candida glabrata and the lower MFC were with Candida glabrata, C. krusei, C. parapsilosis and C. tropicalis. The dichloromethane extract presented the lowest MIC and MFC against C. neoformans. Not activity was observed with aqueous extract. Conclusions: The present study revealed antifungal and fungicidal activity in the extract of lichen Cladonia aff. rappii.

  1. Metabolic adjustments in Satanoperca aff. jurupari (Perciformes: Cichlidae

    Directory of Open Access Journals (Sweden)

    Chippari-Gomes Adriana R.

    2003-01-01

    Full Text Available In this paper, we describe the enzyme levels and isozyme distribution in skeletal and heart muscle of Satanoperca aff. jurupari, (Cichlidae, subgroup Geophaginae. LDH and CS were measured in skeletal and heart muscle. Starch gel electrophoresis was used to determine the isozyme/allozyme patterns in different tissues; LDH, MDHs, PGM, PGI, ADH, G-6-PDH and SOD were screened for the numbers of loci, presence of alleles, and tissue specificity. The LDH/CS ratio in heart and skeletal muscle were 173.36 and 6.1, respectively, indicating anaerobic metabolism in the former and aerobic metabolism in the latter muscle. No inhibition by pyruvate (based on the ratios of LDH activity with 1 mM and 10 mM pyruvate was detected in heart and skeletal muscle, indicating the presence of physiological plasticity in heart muscle. The heart can cope with anaerobic metabolism for short periods of hypoxia such as occurs in nature. Isozyme patterns for most of the enzymes analyzed were similar to the general patterns for advanced teleosts. S. aff. jurupari had no reduced LDH-B* expression in heart muscle, but the, MDHs-B* locus was duplicated, as reported for most Amazon cichlids species. Only three out of the 13 loci analyzed (PGM, PGI and SOD were variable. These results are consistent with the metabolic profile and life style of the most cichlids. A low genetic variability may be a counterpart for plasticity, and may be guaranteed by the regulation of invariable structural genes.

  2. Who helps whom? Pollination strategy of Iris tuberosa and its relationship with a sexually deceptive orchid.

    Science.gov (United States)

    Pellegrino, Giuseppe; Bellusci, Francesca; Palermo, Anna Maria

    2016-11-01

    Reproductive success of plants may be affected by interactions with co-flowering species either negatively, through competition for pollinators, or positively, by means of a magnet species effect and floral mimicry. In this study, potential interactions between Iris tuberosa, a rewarding species, and Ophrys fusca, a sexually deceptive orchid, were explored in four populations in southern Italy. In each population plots showing different ratios of the examined species were arranged in the field, and in each plot the number of pollinators and fruit set were assessed. In addition, flower size and floral hydrocarbons produced by the two species were analysed. Morphological and scent data pointed out that flower size and aliphatic compounds did not differ significantly between the two species. Interestingly, both species shared tricosane and 11-nonacosene, electrophysiologically active compounds in the shared dominant pollinator Adrena. We have found that fruit production and number of pollinators in I. tuberosa varied significantly among plots, while percentage of capsules and number of pollinators of O. fusca captured showed no significant differences across plots. These results suggested, that the presence of O. fusca contributes differentially to pollinator attraction, and thus, to total reproductive success of I. tuberosa, according to a different ratio of aggregation. These findings suggest that I. tuberosa profits from the greater abundance of insects attracted by the presence of orchid specimens, and that a sexually deceptive orchid may be a magnet species in pollination strategy.

  3. Excess variants in AFF2 detected by massively parallel sequencing of males with autism spectrum disorder.

    Science.gov (United States)

    Mondal, Kajari; Ramachandran, Dhanya; Patel, Viren C; Hagen, Katie R; Bose, Promita; Cutler, David J; Zwick, Michael E

    2012-10-01

    Autism spectrum disorder (ASD) is a heterogeneous disorder with substantial heritability, most of which is unexplained. ASD has a population prevalence of one percent and affects four times as many males as females. Patients with fragile X E (FRAXE) intellectual disability, which is caused by a silencing of the X-linked gene AFF2, display a number of ASD-like phenotypes. Duplications and deletions at the AFF2 locus have also been reported in cases with moderate intellectual disability and ASD. We hypothesized that other rare X-linked sequence variants at the AFF2 locus might contribute to ASD. We sequenced the AFF2 genomic region in 202 male ASD probands and found that 2.5% of males sequenced had missense mutations at highly conserved evolutionary sites. When compared with the frequency of missense mutations in 5545 X chromosomes from unaffected controls, we saw a statistically significant enrichment in patients with ASD (OR: 4.9; P < 0.014). In addition, we identified rare AFF2 3' UTR variants at conserved sites which alter gene expression in a luciferase assay. These data suggest that rare variation in AFF2 may be a previously unrecognized ASD susceptibility locus and may help explain some of the male excess of ASD.

  4. Embryogenesis in Polianthes tuberosa L var. Simple: from megasporogenesis to early embryo development

    OpenAIRE

    González-Gutiérrez, Alejandra G; Rodríguez-Garay, Benjamín

    2016-01-01

    The genus Polianthes belongs to the subfamily Agavoideae of the Asparagaceae family formerly known as Agavaceae. The genus is endemic to México and comprises about 15 species, among them is Polianthes tuberosa L. The aim of this work was to study and characterize the embryo sac and early embryo development of this species in order to generate basic knowledge for its use in taxonomy, in vitro fertilization and production of haploid plants and to complement studies already performed in other ge...

  5. Spondias tuberosa Arruda (Anacardiaceae), a threatened tree of the Brazilian Caatinga?

    OpenAIRE

    Mertens, J; Germer,J.; Siqueira Filho,J. A.; J. Sauerborn

    2016-01-01

    Abstract Spondias tuberosa Arr., a fructiferous tree endemic to the northeast Brazilian tropical dry forest called Caatinga, accounts for numerous benefits for its ecosystem as well as for the dwellers of the Caatinga. The tree serves as feed for pollinators and dispersers as well as fodder for domestic ruminants, and is a source of additional income for local smallholders and their families. Despite its vantages, it is facing several man-made and natural threats, and it is suspected that S. ...

  6. Embryogenesis in Polianthes tuberosa L var. Simple: from megasporogenesis to early embryo development.

    Science.gov (United States)

    González-Gutiérrez, Alejandra G; Rodríguez-Garay, Benjamín

    2016-01-01

    The genus Polianthes belongs to the subfamily Agavoideae of the Asparagaceae family formerly known as Agavaceae. The genus is endemic to México and comprises about 15 species, among them is Polianthes tuberosa L. The aim of this work was to study and characterize the embryo sac and early embryo development of this species in order to generate basic knowledge for its use in taxonomy, in vitro fertilization and production of haploid plants and to complement studies already performed in other genera and species belonging to the Agavoideae sub-family. It was found that the normal development of the P. tuberosa var. Simple embryo sac follows a monosporic pattern of the Polygonum type and starts its development from the chalazal megaspore. At maturity, the embryo sac is of a pyriform shape with a chalazal haustorial tube where the antipodals are located, just below the hypostase, which connects the embryo sac with the nucellar tissue of the ovule. The central cell nucleus shows a high polarity, being located at the chalazal extreme of the embryo sac. The position of cells inside the P. tuberosa embryo sac may be useful for in depth studies about the double fertilization. Furthermore, it was possible to make a chronological description of the events that happen from fertilization and early embryo development to the initial development of the endosperm which was classified as of the helobial type.

  7. Physical Stability and HPLC Analysis of Indian Kudzu (Pueraria tuberosa Linn. Fortified Milk

    Directory of Open Access Journals (Sweden)

    Subha Rastogi

    2013-01-01

    Full Text Available Functional foods provide health benefit beyond basic nutrition. Functional foods fortified with plant ingredients are well known. Ayurveda (Indian System of Medicine has found several ways in which the medicinal benefits of herbs can be conveyed via certain foods as carriers. Milk is one such carrier which has been effectively used to deliver phytochemicals for targeted health benefits. Indian Kudzu or Pueraria tuberosa Linn. (Fabaceae is an important medicinal plant of Ayurveda, and experiments suggest that it enhances the health benefits of milk when taken with milk as a carrier. Different milk combinations with P. tuberosa were prepared by homogenizing pasteurized toned milk with its ethanolic and hot water extracts and their stability with reference to pH and coagulation was studied over a period of 15 days. The combinations were also analyzed for puerarin, the major isoflavone C-glucoside present in P. tuberosa, through high-performance liquid chromatography using photo diode array detector. It was observed that there was no precipitate formation and the pH also did not change during the study period indicating their physical stability under the experimental conditions. Also there was no significant change in the content of puerarin during the study period, thereby indicating the chemical stability of the samples. These studies will be useful for developing milk nutraceuticals fortified with Indian Kudzu which has the potential to be included as an ingredient in health and functional foods.

  8. Physical Stability and HPLC Analysis of Indian Kudzu (Pueraria tuberosa Linn.) Fortified Milk.

    Science.gov (United States)

    Rastogi, Subha; Katara, Antariksha; Pandey, Madan M; Arora, Sumit; Singh, R R B; Rawat, A K S

    2013-01-01

    Functional foods provide health benefit beyond basic nutrition. Functional foods fortified with plant ingredients are well known. Ayurveda (Indian System of Medicine) has found several ways in which the medicinal benefits of herbs can be conveyed via certain foods as carriers. Milk is one such carrier which has been effectively used to deliver phytochemicals for targeted health benefits. Indian Kudzu or Pueraria tuberosa Linn. (Fabaceae) is an important medicinal plant of Ayurveda, and experiments suggest that it enhances the health benefits of milk when taken with milk as a carrier. Different milk combinations with P. tuberosa were prepared by homogenizing pasteurized toned milk with its ethanolic and hot water extracts and their stability with reference to pH and coagulation was studied over a period of 15 days. The combinations were also analyzed for puerarin, the major isoflavone C-glucoside present in P. tuberosa, through high-performance liquid chromatography using photo diode array detector. It was observed that there was no precipitate formation and the pH also did not change during the study period indicating their physical stability under the experimental conditions. Also there was no significant change in the content of puerarin during the study period, thereby indicating the chemical stability of the samples. These studies will be useful for developing milk nutraceuticals fortified with Indian Kudzu which has the potential to be included as an ingredient in health and functional foods.

  9. Pharmacognostical studies on tubers of Momordica tuberosa Cogn., Cucurbitaceae Estudos farmacognósticos de tubérculos de Momordica tuberosa Cogn., Cucurbitaceae

    Directory of Open Access Journals (Sweden)

    Pramod Kumar

    2010-03-01

    Full Text Available The study was aimed at establishing pharmacognostical profile for the tubers of plant Momordica tuberosa Cogn., Cucurbitaceae. Morphoanatomy of tubers of this plant were studied in order to establish its complete profile to aid in its identification and avoid confusion in its taxanomic species. These were established using light microscopy, WHO recommended physicochemical and phytochemical procedures. The parameters presented here may be used to establish the authenticity of tubers of this plant as this part has been used traditionally in India and also to differentiate between closely related Momordica species.Este trababalho teve como objetivo estabelecer um perfil farmacognóstico dos tuvérculos da planta Momordica tuberosa Cogn., Cucurbitaceae. A morfoanatomia dos tubérculos da espécie foi realizada para estabelecer um perfil completo que possa ajudar na identificação e evitar problemas na sua taxonomia. Os ensaios foram realizados usando microscópio ótico, procedimentos fisico-químicos e fitoquímicos estabelecidos pela OMS. Os parâmetros apresentados podem ser usados para apresetar a autenticidade dos tubérculos desta espécie, uma vez que esta parte da droga é utilizada tradicionalmente na Índia e, também, para diferenciá-la de outras espécies de Momordica.

  10. Structural basis for ELL2 and AFF4 activation of HIV-1 proviral transcription.

    Science.gov (United States)

    Qi, Shiqian; Li, Zichong; Schulze-Gahmen, Ursula; Stjepanovic, Goran; Zhou, Qiang; Hurley, James H

    2017-01-30

    The intrinsically disordered scaffold proteins AFF1/4 and the transcription elongation factors ELL1/2 are core components of the super elongation complex required for HIV-1 proviral transcription. Here we report the 2.0-Å resolution crystal structure of the human ELL2 C-terminal domain bound to its 50-residue binding site on AFF4, the ELLBow. The ELL2 domain has the same arch-shaped fold as the tight junction protein occludin. The ELLBow consists of an N-terminal helix followed by an extended hairpin that we refer to as the elbow joint, and occupies most of the concave surface of ELL2. This surface is important for the ability of ELL2 to promote HIV-1 Tat-mediated proviral transcription. The AFF4-ELL2 interface is imperfectly packed, leaving a cavity suggestive of a potential binding site for transcription-promoting small molecules.

  11. Auto-ecology of Guadua aff. paraguayana (Poaceae Autoecologia de Guadua aff. paraguayana Döll (Poaceae

    Directory of Open Access Journals (Sweden)

    Franklin Galvão

    2010-02-01

    Full Text Available

    Bamboos are agents of natural remediation, but its outbreak in an already established landscape may
    have an intense repercussion, completely changing the flora of the area. A study to determine the effects of the presence of Guadua aff. paraguayana Döll  (Poaceae found in the last remnants of the riparian forest in the areas of permanent preservation of the Wildlife Refuge of Rio Tibagi - a conservation unit in process of stablishment on the Parana’s second plateau, has been developed. This aggressive and opportunistic woody species develops vigorous tussocks in consequence of its pachymorph rhizome system a form of “short neck”; and gets established only on the higher portions of the degraded flood plain. The tussocks have an average size of 2.79 meters, with 11 stems/ m². The shooting season lasts, on average, four months and occurs between spring and summer. The culms have an average length of 13 m, with an increment of 18 cm/day during the stretch period. The average diameter at breast height is 4.25 cm. The tussocks are formed from only one stem that expands from extremely robust sprouts. When it shoots up over the canopy and receives direct sunlight, it forms a kind of braided branches and leaves capable of hardly increase the shade levels and suppress the established vegetation, changing the local succession patterns.

    doi: 10.4336/2009.pfb.58.05

    Bambus são agentes de remediação natural, mas sua irrupção numa paisagem já estabelecida pode ter repercussão intensa, alterando completamente a florística da área. Para estabelecer os efeitos da presença de Guadua affparaguayana Döll (Poaceae – um dos pouco conhecidos bambus maciços do planeta – sobre os últimos remanescentes da Floresta Ombrófila Mista Aluvial, nas áreas de preservação permanente do Refúgio de Vida Silvestre do Rio Tibagi, unidade de conservação em processo de criação no Segundo Planalto Paranaense, est

  12. Ocurrencia simultánea de neurofibromatosis y esclerosis tuberosa, adquiridas como neomutaciones

    OpenAIRE

    Janeiro, P; Cunha, M.; Cordeiro, I; Santos, H.; Antunes, N

    2008-01-01

    Introducción. La neurofibromatosis tipo 1 y la esclerosis tuberosa son dos síndromes neurocutáneos distintos, resultado de la mutación de genes supresores tumorales, que aumentan la propensión a la génesis tumoral. Ambas tienen una herencia autosómica dominante y la mitad de los casos corresponden a nuevas mutaciones. Estas enfermedades raramente se presentan asociadas. Caso clínico. Niño sin antecedentes familiares de enfermedades neurocutáneas, que presenta características de neurofibrom...

  13. Growth evaluation of spondias tuberosa rootsctocks in the substrate fertilization with nitrogen and boron.

    Directory of Open Access Journals (Sweden)

    Cleiton José de Oliveira

    2009-08-01

    Full Text Available The main goal of this works was evaluate the effect of nitrogen and boron doses, in the rootstocks ‘umbu’ (Spondias tuberosa Arruda Câmara. The experiment it was led at CCA/UFPB-Campus II, located in the Areia city, state of Paraiba in Brazil. The treatments were five levels of nitrogen (0 to 4,50 g dm-3 as ureia (45% N, and five boron doses (0 to 3,0 mg dm-3, as borax (11% B, applied in the subtract constituted by the mixture of 75% of soil and 25% of manure bovine, in the randomized blocks design, with four repetitions. The experimental unit was constituted of three recipient containing three seedlings. It was evaluated height and the diameter of the stem of the seedlings, besides the mass of the matter evaporates and the areas of the root system and aerial part. The increase of the levels of nitrogen resulted in smaller growth of the seedlings. The application of 3 mg dm-3 of the boron provided the largest growth of the aerial parts and root.Key-words: Spondias tuberosa, mixture, fertilization

  14. Preliminary Study on Immunomodulatory Effect of Sarang-Semut Tubers Myrmecodia tuberosa and Myrmecodia pendens

    Directory of Open Access Journals (Sweden)

    Triana Hertiani

    2010-01-01

    Full Text Available Problem Statement: Sarang-Semut tubers, Myrmecodia tuberosa and M. pendens (Rubiaceae are both medicinal plants originating from Papua which have broad range of therapeutic values including those to improve vitality. Nevertheless, no scientific proof is available so far on their immunomodulatory effect. The purpose of this study was to reveal the potency of Sarang-Semut tubers as immunomodulatory agent by evaluating their effects on Balb/c mice lymphocytes proliferation and macrophage phagocytosis by in vitro techniques. Approach: Bioactivity assays were performed on the raw extracts and fractions. Extracts were obtained by macerating the pulverized samples in ethanol 95%, followed by successive fractionation to yield n-hexane, ethyl acetate and water fractions. Series of extracts and fractions were made to concentration 10, 20, 50 and 100 µg mL-1 by adding 0.5% Tween 80. Lymphocytes proliferation was observed by the MTT reduction method and analyzed using microplate reader at 550 nm. Macrophage phagocytosis activity was determined based on the number of latex beads uptake by the macrophage cells. Results: All extracts and fractions significantly increased the lymphocytes proliferation and macrophage phagocytosis activity in comparison to negative control. The ethyl acetate fraction of M. pendens (50 µg mL-1 showed the highest activity in lymphocytes proliferation assay, but the highest macrophage phagocytic index was shown by M. tuberosa ethanol extract (50 µg mL-1. Conclusion: Our study demonstrated that Sarang-Semut tubers are potential to be developed as immunomodulatory agents.

  15. Growth and pigment accumulation in nutrient-depleted Isochrysis aff. galbana T-ISO

    NARCIS (Netherlands)

    Mulders, K.J.M.; Weesepoel, Y.J.A.; Lamers, P.P.; Vincken, J.P.; Martens, D.E.; Wijffels, R.H.

    2013-01-01

    The effect of three different nutrient depletions (nitrogen, sulphur and magnesium) on the growth and pigment accumulation of the haptophyte Isochrysis aff. galbana (clone T-ISO) has been studied. Pigments were quantified based on RP-UHPLC-PDA-MSn analysis. All nutrient depletions led to reduced max

  16. Rhabdastrellins A-F, isomalabaricane triterpenes from the marine sponge Rhabdastrella aff. distincta

    NARCIS (Netherlands)

    Lv, F.; Xu, M.; Deng, Z.; de Voogd, N.J.; van Soest, R.W.M.; Proksch, P.; Lin, W.

    2008-01-01

    Chemical examination of the marine sponge Rhabdastrella aff. distincta resulted in the isolation of six new isomalabaricane triterpenes, rhabdastrellins A−F (1−6), which were present as minor components, along with stellettins L and M. Their structures were elucidated on the basis of extensive spect

  17. Spondias tuberosa (Anacardiaceae) leaves: profiling phenolic compounds by HPLC-DAD and LC-MS/MS and in vivo anti-inflammatory activity.

    Science.gov (United States)

    da Silva Siqueira, Emerson Michell; Félix-Silva, Juliana; de Araújo, Lorena Maria Lima; Fernandes, Julia Morais; Cabral, Bárbara; Gomes, Jacyra Antunes Dos Santos; de Araújo Roque, Alan; Tomaz, José Carlos; Lopes, Norberto Peporine; de Freitas Fernandes-Pedrosa, Matheus; Giordani, Raquel Brandt; Zucolotto, Silvana Maria

    2016-10-01

    Spondias tuberosa is a medicinal plant used by several local communities in northeast Brazil to treat infections, digestive disorders and inflammatory conditions. The study aimed to identify and quantify the major phenolic in hydroethanolic extract of leaves from S. tuberosa and to evaluate its anti-inflammatory potential. The chemical profile of extract was analyzed by HPLC-DAD and HPLC-MS. The in vivo anti-inflammatory activity was investigated in carrageenan-induced hind paw edema and peritonitis models in mice. Identified and quantified through HPLC-DAD or HPLC-MS analyses of S. tuberosa extract were the following compounds: chlorogenic acid, caffeic acid, rutin and isoquercitrin. The inflammatory response to carrageenan was significantly reduced in both models by S. tuberosa extract. In hind paw edema, the edematogenic response was reduced by up to 63.6% and the myeloperoxidase activity was completely inhibited. In the peritonitis model, the total cell migration into the peritoneal cavity was reduced by up to 65%. The results obtained give evidence of the anti-inflammatory action of S. tuberosa and suggest the potential therapeutic benefit of this plant on inflammatory conditions. The chlorogenic acid, caffeic acid, rutin and isoquercitrin identified and quantified in S. tuberosa leaves enable us to suggest that these compounds could be used as chemical markers for quality control of derivative products from this species. Copyright © 2016 John Wiley & Sons, Ltd.

  18. Corrección de la mama tuberosa solo con implantes anatómicos

    Directory of Open Access Journals (Sweden)

    A. Rancati

    2013-09-01

    Full Text Available Las mamas tuberosas, denominadas así por Rees y Aston, y también llamadas hernias del complejo areolar (Bass, Snoopy deformity (Gruber, mamas tubulares (Williams, hipoplasia del polo inferior (Brink o mamas de base estrecha (Puckett, son una malformacion en el desarrollo del volumen mamario en los cuadrantes inferiores con hernia areolar secundaria (placa areolar y músculo mamilar débiles, areola ancha y protruida (en la mitad de los casos, ascenso del surco submamario, mamas hipotróficas y raramente hipertróficas, con asimetrías en las dos terceras partes de las pacientes. Presentamos la estrategia quirúrgica adecuada para resolver esta patología utilizando solo implantes anatómicos de gel cohesivo sin necesidad de tallar colgajos glandulares. De esta manera, disminuimos la morbilidad quirúrgica, ofreciendo resultados estables y con alta satisfaccion por parte de las pacientes.

  19. Esclerosis Tuberosa asociada a Síndrome Nefrótico y falla renal aguda

    OpenAIRE

    Gabriela Santos Revilla; Kevin Schreiber Álvarez; Aníbal Manrique Acha; Luis Miguel Orellana Solís; Josué Bernardo Holguín; David Loja Oropeza

    2014-01-01

    El complejo de esclerosis tuberosa es una facomatosis, caracterizada por lesiones cutáneas, epilepsia y retardo mental; de variable afectación a: cerebro, riñones, corazón y otros órganos. De carácter autosómico dominante, existe entre un 60 a 70% de mutaciones de novo. Las lesiones renales se pueden identificar hasta en un 57.5% de pacientes.Se reporta el caso de un paciente varón de 20 años de edad en el Hospital Nacional Arzobispo Loayza. Se presentó con angiofibromas cutáneos, placas de Cha...

  20. Rabdomiomas Intracardíacos em Recém-nascido: ...Pensou em Esclerose Tuberosa?

    OpenAIRE

    Costa, Andreia; Baptista, Maria João; Viera, António; Temudo, Teresa

    2014-01-01

    Os autores descrevem o caso clínico de um recém-nascido com rabdomiomas cardíacos que se manifestaram pela detecção à nascença de frustes alterações auscultatórias cardíacas. O diagnóstico definitivo de Esclerose Tuberosa foi feito no período neonatal, com posterior expressão multissístémica da doença. Os autores fazem uma breve revisão teórica desta entidade clínica, no que concerne à sua eliopatogénese, critérios diagnósticos, espectro clínico, laboratorial e imagiológico, e abordagem terap...

  1. O Crescimento de Plantas de Imbuzeiro (Spondias tuberosa ARRUDA no semiárido de Pernambuco

    Directory of Open Access Journals (Sweden)

    Nilton de Brito Cavalcanti

    2010-10-01

    Full Text Available The objective of this study was to determine the growth the imbu (Spondias tuberosa Arruda is a native plants of the semi-arid region of the Brazilian Northeast, Brazil, and the 10 years. The study was conducted in the Caatinga Experimental Station, Embrapa Semi-Arid, Petrolina, and Pernambuco State, Brazil during the 1997 and 2007. The average height of the plants in the first one and the tenth year had been of 70.81 and 258.27 cm. The basal diameter and the circumference of stalk to the level of the ground had been, on average, of 10.39 and 35.26 cm, respectively. The plants had presented horizontal roots of 436.17 cm and vertical of 186.45 cm.

  2. Esclerosis Tuberosa asociada a Síndrome Nefrótico y falla renal aguda

    OpenAIRE

    Gabriela Santos Revilla; Kevin Schreiber Álvarez; Aníbal Manrique Acha; Luis Miguel Orellana Solís; Josué Bernardo Holguín; David Loja Oropeza

    2014-01-01

    El complejo de esclerosis tuberosa es una facomatosis, caracterizada por lesiones cutáneas, epilepsia y retardo mental; de variable afectación a: cerebro, riñones, corazón y otros órganos. De carácter autosómico dominante, existe entre un 60 a 70% de mutaciones de novo. Las lesiones renales se pueden identificar hasta en un 57.5% de pacientes.Se reporta el caso de un paciente varón de 20 años de edad en el Hospital Nacional Arzobispo Loayza. Se presentó con angiofibromas cutáneos, placas de Cha...

  3. Reconstrucción de la mama tuberosa Reconstruction of the tuberous breast

    Directory of Open Access Journals (Sweden)

    J. Oroz

    2005-01-01

    Full Text Available La mama tuberosa constituye una entidad malformativa que afecta uni o bilateralmente a las mujeres adolescentes, manifestándose en la pubertad con el crecimiento de la mama. Se caracteriza por una alteración de las dimensiones verticales y horizontales de la mama, que se traduce en una falta de desarrollo de la misma y en la herniación del tejido glandular dentro de la areola con hipertrofia de ésta. Se han empleado numerosos términos para describir esta deformidad, además del de mama tuberosa: mama tubular, mama caprina, hernia areolar, hipoplasia del polo inferior o mama constreñida. En su grado más desarrollado es una deformidad grave, que afecta de una forma importante la estabilidad emocional de la paciente, alterando su vida de relación. El tratamiento quirúrgico varía dependiendo del grado y severidad de la deformidad e incluye procedimientos tales como: remodelación glandular, mamoplastia de aumento, mastopexia o combinación de ambas.The tuberous breast is a malformation that affects adolescent women uni- or bilaterally, becoming apparent at puberty with the growth of the breast. It is characterised by an alteration of the vertical and horizontal dimensions of the breast, which is translated into a lack of development of the breast and into the herniation of the glandular tissue within the areola with hypertrophy of the latter. Numerous terms have been employed to describe this deformity, besides that of tuberous breast: tubular breast, caprine breast, areolar hernia, hypoplasia of the lower pole or constricted breast. At its most developed degree it is a serious deformity, which affects the emotional stability of the patient in an important way, altering their relational life. Surgical treatment varies depending on the degree and severity of the deformity and includes procedures such as: glandular remodelling, augmentation mammoplasty, mastopexy or a combination of both.

  4. Reproductive biology of a population of Gymnotus aff.carapo (Teleostei: Gymnotidae from southern Brazil

    Directory of Open Access Journals (Sweden)

    Diego de Paula Cognato

    Full Text Available The reproductive period and its relation with somatic and abiotic factors, the relative and absolute fecundity, spawning type, length of first maturation and sex ratio is describe for Gymnotus aff.carapo from a small lake at Itapuã State Park, Rio Grande do Sul, Brazil. Gymnotus aff. carapo presents a relatively long reproductive cycle extending from November/2003 to March/2004. Decreases in water conductivity and increases in dissolved oxygen are correlated with increased gonadal development in males. In females, seasonal increases in temperature and photoperiod and decreases in dissolved oxygen are correlated with increased gonadal development. The mean absolute fecundity was 915.3 oocytes, and mean relative fecundity 0.20 oocytes/mg body weight. Egg size distributions indicate multiple spawning. The size of first maturation was 141 mm in females and 146 mm in males. The sex ratio was 1:1, with a male bias only in smaller size classes.

  5. Asymbiotic germination, seedling development and plantlet propagation of Encyclia aff. oncidioides - an endangered orchid

    Directory of Open Access Journals (Sweden)

    Ewa Łojkowska

    2011-01-01

    Full Text Available In order to estimate the best germination conditions of Encyclia aff. oncidioides seeds, five different media (Fast, Knudson C modified by Vajrabhaya, Murashige and Skoog, PB2 and modified Vacin and Went with different concentrations of plant growth regulators such as benzyladenine (BA, naphthaleneacetic acid (NAA and gibberellic acid (GA3 were tested. No beneficial effect was observed when BA and NAA were applied to the germination medium and GA3 inhibited germination. The effect of light, activated charcoal, coconut water and casein hydrolysate on seed germination was also studied. The growth rate of seedlings on three different media supplemented with activated charcoal and plant growth regulators was checked. The applied plant growth regulators had no beneficial effect on the further growth of seedlings. Fast and PB2 media with 0.2% activated charcoal proved to be the best for E. aff. oncidioides seed germination, seedling development and plantlet propagation.

  6. The stingless bee species, Scaptotrigona aff. depilis, as a potential indicator of environmental pesticide contamination.

    Science.gov (United States)

    de Souza Rosa, Annelise; I'Anson Price, Robbie; Ferreira Caliman, Maria Juliana; Pereira Queiroz, Elisa; Blochtein, Betina; Sílvia Soares Pires, Carmen; Imperatriz-Fonseca, Vera Lucia

    2015-08-01

    Neonicotinoids have the potential to enter the diet of pollinators that collect resources from contaminated plants. The species Scaptotrigona aff. depilis (Moure, 1942) can be a useful indicator of the prevalence of these chemicals in the environment. Using high-performance liquid chromatography-mass spectrometry, the authors devised a protocol for neonicotinoid residue extraction and detected the presence of neonicotinoids in the bee bodies. Thus, the authors consider this species to be a potential indicator of environmental contamination.

  7. Pharmacognostic and acute toxicological evaluation of Scaptotrigona aff. postica propolis extract in pre-clinical assays.

    Science.gov (United States)

    Araújo, M J A M; Mattar, N S; Reis, A S; Serra, I C P B; Fialho, E M S; Assunção, A K M; Dutra, R P; Nogueira, A M C; Libério, S A; Guerra, R N M; Lopes, A S; Ribeiro, M N S; Nascimento, F R F

    2011-07-01

    The propolis of Scaptotrigona aff. postica is popularly used in Maranhão State, Brazil, for treating wounds and respiratory illnesses. Nevertheless, little is known about the chemical composition of this propolis and the adverse effects of its use. Hence, this study is a pharmacognostic characterisation of the propolis hydroalcoholic extract (PHE) from S. aff. postica. The methodology consisted of an evaluation of the sensory and chemical parameters. Chemical analysis of PHE indicated high concentrations of phenolic and triterpens substances, and the absence of steroids. Additionally, we evaluated the acute toxicity of propolis using 48 Swiss male and female mice. The animals received single doses of PHE (1000, 2000 or 4000 mg kg⁻¹) orally and were observed for 14 days. After this period, the mice were sacrificed and the blood was used for biochemical and haematological evaluation. PHE did not induce any death, and the acute treatment significantly reduced serum concentrations of alanine aminotransferase and alkaline phosphatase. The resultant data indicate that PHE from S. aff. postica has low toxicity when used orally, even in high doses.

  8. Rapid identification of α-glucosidase inhibitors from Phlomis tuberosa by Sepbox chromatography and thin-layer chromatography bioautography.

    Science.gov (United States)

    Yang, Yingbo; Gu, Lihua; Xiao, Ying; Liu, Qing; Hu, Haijun; Wang, Zhengtao; Chen, Kaixian

    2015-01-01

    Alpha-glucosidase inhibitors currently form an important basis for developing novel drugs for diabetes treatment. In our preliminary tests, the ethyl acetate fraction of Phlomis tuberosa extracts showed significant α-glucosidase inhibitory activity (IC₅₀ = 100 μg/mL). In the present study, a combined method using Sepbox chromatography and thin-layer chromatography (TLC) bioautography was developed to probe α-glucosidase inhibitors further. The ethyl acetate fraction of P. tuberosa extracts was separated into 150 individual subfractions within 20 h using Sepbox chromatography. Then, under the guidance of TLC bioautography, 20 compounds were successfully isolated from these fractions, including four new diterpenoids [14-hydroxyabieta-8,11,13-triene-11-carbaldehyde-18-oic-12-carboxy-13-(1-hydroxy-1-methylethyl)-lactone (1), 14-hydroxyabieta-8,11,13-triene-17-oic-12-carboxy-13-(1-hydroxy-1-methylethyl)-lactone (2), 14,16-dihydroxyabieta-8,11,13-triene-15,17-dioic acid (3), and phlomisol (15,16-eposy-8,13(16),14-labdatrien-19-ol) (4)], and 16 known compounds. Activity estimation indicated that 15 compounds showed more potent α-glucosidase inhibitory effects (with IC50 values in the range 0.067-1.203 mM) than the positive control, acarbose (IC50 = 3.72 ± 0.113 mM). This is the first report of separation of α-glucosidase inhibitors from P. tuberosa.

  9. Mosquito larvicidal and biting deterrency activity of bud of Polianthes tuberosa plants extract against Anopheles stephensi and Culex quinquefasciatus

    Directory of Open Access Journals (Sweden)

    Anjali Rawani

    2012-06-01

    Full Text Available Objective: To evaluate the larvicide and biting deterrency activity of bud of Polianthes tuberosa (P. tuberosa against Culex quinquefasciatus (Cx. quinquefasciatus and Anopheles stephensi (An. stephensi. Methods: Crude and solvent extract [ethyl acetate, chloroform: methanol (1:1, v/v, acetone] of fresh, mature, bud of P. tuberosa was tested against Cx. quinquefasciatus and An. stephensi. The repellent activity tested by chloroform: methanol (1:1, v/v solvent extract against both mosquito species. The appropriate lethal concentrations at 24 h for chloroform: methanol (1:1, v/v extract was also studied on non target organisms such as Toxorhynchites larvae, Diplonychus annulatum and Chironomus circumdatus. Results: In a 72 h bioassay experiment, 0.5 % crude extract showed the highest mortality and chloroform: methanol (1:1, v/v solvent extract showed the highest mortality, the maximum (P < 0.05 mortality was recorded at a concentration of 60 mg/L. The chloroform: methanol (1:1, v/v solvent extract provide 4 h protection against Cx. quinquefasciatus and 5 h against An. stephensi from biting. Conclusions: Both crude and chloroform: methanol (1:1, v/v extract showed efficient activity against Cx. quinquefasciatus, so it could be used as a mosquito larvicide agent. There is no change in the activity of non-target organism so, it is safe to use.

  10. Acute Toxicity and Cytotoxicity Effect of Ethanolic Extract of Spondias tuberosa Arruda Bark: Hematological, Biochemical and Histopathological Evaluation

    Directory of Open Access Journals (Sweden)

    HUMBERTO M. BARBOSA

    Full Text Available ABSTRACT Spondias tuberosa Arruda, popularly named as umbu, is native from savanna-like vegetation and widely used for medicinal purposes, however, the toxicological profile is not available yet. This study evaluated the phytochemical profile and acute toxicity and citoxicity of Ethanolic Extract of Spondias tuberosa Arruda Bark (EEStb in hematological, biochemical and histopathological parameters. Female Wistar rats were divided into: control (C and animal treated single doses of 300mg/Kg (EEStb300 or 2.000mg/kg body weight (ESStb2.000 of the EEStb. After 24 hours and 14 days from gavage, the behavior, hematological, biochemical and histopathological parameters were assayed. Cytotoxicity effect was evaluated on HEp-2 cell lines. Neither EEStb300 nor EEStb2.000 produced mortality nor changes in body weight during the 14-days of observation, but EEStb2.000 reduced quietly the food and water intake as well as locomotor activity at first day. There were no changes in macroscopic, histopathological, biochemical and hematological parameters. EEStb in concentrations of 6.25- 50μg ml−1 on HEp-2 cell did not produce cytotoxic effect. These results suggest that EEStb did not cause acute toxicity and cytotoxic, suggesting a good safety rate for Spondias tuberosa Arruda.

  11. Acute Toxicity and Cytotoxicity Effect of Ethanolic Extract of Spondias tuberosa Arruda Bark: Hematological, Biochemical and Histopathological Evaluation.

    Science.gov (United States)

    Barbosa, Humberto M; Nascimento, Jailson N DO; Araújo, Thiago A S; Duarte, Filipe S; Albuquerque, Ulysses P; Vieira, Jeymesson R C; Santana, Edson R B DE; Yara, Ricardo; Lima, Cláudia S A; Gomes, Dayane A; Lira, Eduardo C

    2016-01-01

    Spondias tuberosa Arruda, popularly named as umbu, is native from savanna-like vegetation and widely used for medicinal purposes, however, the toxicological profile is not available yet. This study evaluated the phytochemical profile and acute toxicity and citoxicity of Ethanolic Extract of Spondias tuberosa Arruda Bark (EEStb) in hematological, biochemical and histopathological parameters. Female Wistar rats were divided into: control (C) and animal treated single doses of 300mg/Kg (EEStb300) or 2.000mg/kg body weight (ESStb2.000) of the EEStb. After 24 hours and 14 days from gavage, the behavior, hematological, biochemical and histopathological parameters were assayed. Cytotoxicity effect was evaluated on HEp-2 cell lines. Neither EEStb300 nor EEStb2.000 produced mortality nor changes in body weight during the 14-days of observation, but EEStb2.000 reduced quietly the food and water intake as well as locomotor activity at first day. There were no changes in macroscopic, histopathological, biochemical and hematological parameters. EEStb in concentrations of 6.25- 50μg ml-1 on HEp-2 cell did not produce cytotoxic effect. These results suggest that EEStb did not cause acute toxicity and cytotoxic, suggesting a good safety rate for Spondias tuberosa Arruda.

  12. Caracterização físico-química de algumas tuberosas amiláceas

    Directory of Open Access Journals (Sweden)

    Leonel Magali

    2002-01-01

    Full Text Available As principais fontes de amido comercial no mundo são o milho, a batata e a mandioca. Entretanto, nos últimos anos vem crescendo o interesse em amidos naturais que possam ser utilizados pela indústria alimentícia. Assim, este trabalho teve por objetivo caracterizar, quanto à composição físico-química, açafrão, ahipa, araruta, batata-doce, biri, inhame e mandioquinha-salsa, tuberosas amiláceas potencialmente passíveis de introdução como matérias-primas de interesse comercial. Amostras das tuberosas foram analisadas quanto ao teor de umidade, cinzas, proteína, matéria graxa, açúcares redutores e totais, fibras e amido. Os resultados obtidos mostraram que das tuberosas analisadas as que apresentaram maior teor de amido foram a araruta (Maranta arundinacea, o inhame (Dioscorea sp e o biri (Canna edulis, sendo que o inhame e o biri apresentaram também o maior rendimento potencial em toneladas de amido/hectare.

  13. Mosquito larvicidal and biting deterrency activity of bud of Polianthes tuberosa plants extract against Anopheles stephensi and Culex quinquefasciatus.

    Science.gov (United States)

    Anjali, Rawani; Atanu, Banerjee; Goutam, Chandra

    2012-06-01

    Mosquito control by phytochemicals is an alternative method to synthetic insecticides, as it is biodegradable and non resistant to vector mosquito. Polianthes tuberosa is a perennial plant distributed in many parts of India. The present study was undertaken to scientifically evaluate the larvicide and biting deterrency activity of bud of Polianthes tuberosa against Culex quinquefasciatus and Anopheles stephensi. Crude and solvent extract [ethyl acetate, chloroform: methanol (1:1, v/v), acetone] of fresh, mature, bud of P. tuberosa was tested against (ex. quinquefasciatus and An. stephensi. The repellent activity tested by chloroform: methanol (1:1, v/v) solvent extract against both mosquito species. The appropriate lethal concentrations at 24h for chloroform: methanol (1:1, v/v) extract was also studied on non target organisms such as Toxorhynchites larvae, Diplonychus annulatum and Chironomus circumdatus. In a 72 hour bioassay experiment, 0.5% crude extract showed the highest mortality and chloroform: methanol (1:1, v/v) solvent extract showed the highest mortality, the maximum (p larvicide agent. There is no changes in the activity non-target organism so, it is safe to use.

  14. Histological alterations in gills of Astyanax aff. bimaculatus caused by acute exposition to zinc.

    Science.gov (United States)

    dos Santos, Daiane Cristina Marques; da Matta, Sérgio Luis Pinto; de Oliveira, Juraci Alves; dos Santos, Jorge Abdala Dergam

    2012-11-01

    Increasing contamination of aquatic ecosystems by metals has caused various morphological, physiological and biochemical changes in aquatic organisms, and the gills of fish are recognized as indicators of environmental quality. In this context, the present work proposed to study the effects of different concentrations of zinc (Zn) in the histology of gills of yellow tail lambari (Astyanax aff. bimaculatus) after acute exposure. Seventy-two adult males of A. aff. bimaculatus were used, the treatments were six concentrations of Zn: 0; 3; 5; 10; 15; and 20 mg/L of water, by 96 h, and gills, muscle and bone fragments were removed. Fragments of gills were fixed and included, sectioned in a rotary microtome and stained with toluidin blue. Fragments of bone, muscle and gills were dehydrated and digested to quantify the absorption of Zn. The median lethal concentration (LC(50)) 96 h after Zn acute exposure was 10 mg/L of water. Noteworthy, Zn was highly toxic in acute exposure trials starting at the concentration 5 mg/L. The exposure of fish to the metal caused branchial histopathological changes correlated with increasing concentration, caused the death of fish at concentrations of 10, 15 and 20 mg/L. The histological alterations observed in the gills were hyperplasia, lamellar fusion, aneurysm, destruction of the lamellar epithelium, rupture of membrane, deletion of secondary lamellar high, which presented more severity in treatments exposed to the highest concentrations. In conclusion, gills of A. aff. bimaculatus presented profound histological alterations as a result of Zn exposure, and hence, proved to be excellent indicators of environmental contamination.

  15. Otimização da micropropagação de Pfaffia tuberosa (Spreng. Hicken

    Directory of Open Access Journals (Sweden)

    Flores Rejane

    2006-01-01

    Full Text Available Este trabalho objetivou otimizar o protocolo de micropropagação de Pfaffia tuberosa, uma espécie medicinal encontrada em várias regiões do Brasil. O tratamento da planta matriz com benomyl (0,1% e o uso sucessivo de soluções com detergente comercial (duas gotas/100mL de água, durante dois minutos, etanol (70%, por 10 segundos, hipoclorito de sódio (1% + detergente comercial (duas gotas/100mL de água, por 10 minutos e HgCl2 (0,1%, por 5 minutos na etapa de desinfestação dos explantes foram eficazes para a limpeza e regeneração de plantas. As plantas devem ser subcultivadas para um novo meio MS a cada 30 dias de cultivo. Explantes provenientes de segmentos nodais apresentaram uma maior taxa de multiplicação quando comparados com os apicais. Não foi observado declínio na taxa de propagação no decorrer de cinco subcultivos in vitro. As mudas apresentaram um índice elevado de sobrevivência durante a fase de aclimatização.

  16. Mangiferin from Pueraria tuberosa reduces inflammation via inactivation of NLRP3 inflammasome.

    Science.gov (United States)

    Bulugonda, Ramakrishna K; Kumar, Kotha Anil; Gangappa, D; Beeda, Harshavardhan; Philip, Gundala Harold; Muralidhara Rao, Dowlathabad; Faisal, Syed M

    2017-02-20

    Recent reports have demonstrated the role of phyto-constituents in modulating inflammatory responses. Mangiferin isolated from Mangifera indica is known to induce potent anti-oxidative, anti-diabetic and anti-inflammatory activity. However, the molecular mechanism of its anti-inflammatory activity is not properly understood. In this study we have isolated Mangiferin from the tubers of Pueraria tuberosa (PT-Mangiferin) and analysed the mechanism of its potent anti-inflammatory effects in LPS stimulated RAW 264.7 mouse macrophage cell line and in a carrageenan induced air pouch model. PT-Mangiferin was non-toxic to primary cells but showed significant toxicity and apoptotic effect on cancerous cells. It significantly reduced the production of pro-inflammatory mediators (COX-2, iNOS and TNF-α) in LPS stimulated RAW 264.7 cells. Further, it has also reduced the generation of ROS and inhibited LPS induced NF-kB translocation in these cells. Additionally, PT-Mangiferin significantly reduced inflammation in a mouse air pouch model by inhibiting the infiltration of monocytes and neutrophils and reducing the production of cytokines. These effects were mediated via inactivation of NLRP3 inflammasome complex and its downstream signalling molecules. Taken together these results suggest that PT-Mangiferin is potent anti-inflammatory compound that reduces inflammation and holds promise in development of herbal based anti-inflammatory therapeutics in future.

  17. Evaluation of Anti-Inflammatory Properties of Isoorientin Isolated from Tubers of Pueraria tuberosa

    Science.gov (United States)

    Anilkumar, Kotha; Reddy, Gorla V.; Azad, Rajaram; Yarla, Nagendra Sastry; Dharmapuri, Gangappa; Srivastava, Anand

    2017-01-01

    Inflammation is the major causative factor of different diseases such as cardiovascular disease, diabetes, obesity, osteoporosis, rheumatoid arthritis, inflammatory bowel disease, and cancer. Anti-inflammatory drugs are often the first step of treatment in many of these diseases. The present study is aimed at evaluating the anti-inflammatory properties of isoorientin, a selective cyclooxygenase-2 (COX-2) inhibitor isolated from the tubers of Pueraria tuberosa, in vitro on mouse macrophage cell line (RAW 264.7) and in vivo on mouse paw edema and air pouch models of inflammation. Isoorientin reduced inflammation in RAW 264.7 cell line in vitro and carrageenan induced inflammatory animal model systems in vivo. Cellular infiltration into pouch tissue was reduced in isoorientin treated mice compared to carrageenan treated mice. Isoorientin treated RAW 264.7 cells and animals showed reduced expression of inflammatory proteins like COX-2, tumor necrosis factor-α (TNF-α), interleukin-6 (IL-6), 5-lipoxygenase (5-LOX), and interleukin 1-β (IL-1-β) both in vitro and in vivo. The antioxidant enzyme levels of catalase and GST were markedly increased in isoorientin treated mice compared to carrageenan treated mice. These results suggest that isoorientin, a selective inhibitor of COX-2, not only exerts anti-inflammatory effects in LPS induced RAW cells and carrageenan induced inflammatory model systems but also exhibits potent antioxidant properties.

  18. Evaluation of Anti-Inflammatory Properties of Isoorientin Isolated from Tubers of Pueraria tuberosa

    Directory of Open Access Journals (Sweden)

    Kotha Anilkumar

    2017-01-01

    Full Text Available Inflammation is the major causative factor of different diseases such as cardiovascular disease, diabetes, obesity, osteoporosis, rheumatoid arthritis, inflammatory bowel disease, and cancer. Anti-inflammatory drugs are often the first step of treatment in many of these diseases. The present study is aimed at evaluating the anti-inflammatory properties of isoorientin, a selective cyclooxygenase-2 (COX-2 inhibitor isolated from the tubers of Pueraria tuberosa, in vitro on mouse macrophage cell line (RAW 264.7 and in vivo on mouse paw edema and air pouch models of inflammation. Isoorientin reduced inflammation in RAW 264.7 cell line in vitro and carrageenan induced inflammatory animal model systems in vivo. Cellular infiltration into pouch tissue was reduced in isoorientin treated mice compared to carrageenan treated mice. Isoorientin treated RAW 264.7 cells and animals showed reduced expression of inflammatory proteins like COX-2, tumor necrosis factor-α (TNF-α, interleukin-6 (IL-6, 5-lipoxygenase (5-LOX, and interleukin 1-β (IL-1-β both in vitro and in vivo. The antioxidant enzyme levels of catalase and GST were markedly increased in isoorientin treated mice compared to carrageenan treated mice. These results suggest that isoorientin, a selective inhibitor of COX-2, not only exerts anti-inflammatory effects in LPS induced RAW cells and carrageenan induced inflammatory model systems but also exhibits potent antioxidant properties.

  19. Mangiferin from Pueraria tuberosa reduces inflammation via inactivation of NLRP3 inflammasome

    Science.gov (United States)

    Bulugonda, Ramakrishna K.; kumar, Kotha Anil; Gangappa, D.; Beeda, Harshavardhan; Philip, Gundala Harold; Muralidhara Rao, Dowlathabad; Faisal, Syed M.

    2017-01-01

    Recent reports have demonstrated the role of phyto-constituents in modulating inflammatory responses. Mangiferin isolated from Mangifera indica is known to induce potent anti-oxidative, anti-diabetic and anti-inflammatory activity. However, the molecular mechanism of its anti-inflammatory activity is not properly understood. In this study we have isolated Mangiferin from the tubers of Pueraria tuberosa (PT-Mangiferin) and analysed the mechanism of its potent anti-inflammatory effects in LPS stimulated RAW 264.7 mouse macrophage cell line and in a carrageenan induced air pouch model. PT-Mangiferin was non-toxic to primary cells but showed significant toxicity and apoptotic effect on cancerous cells. It significantly reduced the production of pro-inflammatory mediators (COX-2, iNOS and TNF-α) in LPS stimulated RAW 264.7 cells. Further, it has also reduced the generation of ROS and inhibited LPS induced NF-kB translocation in these cells. Additionally, PT-Mangiferin significantly reduced inflammation in a mouse air pouch model by inhibiting the infiltration of monocytes and neutrophils and reducing the production of cytokines. These effects were mediated via inactivation of NLRP3 inflammasome complex and its downstream signalling molecules. Taken together these results suggest that PT-Mangiferin is potent anti-inflammatory compound that reduces inflammation and holds promise in development of herbal based anti-inflammatory therapeutics in future. PMID:28218280

  20. Pueraria tuberosa DC Extract Improves Androgenesis and Sexual Behavior via FSH LH Cascade

    Directory of Open Access Journals (Sweden)

    Nagendra Singh Chauhan

    2013-01-01

    Full Text Available The aim of this study was to investigate the effects of ethanolic extract of Pueraria tuberosa (PT on sexual behaviour and androgenic activity. Male albino rats were divided into four groups of six animals each: control group 1 (2% acacia solution, PT-treated group 2 (50 mg/Kg, PT-treated group 3 (100 mg/Kg, and PT-treated group 4 (150 mg/Kg. Sexual behavior of male rats in the presence of a female rat was recorded. The treated groups were evaluated for sexual parameters. The extract was characterized using LC-MS. The effect of treatment on anabolic and weight of secondary sexual organs was determined. The histological changes in section of testis and epididymis after treatment were observed. Sperm count in epididymis and fructose content in seminal vesicles were also measured. Levels of hormones like FSH, LH, and T were determined. A dose-dependent increase in sexual behaviors was evidenced in the animals of extract treated groups. Increase in testis weight was recorded in PT. At the highest dose PT also affects the hormones level. The four compounds namely puerarin, daidzein, biochanin-A and formononetin were identified in ethanolic extract using LC-MS. It concluded that PT extract possesses androgenic effect and it significantly increased the sexual behaviour and hormones level.

  1. Anatomical and molecular characterization of Lactarius aff. omphaliformis, Russula alnijorullensis and Cortinarius tucumanensis ectomycorrhizae on Alnus acuminata.

    Science.gov (United States)

    Becerra, Alejandra; Beenken, Ludwig; Pritsch, Karin; Daniele, Graciela; Schloter, Michael; Agerer, Reinhard

    2005-01-01

    Ectomycorrhizae (ECM) of Lactarius aff. omphaliformis Romagn., Russula alnijorullensis (Sing.) Sing. and Cortinarius tucumanensis Mos. on Andean alder (Alnus acuminata Kunth) were characterized and identified. The identification of the fungal symbionts was achieved by morpho-anatomical observations of mycorrhizae and by comparison of ITS-RFLP patterns obtained from ECM and fruitbodies. L. aff omphaliformis ECM differed in some morphological details such as ramification and mantle type from ECM of the same species on A. glutinosa. L. aff omphaliformis ECM show an orange to ochre mantle containing latex cells, which stain with sulpho-vanillin, emanating hyphae without clamps. R. alnijorullensis ECM represent a typical Russula-type-ECM, light yellow to pinkish, the outer mantle being composed of triangular latex-filled cells staining with sulpho-vanillin, emanating hyphae without clamps. C. tucumanensis ECM exhibit a white (silvery) to yellowish brown mantle covered with soil particles, emanating hyphae with clamps.

  2. Effects of water-soluble fraction of petroleum on growth and prey consumption of juvenile Hoplias aff. malabaricus (Osteichthyes: Erythrinidae).

    Science.gov (United States)

    Santos, R M; Weber, L; Souza, V L; Soares, A R; Petry, A C

    2016-02-01

    The influence of the water-soluble fraction of petroleum (WSF) on prey consumption and growth of juvenile trahira Hoplias aff. malabaricus was investigated. Juveniles were submitted to either WSF or Control treatment over 28 days, and jewel tetra Hyphessobrycon eques adults were offered daily as prey for each predator. Total prey consumption ranged from 16 to 86 individuals. Despite the initially lower prey consumption under WSF exposure, there were no significant differences in overall feeding rates between the two treatments. Water-soluble fraction of petroleum had a negative effect on the growth in length of H. aff. malabaricus juveniles. Although unaffected, prey consumption suggested a relative resistance in H. aff. malabaricus to WSF exposition and the lower growth of individuals exposed to WSF than the Control possibly reflects metabolic costs. The implications of the main findings for the individual and the food chain are discussed, including behavioral aspects and the role played by this predator in shallow aquatic systems.

  3. Caracterización de la esclerosis tuberosa en pacientes que consultan al Hospital Universitario San Vicente de Paúl, Medellín, Colombia

    OpenAIRE

    Dagoberto Nicanor Cabrera Hémer; Jaime Carrizosa Moog; Olga Juliana Cuéllar; Dionis Vallejo Mesa; José Vladimir Tobón Areiza; José William Cornejo Ochoa

    2008-01-01

    La esclerosis tuberosa (ET) es una enfermedad autosómica dominante, que afecta muchos sistemas y cursa con diversas manifestaciones clínicas, entre ellas epilepsia, retardo mental y lesiones cutáneas. Se hizo un estudio retrospectivo para contribuir a la caracterización de la esclerosis tuberosa en Medellín, Colombia. Se revisaron 21 historias, 62% mujeres y 38% hombres; la edad media al momento del diagnóstico fue 23 meses, todos los pacientes tenían epilepsia y lesiones cutáneas, las crisis...

  4. Evaluation of growth, cell size and biomass of Isochrysis aff. galbana (T-ISO) with two LED regimes

    OpenAIRE

    Miguel Victor Cordoba-Matson; Bertha O. Arredondo - Vega; Laura Carreón - Palau

    2013-01-01

    In contrast to crops, there are fewer studies using LED-based light with green microalgae and none cultivating the microalga Isochrysis aff. galbana (T-ISO) even though of its importance in marine aquaculture. The objective was to evaluate of white and red LEDs as an alternative source of light to cultivate I. aff. galbana (T-ISO). In order to carry this out white and red LEDs were used with a laboratory built Erlenmeyer-type photobioreactor to determine productivity, cell number and size an...

  5. Sistemas de labranza y densidades de la batata: calidad del suelo y de las raíces tuberosas.

    Directory of Open Access Journals (Sweden)

    Maiby Pérez-Darniz

    2016-12-01

    Full Text Available El objetivo de este trabajo fue determinar el efecto de sistemas de labranza y densidades de siembra en la calidad de las raíces tuberosas de batata (Ipomoea batata (L Lamb.. El estudio se realizó en la Universidad Central de Venezuela, en el año 2014. Se determinaron los grados de severidad de la degradación del suelo y su correspondencia con las escalas de preferencia basadas en el peso unitario y dimensiones de la raíz tuberosa. Se usó un arreglo en franjas, donde los sistemas de labranza (SL fueron asignados a las parcelas, y las densidades de siembra (Ds a las franjas. Los SL consistieron en labranza vertical con cincel (LC, con arado de disco (LA, convencional con tres pases de rastra de disco (LCo y mínima con un pase de rastra de disco (LM. Las Ds fueron de 0,25 cm (D1 y 0,15 cm (D2 en la hilera. La calidad física del suelo fue superior en los tratamientos de LA. De estos, la combinación con la distancia de siembra más larga (LA-D1 favoreció la mayor calidad postcosecha del cultivo. Al contrario, en los tratamientos con cincel se promovió la menor aceptación del consumidor. La ligera a moderada severidad de la degradación del suelo no explicó la variación de la calidad postcosecha. Se in ere sobre la menor tasa de movimiento de agua en LC, que promovió un exceso de humedad y la más baja calidad de la raíz tuberosa.

  6. An AFLP estimation of the outcrossing rate of Spondias tuberosa (Anacardiaceae), an endemic species to the Brazilian semiarid region.

    Science.gov (United States)

    Fernandes Santos, Carlos Antonio; de Souza Gama, Renata Natália Cândido

    2013-06-01

    The umbu tree (Spondias tuberosa) is one of the most important endemic species to the Brazilian tropical semiarid region. The umbu tree has edible fruits with a peculiar flavor that are consumed in natura or in a semi-industrialized form, such as jams, candies and juices. The majority of endemic species to Brazilian semiarid region have not been studied or sampled to form germ-plasm collections, which increases the risk of losing genetic variability of the adapted species to xerophytic conditions. The aim of this study was to estimate outcrossing rates in S. tuberosa using a multilocus mixed model in order to guide genetic resources and breeding programs of this species. DNA samples were extracted from 92 progenies of umbu trees, which were distributed among 12 families. These trees were planted by seed in 1991 in Petrolina, PE, Brazil. The experimental design was a randomized block, with a total of 42 progenies sampled in three regions. The experimental units were composed by five plants and five replications. The outcrossing rate was estimated by the multilocus model, which is available in the MLTR software, and was based on 17 polymorphic AFLP bands obtained from AAA_CTG and AAA_CTC primer combinations. The observed heterozygotes ranged from 0.147 to 0.499, with a maximum frequency estimated for the AAA_CTC 10 amplicon. The multilocus outcrossing estimation (t(m)) was 0.804 +/- 0.072, while the single-locus (t(s)) was 0.841 +/- 0.079, which suggests that S. tuberosa is predominantly an outcrossing species. The difference between t(m) and t(s) was -0.037 +/- 0.029, which indicates that biparental inbreeding was nearly absent. The mean inbreeding coefficient or fixation index (F) among maternal plants was--0.103 +/- 0.045, and the expected F was 0.108, which indicates that there was no excess of heterozygotes in the maternal population. The outcrossing estimates obtained in the present study indicate that S. tuberosa is an open-pollinated species. Biometrical

  7. Fibroma desmoplásico del alvéolo maxilar asociado a esclerosis tuberosa: reporte de caso

    OpenAIRE

    Mejía Cortés, Maddy; Departamento de Patología, Hospital Universitario San Ignacio, Bogotá, Colombia. Docente del Departamento de Patología, Facultad de Medicina, Pontificia Universidad Javeriana, Bogotá, Colombia.; De León Rodríguez, Oscar; Odontólogo cirujano maxilofacial, Hospital Universitario San Ignacio. Profesor de la Facultad de Medicina, Pontificia Universidad Javeriana, Bogotá, Colombia.; Peña, Claudia; Pontificia Universidad Javeriana, Bogotá, Colombia. Facultad de Odontología, Universidad Nacional de Colombia.; Paez, Jorge; Pontificia Universidad Javeriana, Bogotá, Colombia.; Solarte, Paula; Pontificia Universidad Javeriana; Bermúdez Rey, Maria Carolina; Pontificia Universidad Javeriana, Bogotá, Colombia

    2016-01-01

     La esclerosis tuberosa es un trastorno autosómico dominante que se manifiesta con la formación de hamartomas en múltiples órganos y sistemas, como el sistema nervioso central, la piel, los riñones, los pulmones y el corazón. Los pacientes se ven afectados por cuadros de convulsiones, así como por hallazgos cutáneos. En la cavidad oral, las lesiones se presentan en el esmalte dental y constituyen la presentación más frecuente, pero rara vez se encuentran lesiones en los maxilares. El fibroma ...

  8. Neoparamoeba branchiphila infections in moribund sea urchins Diadema aff. antillarum in Tenerife, Canary Islands, Spain.

    Science.gov (United States)

    Dyková, Iva; Lorenzo-Morales, Jacob; Kostka, Martin; Valladares, Basilio; Pecková, Hana

    2011-07-12

    A total of 109 sea urchins from 3 species collected in 2 localities off the coast of Tenerife Island, Spain, were examined for the presence of free-living amoebae in their coelomic fluid. Amoeba trophozoites were isolated exclusively from moribund individuals of long-spined sea urchins Diadema aff. antillarum (Philippi) (Echinoidea, Echinodermata) that manifested lesions related to sea urchin bald disease on their tests (16 out of 56 examined). No amoebae were detected in Arbacia lixula (L.) and Paracentrotus lividus (Lamarck). From the former sea urchin species, 8 strains, established from 10 primary isolates, were identified as Neoparamoeba branchiphila Dyková et al., 2005 using morphological and molecular methods. Results of this study (limited to the screening for free-living amoebae) together with data on agents of sea urchin mortalities reported to date justify the hypothesis that free-living amoebae play an opportunistic role in D. aff. antillarum mortality. The enlargement of the dataset of SSU rDNA sequences brought new insight into the phylogeny of Neoparamoeba species.

  9. Combined foraging strategies and soldier behaviour in Nasutitermes aff. coxipoensis (Blattodea: Termitoidea: Termitidae).

    Science.gov (United States)

    Almeida, Camilla S; Cristaldo, Paulo F; Florencio, Daniela F; Cruz, Nayara G; Santos, Abraão A; Oliveira, Alexandre P; Santana, Alisson S; Ribeiro, Efrem J M; Lima, Ana P S; Bacci, Leandro; Araújo, Ana P A

    2016-05-01

    A range of behavioural strategies and sensory abilities allows animals to minimize costs involved in food search. By building a network of tunnels and presenting a large number of soldiers (i.e., trophically dependent individuals), Nasutitermes spp. termites feature behaviours that imply additional costs during this process. Here we evaluated N. aff. coxipoensis foraging strategies focusing on the role of soldiers during foraging. Field experiments were carried out via nests transplantation to dune areas, and laboratory experiments evaluated termite responses to sternal gland chemical signals from workers and soldiers. N. aff. coxipoensis presented primarily nocturnal foraging. Soldiers typically initiated foraging; however, in established trails, the number of workers was always higher than that of soldiers. The number of trails remained constant over time, while the number of tunnels increased linearly over time. A higher proportion of tunnels originated in surrounding areas than directly from the nests. At observation points with tunnels, there were more stationary than walking soldiers; the opposite was true at observation points without tunnels. In mixed groups, the workers chose to follow soldier chemical signals, and in these groups, soldiers were the first to follow trails. Our results allowed us to identify a not common foraging strategy in termite species; which included the establishment of trails followed by construction of tunnels. Such foraging strategies occur predominantly at night and soldiers play a key role in the foraging process. This foraging strategy reported here seems to be employed to optimize energetic gain.

  10. Physicochemical characteristics of commercial umbu pulp (Spondias tuberosa Arruda Câmara: concentration effect

    Directory of Open Access Journals (Sweden)

    Jaqueline Santos Bastos

    2016-03-01

    Full Text Available The umbu is the umbuzeiro fruit (Spondias tuberosa Arr. Cam. which is a tree native of the Brazilian backlands. The aim of this work was to evaluate the physical and chemical properties of commercial and concentrated umbu pulp to be used as raw material in the production of structured. The commercial pulp (2.5 kg was acquired in the trade of Feira de Santana. The concentration of the evaporator route pulp vacuo to increase the soluble solids content of 8.5ºBrix to 15.5ºBrix It was held in the Food Chemistry Laboratory of the State University of Feira de Santana. It was obtained after concentrating a yield of 41.12% by mass of fruit pulp. The concentration process had no influence in the nutritional value of umbu pulp. The concentrated pulp had the following properties pH (2.43, soluble solids (15.5°Brix, acidity (3.11 g citric acid/100 g, total protein (1.28% - w/v, vitamin C (4.36 mg/100 g - w/v, reducing sugars (6.08% - w/v, total sugars (13.55% - w/v non reducing sugars (7.46% - w/v and ash (0.42% - w/v. The physicochemical characteristics of commercial umbu pulps had similar pH, Total Soluble Solids, acidity, proteins and ashes; higher values of reducing sugars and non-reducing and a lower vitamin C content that the pulps reported in the literature. The concentration process produced an increase in Total Soluble Solids, proteins, acidity, reducing and non reducing sugars and ash content. However there was a decrease in vitamin C concentration of the pulp.

  11. Pengaruh Kombinasi Media Tanam dan Pemupukan terhadap Pertumbuhan Biji Tumbuhan Sarang Semut (Myrmecodia tuberosa Jack.

    Directory of Open Access Journals (Sweden)

    Yanti Puspita Sari

    2016-03-01

    Full Text Available Anthill plant (Myrmecodia tuberosa Jack. or sarang semut is a native plant epiphytes from Indonesia. Anthill plants used as a medicinal because contains compounds active such as flavonoids, tannins and polyphenols that are beneficial to the human body. The aims of study to determine the influence of the media type of planting and the best of fertilization on the growth of anthill plants. This study consisted of two treatment are the first treatment plant seed germination anthill on different media of treatments that husk fuel, cocopeat, fern roots and moss. The second treatment is growth plant of anthill are using completely randomized design (CRD with two factors different. The first factor is the growing media with 4 levels of fuel treatments, husk fuel, cocopeat, fern roots and moss. The second factor is a fertilizer with a second level of treatment that is with and without fertilizer (Gandasil D 2 g/L. Influence significantly of treatment we used Duncan test (DMRT level of 95%. The results of study in the first treatment, anthill plant can germinate 100% in all treatment media. In the second treatment, the use of growing media and fertilizer significantly influenced the increase of plant height, leaf number and leaf area. The average of plant height in moss media with the addition of fertilizer of 35.75 mm, the highest number of leaves from all treatment media with the addition of fertilizer of 2,00 strands, the largest leaf area from cocopeat media with the addition of fertilizer of 77,02 mm2, and the increase of tubers diameter found in cocopeat media with the addition of fertilizer of 4.13 mm.

  12. EFEITOS DA ESPESSURA DAS FATIAS E PRÉ-COZIMENTO NA QUALIDADE DE SALGADINHOS FRITOS (CHIPS DE TUBEROSAS TROPICAIS

    Directory of Open Access Journals (Sweden)

    W. F. ROGÉRIO

    2008-09-01

    Full Text Available

    O consumo de alimentos fritos e pré-fritos tem aumentado nos últimos anos. As culturas de mandioquinha-salsa (Arracacia xanthorrhiza, batata doce (Ipomoea batatas, taro (Colocasia esculenta e inhame (Dioscorea alata apresentam potencial significativo de crescimento como matérias-primas industriais. Este trabalho teve por objetivo analisar os efeitos da espessura das fatias e pré-cozimento na qualidade de salgadinhos fritos dessas tuberosas tropicais. Os resultados obtidos mostraram que a espessura das fatias é um fator determinante sobre a absorção de gordura e aceitação do produto em todas as tuberosas analisadas, sendo que com a espessura de dois milímetros ocorreu uma menor absorção de gordura para todas as tuberosas. O pré-cozimento das fatias interfere no rendimento do processo. O processamento das tuberosas levou á alterações de cor nos produtos finais.

  13. An Apple Fruit Fermentation (AFF) Treatment Improves the Composition of the Rhizosphere Microbial Community and Growth of Strawberry (Fragaria × ananassa Duch ‘Benihoppe’) Seedlings

    Science.gov (United States)

    Bu, Yufen; Shao, Wei; Huang, Weijing; Ji, Qianlong; Yao, Yuncong

    2016-01-01

    Plant growth can be promoted by the application of apple fruit fermentation (AFF), despite unclear of the underlying mechanisms, the effects involved in AFF on rhizosphere microorganisms have been hypothesized. We investigated the consequences of applying AFF alone or in combination with Bacillus licheniformis to strawberry tissue culture seedlings in vitro, the analyses of Denaturing Gradient Gel Electrophoresis (DGGE) and 16S rDNA were performed to determine AFF effects on rhizosphere. Moreover, the growth index and antioxidant enzyme activities were determined 30 days after treatments. We identified five dominant bacteria in AFF: Coprinus atramentarius, Bacillus megaterium, Bacillus licheniformis, Weissella and B. subtilis. The greatest number of bacterial species were observed in the rhizosphere of control matrix (water treated), and the lowest diversity appeared in the rhizosphere soil treated with 108 cfu/mL B. licheniformis alone. Combining AFF plus B. licheniformis in one treatment resulted in the largest leaf area, plant height, root length, plant weight, and the markedly higher activities of antioxidant enzymes. We conclude that a combination of AFF plus B. licheniformis treatment to matrix can increase antioxidant enzymes activities in strawberry seedlings, optimize the status of rhizosphere microbial, and promote plant growth. PMID:27755580

  14. Diterpenóides com esqueleto cleistantano de Vellozia aff. carunculares martius ex seubert (Velloziaceae

    Directory of Open Access Journals (Sweden)

    Silva Gilson Cruz da

    2001-01-01

    Full Text Available From the hexane extract of leaves, stem and roots, of Vellozia aff. carunculares, fourteen cleistanthane diterpenoids were detected by HRGC-MS, through the analysis of their fragmentation patterns. Comparison of their MS spectra with those of authentic standards previously isolated from other species of the family Velloziaceae allowed the identification, with a high degree of confidence, of eigth known cleistanthane diterpenoids. Of these, four were isolated and identified from their MS, IR and ¹H and 13C NMR spectra, as the known cleistantha-8,11,13-trien-7-one, cleistantha-8,11,13-trien-3,7-dione, cleistantha-1,8,11,13-tetraen-3,7-dione and the first reported 6-alpha-hydroxy-cleistantha-8,11,13-trien-7-one. The triterpenoid beta-amyrin was also isolated.

  15. CARACTERIZAÇÃO HISTOQUÍMICA DOS FOLÍOLOS DE SPONDIAS TUBEROSA ARRUDA (ANACARDIACEAE LINDL.

    Directory of Open Access Journals (Sweden)

    Osmar Nascimento-Silva

    2008-01-01

    Full Text Available Is a native species of the Brazilian half-barren, pertaining to the family Anacardiaceae Lindl., being of importance socioeconomic for the populations of these regions. With intention to supply subsidies that contribute for optimum knowledge of the species, the present work has for objective the histochemistry characterization of leaflets of Spondias tuberosa Arruda. For this study cuts of the transversal from medium portion of leaflets, submitting them later the diverse reagents and corantings. The analyses had evidenced the starch granule presence, oxalate of calcium crystals, greasy composites, resins, phenolic composites and tannins. Mucilages peptics and reducing sugars had not been found in no tissues to leaflet. One expects that the results of the histochemistry tests serve as elements to qualitative comparison for identification of phytotherapeutics drugs and to the prospection of the principle(s active(s of the vegetable.

  16. Analysis of umbu (Spondias tuberosa Arruda (Anacardiaceae)) in different landscape management regimes: a process of incipient domestication?

    Science.gov (United States)

    Lins Neto, Ernani Machado de Freitas; Peroni, Nivaldo; Maranhão, Christine Maria Carneiro; Maciel, Maria Inês Sucupira; de Albuquerque, Ulysses Paulino

    2012-07-01

    Plant domestication is an evolutionary process guided by human groups who modify the landscape for their needs. The objective of this study was to evaluate the phenotypic variations between populations of Spondias tuberosa Arruda (umbuzeiro) when subjected to different local landscape management strategies. The influence of the landscape management system on these populations was evaluated in five identified regional units (mountains, base of mountains, pastures, cultivated areas and home gardens). Ten individuals were randomly selected from each region and subjected to morphological and chemical fruit analysis. The diversity index, based on Simpson's index, was determined for the different populations. We then evaluated the morphological differences between the individual fruits from the distinct landscape areas. We observed no significant differences in morphological diversity between the areas studied. Our data suggest that the umbuzeiro specimens in this region may be in the process of incipient domestication.

  17. Injuries caused by animals to young imbuzeiro (Spondias tuberosa Arruda plants in native and degraded caatinga areas

    Directory of Open Access Journals (Sweden)

    Luiza Teixeira de Lima Brito

    2009-12-01

    Full Text Available This study had the objective of evaluating the injuries caused by animals to young imbu tree (Spondias tuberosa Arruda plants in native and degraded Caatinga areas, between the years 1997 and 2002. One thousand imbu tree scions were planted, being 500 in a degraded Caatinga area at the community of Alto do Angico, Petrolina-PE, and 500 in a native Caatinga area at the Caatinga Experimental Station of Embrapa Tropical Semi-Arid, Petrolina-PE. At every 30 days after having planted the scions, data were collected regarding survival and injuries caused by animals to the plants. The results showed that goats are responsible for the reduction on survival rates and for the slow development of young imbu tree in the degraded Caatinga area. In the native Caatinga area, of the collared peccary (Tayassu tajacu and armadillo (Euphractus sexcinctus caused the highest injury levels.

  18. Effects of water-soluble fraction of petroleum on growth and prey consumption of juvenile Hoplias aff. malabaricus (Osteichthyes: Erythrinidae

    Directory of Open Access Journals (Sweden)

    R. M. Santos

    Full Text Available Abstract The influence of the water-soluble fraction of petroleum (WSF on prey consumption and growth of juvenile trahira Hoplias aff. malabaricus was investigated. Juveniles were submitted to either WSF or Control treatment over 28 days, and jewel tetra Hyphessobrycon eques adults were offered daily as prey for each predator. Total prey consumption ranged from 16 to 86 individuals. Despite the initially lower prey consumption under WSF exposure, there were no significant differences in overall feeding rates between the two treatments. Water-soluble fraction of petroleum had a negative effect on the growth in length of H. aff. malabaricus juveniles. Although unaffected, prey consumption suggested a relative resistance in H. aff. malabaricus to WSF exposition and the lower growth of individuals exposed to WSF than the Control possibly reflects metabolic costs. The implications of the main findings for the individual and the food chain are discussed, including behavioral aspects and the role played by this predator in shallow aquatic systems.

  19. Sicil Affı Yasası 2017 yılında çıkıyor.

    OpenAIRE

    Reza

    2016-01-01

    Kara Liste ve sicil affı yasası 2017 yılı itibaryle gün yüzüne çıkıyor ve birçok kişinin halihazırda iyi haberlerini beklediği yasa tasarısı meclise sunuldu. 11 milyondan fazla bireysel 2 milyondan fazla kurumsal şirketin yararlanacağı bu yasanın meclisten çok yüksek ihtimalle geçeceği ön görülüyor. 2017 ocak ayında geçmesi planlanan sicil affı için kısaca geri sayım başladı diyebiliriz. Kara listede bulunuyorsanız veya yasal takibe düştüyseniz bu aftan yararlanabileceksiniz. Sicil affı yasas...

  20. PRODUÇÃO DE MUDAS DE UMBUZEIRO (Spondias tuberosa Arruda Câmara EM DIFERENTES SUBSTRATOS E TAMANHO DE RECIPIENTES

    Directory of Open Access Journals (Sweden)

    Flávio Ricardo da Silva Cruz

    2016-01-01

    Full Text Available The species Spondias tuberosa Arr. Cam. (umbuzeiro stands out as one of the tree species with the greatest potential of the Brazilian semiarid. Even though it’s significant socioeconomic and environmental importance, there is a lack of studies aimed at establishing a seedlings production model of this kind of plant. The purpose of this study was to evaluate the production of seedlings Spondias tuberosa using different substrates and size of bags. The experiment was conducted in the nursery of the Plant Ecology Laboratory (LEV from the Agrarian Sciences Center (CCA of the Federal University of Paraiba (UFPB, Areia/ PB. The experimental design was a randomized block in factorial 2 x 7 and subdivided blocks containers plots and subplots substrates. It were used substrates formulated from the starting mixture of subsoil land (37.5-100%, sand (12.5-25% and tanned cattle manure (10-50%. The containers used were black polyethylene bags with a volume of 1900 cm 3 (15 x 27 cm and 5000 cm 3 (25 x 26 cm. To obtain seedlings of Spondias tuberosa seeds were sown in seed masonry until the transplant (90 days after sowing. At 78 days after transplanting the seedlings were evaluated for height, root collar diameter, relationship shoot/root collar diameter, xylopodium diameter, root length, dry weigh of shoot and root. The datas were subjected to analysis of variance and F test, measured and compared by Tukey test at 5% probability, using the software SISVAR ® . The substrates with cattle manure provided higher values for height and root length. For the seedlings production of Spondias tuberosa , is recommended substrate subsoil land (45% + sand (15% + cattle manure (40%.

  1. Feeding ecology of the copepod Lucicutia aff. L. grandis near the lower interface of the Arabian Sea oxygen minimum zone

    Science.gov (United States)

    Gowing, Marcia M.; Wishner, Karen F.

    Feeding ecology of the calanoid copepod Lucicutia aff. L. grandis collected in the Arabian Sea at one station during the Spring Intermonsoon and during the Southwest Monsoon of 1995 was studied with transmission electron microscopy of gut-contents. Highest abundances of these animals occurred from ˜400 to 1100 m, near the lower interface of the oxygen minimum zone and at the inflection point where oxygen starts to increase. We expected that their gut-contents would include particles and cells that had sunk relatively undegraded from surface waters as well as those from within the oxygen minimum zone, and that gut-contents would differ between the Spring Intermonsoon and the more productive SW Monsoon. Overall, in both seasons Lucicutia aff. L. grandis was omnivorous, and consumed a variety of detrital particles, prokaryotic and eukaryotic autotrophs, gram-negative bacteria including metal-precipitating bacteria, aggregates of probable gram-positive bacteria, microheterotrophs, virus-like particles and large virus-like particles, as well as cuticle and cnidarian tissue. Few significant differences in types of food consumed were seen among life stages within or among various depth zones. Amorphous, unidentifiable material was significantly more abundant in guts during the Spring Intermonsoon than during the late SW Monsoon, and recognizable cells made up a significantly higher portion of gut-contents during the late SW Monsoon. This is consistent with the Intermonsoon as a time when organic material is considerably re-worked by the surface water microbial loop before leaving the euphotic zone. In both seasons Lucicutia aff. L. grandis had consumed what appeared to be aggregates of probable gram-positive bacteria, similar to those we had previously found in gut-contents of several species of zooplankton from the oxygen minimum zone in the eastern tropical Pacific. By intercepting sinking material, populations of Lucicutia aff. L. grandis act as a filter for carbon

  2. Histological alterations in liver and testis of Astyanax aff. bimaculatus caused by acute exposition to zinc

    Directory of Open Access Journals (Sweden)

    Daiane Cristina Marques dos Santos*

    2015-04-01

    Full Text Available This study investigated the effect of acute exposition to zinc (Zn on histology of the liver and testes of yellow tail lambari (Astyanax aff. bimaculatus. The exposure consisted of six concentrations of Zn (0, 3, 5, 10, 15, and 20 mg/L for 96 hours of exposure. Fragments of liver and testis were routinely processed and embedded in plastic resin based on glycol methacrylate. Fragments of bones, muscles, liver and testis were dehydrated and digested to quantify the absorption levels of Zn in the tissue. Acute exposure to concentrations above 10mg/L has produced structural changes in the liver and gonads. The changes found in the liver were vascular congestion; decrease of cellular volume; displacement of the hepatocyte nucleus; necrosis; disarrangement of cordon structure; leukocyte infiltrate and vacuolization. The changes found in the gonads were ruptured cyst, delayed development of germ cells, pyknotic nucleus, cell cluster, displacement of cyst wall and vacuolization. The histological changes observed were compatible with the increasing concentration of zinc in environment, compromising liver and reproductive functions, because there was an increase in relative frequency of hepatocytes and reduced sperm production

  3. Large scale artificial rearing of Anastrepha sp.1 aff. fraterculus (Diptera: Tephritidae in Brazil

    Directory of Open Access Journals (Sweden)

    Julio Marcos Melges Walder

    2014-08-01

    Full Text Available Some species of the genus Anastrepha (Diptera: Tephritidae are successfully managed by matching the sterile insect technique with parasitoid releases. Such strategies used in integrated pest management can be implemented only where insect mass-rearing programs are feasible. In this study, we show the process of domestication, rearing technology and quality control data obtained from 54 generations of Anastrepha sp.1 aff. fraterculus (Wiedemann, 1830 kept under fully artificial conditions. Eggs were collected by an artificial oviposition panel consisting of one side of the cage made of blue voile fabric externally covered with a thin layer of silicon rubber. They were then air-bubbled in water at 25 ºC for 48 h before seeding. Larvae were reared on the regular laboratory artificial diet with 66 % of agar reduction turning over a semi-liquid diet, which reduced costs and improved insect quality. The adult and larval diets were composed of local ingredients including hydrolyzed yeast. When large-scale production of this fly is contemplated, the critical stage is larval development. This system of artificial rearing for A. fraterculus sp.1 developed in Brazil, allows for the production of a large number of insects of excellent quality using local ingredients and less agar in diet composition than the original medium used for this species. By reducing the interval of egg collection, the system might be optimized in terms of insect yield and, therefore, meet the demands of A. fraterculus sp.1 with regard to integrated pest management purposes.

  4. Modeling natural photic entrainment in a subterranean rodent (Ctenomys aff. knighti, the Tuco-Tuco.

    Directory of Open Access Journals (Sweden)

    Danilo E F L Flôres

    Full Text Available Subterranean rodents spend most of the day inside underground tunnels, where there is little daily change in environmental variables. Our observations of tuco-tucos (Ctenomys aff. knighti in a field enclosure indicated that these animals perceive the aboveground light-dark cycle by several bouts of light-exposure at irregular times during the light hours of the day. To assess whether such light-dark pattern acts as an entraining agent of the circadian clock, we first constructed in laboratory the Phase Response Curve for 1 h light-pulses (1000lux. Its shape is qualitatively similar to other curves reported in the literature and to our knowledge it is the first Phase Response Curve of a subterranean rodent. Computer simulations were performed with a non-linear limit-cycle oscillator subjected to a simple model of the light regimen experienced by tuco-tucos. Results showed that synchronization is achieved even by a simple regimen of a single daily light pulse scattered uniformly along the light hours of the day. Natural entrainment studies benefit from integrated laboratory, field and computational approaches.

  5. Semillas de Spondias tuberosa oriundas de frutos cosechados en cuatro estadios de maduración y almacenadas Seeds of Spondias tuberosa originated from fruits harvested at four maturation stages and stored

    Directory of Open Access Journals (Sweden)

    Adalgisa A. de Souza

    2005-09-01

    Full Text Available Las condiciones climatológicas que son peculiares de la región semiárida ofrece de forma natural plantas propicias a la explotación humana, las cuales se destaca la Spondias tuberosa Arruda Câmara, cuyo fruto es cosechado de forma extractivita y desordenada, poniendo en riesgo su perpetuación. El propósito de esta investigación fue analizar el tiempo de almacenamiento de semillas, el ambiente y el estadio de maduración del fruto que sea más adecuado a una buena propagación de esa especie fructífera. El ensayo se llevó a cabo en casa de vegetación del Centro de Ciencias Agrarias, CCA, Areia, PB. Se utilizó un diseño experimental de bloques al azar, en esquema factorial 5 x 2 x 4, con cuatro repeticiones. Las variables estudiadas fueron el porcentaje de germinación, vigor, número de brotes, altura de plantas, diámetro y longitud de túbera. Semillas mantenidas bajo condiciones ambientes, durante ocho meses de almacenamiento alcanzaron mayor uniformidad de germinación, potencial germinativo (90% y vigor (0,505. Las semillas más adecuadas a la optimización de buena germinación fueron aquéllas oriundas de frutos maduros (87% y muy maduros (90%.The peculiar climatic conditions of the semi-arid area offer plants for the human exploration in natural a way among these, stands out the Spondias tuberosa Arruda Câmara, whose fruit is havested in an extractive and disorganized way, putting in risk its perpetuation. The objective of this study was to verify the storage period of the seeds, the environments and the stage of fruit maturation most adopted to a good propagation of the species. The experiment was conduted in a greenhouse at the Center of Agricultural Sciences, (CCA, Areia, UFPB, PB. The experimental design used was a completely randomized in a factorial scheme (5 x 2 x 4, with four repetitions. The studied variables were the germination percentage, vigour (index of germination speed, number of sprouts, height of plants

  6. Extraction and partial characterization of venom from the Colombian spider Pamphobeteus aff. nigricolor (Aranae:Theraphosidae).

    Science.gov (United States)

    Estrada-Gomez, Sebastian; Vargas Muñoz, Leidy Johana; Quintana Castillo, Juan C

    2013-12-15

    We report the first studies of characterization and extraction of the Pamphobeteus aff. nigricolor (Pocock, 1901) (Aranae:Theraphosidae) venom done in Colombia using the electro-stimulation technique previous anesthesia with isofluorane. After each extraction process, a low viscosity, colorless venom was obtained. This venom showed a 1.01 mg/μl density and a pH of 5. The humidity percentage did not show a significance difference between males and females (P > 0.05) with a general media of 77.49 ± 1.74%. In all cases the venom yielded was variable between males and females, with a media of 22.45 ± 5.17 mg (wet weight) and 4.58 ± 0.94 mg (dry weigh), obtaining larger amounts in females, 28.34 ± 7.49 mg and 5.69 ± 1.36 (wet and dry weight respectively). Venom showed a hemolytic activity dependent of enzymatic active phospholipase and neither coagulant nor proteolytic activities were observed. Electrophoretic profile showed a main protein content with a molecular mass below 14 kDa. RP-HPLC venom profile revealed a difference among male and female venom's content where 17 and 21 main fractions were obtained respectively. Three peptides, Theraphotoxin-Pn1a, Theraphotoxin-Pn1b and Theraphotoxin-Pn2a, were identified using HPLC-nESI-MS/MS. These peptides showed a high identity with other peptides found on Theraphosides which are proved to affect voltage-gated calcium channels.

  7. Evaluation of growth, cell size and biomass of Isochrysis aff. galbana (T-ISO with two LED regimes

    Directory of Open Access Journals (Sweden)

    Miguel Victor Cordoba-Matson

    2013-04-01

    Full Text Available In contrast to crops, there are fewer studies using LED-based light with green microalgae and none cultivating the microalga Isochrysis aff. galbana (T-ISO even though of its importance in marine aquaculture. The objective was to evaluate of white and red LEDs as an alternative source of light to cultivate I. aff. galbana (T-ISO. In order to carry this out white and red LEDs were used with a laboratory built Erlenmeyer-type photobioreactor to determine productivity, cell number and size and biomass composition. Results were compared with standard fluorescent lights of the same light intensity. The culture system consisted of 3 flasks for applying red LEDs and three for white LEDs and 3 control group flasks illuminated with the normal fluorescent lighting at the similar light intensity of ~60 mM m–2 s–1. It was found that the population cell density did not significantly increase with either red LEDs or white LEDs (p > 0.05, if at all. Standard fluorescent lighting (control group showed significant increases in population cell number (p < 0.05. Through microscopic observation cell size was found to be smaller for white LEDS and even smaller for red LEDs compared to fluorescent lighting. Biochemical composition of proteins, carbohydrates and lipids was similar for all light regimes. The authors suggest that the unexpected non-growth I. aff. galbana (T-ISO, a haptophyte microalga, with white and red LEDs is possibly due to fact that to initiate cell growth this microalgae requires other wavelengths (possibly green besides red and blue, to allow other pigments, probably fucoxanthin, to capture light

  8. Biological aspects of Leucothyreus alvarengai Frey and Leucothyreus aff. semipruinosus Ohaus (Coleoptera, Melolonthidae, Rutelinae in crop succession at central Brazil

    Directory of Open Access Journals (Sweden)

    Alex Furquim Pereira

    2013-09-01

    Full Text Available Biological aspects of Leucothyreus alvarengai Frey and Leucothyreus aff. semipruinosus Ohaus (Coleoptera, Melolonthidae, Rutelinae in crop succession at central Brazil. Beetles of the family Melolonthidae make up a large group and some species are considered pests of planted crops. Little information is available on the basic biological aspects of the genus Leucothyreus, such as association with cultivated crops and their occurrence periods. Therefore studies were developed in soybean and corn crops in Tangará da Serra, Mato Grosso, Brazil, with the objective of studying the occurrence and biological aspects of Leucothyreus alvarengai Frey and Leucothyreus aff. semipruinosus Ohaus. For acquisition of immature specimens of both species, in April 2011 sampling was performed in corn fields, in July and October in the fallow area, and in soybeans fields planted in December; in 2012 sampling was performed in January and February in soybean fields and in March in corn fields. In 2011 the total number of larvae obtained in April, July, October and December were 100, 6, 30 and 27, and in January, February and March of 2012 these quantities were 32, 52 and 65 larvae, respectively. In all sampling events the larvae of L. alvarengai were collected in greater quantity. At the beginning of the reproductive period of L. alvarengai and L. aff. semipruinosus, it was observed that the adults began to fly and soon after started oviposition in the field in September. The appearance of larvae coincides with the time of soybean planting in the field, thus the larvae feed on roots of soybean plants at the beginning of their development and the cycle from egg to adult of the two species was completed in one year.

  9. Feeding of Hoplias aff. malabaricus (Bloch, 1794 and Oligosarcus robustus Menezes, 1969 in a lagoon under estuarine influence, Pelotas, RS

    Directory of Open Access Journals (Sweden)

    Fabiano Corrêa

    2009-09-01

    Full Text Available The objective of the present paper was to study the diets of Hoplias aff. malabaricus and Oligosarcus robust in “Pequena Lagoon” and evaluate the importance of estuarine organisms in the feeding of freshwater fish. A total of twelve food categories were identified and it was established that the fish resource was the most frequent in the diet of both species. Euryhaline fish such as Mugil platanus mullets and Odontesthes argentinensis silversides were common items in the diets of these two species, which included not only freshwater fish but also euryhaline fish from the adjacent estuarine zone, integrating both resources in the food chain.

  10. ESTRESSE SALINO EM PLANTAS DE Spondias tuberosa Arruda (Câmara COLONIZADAS COM FUNGOS MICORRÍZICOS ARBUSCULARES

    Directory of Open Access Journals (Sweden)

    Magnólia Góes Silva

    2009-01-01

    Full Text Available The agriculture soil in the semi-arid Brazilian Northeast, it finds, in many areas, degraded by the utilization of not sustainable practice. This work proposed to evaluate the effect of increasing NaCl levels in the soils under Spondias tuberosa plants colonized with arbuscular mycorrhizal fungi. Under greenhouse conditions, Spondias seeds were going placed to germinate in trays with mycorrhizal soil and in trays with soil autoclavado. The germination occurred 15 days after the planting and in the 30th cultivation day, the plants were going transferred to plastic vases with capacity for 2 L of nutritious solution with the next NaCl doses: 0, 100 and 150 mM. They were monitored the transpiration rate and stomatal conductance until the plants introduced toxicity symptoms to the Na+. After the saline stress suspending, they were evaluated the N, P, K, S, Ca, Mg, Na and Cl contents in the drought matter of the aerial part (stem + leaves and root. It was going observed the reduction in radicular phytomass and aerial in NaCl first-level regarding the control. Stomatal conductance in plants not micorrizadas was equally reduced. In the root, it was observed significant reductions in Ca, K and Mg contents for the mycorrhizal plants and not mycorrhizal. In the leaves, the increase of NaCl dose induced a substantial reduction in the Ca, Mg and N contents and probably it was caused the reduction in the mass drought production.

  11. EMERGÊNCIA E SOBREVIVÊNCIA DE PLÂNTULAS DE IMBUZEIRO (Spondias tuberosa Arruda NA CAATINGA

    Directory of Open Access Journals (Sweden)

    Nilton de Brito Cavalcanti

    2006-01-01

    Full Text Available This work had as objective to evaluate the emergency and the survival of seedlings of imbu tree (Spondias tuberosa Arruda in caatinga. The assay was carried through of January of 2001 the December of 2004 with 37 plants of imbu tree, selected to perhaps in area of caatinga of the Embrapa Semi-Árido, Petrolina - PE. In each plant four quadrants of 1 m2 had been demarcated randomized below of the pantry for counting of the emergency and survival of seedlings. The comments had been carried through to each 15 days in the rainy station and 30 days in the dry station. A rain gauge was installed in the area of the experiment for attainment of the values of the occurred precipitation during the period of evaluation. The biggest indices of emergency had occurred in the period of bigger precipitation with 57,89 plântulas.m-2, in average, for plant-mother in the rainy station of 2004. Few seedlings had survived until the end of the period of evaluation. The stadium seedling is most critical for the survival and development of the imbu tree in caatinga. The biggest volume of precipitation significantly contributed for a bigger tax of germination and emergency of seedlings of imbu tree.

  12. Natural regeneration and dispersion of seeds of the imbuzeiro (spondias tuberosa Arruda in the Pernambuco hinterland, Brazil

    Directory of Open Access Journals (Sweden)

    Luiza Teixeira de Lima Brito

    2009-08-01

    Full Text Available This work had as objective to evaluate the dispersion of the seeds of imbuzeiro (Spondias tuberosa Arruda for the animals and the survival of plants in caatinga. The work was carried out in the period from October of 2002 to December of 2005 in degraded and native area of caatinga. They had been selected to perhaps, 16 plants of imbuzeiro, being eight plants in each area. In each plant twelve transectos of 1 m of width for 25 m had been demarcated, where the seeds found in the young ground and plants. The used experimental delineation was block-type to perhaps in factorial project 5 x 2, with four repetitions. 1003.5 seeds.m-2 had been, on average, in the first units you show of caatinga native and in caatinga degraded, it was observed, on average, 31.25 seeds m-2. In the native area of caatinga they had been registered 2.5 plants m-2, on average, in the first units you show during the rainy station. The dispersive ones of the seeds observed in the native area of catinga had been the deer-catingueiro (Mazama gouazoubira, the cotia (Dasyprocta cf. prymnolopha, caititu (Tayassu tajacu, the fox (Dusicyon thous, the teiú (Tupinambis merianae, the tatu-peba (Euphractus sexcinctus of the guará (Procyon cancrivous the area of caatinga e na área de caatinga degraded the sheep (Capra hircus.Key-words: rain, tree, seedlings, emergency, germination.

  13. Caracal depereti nov. Sp. Y felis aff. Silvestris (felidae, mammalia del plioceno inferior de layna (Soria, España

    Directory of Open Access Journals (Sweden)

    Salesa, M. J.

    2003-08-01

    Full Text Available Two species of small-medium size felids, Felis aff. silvestris and Caracal depereti nov. sp., have been identified from the Pliocene karstic locality of Layna (Soria, Spain. Caracal depereti nov. sp. shows close affinities with Caracal issiodorensis, species that has been traditionally classified in the genus Lynx. This new interpretation implies that there are no evidences of lynxes in the Pliocene of Westem Europe, and probably this consideration can be applicable to other Eurasiatic localities where Lynx issiodorensis has been determined.Dos especies de félidos de talla pequeña a media, Felis aff. silvestris y Caracal depereti nov. sp., han sido identificadas en el yacimiento cárstico plioceno de Layna, Soria. Caracal depereti nov. sp. muestra estrechas afinidades con Caracal issiodorensis, especie que tradicionalmente ha sido clasificada en el género Lynx. Esta interpretación implica que no hay evidencias de linces en el Plioceno de Europa occidental, y probablemente esta consideración pueda aplicarse a otros yacimientos pliocenos de Eurasia, en los que se ha determinado Lynx issiodorensis.

  14. Foraging of Scaptotrigona aff. depilis (Hymenoptera, Apidae in an Urbanized Area: Seasonality in Resource Availability and Visited Plants

    Directory of Open Access Journals (Sweden)

    Letícia Biral de Faria

    2012-01-01

    Full Text Available The floral sources used by bees can be identified by analyzing pollen grains obtained from their bodies, feces, brood cells, or storage pots in the nests. In addition to data on resource availability, this information enables the investigation on the selection of food resource by bees. We assessed the foraging patterns of Scaptotrigona aff. depilis in an urbanized area with seasonal availability of food resources. The species visited a percentage of 36.60% of the available flora, suggesting that these bees are selective at spatiotemporal scale. When many types of resources were available, the workers concentrated their collection activities on a limited group of sources. In contrast, more plant species were exploited during periods of lower number of flowering plants. A monthly analysis of the foraging patterns of the studied colonies revealed that Syzygium cumini (88.86%, Mimosa sp.1 (80.23%, Schinus terebinthifolius (63.36%, and Eucalyptus citriodora (61.75% were the most frequently used species and are therefore important for maintaining S. aff. depilis at the study area. These plants are close to the colonies and exhibit mass flowering. This study is one of few works to quantify natural resource availability and to analyze the effects of flowering seasonality on the selection of food sources by bees.

  15. Desenvolvimento de dispositivo caseiro para dessalinização de água salobra a partir de sementes de umbu (Spondias tuberosa Arruda Câmara

    Directory of Open Access Journals (Sweden)

    Joilma da S. Menezes

    2012-01-01

    Full Text Available The goal of this work was to develop a homemade device to desalinate brackish water, using biological material like seeds from different plant species of the semi arid regions. Umbu seeds (Spondias tuberosa Arruda Câmara were found to be the most appropriate material, removing a higher quantity of salt from the water compared to the other tested materials. The salt content in 1 L of brackish water typical of the region can be removed with only 1 g of the material, if the water is heated to 50 °C and it may also lower the water hardness, achieving drinking water standards.

  16. Desenvolvimento de dispositivo caseiro para dessalinização de água salobra a partir de sementes de umbu (Spondias tuberosa Arruda Câmara)

    OpenAIRE

    Joilma da S. Menezes; Vânia P. Campos; Costa,Tadeu A. C.

    2012-01-01

    The goal of this work was to develop a homemade device to desalinate brackish water, using biological material like seeds from different plant species of the semi arid regions. Umbu seeds (Spondias tuberosa Arruda Câmara) were found to be the most appropriate material, removing a higher quantity of salt from the water compared to the other tested materials. The salt content in 1 L of brackish water typical of the region can be removed with only 1 g of the material, if the water is heated to 5...

  17. Astrocitoma subependimario de células gigantes asociado a complejo de esclerosis tuberosa: recomendaciones para el diagnóstico oportuno y tratamiento.

    OpenAIRE

    Matilde Ruiz; Sandra Sánchez; Alejandro Rea; Roberto Sanromán; Joao García; Antonio Bravo; Infante Cantú; Hugo Ceja; Ariadna González; María del Mar Sáez

    2015-01-01

    RESUMEN El complejo de esclerosis tuberosa es una enfermedad genética poco frecuente, autosómica dominante con fenotipo y expresión clínica muy variables. Se caracteriza por alteraciones en la migración, diferenciación y proliferación celulares con formación de múltiples tumores benignos llamados hamartomas, las cuales afectan principalmente piel, encéfalo, riñón, ojo, corazón y pulmón. Los astrocitomas subependimarios de células gigantes son tumores benignos de crecimien...

  18. Morfogénesis in vitro, identificación y control de hongos contaminantes y efecto de rayos gamma en nardo (Polianthes tuberosa L.)

    OpenAIRE

    Estrada Basaldua, Jorge Adán

    2012-01-01

    La planta endémica de México conocida como nardo (Polianthes tuberosa L.) es importante para la industria farmacéutica y del perfume y como flor de corte, por lo que se justifica el desarrollo de técnicas como el cultivo de tejidos vegetales y técnicas de inducción de mutaciones que induzcan la generación de variación genética y faciliten el mejoramiento genético de esta especie. Sin embargo, es necesaria la identificación de los hongos contaminantes que eventualmente aparecen ...

  19. Superação da dormência de sementes de umbuzeiro (Spondias tuberosa, Arr. Câm. utilizando diferentes métodos Overcoming dormancy of 'umbuzeiro' seeds (Spondias tuberosa, Arr. Câm. by using different methods

    Directory of Open Access Journals (Sweden)

    Paulo Sérgio Nascimento Lopes

    2009-09-01

    Full Text Available Vários frutos de espécies nativas da região semiárida possuem grande potencial de comercialização, dentre eles destaca-se o umbuzeiro (Spondias tuberosa, Arr. Câmara. Entretanto, cultivos comerciais desta espécie são limitados pela dificuldade da obtenção de mudas, em função principalmente da dormência de suas sementes. Desta forma, o objetivo do presente estudo foi avaliar os métodos de superação de dormência da semente de umbuzeiro, visando a promover incrementos nas taxas de germinação, uniformidade e vigor das plântulas. Foram montados dois experimentos independentes. Os tratamentos do primeiro experimento foram: testemunha, imersão dos pirênios em água por 24 horas, imersão dos pirênios em solução de ácido giberélico com 1.000 mg/L por 24 horas, escarificação dos pirênios com ácido sulfúrico PA por 10 minutos e escarificação mecânica. No segundo experimento, os tratamentos consistiram em se plantar os pirênios com 0; 30; 60; 90; 120; 150; 180 e 210 dias de armazenados em sacos de papel sob condições de laboratório, a uma temperatura média de 22,5C° e umidade relativa do ar média de 65%. No primeiro estudo, constatou-se que houve efeito significativo dos métodos de superação de dormência, sendo que escarificação mecânica foi o que apresentou os melhores resultados, com uma taxa de germinação média aos 60 dias pós-plantio de 26,6%. Já no segundo, as sementes armazenadas influenciaram positivamente na germinação e no vigor da plântula. Os melhores resultados para uniformidade e porcentagem de germinação (83% foram obtidos entre 120 e 210 dias de armazenamento das sementes, enquanto para o comprimento e massa fresca da radícula e hipocótilo foram entre 120 e 150 dias.Several fruits of native species of semi-arid region have great potential for commercialization, and among them there is the Spondias tuberosa. However, commercial cultivation of this species is limited by the

  20. Neuritogenic activity-guided isolation of a free base form manzamine A from a marine sponge, Acanthostrongylophora aff. ingens (Thiele, 1899)

    NARCIS (Netherlands)

    Zhang, B.; Miyamoto, T.; van Soest, R.W.M.

    2008-01-01

    Two manzamine-class alkaloids, manzamine A (1) and 8-hydroxymanzamine (2) were isolated from a Japanese marine sponge Acanthostrongylophora aff. ingens, together with three known alkaloids manzamine E (3), manzamine F (4), and manzamine X (5). The spectral features of 1 and 2 were different from the

  1. Cold seep biogenic carbonate crust in the Levantine basin is inhabited by burrowing Phascolosoma aff. turnerae, a sipunculan worm hosting a distinctive microbiota

    Science.gov (United States)

    Rubin-Blum, Maxim; Shemesh, Eli; Goodman-Tchernov, Beverly; Coleman, Dwight F.; Ben-Avraham, Zvi; Tchernov, Dan

    2014-08-01

    Biogenic calcium carbonate crusts represent a cryptic habitat that is often associated with hydrocarbon seeps. Most biological observations of these crusts concern the external surfaces and the fauna inhabiting their inner cavities are generally neglected. Exposed carbonates in areas of active seepage at the 1100-m-deep base of the Palmachim slumping feature in the Levantine basin are intensively burrowed by metazoans, especially by sipunculans (peanut worms), identified by genetic and morphological markers as a potentially novel Phascolosoma sp., closely related to Phascolosoma turnerae (Rice, 1985) and named here P. aff. turnerae. Bacterial 16S-based tag encoded FLX amplicon pyrosequencing (bTEFAP) was utilized to analyze the bacterial community associated with P. aff. turnerae. We compared the bacterial community structure in P. aff. turnerae to the bacterial community structure associated with the sediment-water interface in adjacent gas seeps and in biofilm covering the carbonate crust hosting the sipunculan. A distinctive microbiota, capable of chemosynthesis and sulfide detoxification, was found in association with P. aff. turnerae.

  2. Caracterización de la esclerosis tuberosa en pacientes que consultan al Hospital Universitario San Vicente de Paúl, Medellín, Colombia

    Directory of Open Access Journals (Sweden)

    Dagoberto Nicanor Cabrera Hémer

    2008-11-01

    Full Text Available La esclerosis tuberosa (ET es una enfermedad autosómica dominante, que afecta muchos sistemas y cursa con diversas manifestaciones clínicas, entre ellas epilepsia, retardo mental y lesiones cutáneas. Se hizo un estudio retrospectivo para contribuir a la caracterización de la esclerosis tuberosa en Medellín, Colombia. Se revisaron 21 historias, 62% mujeres y 38% hombres; la edad media al momento del diagnóstico fue 23 meses, todos los pacientes tenían epilepsia y lesiones cutáneas, las crisis más frecuentes fueron las parciales con generalización secundaria (66%, 47% tuvieron espasmos infantiles, la mayoría presentaron dos o más tipos de crisis (90%. Todos los pacientes recibieron anticonvulsivantes, los más frecuentemente utilizados fueron: fenobarbital, ácido valproico, vigabatrina, carbamazepina y clonazepam. En general, la mayoría de los pacientes requirieron varios medicamentos durante la evolución de su enfermedad y los pocos que lograron un adecuado control de la epilepsia, lo hicieron con anticonvulsivantes de primera generación. CONCLUSIÓN:las características de nuestra serie son similares a las reportadas en la literatura mundial. Los antiepilépticos de primera generación siguen siendo la principal herramienta terapéutica para el tratamiento inicial de los pacientes Medellín.

  3. Research on the Production of Eleocharis tuberosa Peel Fruit Wine%马蹄皮果酒制作的工艺研究

    Institute of Scientific and Technical Information of China (English)

    潘百明; 韦志园

    2012-01-01

    Fresh Eleocharis tuberosa peel was used as raw materials, after washing, drying, crushing and enzymatic juicing, fermenting broth was then made, and Eleocharis tuberosa peel fruit wine was finally produced through the fermentation of fermenting broth. The change in alcohol con- tent during the fermentation process was observed and the effects of fermenting temperature, inoculating quantity of yeast strains, and sugar con- tent in fermenting broth on the fermentation of yeast strains were studied. Finally, the best technical conditions were summed up as follows: sugar content was 12 %, fermenting temperature was at 32 ℃, and the inoculating quantity of yeast strains was 1%.%以新鲜的马蹄皮为原料,经过清洗、干燥、粉碎,酶解取汁制成发酵液,经发酵制成马蹄皮果酒。实验中分析了发酵过程中酒度的变化,研究发酵温度,酵母菌接种量和发酵液的糖度对酵母茵发酵的影响,最后得出马蹄皮发酵液的最佳发酵工艺条件:糖度为12%,发酵温度为32℃,接种量为1%。

  4. Development and validation of a high-performance liquid chromatographic method for the determination of stemoninine in rat plasma after administration of Stemona tuberosa extracts.

    Science.gov (United States)

    Jiang, Dengzhao; Yang, Xue; Liu, Hongbing; Guan, Huashi

    2011-04-01

    For the first time, an HPLC method was developed and validated for the determination of stemoninine in plasma after oral and intravenous administration of the extract of the roots of Stemona tuberosa to rats. Plasma samples were analyzed on a Waters reversed-phase C(18) column using a gradient mobile-phase of eluent A (water containing 0.1% formic acid and 0.2% triethylamine, pH 3.68) and eluent B (acetonitrile-water, 50:50, v/v). The flow rate was 1.0 mL/min and the detector wavelength was 210 nm. The Waters Oasis solid-phase extraction cartridge was applied for the preparation of plasma samples with high recovery. A good linear relationship was obtained in the concentration range of 1.55-124 µg/mL (r = 0.9995). The limits of quantification and detection were 1.55 and 0.42 µg/mL, respectively. The average recoveries ranged from 91.11 to 96.43% in plasma at stemoninine concentrations of 3.10, 62.0 and 99.2 µg/mL. Intra- and inter-batch coefficient of variations were 3.27-5.37% and 2.49-3.92%, respectively. This method was successfully applied to pharmacokinetic studies after oral and intravenous administration of Stemona tuberosa extract in rats.

  5. DDX6 transfers P-TEFb kinase to the AF4/AF4N (AFF1) super elongation complex

    Science.gov (United States)

    Mück, Fabian; Bracharz, Silvia; Marschalek, Rolf

    2016-01-01

    AF4/AFF1 and AF5/AFF4 are both backbones for the assembly of “super elongation complexes” (SECs) that exert 2 distinct functions after the recruitment of P-TEFb from the 7SK snRNP: (1) initiation and elongation of RNA polymerase II gene transcription, and (2) modification of transcribed gene regions by distinct histone methylation patterns. In this study we aimed to investigate one of the initial steps, namely how P-TEFb is transferred from 7SK snRNPs to the SECs. In particular, we were interested in the role of DDX6 that we have recently identified as part of the AF4 complex. DDX6 is an evolutionarily conserved member of the DEAD-box RNA helicase family that is known to control miRNA and mRNA biology (translation, storage and degradation). Overexpressed DDX6 is associated with different cancer types and with c-Myc protein overexpression. We could demonstrate that DDX6 binds to 7SK snRNA and causes the release and transfer of P-TEFb to the AF4/AF4N SEC. DDX6 also binds stably to AF4 and AF4N as demonstrated by GST pull-down and co-immunoprecipitation experiments. As a consequence, overexpression of either AF4/AF4N or DDX6 resulted in a strong increase of mRNA production (5-6 fold), while their simultaneous expression increased the cellular mRNA production by 11-fold. Conversely, the corresponding knockdown of DDX6 decreased mRNA production by 70%. In conclusion, AF4/AF4N and DDX6 represent key molecules for the elongation process of gene transcription and a model will be proposed for the hand-over process of P-TEFb to SECs. PMID:27679741

  6. Efeito dos conservantes sobre a densidade calórica em músculos de Hoplias aff. malabaricus (Bloch, 1794 (Osteichthyes, Erythrinidae Effect of preservatives on caloric density in the muscles of Hoplias aff. malabaricus (Bloch, 1794 (Osteichthyes, Erythrinidae

    Directory of Open Access Journals (Sweden)

    Milena Morimoto

    2002-05-01

    Full Text Available A conservação de amostras para a determinação dos valores calóricos em estudos de bioenergética de peixes tem se apresentado, na literatura, com uma variedade de métodos. Com o intuito de identificar o efeito de conservantes sobre os resultados obtidos com as diferentes técnicas de conservação, foram coletados exemplares adultos de Hoplias aff. malabaricus (Osteichthyes, Erythrinidae na planície de inundação do rio Paraná. De cada exemplar, foram retiradas 5 amostras da musculatura, as quais foram submetidas aos seguintes tratamentos: formol (4%, álcool (70%, congelamento (-10oC, nitrogênio líquido (-180oC e estufa à 60oC (amostra controle. Depois de 30 dias, todas as amostras foram secas em estufa à 60oC e posteriormente procedeu-se à determinação calórica de cada uma das amostras em bomba calorimétrica. Detectaram-se diferenças significativas entre os tratamentos (ANOVA: N=206; F=50,28; pThe preservation of samples for caloric values determination in bioenergetic studies of fish has been presented literature with a variety of methods. To identify the effect of preservatives over the results obtained with different preservation techniques, adult individuals of Hoplias aff. malabaricus (Osteichthyes, Erythrinidae were collected in Paraná river floodplain. From each fish, five samples were extracted from its dorsal muscle and submitted each sample for a different treatment: ice (-10ºC, formaldehyde (4%, alcohol (70%, liquid nitrogen (-180oC and a control sample immediately oven dried (60oC. After 30 days, the treatments were oven dried (60oC and caloric values of each sample were determined in a caloric bomb. Significant differences among the treatments were found (ANOVA: n = 206; F = 50.28; p < 0.001. Some evaluations of the effects of each treatment were presented for further comparisons with the results published in literature.

  7. Morfologia do trato digestório e dieta de larvas de Bryconamericus aff. iheringii (Boulenger, 1887 (Osteichthyes, Characidae = Morphology of Digestive tract and diet of Bryconamericus aff. iheringii larvae (Boulenger, 1887 (Osteichthyes, Characidae

    Directory of Open Access Journals (Sweden)

    Renato Ziliani Borges

    2006-01-01

    Full Text Available Este trabalho teve como objetivo analisar alguns aspectos da alimentação de larvas de Bryconamericus aff. iheringii, capturadas nos meses de julho e novembro de 2001, nas regiões limnética e litorânea do reservatório de Santa Maria, rio Piquiri, Estado do Paraná. As larvas apresentaram boca subterminal durante todo o seu desenvolvimento. O tubo digestório se diferenciou em estômago e intestino apenas no estágio de pós-flexão. As larvas consumiram, principalmente, algas e microcrustáceos, o que permitiu caracterizá-las como planctófagas. A intensa modificação morfológica no trato digestório nos indivíduos em pósflexão coincidiu com o aumento na abundância de algas em relação aos itens de origemanimal; porém, de forma geral, a ocorrência aumentou para todos os itens. A análise do grau de digestão dos itens alimentares sugeriu que indivíduos em pré-flexão alimentaram-se, possivelmente, durante o dia, e os mais desenvolvidos, durante o entardecer e no períodonoturno.The aim of this study was to analyze some feeding treats of Bryconamericus aff. iheringii larvae, sampled in both the limnetic and littoral regions of the Piquiri River, in Santa Maria reservoir, between July and November 2001. The larvae presented sub-terminal mouth in larval period. The digestive tract differentiated in terms of stomach and intestine only in the postflexion larvae. The larvae fed mainly on algae and microcrustacea allowing to characterize them as planktivorous. The intense morphologic shift in the digestive tract in the postflexion larvae coincided with an increase in the abundance of algae in relation to animals items; however, in general, all the items had their occurrence increased. Analysis of the digestion stage suggested that preflexion larvae, possibly, fed themselves during the day, and those more developed, at dusk and night.

  8. Phebaclavin I, a novel 3-prenylated coumarin, and trichoclin acetate, a new natural furocoumarin, from the aerial parts of Phebalium aff. tuberculosum (Rutaceae).

    Science.gov (United States)

    Roux, Delphine; Muyard, Frédéric; Girard, Corinne; Colombain, Michel; Tillequin, François; Waterman, Peter G; Bévalot, Françoise

    2006-03-01

    Phebaclavin I, a novel 3-prenylated coumarin, was isolated from the aerial parts of Phebalium aff. tuberculosum (Rutaceae) together with five known related compounds, Phebaclavin A, B, D, G, H. The structure of phebaclavin I was established by spectroscopic methods. Several other known coumarins were obtained, including trichoclin acetate, a furocoumarin isolated for the first time from a natural source, but previously described from acetylation of trichoclin.

  9. Spatial, seasonal and ontogenetic variation in the diet of Astyanax aff. fasciatus (Ostariophysi: Characidae in an Atlantic Forest river, Southern Brazil

    Directory of Open Access Journals (Sweden)

    Luciano Lazzarini Wolff

    Full Text Available This study described the feeding habits of the characin Astyanax aff. fasciatus. The diet compositions of specimens from two sites (A and B on a river in Southern Brazil were compared according to the size of individuals and seasonal period. The collections were performed monthly from March 2005 to February 2006, where the stomach contents of 290 specimens were assessed. Food items for A. aff. fasciatus were basically composed of plants and insects, especially leaf fragments, seeds, fruits, filamentous algae, aquatic and terrestrial insects and insect fragments. At site A, the most common items were insect and plant fragments. Conversely at site B, plant fragments were more representative. In general, all items of animal origin showed the highest feeding index values at site A, whereas at site B detritus and grass items were more abundant. The composition of items varied seasonally, with higher diversity of items being recorded during the spring at both sites. Smaller individuals preferred items of animal origin, while the larger ones consumed mainly items of plant origin. According to its size, A. aff. fasciatus in this study may be considered a species with insectivorous tendencies when immature or herbivorous tendencies when adult. Nevertheless, its feeding habits may be flexible according to resource availability, showing wide ontogenetic, besides spatial and temporal variation.

  10. Raiz tuberosa de yacon (Smallanthus sonchifolius: potencialidade de cultivo, aspectos tecnológicos e nutricionais Yacon tuberous root (Smallanthus sonchifolius: cultivation potentialities, technological and nutritional aspects

    Directory of Open Access Journals (Sweden)

    Isabelle Santana

    2008-06-01

    Full Text Available O yacon (Smallanthus sonchifolius é uma planta da família Asteraceae, originária das regiões Andinas. Suas raízes tuberosas são semelhantes a batatas doces em aparência, possuem gosto doce e polpa crocante, sendo bastante consumidas na forma in natura. Seu consumo foi negligenciado até meados dos anos 80, quando foram descobertas peculiaridades em sua composição química que poderiam ser benéficas à saúde humana. A raiz apresenta elevado teor de água, possui reduzido valor energético e, diferentemente da maioria das espécies tuberosas que estocam energia na forma de amido, o yacon tem como principal carboidrato de reserva os frutooligossacarídeos (FOS, os quais têm sido motivo de destaque por exercerem atividade bifidogênica. Esta revisão aborda diferentes aspectos inerentes a esta espécie, como origem histórica, características botânicas, composição química e efeitos pós-colheita.Yacon (Smallanthus sonchifolius is a plant that belongs to Asteraceae family, originated from Andean regions. The tuberous roots produced by this plant are similar to sweet potatoes in appearance, have a sweet taste and a crunch pulp, being often consumed "in natura". Yacon was not usually consumed until the 80’s decade, when some peculiarities were discovered in its chemical composition that could be beneficial to human health. The tubers contain high water content, reduced energetic value and, unlikely most tuberous species which store the carbohydrates in the form of starch, yacon has fructooligosaccharides (FOS as its main reserve carbohydrate, being highlighted by its bifidogenic activity. This paper presents a literature review on many aspects about this specie, such as historical origin, botanical features, chemical composition and post harvest effects.

  11. Efecto de extractos de la esponja calcarea Leucetta aff. floridana sobre el ciclo de líneas celulares leucemoides

    Directory of Open Access Journals (Sweden)

    Diana Margarita Márquez Fernández

    2012-12-01

    Full Text Available Introducción: la esponja Leucetta aff. floridana produce compuestos con actividad antiproliferativa diferencial en células tumorales de pulmón y mama, la cual no ha sido explorada en otras líneas tumorales y se desconoce si su potencial antiproliferativo está relacionado con la progresión de células a través del ciclo celular. Objetivo: evaluar el potencial antiproliferativo, anticlonogénico y el efecto sobre el ciclo celular de los extractos hexánico y metanólico de la esponja Leucetta aff. floridana del Caribe colombiano en las líneas celulares leucemoides Jurkat y K562. Métodos: la viabilidad y proliferación celular se determinaron mediante el ensayo de azul de tripano a 0, 24, 48, 72 y 96 h. La eficiencia de clonación y el efecto sobre el ciclo celular se evaluaron a 10 y 100 µg/mL. Los datos se analizaron usando ANOVA multifactorial y la prueba Tukey. Resultados: el extracto hexánico presentó actividad antiproliferativa en ambas líneas celulares siendo Jurkat más sensible que K562, lo cual se corroboró con los ensayos de clonogenicidad. Este extracto también mostró un efecto de acumulación de células Sub-G1 dependiente de la dosis, el cual fue diferencial entre las dos líneas celulares. La duración del tratamiento con el extracto hexánico no fue significativa para las células K562 pero sí para la línea celular Jurkat. Además, el porcentaje de acumulación de las células Sub-G1 fue mayor para células K562 comparado con Jurkat. El extracto metanólico presentó un efecto antiproliferativo similar al hexánico, pero fue más potente con la menor concentración (10 µg/mL en la clonogenicidad de K562. El efecto sobre el ciclo celular, también fue similar al hexánico, pero la duración del tratamiento no fue significativa en la acumulación de células en Sub-G1. Conclusiones: los resultados muestran el potencial diferencial de los extractos sobre el ciclo celular de las líneas leucemoides evaluadas.

  12. Efecto de extractos de la esponja calcarea Leucetta aff. floridana sobre el ciclo de líneas celulares leucemoides Effect of extracts from the calcareous sponge Leucetta aff. floridana on the cell cycle of leukemoid cell lines

    Directory of Open Access Journals (Sweden)

    Diana Margarita Márquez Fernández

    2012-12-01

    Full Text Available Introducción: la esponja Leucetta aff. floridana produce compuestos con actividad antiproliferativa diferencial en células tumorales de pulmón y mama, la cual no ha sido explorada en otras líneas tumorales y se desconoce si su potencial antiproliferativo está relacionado con la progresión de células a través del ciclo celular. Objetivo: evaluar el potencial antiproliferativo, anticlonogénico y el efecto sobre el ciclo celular de los extractos hexánico y metanólico de la esponja Leucetta aff. floridana del Caribe colombiano en las líneas celulares leucemoides Jurkat y K562. Métodos: la viabilidad y proliferación celular se determinaron mediante el ensayo de azul de tripano a 0, 24, 48, 72 y 96 h. La eficiencia de clonación y el efecto sobre el ciclo celular se evaluaron a 10 y 100 µg/mL. Los datos se analizaron usando ANOVA multifactorial y la prueba Tukey. Resultados: el extracto hexánico presentó actividad antiproliferativa en ambas líneas celulares siendo Jurkat más sensible que K562, lo cual se corroboró con los ensayos de clonogenicidad. Este extracto también mostró un efecto de acumulación de células Sub-G1 dependiente de la dosis, el cual fue diferencial entre las dos líneas celulares. La duración del tratamiento con el extracto hexánico no fue significativa para las células K562 pero sí para la línea celular Jurkat. Además, el porcentaje de acumulación de las células Sub-G1 fue mayor para células K562 comparado con Jurkat. El extracto metanólico presentó un efecto antiproliferativo similar al hexánico, pero fue más potente con la menor concentración (10 µg/mL en la clonogenicidad de K562. El efecto sobre el ciclo celular, también fue similar al hexánico, pero la duración del tratamiento no fue significativa en la acumulación de células en Sub-G1. Conclusiones: los resultados muestran el potencial diferencial de los extractos sobre el ciclo celular de las líneas leucemoides evaluadas

  13. AFLP estimation of the outcrossing rate of Spondias tuberosa (Anacardiaceae, an endemic species to the Brazilian semiarid region Una estimación AFLP de la tasa de fecundación cruzada de Spondias tuberosa (Anacardiaceae, una especie endémica de la región semiárida de Brasil

    Directory of Open Access Journals (Sweden)

    Carlos Antonio Fernandes Santos

    2013-06-01

    Full Text Available The umbu tree (Spondias tuberosa is one of the most important endemic species to the Brazilian tropical semiarid region. The umbu tree has edible fruits with a peculiar flavor that are consumed in natura or in a semi-industrialized form, such as jams, candies and juices. The majority of endemic species to Brazilian semiarid region have not been studied or sampled to form germ- plasm collections, which increases the risk of losing genetic variability of the adapted species to xerophytic conditions. The aim of this study was to estimate outcrossing rates in S. tuberosa using a multilocus mixed model in order to guide genetic resources and breeding programs of this species. DNA samples were extracted from 92 progenies of umbu trees, which were distributed among 12 families. These trees were planted by seed in 1991 in Petrolina, PE, Brazil. The experimental design was a randomized block, with a total of 42 progenies sampled in three regions. The experimental units were composed by five plants and five replications. The out- crossing rate was estimated by the multilocus model, which is available in the MLTR software, and was based on 17 polymorphic AFLP bands obtained from AAA_CTG and AAA_CTC primer combinations. The observed heterozygotes ranged from 0.147 to 0.499, with a maximum frequency estimated for the AAA_CTC_10 ampli- con. The multilocus outcrossing estimation ( was 0.804±0.072, while the single-locus ( was 0.841±0.079, which suggests that S. tuberosa is predominantly an outcrossing species. The difference between and was -0.037±0.029, which indicates that biparental inbreeding was nearly absent. The mean inbreeding coefficient or fixation index ( among maternal plants was - 0.103±0.045, and the expected was 0.108, which indicates that there was no excess of heterozygotes in the maternal population. The outcrossing estimates obtained in the present study indicate that S. tuberosa is an open-pollinated species. Biometrical models applied

  14. Differences between the quality of strawberries (Fragaria x ananassa) pollinated by the stingless bees Scaptotrigona aff. depilis and Nannotrigona testaceicornis.

    Science.gov (United States)

    Roselino, A C; Santos, S B; Hrncir, M; Bego, L R

    2009-05-12

    We investigated the success of two stingless bee species in pollinating strawberries in greenhouses. Three greenhouses and one open field area were used; one greenhouse had only strawberry plants (control), another (G1) had three colonies of Scaptotrigona aff. depilis and another (G2) had three colonies of Nannotrigona testaceicornis. In the open field area, the flowers could be visited by any bee. The total production of fruits was counted and a random sample (N = 100) from each area was used to measure weight, length, circumference, and achenes number (N = 5). The percentages of deformed strawberries were: 23% (no bees); 2% (greenhouses with bees) and 13% (open field). The strawberries from the greenhouse with N. testaceicornis and the open field were heavier than those from the greenhouses with no bees and with S. depilis. The fruit circumference was largest in the greenhouses with bees. The achenes number did not differ among the experimental areas. The strawberries produced in the greenhouses with stingless bees had more quality and greater commercial value than the fruits produced in the open field area and the greenhouse without bees. We conclude that stingless bees are efficient pollinators of strawberry flowers cultivated in greenhouses.

  15. Male meliponine bees (Scaptotrigona aff. depilis) produce alarm pheromones to which workers respond with fight and males with flight.

    Science.gov (United States)

    Schorkopf, Dirk Louis P

    2016-10-01

    In highly social hymenopteran societies, males mainly serve reproductive purposes. Semiochemicals enable the different hymenopteran sexes and castes to communicate with each other and to coordinate important functions within colonies. I hereby show that sexual dimorphism in meliponine bees incorporates the alarm and defence communication system. I chemically analysed the mandibular glands of Scaptotrigona aff. depilis using GCMS methods and conducted behavioural experiments in both males and female workers using cephalic and mandibular gland extracts. In addition, behaviour studies with male cephalic extracts were also conducted in Scaptotrigona bipunctata and Partamona cupira. Males and female worker bees showed differences in the content of the mandibular glands, which are responsible for alarm communication in meliponines. Males never attacked but usually fled when confronted with the mandibular gland extract content of other conspecific males or females. Interestingly, however, meliponine males were still able to raise alarm and to induce substantial amounts of aggression at nest entrances, which is different from the much better known and studied honey bees. Potential reasons are briefly discussed.

  16. Morphological development of Corydoras aff. paleatus (Siluriformes, Callichthyidae and correlation with the emergence of motor and social behaviors

    Directory of Open Access Journals (Sweden)

    Daniel Rodríguez-Ithurralde

    2014-06-01

    Full Text Available Here we examine major anatomical characteristics of Corydoras aff. paleatus (Jenyns, 1842 post-hatching development, in parallel with its neurobehavioral evolution. Eleutheroembryonic phase, 4.3-8.8 days post-fertilization (dpf; 4.3-6.4 mm standard length (SL encompasses from hatching to transition to exogenous feeding. Protopterygiolarval phase (8.9-10.9 dpf; 6.5-6.7 mm SL goes from feeding transition to the commencement of unpaired fin differentiation, which marks the start of pterygiolarval phase (11-33 dpf; 6.8-10.7 mm SL defined by appearance of lepidotrichia in the dorsal part of the median finfold. This phase ends with the full detachment and differentiation of unpaired fins, events signaling the commencement of the juvenile period (34-60 dpf; 10.8-18.0 mm SL. Eleutheroembryonic phase focuses on hiding and differentiation of mechanosensory, chemosensory and central neural systems, crucial for supplying the larval period with efficient escape and nutrient detection-capture neurocircuits. Protopterygiolarval priorities include visual development and respiratory, digestive and hydrodynamic efficiencies. Pterygiolarval priorities change towards higher swimming efficacy, including carangiform and vertical swimming, necessary for the high social interaction typical of this species. At the end of the protopterygiolarval phase, simple resting and foraging aggregations are seen. Resting and foraging shoals grow in complexity and participant number during pterygiolarval phase, but particularly during juvenile period.

  17. Spatial, seasonal and ontogenetic variation in the diet of Astyanax aff. fasciatus (Ostariophysi: Characidae in an Atlantic Forest river, Southern Brazil

    Directory of Open Access Journals (Sweden)

    Luciano Lazzarini Wolff

    2009-06-01

    Full Text Available This study described the feeding habits of the characin Astyanax aff. fasciatus. The diet compositions of specimens from two sites (A and B on a river in Southern Brazil were compared according to the size of individuals and seasonal period. The collections were performed monthly from March 2005 to February 2006, where the stomach contents of 290 specimens were assessed. Food items for A. aff. fasciatus were basically composed of plants and insects, especially leaf fragments, seeds, fruits, filamentous algae, aquatic and terrestrial insects and insect fragments. At site A, the most common items were insect and plant fragments. Conversely at site B, plant fragments were more representative. In general, all items of animal origin showed the highest feeding index values at site A, whereas at site B detritus and grass items were more abundant. The composition of items varied seasonally, with higher diversity of items being recorded during the spring at both sites. Smaller individuals preferred items of animal origin, while the larger ones consumed mainly items of plant origin. According to its size, A. aff. fasciatus in this study may be considered a species with insectivorous tendencies when immature or herbivorous tendencies when adult. Nevertheless, its feeding habits may be flexible according to resource availability, showing wide ontogenetic, besides spatial and temporal variation.Este estudo descreveu os hábitos alimentares do lambari Astyanax aff. fasciatus. Foram comparadas as composições alimentares de espécimes de dois sítios (A e B de um rio no sul do Brasil de acordo com o tamanho dos indivíduos e do período sazonal. As coletas foram realizadas mensalmente de março de 2005 a fevereiro de 2006, sendo o conteúdo estomacal de 290 exemplares analisado. A dieta de A. aff. fasciatus foi composta basicamente por plantas e insetos, especialmente fragmentos de folhas, sementes, frutos, algas filamentosas, insetos aquáticos e terrestres

  18. Regeneración in vitro de brotes de Polianthes tuberosa L. a partir de yemas vegetativas de la inflorescencia y de tejido de cormo

    Directory of Open Access Journals (Sweden)

    Fanny Hernández-Mendoza

    2014-01-01

    Full Text Available Polianthes tuberosa L. es una planta endémica de México, comercialmente se cultiva para flor de corte, y, además, es utilizada en la industria farmacéutica y del perfume. Tradicionalmente, los productores la propagan utilizando los cormos, lo que ha ocasionado que el cultivo presente poca variabilidad genética y posiblemente, por esta razón solo se conocen cultivares con flores blancas. Con base en lo anterior el objetivo de la presente investigación consistió en establecer la metodología práctica y competitiva para propagar in vitro Polianthes tuberosa L. Las yemas y pequeños segmentos de tejido de cormo fueron colocadas sobre la superficie del medio de cultivo, base GC (comunicación personal Guillermo Carrillo con las sales inorgánicas del medio de cultivo Murashige y Skoog (1962 por litro, 50 mL de agua de coco, 20 g de sacarosa, 6.4 g de agar y el pH fue ajustado a 5.7. Con este medio básico se prepararon medios de cultivo que contenían bencilaminopurina (BAP, ácido naftalenacético (ANA, ácido 2,4-diclorofenoxiacético (2,4-D, ácido indolacético (AIA, y cinetina. La formación de brotes que dieron origen a las plántulas ocurrió mediante, la regeneración directa de la yema floral la cual al crecer forma sólo una plántula y a partir del tejido de la base de la yema, de esta región se obtuvieron hasta seis brotes por yema en el medio que contiene BAP, 4.5 mg y ANA, 0.1 mg, del cual la regeneración de brotes fue mayor (56.1 %. En el caso de cormo el problema fue la contaminación llegando en algunos casos hasta el 100 % de los cultivos. Es de resaltar la importancia de poder lograr la regeneración masiva in vitro de plantas de nardo a partir de yemas florales.

  19. Study of the umbu (Spondias tuberosa Arruda Câmara osmotic dehydration processEstudio del processo de deshidratación osmótica de umbu

    Directory of Open Access Journals (Sweden)

    Catiana Freitas Pinto de Oliveira

    2013-05-01

    Full Text Available The umbu (Spondias tuberosa Arruda Câmara is a fruit native of Northeastern semi-arid with large productive capacity and excellent nutritional characteristics that have been underused in the family farming of the region. Aiming to minimize post-harvest losses and add value to the fruit, this research has the objective of studying the osmotic dehydration process of umbu through a 2² factorial design, with independent variables: time of immersion (1-3 hours and osmotic solution concentration (35-45 °Brix. The dependent variables were: acidity (A, vitamin C (Vc, weight loss (PP, moisture loss (PU, solid gain (GS and dehydration efficiency index (IED. The highest values for vitamin C, PU and FDI and lower GS were observed under conditions of higher immersion time (3 h and lower concentration of the solution (35 °Brix, associated with the fact that the process had been performed at room temperature. El umbu (Spondias tuberosa Arruda Câmara es un fruto nativo del semiárido Nordestino que tiene elevada capacidad productiva y excelentes características nutricionales que no son aprovechadas en la agricultura familiar de esa región. El presente trabajo tiene como objetivo el estudio del proceso de deshidratación osmótica de umbu a través de un diseño experimental factorial 2². Los efectos de las variables independientes tiempo de inmersión (1 a 3 h y concentración de la solución osmótica (35 a 45 °Brix fueron analizados sobre las respuestas acidez (A, contenido de vitamina C (Vc, pérdida de peso (PP, pérdida de humedad (PU, ganancia de sólidos (GS e índice de eficiencia de la deshidratación (IED. Los mejores resultados correspondientes a mayores contenidos de vitamina C, PU e IED y menor GS fueron observados en las condiciones de mayor tiempo de inmersión (3 h y menor concentración de la solución (35°Brix en condiciones de temperatura ambiente.

  20. Neuritogenic activity-guided isolation of a free base form manzamine A from a marine sponge, Acanthostrongylophora aff. ingens (Thiele, 1899).

    Science.gov (United States)

    Zhang, Bo; Higuchi, Ryuichi; Miyamoto, Tomofumi; Van Soest, Rob W M

    2008-06-01

    Two manzamine-class alkaloids, manzamine A (1) and 8-hydroxymanzamine (2) were isolated from a Japanese marine sponge Acanthostrongylophora aff. ingens, together with three known alkaloids manzamine E (3), manzamine F (4), and manzamine X (5). The spectral features of 1 and 2 were different from the reported data. Detailed structure analysis using 2D NMR revealed the structure of 1 and 2 as a free base form of hydrochloric salt. These manzamine-class alkaloids showed neuritogenic activity against Neuro 2a cells.

  1. Congruence between morphological and molecular markers inferred from the analysis of the intra-morphotype genetic diversity and the spatial structure of Oxalis tuberosa Mol.

    Science.gov (United States)

    Pissard, Audrey; Arbizu, Carlos; Ghislain, Marc; Faux, Anne-Michèle; Paulet, Sébastien; Bertin, Pierre

    2008-01-01

    Oxalis tuberosa is an important crop cultivated in the highest Andean zones. A germplasm collection is maintained ex situ by CIP, which has developed a morphological markers system to classify the accessions into morphotypes, i.e. groups of morphologically identical accessions. However, their genetic uniformity is currently unknown. The ISSR technique was used in two experiments to determine the relationships between both morphological and molecular markers systems. The intra-morphotype genetic diversity, the spatial structures of the diversity and the congruence between both markers systems were determined. In the first experience, 44 accessions representing five morphotypes, clearly distinct from each other, were analyzed. At the molecular level, the accessions exactly clustered according to their morphotypes. However, a genetic variability was observed inside each morphotype. In the second experiment, 34 accessions gradually differing from each other on morphological base were analyzed. The morphological clustering showed no geographical structure. On the opposite, the molecular analysis showed that the genetic structure was slightly related to the collection site. The correlation between both markers systems was weak but significant. The lack of perfect congruence between morphological and molecular data suggests that the morphological system may be useful for the morphotypes management but is not appropriate to study the genetic structure of the oca. The spatial structure of the genetic diversity can be related to the evolution of the species and the discordance between the morphological and molecular structures may result from similar selection pressures at different places leading to similar forms with a different genetic background.

  2. The physical, chemical and functional characterization of starches from Andean tubers: oca (Oxalis tuberosa Molina, olluco (Ullucus tuberosus Caldas and mashua (Tropaeolum tuberosum Ruiz & Pavón

    Directory of Open Access Journals (Sweden)

    Beatriz Valcárcel-Yamani

    2013-09-01

    Full Text Available The physical, chemical, and functional properties of starches isolated from the Andean tubers oca (Oxalis tuberosa M., olluco (Ullucus tuberosus C. and mashua (Tropaeolum tuberosum R. & P. were studied. The tubers were obtained from a local grocery. The morphology of the starch granules (size and shape was studied with scanning electron microscopy (SEM, which revealed ellipsoid, oval, conical, pear-shaped and prismatic forms: ellipsoids and oval granules with lengths up to 54.30 µm in oca; with lengths up to 32.09 µm for olluco starch granules; and with predominantly truncated spherical or oval forms and smaller dimensions (up to 16.29 um for mashua starch granules. Amylose contents were similar among the samples: 27.60% (oca, 26.49% (olluco and 27.44% (mashua. Olluco starch had less swelling power, forming opaque, less firm gels. All three starch gels showed the same stability on refrigeration and presented high syneresis under freezing temperatures, with a variation of 40.28 to 74.42% for olluco starch. The starches cooked easily, with high peak viscosity. The low gelatinization temperatures and high stability during cooling make these starches suitable feedstock for use in formulations that require milder processing temperatures and dispense freezing storage.

  3. Synergism between sodium chloride, sucrose and tricalcium phosphate in the osmotic dehydration of oca (Oxalis tuberosa with and without chitosan coating

    Directory of Open Access Journals (Sweden)

    José Arroyo Portal

    2010-12-01

    Full Text Available We investigated the synergistic effect of three solutes (sodium chloride, sucrose, tricalcium phosphate in different combinations of concentration, on the moisture, solid gain and calcium gain in oca (Oxalis tuberosa with and without chitosan (CR and SR. In both cases applied the Simplex with Extended Centroid mixture design. Were used cylinders of oca of 0.9 cm of diameter and 3.4 cm of length. The kinetics of moisture, solid gain and calcium gain for 48 hours was evaluated. The effective diffusivity of water, solids and calcium was determined. We found that in samples CR is greater loss of water and less solid gain compared with SR samples mainly as sodium chloride or sucrose participate independently, while for the gain of calcium, in all cases, the CR samples gain more of calcium than SR samples. The effective diffusivities found are: water, 1.19E-09 m2 /s in samples CR and 1.34E-09 m2 /s in SR samples; for solid, 3.67E-09 m2 /s in samples CR and 5.43E-09 m2 /s in SR samples; and, for calcium 3.32E-11 m2 /s in samples CR and 1.57E-09 m2 /s in SR samples.

  4. AVALIAÇÕES FENOTÍPICAS E FISIOLÓGICAS DE ESPÉCIES DE SPONDIAS TENDO COMO PORTA ENXERTO O UMBUZEIRO (Spondias tuberosa Cam.

    Directory of Open Access Journals (Sweden)

    José Moacir Pinheiro Lima Filho

    2009-01-01

    Full Text Available The experiment was carried out at the Embrapa Semi-Arid, Petrolina, Pernambuco State, Brazil aiming to study the behavior of five species of the genus Spondias: umbu-cajá (Spondias sp., umbuguela (Spondias sp., cajá (S. lutea L., cajá-manga (S. cytherea Sonn. e ceriguela (S. purpurea L. grafted on umbuzeiro (S. tuberosa Cam, which presents a specialized root system bearing tubers. Five-years old plants, spaced by 10.0 m x 10.0 m were studied under rainfed conditions based on phenotypic and physiological data acquisition. The results indicated the occurrence of high levels of graft unions and good vegetative performance of all species, suggesting the occurrence of week incompatibility barriers among them and the rootstock. Consequently, all grafted species presented a internal water balance recovering similar to the umbuzeiro due to the presence of tubers in the root system. Despite the improvement on the species' water balance, the values on stomatal conductance, transpiration and photosynthesis significantly decreased along the experimental period suggesting the existing of a signal present in the root system that controls the stomatal aperture, although to the umbuzeiro, the reduction on gas exchange was less steeped.

  5. Phenology of Spondias tuberosa Arruda (Anacardiaceae under different landscape management regimes and a proposal for a rapid phenological diagnosis using local knowledge

    Directory of Open Access Journals (Sweden)

    Neto Ernani MF Lins

    2013-01-01

    Full Text Available Abstract Background Studies aimed at investigating the influence of habitat change on species phenology. Studies that investigate people's perceptions of the phenology of certain species still area few; yet this approach is important for effective decision-making for conservation. The aim of this study was to investigate the phenology of Spondias tuberosa Arruda (Anacardiaceae, a native species of economic and ecological importance in northeastern Brazil, in five landscape units (LUs (Mountain, Mountain Base, Pasture, Cultivated Areas and Homegardens of a Caatinga region in Altinho, Pernambuco, northeastern Brazil. These data could then be compared with local people's perceptions of the species’ phenophases. Method Collection of phenological data was carried out monthly from February 2007 to January 2009 and included activity, intensity and synchronization of reproductive and vegetative phenophases. Ethnobotanical data were gathered using a collaborative approach to access local people’s knowledge about the species’ phenological schedule. Results There were no significant differences in the intensity of phenophases among LUs, and there was a correspondence between people’s perception of phenophases and the phenological data collected. The data show that the different management practices for LUs did not influence the phenology of the species. Conclusion The main conclusion of this study is the use of traditional knowledge as interesting tool for rapid phenological diagnosis. However further studies need to be developed to test this tool in other environments and cultural contexts.

  6. Pollination of cucumber, Cucumis sativus L. (Cucurbitales: Cucurbitaceae), by the stingless bees Scaptotrigona aff. depilis moure and Nannotrigona testaceicornis Lepeletier (Hymenoptera: Meliponini) in greenhouses.

    Science.gov (United States)

    Santos, Solange A B dos; Roselino, Ana C; Bego, Luci R

    2008-01-01

    When for a successful fruit development the fertilization of flowers is necessary, bees can be used as crop-pollinators in greenhouses. In the present study, we investigated the effectiveness of the stingless bees Scaptotrigona aff. depilis Moure and Nannotrigona testaceicornis Lepeletier as pollinators of cucumber plants (Cucumus sativus var. caipira) in greenhouses during the Brazilian winter season. The study was conducted in four greenhouses (GH), of which two greenhouses contained bee colonies to ascertain pollination of the cucumber plants (GH I, with S. aff. depilis, GH II, with N. testaceicornis), whereas the other two greenhouses (GH III, GH IV) had no bee colonies and served as control groups. Furthermore, we planted cucumbers in an open field plot (OA) where pollination by any/various visiting insects could occur. Each of the experimental areas measured 87.5 m2. Without pollination (GH III, GH IV), the plants produced a low number of cucumbers, and the fruits were smaller and less heavy than in those experimental areas where pollination occurred. In the open field area, not protected against unfavorable climatic conditions, the plants produced fewer flowers than the plants in the greenhouses. The highest cucumber yield (with the highest amount of perfect fruits) was found in those greenhouses which housed the stingless bees as pollinators (GH I, GH II). Our results demonstrate that stingless bees can be successfully and efficiently used as pollinators of greenhouse cucumbers during the winter season.

  7. The occurence of black spot disease in Astyanax aff. fasciatus(characiformes: characidae in the Guaíba Lake basin, RS, Brazil

    Directory of Open Access Journals (Sweden)

    F Flores-Lopes

    Full Text Available Black spot disease is common in freshwater fish and is usually caused by the metacercaria stage of digenetic trematodes, normally from the Diplostomidae family. The present study evaluated the prevalence and intensity of this disease in Astyanax aff. fasciatus(Teleostei: Characiformes in the Guaíba Lake basin (RS, Brazil, including body parts assessment and the points of sampling with higher occurrence of black spots. Fish samples were taken seasonally from December 2002 until October 2004. The samples were collected with the use of a seine net at eleven points. The specimens were fixed in 10% formalin and stored in 70% ethanol. Black spot disease showed a low frequency in the Guaíba lake basin (2.07% and no specificity to the species Astyanax aff. fasciatus was observed. A high prevalence among the individuals and high intensity of infection levels was found in the ventral and dorsal regions in relation to other body parts (e.g., pectoral, pelvic and anal regions. Among the sampling points studied, we observed a higher prevalence on samples collected at points Gasômetro, Saco da Alemoa and Sinos, located in open areas with less occurrence of mollusks.

  8. The occurence of black spot disease in Astyanax aff. fasciatus (Characiformes: Characidae) in the Guaíba Lake basin, RS, Brazil.

    Science.gov (United States)

    Flores-Lopes, F

    2014-08-01

    Black spot disease is common in freshwater fish and is usually caused by the metacercaria stage of digenetic trematodes, normally from the Diplostomidae family. The present study evaluated the prevalence and intensity of this disease in Astyanax aff. fasciatus (Teleostei: Characiformes) in the Guaíba Lake basin (RS, Brazil), including body parts assessment and the points of sampling with higher occurrence of black spots. Fish samples were taken seasonally from December 2002 until October 2004. The samples were collected with the use of a seine net at eleven points. The specimens were fixed in 10% formalin and stored in 70% ethanol. Black spot disease showed a low frequency in the Guaíba lake basin (2.07%) and no specificity to the species Astyanax aff. fasciatus was observed. A high prevalence among the individuals and high intensity of infection levels was found in the ventral and dorsal regions in relation to other body parts (e.g., pectoral, pelvic and anal regions). Among the sampling points studied, we observed a higher prevalence on samples collected at points Gasômetro, Saco da Alemoa and Sinos, located in open areas with less occurrence of mollusks.

  9. Insights into HIV-1 proviral transcription from integrative structure and dynamics of the Tat:AFF4:P-TEFb:TAR complex

    Science.gov (United States)

    Schulze-Gahmen, Ursula; Echeverria, Ignacia; Stjepanovic, Goran; Bai, Yun; Lu, Huasong; Schneidman-Duhovny, Dina; Doudna, Jennifer A; Zhou, Qiang; Sali, Andrej; Hurley, James H

    2016-01-01

    HIV-1 Tat hijacks the human superelongation complex (SEC) to promote proviral transcription. Here we report the 5.9 Å structure of HIV-1 TAR in complex with HIV-1 Tat and human AFF4, CDK9, and CycT1. The TAR central loop contacts the CycT1 Tat-TAR recognition motif (TRM) and the second Tat Zn2+-binding loop. Hydrogen-deuterium exchange (HDX) shows that AFF4 helix 2 is stabilized in the TAR complex despite not touching the RNA, explaining how it enhances TAR binding to the SEC 50-fold. RNA SHAPE and SAXS data were used to help model the extended (Tat Arginine-Rich Motif) ARM, which enters the TAR major groove between the bulge and the central loop. The structure and functional assays collectively support an integrative structure and a bipartite binding model, wherein the TAR central loop engages the CycT1 TRM and compact core of Tat, while the TAR major groove interacts with the extended Tat ARM. DOI: http://dx.doi.org/10.7554/eLife.15910.001 PMID:27731797

  10. Spatial and temporal distribution of larvae and juveniles of Hoplias aff. malabaricus (Characiformes, Erythrinidae in the Upper Paraná River floodplain, Brazil

    Directory of Open Access Journals (Sweden)

    A. BIALETZKI

    Full Text Available Spatial and temporal distribution of larvae and juveniles of trahira, Hoplias aff. malabaricus (Erythrinidae, and their relationship with environmental parameters in the Upper Paraná River floodplain were analyzed. Sampling of larvae and juveniles of H. aff. malabaricus has been conducted during the period from November 1991 through February 1995, with 42 sampling stations distributed in four sub-areas: Ivinhema I, Ivinhema II, Baía, and Paraná. During the same period, data were obtained for water temperature, dissolved oxygen, pH, electrical conductivity, river level, precipitation index, and photoperiod. The largest catches of larvae were in the Ivinhema I sub-area (47.06%, and of juveniles in the Paraná sub-area (54.55%. Larvae and juveniles were caught from October to February. Larvae were mainly collected at night and in all types of environments sampled (lotic, semi-lotic, and lentic. Principal Component Analysis of the environmental parameters and larval density showed that the largest catches were obtained in dry season months, with low values for temperature, electrical conductivity, river level, and photoperiod, and with high concentrations of dissolved oxygen and pH. This reproductive strategy may minimizes predation and maximizes food utilization, as it enables the fish to reach advanced developmental stages, while most other species are spawning.

  11. Spatial and temporal distribution of larvae and juveniles of Hoplias aff. malabaricus (Characiformes, Erythrinidae in the Upper Paraná River floodplain, Brazil

    Directory of Open Access Journals (Sweden)

    BIALETZKI A.

    2002-01-01

    Full Text Available Spatial and temporal distribution of larvae and juveniles of trahira, Hoplias aff. malabaricus (Erythrinidae, and their relationship with environmental parameters in the Upper Paraná River floodplain were analyzed. Sampling of larvae and juveniles of H. aff. malabaricus has been conducted during the period from November 1991 through February 1995, with 42 sampling stations distributed in four sub-areas: Ivinhema I, Ivinhema II, Baía, and Paraná. During the same period, data were obtained for water temperature, dissolved oxygen, pH, electrical conductivity, river level, precipitation index, and photoperiod. The largest catches of larvae were in the Ivinhema I sub-area (47.06%, and of juveniles in the Paraná sub-area (54.55%. Larvae and juveniles were caught from October to February. Larvae were mainly collected at night and in all types of environments sampled (lotic, semi-lotic, and lentic. Principal Component Analysis of the environmental parameters and larval density showed that the largest catches were obtained in dry season months, with low values for temperature, electrical conductivity, river level, and photoperiod, and with high concentrations of dissolved oxygen and pH. This reproductive strategy may minimizes predation and maximizes food utilization, as it enables the fish to reach advanced developmental stages, while most other species are spawning.

  12. Effects of growth phase and nitrogen starvation on expression of fatty acid desaturases and fatty acid composition of Isochrysis aff. galbana (TISO).

    Science.gov (United States)

    Huerlimann, Roger; Steinig, Eike J; Loxton, Heather; Zenger, Kyall R; Jerry, Dean R; Heimann, Kirsten

    2014-07-15

    Very long-chain polyunsaturated fatty acids (VLC-PUFAs) are important dietary requirements for maintaining human health. Many marine microalgae are naturally high in ω-3 VLC-PUFAs, however, the molecular mechanisms underpinning fatty acid (FA) desaturation and elongation in algae are poorly understood. An advanced molecular understanding would facilitate improvements of this nascent industry. We aimed to investigate expression responses of four front-end fatty acid desaturase genes and downstream effects on FA profiles to nitrogen limitation and cultivation growth stage in Isochrysis aff. galbana (TISO). Cultures were grown in nitrogen-replete and -deplete medium; samples were harvested during logarithmic, late logarithmic and stationary growth phases to analyse FA content/composition and gene expression of ∆(6)-, ∆(8)-, ∆(5)- and ∆(4)-desaturases (d6FAD (putative), d8FAD, d5FAD and d4FAD, respectively). d6FAD (putative) exhibited no differential expression, while d8FAD, d5FAD and d4FAD were significantly upregulated during logarithmic growth of nutrient-replete cultures, coinciding with rapid cell division. In conclusion, it is demonstrated that expression of some FADs in I. aff. galbana varies with culture age and nitrogen status which has downstream consequences on FA desaturation levels. This has implications for the commercial production of VLC-PUFAs where a trade-off between total lipid yield and VLC-PUFAs has to be made.

  13. The effect of nitrogen limitation on acetyl-CoA carboxylase expression and fatty acid content in Chromera velia and Isochrysis aff. galbana (TISO).

    Science.gov (United States)

    Huerlimann, Roger; Steinig, Eike J; Loxton, Heather; Zenger, Kyall R; Jerry, Dean R; Heimann, Kirsten

    2014-06-15

    Lipids from microalgae have become a valuable product with applications ranging from biofuels to human nutrition. While changes in fatty acid (FA) content and composition under nitrogen limitation are well documented, the involved molecular mechanisms are poorly understood. Acetyl-CoA carboxylase (ACCase) is a key enzyme in the FA synthesis and elongation pathway. Plastidial and cytosolic ACCases provide malonyl-CoA for de novo FA synthesis in the plastid and FA elongation in the endoplasmic reticulum, respectively. The present study aimed at investigating the expression of plastidial and cytosolic ACCase in Chromera velia and Isochrysis aff. galbana (TISO) and their impact on FA content and elongation level when grown under nitrogen-deplete conditions. In C. velia, plastidial ACCase was significantly upregulated during nitrogen starvation and with culture age, strongly correlating with increased FA content. Conversely, plastidial ACCase of I. aff. galbana was not differentially expressed in nitrogen-deplete cultures, but upregulated during the logarithmic phase of nitrogen-replete cultures. In contrast to plastidial ACCase, the cytosolic ACCase of C. velia was downregulated with culture age and nitrogen-starvation, strongly correlating with an increase in medium-chain FAs. In conclusion, the expression of plastidial and cytosolic ACCase changed with growth phase and nutrient status in a species-specific manner and nitrogen limitation did not always result in FA accumulation.

  14. Composición química de “oca” (Oxalis tuberosa), ‘arracacha’ (Arracaccia xanthorriza) y ‘tarwi’ (Lupinus mutabilis). Formulación de una mezcla base para productos alimenticios

    OpenAIRE

    María Elena León Marroú; Misael Ydilbrando Villacorta González; Sandra Elizabeth Pagador Flores

    2011-01-01

    El presente trabajo tuvo como objetivo formular una mezcla base a partir de cultivos nativos, la cual una vez estandarizada, se constituye en materia prima de alto valor nutricional para su utilización en la elaboración de productos alimenticios como: purés, papillas y productos de panificación, entre otros. Se seleccionaron tres cultivos andinos: un tubérculo, “oca” (Oxalis tuberosa); una raíz, ‘arracacha’ (Arracaccia xanthorriza) y una leguminosa, ‘tarwi’ (Lupinus mutabilis). Se realizaron ...

  15. Avaliações fenotípicas e fisiológicas de espécies de spondias tendo como porta enxerto o umbuzeiro (Spondias tuberosa Cam.).

    OpenAIRE

    José Moacir Pinheiro Lima Filho; Carlos Antônio Fernandes Santos

    2009-01-01

    The experiment was carried out at the Embrapa Semi-Arid, Petrolina, Pernambuco State, Brazil aiming to study the behavior of five species of the genus Spondias: umbu-cajá (Spondias sp.), umbuguela (Spondias sp.), cajá (S. lutea L.), cajá-manga (S. cytherea Sonn.) e ceriguela (S. purpurea L.) grafted on umbuzeiro (S. tuberosa Cam), which presents a specialized root system bearing tubers. Five-years old plants, spaced by 10.0 m x 10.0 m were studied under rainfed conditions based on phenotypic ...

  16. EFEITO DE ADITIVOS SOBRE A COR DURANTE O ARMAZENAMENTO DE DOCES DE UMBU (SPONDIAS TUBEROSA ARR. CÂMARA VERDE E MADURO

    Directory of Open Access Journals (Sweden)

    Soraia Vilela BORGES

    2011-04-01

    Full Text Available O umbuzeiro (Spondias tuberosa Arr. Câmara é uma planta de grande valor econômico para a região semi-árida nordestina, muito utilizada na fabricação de doces em massa. Este trabalho teve como objetivo detectar as alterações de cor em diferentes formulações de doce de umbu verde e maduro, com adição de aditivos, durante 120 dias de armazenamento, sob condições controladas de temperatura e umidade (30ºC; U.R. 75% através dos parâmetros de cor instrumental L*, a* e b*. Em relação aos valores de L*, os resultados indicaram decréscimo ao longo do armazenamento, exceto nas formulações do doce de umbu maduro acrescentadas de xarope de glicose, devido ao brilho provocado por este aditivo. Para o doce de umbu verde o uso de goma xantana provocou o maior aumento de a* em relação às outras formulações; para o doce de umbu maduro as formulações com amido modifi cado, pectina e xarope de glicose apresentaram as maiores tendências ao acréscimo ao longo do tempo. No doce de umbu verde, os valores de b*diminuíram em todas as formulações, independente do aditivo utilizado. Já no doce maduro a maior perda ocorreu na formulação sem adição de aditivo concluindo-se que o uso de aditivo neste caso retardou a perda da coloração amarela.

  17. Mass production in liquid diet and radiosterilization of South American fruit fly Anastrepha sp.1 aff. fraterculus (Wied., 1830) (Diptera: Tephritidae); Criacao massal em dieta liquida e radioesterilizacao da mosca-sulamericana Anastrepha sp.1 aff. fraterculus (Wied., 1830) (Diptera: Tephritidae)

    Energy Technology Data Exchange (ETDEWEB)

    Kamiya, Aline Cristiane

    2010-07-01

    Both the biological control techniques as the Sterile Insect Technique (SIT), are used in many countries to control, suppress and even eradicate fruit flies and other pests in agriculture and public health. The use of such techniques minimizes the continuous employment of insecticides, protects the environment and conforms to standards for food safety. However, it is necessary to implement such programs, technology to produce millions of parasitoids and the pest in its own laboratory with biological quality similar to the insects found in nature and cost competitive with chemical control. The objectives of this study was to establish protocols for artificial rearing of A. sp. 1 aff. fraterculus in liquid larval diet that will achieve levels of mass production for a possible reduction in the cost of establishing and determining the dose of radiation sterilization of adult A. sp. 1 aff. fraterculus meeting the quality parameters required by the Sterile Insect Technique with insects from the creation of Radioentomology Laboratory of CENA/USP. Seven experimental diets compared to the conventional diet used in Radioentomology Lab. of CENA/USP, which was used as control. All seven diets have in common the exclusion of agar in its formulation. Only two of the diets tested were suitable for larval development of the fly, they compared with the standard diet, showed inferior results with respect to the volume of recovered larvae, pupae and weight of emergency, however, no significant differences regarding the periods of development , pupal recovery, sex ratio and longevity under stress. It is possible to replace the diet with agar for liquid diets for artificial creation of A. sp. 1 aff. fraterculus, reduced cost and greater convenience of handling, but due to their quality standards lower than the standard diet, more tests are needed especially regarding the adaptability of the insect to the new environment. To determine the sterilizing dose this study examined the

  18. Spongicoloides sp. aff. a Spongicoloides galapagensis (Decapoda: Stenopodidea: Spongicolidae: una nueva especie para la carcinofauna chilena y primer registro de un estenopodido en aguas del margen continental de Chile Spongicoloides sp. aff. to Spongicoloides galapagensis (Decapoda: Stenopodidea: Spongicolidae: a new species for Chilean carcinofauna and the first record of aStenopodid for the Chilean margin

    Directory of Open Access Journals (Sweden)

    Guillermo L Guzmán

    2011-11-01

    Full Text Available Se cita por primera vez para el margen continental de Chile una especie de camarón Stenopodidae, asociado a una esponja hexactinelida. Los especímenes fueron recolectados en dos sitios de Chile central (31°12'S, 71°52'W y 36°00'S, 73°38'W; 922 a 1000 m de profundidad. Las esponjas estaban adheridas al sustrato con probable origen en emanaciones de metano. Spongicoloides sp. aff. a S. gala-pagensis, es el primer registro de la familia en aguas del margen continental del Pacífico suroriental. Los ejemplares coinciden con los rangos de la variación morfológica de S. galapagensis, no obstante difieren en el número de branquias descrito.This is the first record of a species of Stenopodid shrimp along the Chilean margin, associated with a hexactinellid sponge. The specimens were collected at two sites in central Chile (31°12'S, 71°52'W and 36°00'S, 73°38'W; 922 to 1000 m depth. The sponges were attached to the substrate with probable origins in methane seepage. Spongicoloides sp. aff. to S. galapagensis constitutes the first record of the family for the eastern south Pacific continental margin. The specimens coincide with the ranges of morphological variation of S. galapagensis, although they differ in the number of brachia described.

  19. Caracterização e qualidade de frutos de umbu-cajá (Spondias tuberosa X S. mombin provenientes do Recôncavo Sul da Bahia

    Directory of Open Access Journals (Sweden)

    Márcio Barros dos Santos

    2010-12-01

    Full Text Available O Recôncavo Sul da Bahia apresenta uma significativa riqueza de fruteiras nativas com grande potencial alimentício. Além de indicativos etnológicos sobre seus usos como alimento, pouco se conhece sobre elas, principalmente sobre sua composição bromatológica. A exemplos destas fruteiras, encontram-se os frutos do umbu-cajá (Spondias tuberosa X S. mombin que são amplamente consumidos in natura ou na forma de produtos processados em quase todo o Brasil. Devido à crescente aceitação de seus produtos e à incessante busca por novos sabores, as agroindústrias vêm despertando o interesse tanto para o mercado interno quanto para exportações. Entretanto, apesar do forte interesse comercial, poucos estudos foram efetuados na busca de respostas sobre a sua composição. Nesse sentido, este trabalho teve o objetivo de efetuar a caracterização física, físico-química e mineralógica dos frutos de umbu-cajá cultivados nas condições climáticas do Recôncavo Sul da Bahia. Foram realizadas análises de peso do fruto e da casca; tamanho e diâmetro; percentagem de casca, semente e polpa; pH; sólidos solúveis totais; acidez titulável; relação sólido solúveis/acidez (Ratio; índice tecnológico; açúcares (redutores, não redutores e totais; vitamina C; proteína; umidade; lipídios; fibra bruta; amido; e minerais (fósforo, ferro, cálcio, sódio e potássio. Os frutos apresentaram tamanho grande (23,18g com rendimento considerável de polpa (69,70 % e razoáveis valores de açucares (7,49 %, acidez (1,32 %, fibras (1,36 %, vitamina C (8 mg /100g e minerais ( Na-40 mg /100g; K-44mg /100g; P-17,76mg /100g; Fé-0,59mg /100g; e Ca-12,25mg /100g, demonstrando ser uma alternativa para o mercado de frutas in natura, bem como para a agroindústria na região.

  20. Molecular variants in populations of Bryconamericus aff. iheringii (Characiformes, Characidae in the upper Paraná river basin - doi: 10.4025/actascibiolsci.v35i2.11451

    Directory of Open Access Journals (Sweden)

    Alberto José Prioli

    2013-05-01

    Full Text Available There are evidences that Bryconamericus aff. iheringii represents a species complex. DNA molecular markers have been effective in studies on phylogeny, taxonomy, and identification of cryptic species. In this study, partial sequences of genes of ATPase 6 and 8 were used to assess genetic diversity within and among populations of B. aff. iheringii of sub-basins of Tibagi, Pirapó and Ivaí rivers, belonging to the Upper Paraná river basin. The analysis of the sequences of genes pointed out high genetic diversity in B. aff. iheringii from the sub-basins studied with genetic distance values comparable to those found among different species. There was a division of the individuals into five groups. The comparison with other species of Bryconamericus that have sequences available in GenBank confirmed that the individuals studied have relevant values of genetic distance, found among different species. Nevertheless, with the available data it is not possible to refute the hypothesis that the populations correspond to a group resulting from hybridization or that there might have been introgression of mitochondrial DNA among different species.

  1. Genome-Wide Linkage and Positional Association Analyses Identify Associations of Novel AFF3 and NTM Genes with Triglycerides: The GenSalt Study

    Science.gov (United States)

    Li, Changwei; Bazzano, Lydia A.L.; Rao, Dabeeru C.; Hixson, James E.; He, Jiang; Gu, Dongfeng; Gu, Charles C.; Shimmin, Lawrence C.; Jaquish, Cashell E.; Schwander, Karen; Liu, De-Pei; Huang, Jianfeng; Lu, Fanghong; Cao, Jie; Chong, Shen; Lu, Xiangfeng; Kelly, Tanika N.

    2016-01-01

    We conducted a genome-wide linkage scan and positional association study to identify genes and variants influencing blood lipid levels among participants of the Genetic Epidemiology Network of Salt-Sensitivity (GenSalt) study. The GenSalt study was conducted among 1906 participants from 633 Han Chinese families. Lipids were measured from overnight fasting blood samples using standard methods. Multipoint quantitative trait genome-wide linkage scans were performed on the high-density lipoprotein, low-density lipoprotein, and log-transformed triglyceride phenotypes. Using dense panels of single nucleotide polymorphisms (SNPs), single-marker and gene-based association analyses were conducted to follow-up on promising linkage signals. Additive associations between each SNP and lipid phenotypes were tested using mixed linear regression models. Gene-based analyses were performed by combining P-values from single-marker analyses within each gene using the truncated product method (TPM). Significant associations were assessed for replication among 777 Asian participants of the Multi-ethnic Study of Atherosclerosis (MESA). Bonferroni correction was used to adjust for multiple testing. In the GenSalt study, suggestive linkage signals were identified at 2p11.2–2q12.1 [maximum multipoint LOD score (MML) = 2.18 at 2q11.2] and 11q24.3–11q25 (MML = 2.29 at 11q25) for the log-transformed triglyceride phenotype. Follow-up analyses of these two regions revealed gene-based associations of charged multivesicular body protein 3 (CHMP3), ring finger protein 103 (RNF103), AF4/FMR2 family, member 3 (AFF3), and neurotrimin (NTM ) with triglycerides (P = 4 × 10−4, 1.00 × 10−5, 2.00 × 10−5, and 1.00 × 10−7, respectively). Both the AFF3 and NTM triglyceride associations were replicated among MESA study participants (P = 1.00 × 10−7 and 8.00 × 10−5, respectively). Furthermore, NTM explained the linkage signal on chromosome 11. In conclusion, we identified novel genes

  2. Composición química de “oca” (Oxalis tuberosa, ‘arracacha’ (Arracaccia xanthorriza y ‘tarwi’ (Lupinus mutabilis. Formulación de una mezcla base para productos alimenticios

    Directory of Open Access Journals (Sweden)

    Sandra Elizabeth Pagador Flores

    2011-01-01

    Full Text Available El presente trabajo tuvo como objetivo formular una mezcla base a partir de cultivos nativos, la cual una vez estandarizada, se constituye en materia prima de alto valor nutricional para su utilización en la elaboración de productos alimenticios como: purés, papillas y productos de panificación, entre otros. Se seleccionaron tres cultivos andinos: un tubérculo, “oca” (Oxalis tuberosa; una raíz, ‘arracacha’ (Arracaccia xanthorriza y una leguminosa, ‘tarwi’ (Lupinus mutabilis. Se realizaron por triplicado análisis bromatológicos, de minerales y vitaminas. Se formularon 8 mezclas bases a diferentes proporciones de cultivos nativos. Se seleccionó la mezcla base identificada como M7 en proporción 1:1:2 (oca:arracacha:tarwi por presentar mayor valor nutricional.

  3. Sistemas de polinização de duas espécies frutíferas endêmicas da caatinga : Ziziphus joazeiro Mart. (Rhamnaceae) e Spondias tuberosa Arruda (Anacardiaceae)

    OpenAIRE

    Correia de Lima Nadia, Tarcila

    2005-01-01

    Ziziphus joazeiro e Spondias tuberosa, espécies endêmicas da caatinga, apresentam grande importância econômica pela produção de lenha, carvão e de frutos comestíveis. Apesar de sua importância, há poucos estudos que tratam da biologia floral e da polinização dessas espécies. Este trabalho propõe-se, portanto, a analisar a fenologia reprodutiva, a biologia floral e o sistema de polinização dessas duas espécies frutíferas de caatinga e comparar o grau de similaridade entre os seu...

  4. Composición química de “oca” (Oxalis tuberosa, ‘arracacha’ (Arracaccia xanthorriza y ‘tarwi’ (Lupinus mutabilis. Formulación de una mezcla base para productos alimenticios

    Directory of Open Access Journals (Sweden)

    María Elena León Marroú

    2011-12-01

    Full Text Available El presente trabajo tuvo como objetivo formular una mezcla base a partir de cultivos nativos, la cual una vez estandarizada, se constituye en materia prima de alto valor nutricional para su utilización en la elaboración de productos alimenticios como: purés, papillas y productos de panificación, entre otros. Se seleccionaron tres cultivos andinos: un tubérculo, “oca” (Oxalis tuberosa; una raíz, ‘arracacha’ (Arracaccia xanthorriza y una leguminosa, ‘tarwi’ (Lupinus mutabilis. Se realizaron por triplicado análisis bromatológicos, de minerales y vitaminas. Se formularon 8 mezclas bases a diferentes proporciones de cultivos nativos. Se seleccionó la mezcla base identificada como M7 en proporción 1:1:2 (oca:arracacha:tarwi por presentar mayor valor nutricional.

  5. CYP96T1 of Narcissus sp. aff. pseudonarcissus Catalyzes Formation of the Para-Para' C-C Phenol Couple in the Amaryllidaceae Alkaloids

    Science.gov (United States)

    Kilgore, Matthew B.; Augustin, Megan M.; May, Gregory D.; Crow, John A.; Kutchan, Toni M.

    2016-01-01

    The Amaryllidaceae alkaloids are a family of amino acid derived alkaloids with many biological activities; examples include haemanthamine, haemanthidine, galanthamine, lycorine, and maritidine. Central to the biosynthesis of the majority of these alkaloids is a C-C phenol-coupling reaction that can have para-para', para-ortho', or ortho-para' regiospecificity. Through comparative transcriptomics of Narcissus sp. aff. pseudonarcissus, Galanthus sp., and Galanthus elwesii we have identified a para-para' C-C phenol coupling cytochrome P450, CYP96T1, capable of forming the products (10bR,4aS)-noroxomaritidine and (10bS,4aR)-noroxomaritidine from 4′-O-methylnorbelladine. CYP96T1 was also shown to catalyzed formation of the para-ortho' phenol coupled product, N-demethylnarwedine, as less than 1% of the total product. CYP96T1 co-expresses with the previously characterized norbelladine 4′-O-methyltransferase. The discovery of CYP96T1 is of special interest because it catalyzes the first major branch in Amaryllidaceae alkaloid biosynthesis. CYP96T1 is also the first phenol-coupling enzyme characterized from a monocot. PMID:26941773

  6. CYP96T1 of Narcissus sp. aff. pseudonarcissus Catalyzes Formation of the Para-Para’ C-C Phenol Couple in the Amaryllidaceae Alkaloids

    Directory of Open Access Journals (Sweden)

    Matthew eKilgore

    2016-02-01

    Full Text Available The Amaryllidaceae alkaloids are a family of amino acid derived alkaloids with many biological activities; examples include haemanthamine, haemanthidine, galanthamine, lycorine, and maritidine. Central to the biosynthesis of the majority of these alkaloids is a C-C phenol-coupling reaction that can have para-para’, para-ortho’, or ortho-para’ regiospecificity. Through comparative transcriptomics of Narcissus sp. aff. pseudonarcissus, Galanthus sp., and Galanthus elwesii we have identified a para-para’ C-C phenol coupling cytochrome P450, CYP96T1, capable of forming the products (10bR,4aS-noroxomaritidine and (10bS,4aR-noroxomaritidine from 4’-O-methylnorbelladine. CYP96T1 was also shown to catalyzed formation of the para-ortho’ phenol coupled product, N-demethylnarwedine, as less than 1 % of the total product. CYP96T1 co-expresses with the previously characterized norbelladine 4’-O-methyltransferase. The discovery of CYP96T1 is of special interest because it catalyzes the first major branch in Amaryllidaceae alkaloid biosynthesis. CYP96T1 is also the first phenol-coupling enzyme characterized from a monocot.

  7. Identification of the glycosidase inhibitors swainsonine and calystegine B2 in Weir vine (Ipomoea sp. Q6 [aff. calobra]) and correlation with toxicity.

    Science.gov (United States)

    Molyneux, R J; McKenzie, R A; O'Sullivan, B M; Elbein, A D

    1995-06-01

    The polyhydroxy alkaloid glycosidase inhibitors swainsonine [1] and calystegine B2 [6] have been identified as constituents of the seeds of the Australian plant Ipomoea sp. Q6 [aff. calobra] (Weir vine) by gas chromatography-mass spectrometry and by their biological activity as inhibitors of specific glycosidases. This plant, which is known only from a small area of southern Queensland, has been reported to produce a neurological disorder when consumed by livestock. The extract of the seeds showed inhibition of alpha-mannosidase, beta-glucosidase, and alpha-galactosidase, consistent with the presence of 1 and alkaloids of the calystegine class. Histological examination of brain tissue from field cases of sheep and cattle poisoned by Weir vine showed lesions similar to those observed in animals poisoned by the swainsonine-containing poison peas (Swainsona spp.) of Australia and locoweeds (Astragalus and Oxytropis spp.) of North America. These results indicate that Weir vine poisoning is an additional manifestation of the induced lysosomal storage disease, mannosidosis, possibly exacerbated by inhibition of the enzymes beta-glucosidase and alpha-galactosidase by calystegine B2. This is the first reported example of a single plant species capable of producing structurally distinct glycosidase inhibitors, namely, alkaloids of the indolizidine and nortropane classes.

  8. New Host Record for Camponotophilus delvarei (Hymenoptera: Eurytomidae, a Parasitoid of Microdontine Larvae (Diptera: Syrphidae, Associated with the Ant Camponotus sp. aff. textor

    Directory of Open Access Journals (Sweden)

    Gabriela Pérez-Lachaud

    2013-01-01

    Full Text Available Microdontine syrphid flies are obligate social parasites of ants. Larvae prey on ant brood whereas adults live outside the nests. Knowledge of their interaction with their host is often scarce, as it is information about their natural enemies. Here we report the first case of parasitism of a species of microdontine fly by a myrmecophilous eurytomid wasp. This is also the first host record for Camponotophilus delvarei Gates, a recently described parasitic wasp discovered in Chiapas, Mexico, within the nests of the weaver ant, Camponotus sp. aff. textor Forel. Eleven pupal cases of a microdontine fly were found within a single nest of this ant, five of them being parasitized. Five adult C. delvarei females were reared from a puparium and 29 female and 2 male pupae were obtained from another one. The eurytomid is a gregarious, primary ectoparasitoid of larvae and pupae of Microdontinae, its immature stages developing within the protective puparium of the fly. The species is synovigenic. Adult females likely locate and parasitize their hosts within the ant nest. As some species of Microdontinae are considered endangered, their parasitoids are likewise threatened and in need of accurate and urgent surveys in the future.

  9. Gametogenesis and reproductive cycle of Melanorivulus aff. punctatus (Boulenger, 1895 (Cyprinodontiformes, Rivulidae in Chapada dos Guimarães, Mato Grosso, Brazil

    Directory of Open Access Journals (Sweden)

    Monica Cassel

    Full Text Available The comprehension of the reproductive cycle allows to understand which are the morphological changes that develop in the gonad during this interval. Thus, many studies have been undertaken in order to describe and classify the stages of gonadal development and reproductive status of Neotropical fishes. For this purpose, specimens of Melanorivulus aff. punctatus were collected in a permanent dam in Chapada dos Guimarães, Mato Grosso, Brazil. The gonads were prepared for analysis by light microscopy. The oogenesis and spermatogenesis have been described, characterizing the stages of gonadal development, together with assessments of the gonadosomatic ratio, germ cell count and verification of variation of mature oocytes in females. Throughout the year the male gonads presented themselves as capable of reproducing, characterized by the presence of undifferentiated and differentiated spermatogonia, spermatocytes organized into cysts, spermatids in cysts whose wall was thicker and the spermatozoa was free in the lumen and the duct. This can indicate a continuous reproductive cycle with split spermiation. The females had gonads in the development stage from May to September with undifferentiated and differentiated oogonias and early oocytes always facing the lumen, abundant pre-vitellogenic and vitellogenic oocytes and some atresias. In the phase capable of spawning, observed from October to March, the mature oocytes are abundant, there are many post-ovulatory complexes and some atresia in advanced stage. The regression, observed in some individuals from February to April, is characterized by ovaries with many atresias and post-ovulatory complexes. The same results were found in the quantitative assessments. Therefore, it may be characterized as discontinuous cycle with split spawning. Thus, the reproductive cycle of this species can be characterized as continuous for males and discontinuous for females, which have a most intense phase of reproduction

  10. Caracterização e qualidade de frutos de umbu-cajá (Spondias tuberosa X S. mombin provenientes do Recôncavo Sul da Bahia Characterization and quality of umbu-caja fruits (Spondias tuberosa X S. mombin procceeding from the Southern Reconcavo in Bahia

    Directory of Open Access Journals (Sweden)

    Márcio Barros dos Santos

    2010-12-01

    Full Text Available O Recôncavo Sul da Bahia apresenta uma significativa riqueza de fruteiras nativas com grande potencial alimentício. Além de indicativos etnológicos sobre seus usos como alimento, pouco se conhece sobre elas, principalmente sobre sua composição bromatológica. A exemplos destas fruteiras, encontram-se os frutos do umbu-cajá (Spondias tuberosa X S. mombin que são amplamente consumidos in natura ou na forma de produtos processados em quase todo o Brasil. Devido à crescente aceitação de seus produtos e à incessante busca por novos sabores, as agroindústrias vêm despertando o interesse tanto para o mercado interno quanto para exportações. Entretanto, apesar do forte interesse comercial, poucos estudos foram efetuados na busca de respostas sobre a sua composição. Nesse sentido, este trabalho teve o objetivo de efetuar a caracterização física, físico-química e mineralógica dos frutos de umbu-cajá cultivados nas condições climáticas do Recôncavo Sul da Bahia. Foram realizadas análises de peso do fruto e da casca; tamanho e diâmetro; percentagem de casca, semente e polpa; pH; sólidos solúveis totais; acidez titulável; relação sólido solúveis/acidez (Ratio; índice tecnológico; açúcares (redutores, não redutores e totais; vitamina C; proteína; umidade; lipídios; fibra bruta; amido; e minerais (fósforo, ferro, cálcio, sódio e potássio. Os frutos apresentaram tamanho grande (23,18g com rendimento considerável de polpa (69,70 % e razoáveis valores de açucares (7,49 %, acidez (1,32 %, fibras (1,36 %, vitamina C (8 mg /100g e minerais ( Na-40 mg /100g; K-44mg /100g; P-17,76mg /100g; Fé-0,59mg /100g; e Ca-12,25mg /100g, demonstrando ser uma alternativa para o mercado de frutas in natura, bem como para a agroindústria na região.The Southern Reconcavo in Bahia has a significant wealth of native plants with high nutritional potential. Besides ethnological indicative of their uses as food, little is known about

  11. Morfologia do trato digestório e dieta de larvas de Bryconamericus aff. iheringii (Boulenger, 1887 (Osteichthyes, Characidae - DOI: 10.4025/actascibiolsci.v28i1.1059 Morphology of Digestive tract and diet of Bryconamericus aff. iheringii larvae (Boulenger, 1887 (Osteichthyes, Characidae - DOI: 10.4025/actascibiolsci.v28i1.1059

    Directory of Open Access Journals (Sweden)

    Keshiyu Nakatani

    2006-03-01

    Full Text Available Este trabalho teve como objetivo analisar alguns aspectos da alimentação de larvas de Bryconamericus aff. iheringii, capturadas nos meses de julho e novembro de 2001, nas regiões limnética e litorânea do reservatório de Santa Maria, rio Piquiri, Estado do Paraná. As larvas apresentaram boca subterminal durante todo o seu desenvolvimento. O tubo digestório se diferenciou em estômago e intestino apenas no estágio de pós-flexão. As larvas consumiram, principalmente, algas e microcrustáceos, o que permitiu caracterizá-las como planctófagas. A intensa modificação morfológica no trato digestório nos indivíduos em pós-flexão coincidiu com o aumento na abundância de algas em relação aos itens de origem animal; porém, de forma geral, a ocorrência aumentou para todos os itens. A análise do grau de digestão dos itens alimentares sugeriu que indivíduos em pré-flexão alimentaram-se, possivelmente, durante o dia, e os mais desenvolvidos, durante o entardecer e no período noturnoThe aim of this study was to analyze some feeding treats of Bryconamericus aff. iheringii larvae, sampled in both the limnetic and littoral regions of the Piquiri River, in Santa Maria reservoir, between July and November 2001. The larvae presented sub-terminal mouth in larval period. The digestive tract differentiated in terms of stomach and intestine only in the postflexion larvae. The larvae fed mainly on algae and microcrustacea allowing to characterize them as planktivorous. The intense morphologic shift in the digestive tract in the postflexion larvae coincided with an increase in the abundance of algae in relation to animals items; however, in general, all the items had their occurrence increased. Analysis of the digestion stage suggested that preflexion larvae, possibly, fed themselves during the day, and those more developed, at dusk and night

  12. Estabilidade da cor de doces em massa de polpa de umbu (Spondias tuberosa arr. cam. no estádio de maturação verde Color stability of marmalade made from pulp of unripe umbu

    Directory of Open Access Journals (Sweden)

    Vânia Madeira Nunes Policarpo

    2007-08-01

    Full Text Available Os frutos de umbu (Spondias tuberosa Arr. Cam. maduros são altamente perecíveis, e o aproveitamento deles no estádio de maturação verde, sob a forma de doce é uma interessante alternativa econômica, para o semi-árido nordestino. A conservação da cor, durante o armazenamento, constitui um fator de qualidade dos mais importantes para o consumo, e o presente trabalho objetivou avaliar sua alteração em função de diferentes formulações, embalagens (polipropileno e celofane e temperaturas (33 e 43°C, por 90 dias de armazenamento. A adição de pectina e/ou xarope de glicose não alterou a luminosidade (L*, mas diminuiu os valores de a* ( intensidade do vermelho e b*. ( intensidade do amarelo. Verificou-se diminuição dos valores de L* a* e b*, notadamente para os doces armazenados à temperatura de 43°C e para a formulação sem adição de pectina. A embalagem não exerceu efeito significativo sobre L*( luminosidade, mas afetou a* e b* aos 90 dias de estocagem, em ambas as temperaturas. Os resultados globais indicaram o uso de pectina e xarope de glicose, embalagens de polipropileno e estocagem à temperaturas mais baixas como sendo as condições mais adequadas para preservação da cor.Ripe umbu (Spondias tuberosa Arr. Cam. is highly perishable, thus using unripe umbu to make marmalade is an interesting economic alternative for the semi arid northeastern region in Brazil. Color conservation during storage is one of the major quality factors for consumption. This work aimed to evaluate color alteration in function of different formulations, packagings (polypropylene and cellophane and temperatures (33 and 43°C over 90 storage days. Pectin and/or glucose syrup adittion did not alter luminosity (L*, but decreased a* (red intensity and b*(yellow intensity values. L* (luminosity, a* ( red intensity and b* (yellow intensity values were found to decrease, especially for marmalade stored at 43°C and formulation without pectin addition

  13. Efecto de diferentes dietas de microalgas sobre la supervivenci y crecimiento de Apocyclops aff. panamensis (Marsh, 1913 (Copépodo: Cyclopoida cultivado bajo condiciones controladas de laboratorio - Effect of different diets from microalga on supervivenci and growth of Apocyclops aff. panamensis (Marsh, 1913 (Copépodo: Cyclopoida cultivated under controlled conditions of laboratory

    Directory of Open Access Journals (Sweden)

    Elifonso Isiordia Perez,

    2006-07-01

    Full Text Available El presente trabajo fue realizado Julio 2001 con el propósito de evaluar el efecto de diferentes dietas de microalgas sobre la supervivencia y crecimiento (desarrollo de Apocyclops aff. Panamensis. El experimento duró 15 días y se realizó en las instalaciones del Instituto de Ciencias del Mar y Limnología (UNAM Unidad académica Mazatlán Sinaloa. El sistema consistió en un acuario de fibra de vidrio (50x30x40 al cual se agregó 4 litros de agua dulce filtrada 5µ se colocó un termostato para presentar condiciones controladas de temperatura (28ºC, así mismo se mantuvo constante el fotoperiodo (8 horas luz. En el interior del acuario se colocó 1 gradilla con 35 tubos de ensayo con 6 ml de agua salada a 32 ‰ filtrada con luz ultravioleta. Los copépodos fueron colectados en la boca del estero el Yugo Mazatlán, Sinaloa, transportados y aclimatados durante 15 minutos. La siembra consistió en colocar 20 nauplios en estadio II en cada tubo de ensayo. Los tratamientos que se aplicaron como alimento fueron: Chaetoceros sp. + Nannocloropsis sp. (50%:50% (T1, Isochrysis sp. + Nannocloropsis sp. (50%:50% (T2, Chaetoceros sp. + Isochrysis sp. (50%:50% (T3, Chaetoceros sp. (100% (T4, Isochrysis sp. (100% (T5, Nannocloropsis sp. (100% (T6, Chaetoceros sp. + Isochrysis sp. + Nannocloropsis sp. (1:1:1 (T7 cada uno con 5 repeticiones. La densidad de microalgas a suministrar para el presente experimento fue de 50,000 células / mililitro. Al finalizar el estudio solo los copépodos que lograron una supervivencia del 15% hasta copepodito 5 fueron los alimentados con Nanocloropsis sp. (100% y la mayor longitud (0.83 mm se presentó en copépodos alimentados con Chaetoceros sp. (100%, De acuerdo a los resultados se concluye que para lograr mayor crecimiento y supervivencia en el cultivo de copépodos Apocyclops aff. Panamensis se recomienda usar estos tratamientos como alimento. The present work was made July 2001 in order to evaluate the effect of

  14. Efeito do tratamento com própolis de Scaptotrigona aff. postica sobre o desenvolvimento do tumor de Ehrlich em camundongos

    Directory of Open Access Journals (Sweden)

    Maria José A. M. Araújo

    2010-09-01

    Full Text Available Neste trabalho foi investigado o efeito do extrato hidroalcoólico de própolis (EHP de Scaptotrigona aff. postica sobre o desenvolvimento do tumor de Ehrlich na forma sólida, sobre a celularidade dos órgãos linfóides dos animais portadores de tumor, bem como, sobre a produção de óxido nítrico (NO pelos macrófagos destes animais. Camundongos Swiss foram divididos em quatro grupos: controle, EHP 0,5; EHP 5 e EHP 50, os quais foram tratados por via intraperitoneal com dose única de solução salina (NaCl 0,9%; 0,5; 5 ou 50 mg de EHP/kg de animal, respectivamente. Depois de 48 h do tratamento, os animais foram inoculados com 10(5 células do tumor de Ehrlich nas patas. Os resultados mostraram que o tratamento com EHP nas doses de 5 e 50 mg/kg inibiu de forma significativa o desenvolvimento do tumor a partir do 6º dia pós-inóculo quando comparado ao controle e ao EHP 0,5. Além disso, houve aumento significativo da celularidade do baço e da medula óssea nos grupos EHP 0,5 e EHP 5 em relação ao controle. A produção de NO estimulada com concanavalina A (ConA apresentou uma significante diminuição nos grupos tratados com EHP em relação ao controle. Pode-se concluir que o tratamento com EHP apresentou efeito antitumoral quando administrado nas doses de 5 e 50 mg/kg, o que pode estar relacionado com a sua composição química e com a inibição da produção de NO.

  15. Placa fibrosa de la frente o del cuero cabelludo: Un marcador cutáneo temprano del complejo de la esclerosis tuberosa Forehead or scalp fibrous plaque: An earley cutaneous marker in tuberous sclerosis complex

    Directory of Open Access Journals (Sweden)

    A. E Saponaro

    2010-09-01

    Full Text Available El complejo de la Esclerosis tuberosa es una afección hereditaria, que se transmite en forma autosómica dominante. Se caracteriza por convulsiones, retraso mental y manifestaciones en diversos órganos. Los signos cutáneos suelen ser determinantes para el diagnóstico de la enfermedad. Entre éstos se destaca la placa fibrosa, la que se localiza más frecuentemente en la frente, pero puede observarse en cualquier área del cuero cabelludo. Cuando está presente, suele ser el signo cutáneo inicial de la enfermedad, como ocurrió en nuestro paciente, subdiagnosticado. Su importancia radica entonces en reconocerlo como un marcador precoz y patognomónico de la enfermedad.The complex of tuberous sclerosis is an hereditary disease that passes in the autosomal dominant way. It is characterized by convulsions, mental retardation and manifestations in different organs. The cutaneous signs are used to be determinant for the diagnosis of the illness. Among these, it is important the fibrous plaque, which is usually localized in the forehead, but it can also be observed in any area of the scalp.When it is presented, it is used to be the first cutaneous sign of the illness, and like it happened in our patient, underdiagnosed. So, the importance of the fibrous plaque lies in recognizing it as an early cutaneous marker and pathognomonic of the disease.

  16. Rabdomioma cardiaco como manifestación de esclerosis tuberosa: Presentación de dos casos y revisión de la literatura Cardiac rhabdomyoma as manifestation of tuberous sclerosis: Presentation of two cases and literature review

    Directory of Open Access Journals (Sweden)

    Rafael Lince

    2009-10-01

    Full Text Available Los rabdomiomas cardiacos son tumores benignos dependientes de las fibras musculares miocárdicas, los cuales usualmente son múltiples, pero tienden a disminuir tanto en número como en tamaño con el crecimiento, con una regresión espontánea en 90% de los casos. Hacen parte de los tumores cardiacos primarios, los cuales son poco frecuentes, con una incidencia que varía entre 0,0017% y 0,28%. El más frecuente de los tumores cardiacos primarios es el rabdomioma. Se describe asociación con esclerosis tuberosa hasta en 72% de los casos, razón por la cual ésta debe buscarse ante el hallazgo de rabdomioma cardiaco.Cardiac rhabdomyomas are benign tumors derived from cardiac muscle fibers. They are usually multiple, but tend to decrease both in number and size with growth, with spontaneous regression in 90% of cases. These lesions are part of the primary cardiac tumors, which are uncommon, and have a variable incidence between 0.0017 and 0.28%. The most common primary cardiac tumor is the rhabdomyoma. An association between rhabdomyoma and tuberous sclerosis has been described in up to 72% of cases. For this reason, a patient with cardiac rhabdomyoma should be investigated for tuberous sclerosis.

  17. Fibroma desmoplásico de mandíbula asociado a esclerosis tuberosa: Revisión de la literatura y presentación de un caso Desmoplastic fibroma of the jaw associated with tuberous sclerosis: Literature review and case report

    Directory of Open Access Journals (Sweden)

    M. Acosta Feria

    2008-04-01

    Full Text Available La esclerosis tuberosa es una anomalía congénita del desarrollo embrionario que se transmite de forma autosómica dominante caracterizada por la presencia por trastornos neurológicos, cutáneos o dermatológicos, y retraso mental. Se pueden afectar otros órganos y sistemas, y dar manifestaciones orofaciales. La lesión a nivel del esmalte dental constituye la lesión intraoral más frecuente. Rara vez se pueden encontrar lesiones óseas en los maxilares. El fibroma desmoplásico es un infrecuente tumor fibroso intraóseo localmente agresivo de lento crecimiento, que se asocia muy rara vez a la esclerosis tuberosa. Presentamos el caso clínico de un paciente de 33 años afecto de esclerosis tuberosa con una lesión en la mandíbula diagnosticada como fibroma desmoplásico. Se discuten los métodos diagnósticos, presentación clínica y tratamiento.Tuberous sclerosis is a congenital anomaly of embryonic development with an autosomal dominant inheritance. It is characterized by the presence of neurologic and dermatologic disorders and mental retardation. It can affect other organs and systems and produce orofacial manifestations. Dental enamel defects are the most frequent intraoral lesion. Bone lesions rarely occur in the upper jaw. Desmoplastic fibroma is an infrequent, slow-growing, locally aggressive intraosseous fibrous tumor that rarely is associated with tuberous sclerosis. We report the clinical case of a 33-year-old man with tuberous sclerosis and a jaw lesion diagnosed as desmoplastic fibroma. The diagnostic methods, clinical presentation, and treatment are discussed.

  18. Fibroma desmoplásico de mandíbula asociado a esclerosis tuberosa: Revisión de la literatura y presentación de un caso Desmoplastic fibroma of the jaw associated with tuberous sclerosis: Literature review and case report

    OpenAIRE

    M. Acosta Feria; P. Infante Cossío; D. López Vaquero; A. Carranza Carranza; J.L. Gutiérrez Pérez

    2008-01-01

    La esclerosis tuberosa es una anomalía congénita del desarrollo embrionario que se transmite de forma autosómica dominante caracterizada por la presencia por trastornos neurológicos, cutáneos o dermatológicos, y retraso mental. Se pueden afectar otros órganos y sistemas, y dar manifestaciones orofaciales. La lesión a nivel del esmalte dental constituye la lesión intraoral más frecuente. Rara vez se pueden encontrar lesiones óseas en los maxilares. El fibroma desmoplásico es un infrecuente tum...

  19. Feeding and morphological analysis of the digestive tract of four species of fish (Astyanax altiparanae, Parauchenipterus galeatus, Serrasalmus marginatus and Hoplias aff. malabaricus from the upper Paraná River floodplain, Brazil

    Directory of Open Access Journals (Sweden)

    D. Peretti

    Full Text Available The present study is inspired by the great wealth of species exhibited by the ichthiofauna. Not only concepts and techniques of ecology deserve attention, but also knowledge in other biological areas, such as zoology and anatomy, are necessary. The intention of the present work is to discover the morphology of fish through the study of the digestive tract morphology, associating it to diet data, in order to better understand the biology of four fish species of the upper Paraná River floodplain. The samples were collected quarterly in the year 2000 with gillnets of different meshes. The stomach content was analyzed under a stereoscopic microscope and the frequencies of occurrence (FO and volumetric (FV and the alimentary index (IAi were calculated. Various morphologic characteristics were analyzed and schematized using a light chamber. The species were grouped into two trophic guilds - insectivores (Astyanax altiparanae and Parauchenipterus galeatus and piscivores (Serrasalmus marginatus and Hoplias aff. malabaricus. The first two, although consumers of insects, preyed on different alimentary groups, notably Hymenoptera in the case of A. altiparanae and Coleoptera in the case of P. galeatus. Serrasalmus marginatus and H. aff. malabaricus consumed mainly fishes. However, only pieces of prey were usually found in the stomach content of the first species, whereas whole fishes were found in the stomach content of the second. Astyanax altiparanae exhibited characteristics that allowed it to obtain food in several compartments of the water column. Similarly P. galeatus consumed food resources that were available in all aquatic compartments, although the abilities to capture, to manipulate and to absorb food differed, as shown by the importance of teeth plates and pharyngeal teeth. Serrasalmus marginatus and H. aff. malabaricus, although resembling each other in many aspects of the digestive tract morphology, differed in the strategies used to capture

  20. Bilateral giant renal angiomyolipoma associated with hepatic lipoma in a patient with tuberous sclerosis Angiomiolipomas renais gigantes bilateralmente associados a lipoma hepático em pacientes com esclerose tuberosa

    Directory of Open Access Journals (Sweden)

    Edison Daniel Schneider-Monteiro

    2003-01-01

    Full Text Available OBJECTIVE: To report a case of bilateral giant renal angiomyolipoma associated with tuberous sclerosis, with successful treatment, and to review the literature concerning angiomyolipoma treatment. CASE REPORT: Patient with tuberous sclerosis and angiomyolipoma diagnosed by ultrasonography during her pregnancy. At that time, the angiomyolipoma on the right side was 9 cm in diameter. Conservative management was selected during her pregnancy. The patient returned 7 years later, with a 24.7 x 19.2 x 10.7 cm tumor on the right side and another of 13 x 11.5 x 6.5 cm on the left side, in addition to multiple small angiomyolipomas. A nephron-sparing surgery with tumoral enucleation was performed on the right side, and after 3 months, the tumor on the left side was removed. Renal function in the post-operative period was preserved, and contrast medium progression was uniform and adequate in both kidneys. CONCLUSION: We conclude that an angiomyolipoma larger than 4 cm should be removed surgically, since they have a greater growth rate and pose a risk of hemorrhage. Resection of smaller tumors is safe and has decreased morbidity. Tumoral enucleation is an effective treatment method that preserves kidney function.OBJETIVO: Relatar um caso de angiomiolipoma gigante, bilateral, associado a esclerose tuberosa, tratado com sucesso e revisar a literatura concernente ao tratamento do angiomiolipoma. RELATO DO CASO: Paciente portadora de esclerose tuberosa, com diagnóstico de angiomiolipoma realizado por ultra-sonografia durante gestação. O tumor apresentava 9cm de diâmetro, à direita. Optou-se por conduta conservadora durante a gestação, e a paciente retornou somente 7 anos após, com tumor de 24,7 x 19,2 x 10,7 cm à direita e outro à esquerda de 13 x 11,5 x 6,5 cm, além de múltiplos angiomiolipomas pequenos. Realizada inicialmente ressecção tumoral à direita, por enucleação, com preservação do parênquima renal, e 3 meses após à esquerda. A

  1. Sinergismo entre el cloruro de sodio, sacarosa y fosfato tricálcico en la deshidratación osmótica de oca (Oxalis tuberosa con y sin recubrimiento de Quitosano

    Directory of Open Access Journals (Sweden)

    José Arroyo Portal

    2010-01-01

    Full Text Available Se investigó el efecto sinérgico de tres solutos (cloruro de sodio, sacarosa, y fosfato tricálcico en distintas combi naciones de concentración, sobre la humedad, ganancia de sólidos y ganancia de calcio en la deshidratación osmótica de oca ( Oxalis tuberosa con y sin recubrimiento de quitosano (CR y SR. En ambos casos se aplicó un diseño de mezclas Simplex con Centroide Ampliado. Se utilizaron cilindros de oca de 0.9 cm de diámetro y 3.4 cm de longitud. S e evaluó la cinética de la humedad, ganancia de sólidos y ganancia de calcio durante 48 horas . S e determinó la difusividad efectiva del agua, sólidos y calcio. Se encont ró que en muestras CR hay mayor pérdida de agua y menor ganancia de sólidos comparado con las muestras SR, principalmente cuando el cloruro de sodio o sacarosa participa independientemente, en tanto que para la ganancia de calcio , en todos los casos, las m uestras CR ganan mayor cantidad de calcio que las muestras SR. L as difusividades efectivas encontradas fueron: para el agua, 1.19E - 09 m 2 /s en muestras CR y 1.34E - 09 m 2 /s en muestras SR; para los sólidos, 3.67E - 09 m 2 /s en muestras CR y 5.43E - 09 m 2 /s en mues tras SR ; y, para el calcio 3.32E - 11 m 2 /s en muestras CR y 1.57E - 09 m 2 /s en muestras SR.

  2. Vigabarina no tratamento da epilepsia de difícil controle em pacientes com síndrome de West e esclerose tuberosa Vigabatrin in the treatment of epilepsy in patients with West syndrome and tuberous sclerosis

    Directory of Open Access Journals (Sweden)

    Newra Tellechea Rotta

    2003-12-01

    Full Text Available OBJETIVO: é relatar a eficácia da vigabatrina no controle das convulsões, bem como as alterações eletrencefalográficas em crianças com esclerose tuberosa e síndrome de West. MÉTODO: Estudo retrospectivo, com dados clínicos, de neuroimagem e de eletrencefalograma. RESULTADOS: Sete pacientes foram acompanhados e o tempo médio de seguimento foi 10 anos. Dos pacientes, quatro eram do sexo feminino e todos eram de cor branca. A média de idade de início das convulsões foi 3,4 meses. Todos usaram associações de vários anticonvulsivantes; no mínimo duas drogas por esquema terapêutico, e cada paciente utilizou pelo menos dois esquemas diferentes. O uso de vigabatrina como monoterapia ou em associação iniciou em média aos 7 anos de idade ou 4 anos após início dos sintomas. Cinco dos sete pacientes que iniciaram vigabatrina ficaram sem crise. CONCLUSÃO: Vigabatrina mostrou-se eficaz no controle das crises, levando a um melhor prognóstico.PURPOSE: To report the efficacy of vigabatrin in seizures control, as well as the electroencephalographic abnormalities in children with tuberous sclerosis and West syndrome. METHOD: Retrospective study, with clinical, neuroimaging, and electroencephalographic data. RESULTS: Seven patients were followed, and the median time of follow-up was 10 years. Four of them were females and all were white. The mean age of seizures onset was 3.4 months. All patients used antiepileptic drugs associations, at least 2 drugs each therapeutic scheme, each one of the patients have used at least two different schemes. Vigabatrin as monotherapy or adjuvant was started in a mean age of seven years or 4 years after the onset of symptons. Five from seven patients on vigabatrin became seizure free. CONCLUSION: Vigabatrin was efficient in seizures control, leading to a better prognosis.

  3. Overcoming seed dormancy and early growth of seedlings of Spondias tuberosa, Arr. CâmaraSuperação de dormência de sementes e crescimento inicial de plântulas de umbuzeiro

    Directory of Open Access Journals (Sweden)

    Janete Motta da Silva Gonzaga

    2012-08-01

    Full Text Available Pre-germination treatments such as scarification and the use of growth regulators can provide the dormancy breaking in seeds and enhance the emergence and development of seedlings. The aim of this study was to determine appropriate treatments to overcome seed dormancy and enhance the initial growth of seedlings of Spondias tuberosa. We used a randomized design in factorial 2 x 4, with the following factors: seeds scarified or not scarified and then soaked in water or aqueous solutions of gibberellin, cytokinin and ethylene, with 4 replicates and 15 seeds. There was no significant interaction between scarification treatments and use of growth regulators. Mechanical scarification and soaking seeds in solutions containing umbuzeiro growth regulators does not increase the percentage of seedling emergence, however soaking in a solution of Ethrel at 100 ppm provides higher speed of emergence and root development. Tratamentos pré-germinativos, como a escarificação e o uso de reguladores de crescimento, podem proporcionar a superação de dormência em sementes e incrementar a emergência e o desenvolvimento de plântulas. O objetivo da presente pesquisa foi determinar tratamentos adequados para a superação da dormência de sementes e potencialização do crescimento inicial de plântulas de umbuzeiro. Utilizou-se o delineamento inteiramente casualizado, em fatorial 2 x 4, sendo os fatores: sementes escarificadas ou não escarificadas e, posteriormente, imersas em água ou soluções aquosas de giberelina, citocinina ou etileno, com 4 repetições de 15 sementes. Não houve interação significativa entre os tratamentos escarificação e uso de reguladores de crescimento. A escarificação mecânica e a embebição de sementes de umbuzeiro em soluções contendo reguladores de crescimento não aumenta a percentagem de emergência de plântulas, entretanto a embebição em solução de Ethrel a 100 ppm proporciona maior velocidade de emergência e

  4. Frequency of the ETV6-RUNX1, BCR-ABL1, TCF3-PBX1, and MLL-AFF1 fusion genes in Guatemalan pediatric acute lymphoblastic leukemia patients and their ethnic associations.

    Science.gov (United States)

    Carranza, Claudia; Granados, Lilian; Morales, Oneida; Jo, Wendy; Villagran, Swuanny; Tinti, Damaris; Villegas, Mauricio; Antillón, Federico; Torselli, Silvana; Silva, Gabriel

    2013-06-01

    Fusion genes involved in acute lymphoblastic leukemia (ALL) occur mostly due to genetic and environmental factors, and only a limited number of studies have reported any ethnic influence. This study assesses whether an ethnic influence has an effect on the frequency of any of the four fusion genes: BCR-ABL1, ETV6-RUNX1, TCF3-PBX1, and MLL-AFF1 found in ALL. To study this ethnic influence, mononuclear cells were obtained from bone marrow samples from 143 patients with ALL. We performed RNA extraction and reverse transcription, then assessed the quality of the cDNA by amplifying the ABL1 control gene, and finally evaluated the presence of the four transcripts by multiplex polymerase chain reaction. We found 10 patients who had the BCR-ABL1 fusion gene (7%); 3 patients (2%) were TCF3-PBX1 positive; and 6 patients (4.5%) were ETV6-RUNX1 positive. The incidence of this last fusion gene is quite low when compared to the values reported in most countries. The low incidence of the ETV6-RUNX1 fusion gene found in Guatemala matches the incidence rates that have been reported in Spain and Indian Romani. Since it is known that an ethnic resemblance exists among these three populations, as shown by ancestral marker studies, the ALL data suggests an ethnic influence on the occurrence and frequency of this particular fusion gene.

  5. Gyrodactylus aff. mugili Zhukov, 1970 (Monogenoidea: Gyrodactylidae) from the gills of mullets (Mugiliformes: Mugilidae) collected from the inland waters of southern Iraq, with an evalutation of previous records of Gyrodactylus spp. on mullets in Iraq.

    Science.gov (United States)

    Kritsky, Delane C; Ali, Atheer H; Khamees, Najim R

    2013-11-01

    Gyrodactylus aff. mugili Zhukov, 1970 (Monogenoidea: Gyrodactylidae) is recorded and described from the gill lamellae of 11 of 35 greenback mullet, Chelon subviridis (Valenciennes) (minimum prevalence 31%), from the brackish waters of the Shatt Al-Arab Estuary in southern Iraq. The gyrodactylid was also found on the gill lamellae of one of eight Speigler's mullet, Valamugil speigleri (Bleeker), from the brackish waters of the Shatt Al-Basrah Canal (minimum prevalence 13%). Fifteen Klunzinger's mullet, Liza klunzingeri (Day), and 13 keeled mullet, Liza carinata (Valenciennes), collected and examined from southern Iraqi waters, were apparently uninfected. The gyrodactylids from the greenback mullet and Speigler's mullet were considered to have affinity to G. mugili Zhukov, 1970, and along with G. mugili may represent members of a species complex occurring on mullets in the Indo-Pacific Region. A single damaged gyrodactylid from the external surfaces of the abu mullet, Liza abu (Heckel), was insufficient for species identification. Previously identified species of Gyrodactylus recorded on L. abu in Iraq by various authors were considered possible misidentifications or accidental infections.

  6. On the comparison of the polarisation behaviour of exchange-biased AF/F NiMn/Fe 37Co 48Hf 15 bi-layer and multi-layer films with increased ferromagnetic cut-off frequencies

    Science.gov (United States)

    Seemann, K.; Leiste, H.; Krüger, K.

    2012-03-01

    Antiferromagnetic/ferromagnetic (AF/F) NiMn/Fe37Co48Hf15 films were investigated with respect to their exchange bias, in-plane unidirectional anisotropy, polarisation and high frequency behaviour. After deposition, carried out by r.f. magnetron sputtering, the films were post-annealed for 4 h at 300 °C in a static magnetic field, in order to induce exchange-bias, which results in a unidirectional anisotropy. Dependent on the presence of a bi-layer or multi-layer sandwich structure the films show a different exchange-bias field-ferromagnetic inter-layer thickness behaviour with exchange-bias fields μ0*Heb between 2 and 10 mT. The in-plane uniaxial (single film) or unidirectional anisotropy fields μ0*HUF were between 4 and 18 mT. This results in a significant increase of the cut-off frequency in the GHz range in comparison to a single Fe37Co48Hf15 film, which is shown by frequency-dependent permeability plots. High damping in the imaginary part of the permeability, i.e., high resonance line broadening could be observed for films with high coercivity μ0*Hc of around 7 mT in the easy axis of magnetisation.

  7. Complejo nódulo subependimario-astrocitoma subependimario gigantocelular en niños con esclerosis tuberosa Subependymal nodules-subependymal giant cell astrocytoma complex in children with tuberous sclerosis

    Directory of Open Access Journals (Sweden)

    Lucas Bongiorni

    2009-01-01

    Full Text Available El objetivo fue describir las características clínico imagenológicas de niños con esclerosis tuberosa que presentaron el complejo Nódulo Subependimario (NS-Astrocitoma Subependimario Gigantocelular(ASGC y analizar el comportamiento evolutivo de dicho "complejo" para detectar precozmente su crecimiento y evitar las complicaciones de la hipertensión endocraneana (HTE. Evaluamos 22 pacientes con diagnóstico anátomo patológico de ASGC. El diagnóstico del tumor se realizó a una media de 10.1 años. Pudimos observar la evolución de NS a ASGC; estos NS se ubicaron adyacentes al agujero de Monro y con el tiempo tuvieron un importante crecimiento con intensa captación de contraste e hidrocefalia. La aceleración en el crecimiento de estos NS y su "transformación" en ASGC se produjo a los 10 años de edad promedio, con un diámetro medio de 9 mm. Ningún NS alejado de los forámenes de Monro evolucionó a ASGC. Quince pacientes (68% fueron operados con síntomas de hipertensión endocraneana. La edad media de la cirugía fue 10.8 años. Seis pacientes presentaron déficit visual. En estos últimos, el diámetro medio mayor del tumor fue 31.5 mm, mayor que los 18.7 mm del grupo de pacientes que no presentó secuela visual. El seguimiento clínico imagenológico periódico de toda lesión subependimaria próxima a los agujeros de Monro, permitiría en etapa presintomática anticipar un tratamiento quirúrgico, que reduciría la incidencia de HTE. Estudios prospectivos podrían determinar si el complejo NS-ASGC corresponde a una misma entidad en distinta etapa evolutiva, o son dos lesiones con diferente potencial de crecimiento.The object of this paper is to describe the imaging and clinical characteristics of subependymal nodule (SN - subependymal giant cell astrocytoma (SGCA complex in tuberous sclerosis and analyze its evolution in order to attempt early detection and the prevention of intracranial hypertension. We evaluated 22 patients with

  8. The clinical characteristics, therapy and outcome of 85 adults with acute lymphoblastic leukemia and t(4;11)(q21;q23)/MLL-AFF1 prospectively treated in the UKALLXII/ECOG2993 trial

    Science.gov (United States)

    Marks, David I.; Moorman, Anthony V.; Chilton, Lucy; Paietta, Elisabeth; Enshaie, Amir; DeWald, Gordon; Harrison, Christine J.; Fielding, Adele K.; Foroni, Letizia; Goldstone, Anthony H.; Litzow, Mark R.; Luger, Selina M.; McMillan, Andrew K.; Racevskis, Janis; Rowe, Jacob M.; Tallman, Martin S.; Wiernik, Peter; Lazarus, Hillard M.

    2013-01-01

    The biology and outcome of adult t(4;11)(q21;q23)/MLL-AFF1 acute lymphoblastic leukemia are poorly understood. We describe the outcome and delineate prognostic factors and optimal post-remission therapy in 85 consecutive patients (median age 38 years) treated uniformly in the prospective trial UKALLXII/ECOG2993. The immunophenotype of this leukemia was pro-B (CD10NEG). Immaturity was further suggested by high expression of the stem-cell antigens, CD133 and CD135, although CD34 expression was significantly lower than in t(4;11)-negative patients. Complete remission was achieved in 77 (93%) patients but only 35% survived 5 years (95% CI: 25–45%); the relapse rate was 45% (95% CI: 33–58%). Thirty-one patients underwent allogeneic transplantation in first remission (15 sibling donors and 16 unrelated donors): with 5-year survival rates of 56% and 67% respectively, only 2/31 patients relapsed. This compares with a 24% survival rate and 59% relapse rate in 46 patients who received post-remission chemotherapy. A major determinant of outcome was age with 71% of patients aged <25 years surviving. Younger patients had lower relapse rates (19%) but most received allografts in first complete remission. In conclusion, multivariate analysis did not demonstrate an advantage of allografting over chemotherapy but only five younger patients received chemotherapy. Prospective trials are required to determine whether poor outcomes in older patients can be improved by reduced-intensity conditioning allografts. NCT00002514 www.clinicaltrials.gov PMID:23349309

  9. On the comparison of the polarisation behaviour of exchange-biased AF/F NiMn/Fe{sub 37}Co{sub 48}Hf{sub 15} bi-layer and multi-layer films with increased ferromagnetic cut-off frequencies

    Energy Technology Data Exchange (ETDEWEB)

    Seemann, K., E-mail: klaus.seemann@kit.edu [Karlsruhe Institute of Technology KIT (Campus North), Institute for Applied Materials, Hermann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany); Leiste, H.; Krueger, K. [Karlsruhe Institute of Technology KIT (Campus North), Institute for Applied Materials, Hermann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany)

    2012-03-15

    Antiferromagnetic/ferromagnetic (AF/F) NiMn/Fe{sub 37}Co{sub 48}Hf{sub 15} films were investigated with respect to their exchange bias, in-plane unidirectional anisotropy, polarisation and high frequency behaviour. After deposition, carried out by r.f. magnetron sputtering, the films were post-annealed for 4 h at 300 Degree-Sign C in a static magnetic field, in order to induce exchange-bias, which results in a unidirectional anisotropy. Dependent on the presence of a bi-layer or multi-layer sandwich structure the films show a different exchange-bias field-ferromagnetic inter-layer thickness behaviour with exchange-bias fields {mu}{sub 0} Low-Asterisk H{sub eb} between 2 and 10 mT. The in-plane uniaxial (single film) or unidirectional anisotropy fields {mu}{sub 0}*H{sub UF} were between 4 and 18 mT. This results in a significant increase of the cut-off frequency in the GHz range in comparison to a single Fe{sub 37}Co{sub 48}Hf{sub 15} film, which is shown by frequency-dependent permeability plots. High damping in the imaginary part of the permeability, i.e., high resonance line broadening could be observed for films with high coercivity {mu}{sub 0}*H{sub c} of around 7 mT in the easy axis of magnetisation. - Highlights: Black-Right-Pointing-Pointer Static and dynamic properties of NiMn/Fe{sub 37}Co{sub 48}Hf{sub 15} bi- and multi-layer films. Black-Right-Pointing-Pointer Theoretic analysis of the H{sub eb}- field difference of bi- and multi-layer films. Black-Right-Pointing-Pointer Two-stage magnetic process in the polarisation curves of the AF/F multi-layers. Black-Right-Pointing-Pointer Damping at the ferromagnetic permeability resonance state of AF/F multi-layers. Black-Right-Pointing-Pointer Derivation of the ferromagnetic resonance of AF/F multi-layer films.

  10. Alterações físico-químicas e microbiológicas durante o armazenamento de doces de umbu (Spondias tuberosa Arr. Câmara verde e maduro Physico-chemical and microbiological changes during storage of green and ripe umbu marmalade

    Directory of Open Access Journals (Sweden)

    Maria Lúcia Almeida Martins

    2010-03-01

    Full Text Available O umbuzeiro (Spondias tuberosa Arr. Câmara é uma planta de grande valor econômico para a região semiárida nordestina, notadamente pela produção de doces em massa. Este trabalho teve como objetivo monitorar a vida de prateleira de quatro formulações de doces em massa de umbu verde e maduro à temperatura de 30 °C durante 120 dias. As alterações físico-químicas e microbiológicas foram avaliadas no referido tempo. Os resultados mostraram um decréscimo na atividade de água, um aumento nos sólidos solúveis e no açúcar redutor; pH e acidez mantiveram estáveis; e uma tendência à redução no conteúdo de açúcar não redutor em ambos os doces. Os produtos foram microbiologicamente estáveis. Recomenda-se o uso de pectina ao processo de formulações de umbu maduro e goma xantana ou xarope de glicose para produção de doces de umbu verde.The umbu (Spondias tuberosa Arr. Câmara tree is of high economic value to the semi-arid Northeast area of Brazil due to umbu jam production. This work aimed to monitor the shelf life of four marmalade formulations made from green and ripe umbu, which were kept at 30 °C for 120 days. The physical, chemical, and microbiological alterations were evaluated during the time specified. The results showed a decrease in water activity; an increase in the soluble solids, and a reduction in sugar; pH and acidity remained stable; and there was a tendency to lower sucrose content in both jams. The products were microbiologically stable. The use of pectin is recommended to process the formulations made from ripe umbu, and either xanthan gum or glucose syrup to produce jam from the green umbu.

  11. Isolation and biological activities of secondary metabolites from the sponges monanchora aff. arbuscula, aplysina sp. petromica ciocalyptoides and topsentia ophiraphidies, from the ascidian didemnum ligulum and from the octocoral carijoa riisei; Isolamento e atividades biologicas de produtos naturais das esponjas monanchora arbuscula, aplysina sp., petromica ciocalyptoides e topsentia ophiraphidites, da ascidia didemnum ligulum e do octocoral carijoa riisei

    Energy Technology Data Exchange (ETDEWEB)

    Kossuga, Miriam H.; Lira, Simone P. de; Nascimento, Andrea M.; Gambardella, Maria Teresa P.; Berlinck, Roberto G.S. [Universidade de Sao Paulo (USP), Sao Carlos, SP (Brazil). Inst. de Quimica]. E-mail: rgsberlinck@iqsc.usp.br; Torres, Yohandra R. [Universidade Estadual do Centro-Oeste, Guarapuava, PR (Brazil). Dept. de Quimica; Nascimento, Gislene G.F. [Universidade Metodista de Piracicaba (UNIMEP), SP (Brazil). Faculdade de Ciencias da Saude; Pimenta, Eli F.; Silva, Marcio; Thiemann, Otavio H.; Oliva, Glaucius [Universidade de Sao Paulo (USP), Sao Carlos, SP (Brazil). Inst. de Fisica; Tempone, Andre G.; Melhem, Marcia S.C. [Instituto Adolfo Lutz, Sao Paulo, SP (Brazil). Div. de Biologia Medica; Souza, Ana O. de; Galetti, Fabio C.S.; Silva, Celio L. [Universidade de Sao Paulo (USP), Ribeirao Preto, SP (Brazil). Faculdade de Medicina. Dept. de Bioquimica e Imunologia; Cavalcanti, Bruno; Pessoa, Claudia O.; Moraes, Manoel O. [Universidade Federal do Ceara (UFC), Fortaleza, CE (Brazil). Faculdade de Medicina. Dept. de Fisiologia e Farmacologia; Hajdu, Eduardo [Universidade Federal do Rio de Janeiro (UFRJ), RJ (Brazil). Museu Nacional; Peixinho, Solange [Universidade Federal da Bahia (UFBA), Salvador, BA (Brazil). Dept. de Biologia; Rocha, Rosana M. [Universidade Federal do Parana (UFPR), Curitiba, PR (Brazil). Setor de Ciencias Biologicas. Dept. de Zoologia

    2007-09-15

    The investigation of extracts from six species of marine invertebrates yielded one new and several known natural products. Isoptilocaulin from the sponge Monanchora aff. arbuscula displayed antimicrobial activity at 1.3 mg/mL against an oxacillin-resistant strain of Staphylococcus aureus. Five inactive known dibromotyrosine derivatives, 2 6, were isolated from a new species of marine sponge, Aplysina sp. The sponges Petromica ciocalyptoides and Topsentia ophiraphidites yielded the known halistanol sulfate A (7) as an inhibitor of the antileishmanial target adenosine phosphoribosyl transferase. The ascidian Didemnum ligulum yielded asterubin (10) and the new N,N-dimethyl-O-methylethanolamine (11). The octocoral Carijoa riisei yielded the known 18-acetoxypregna-1,4,20-trien-3-one (12), which displayed cytotoxic activity against the cancer cell lines SF295, MDA-MB435, HCT8 and HL60. (author)

  12. Astrocitoma subependimário de células gigantes em pacientes com esclerose tuberosa: achados em ressonância magnética de dez casos Subependymal giant cell astrocytoma in patients with tuberous sclerosis: magnetic resonance imaging findings in ten cases

    Directory of Open Access Journals (Sweden)

    Karina Takata

    2007-06-01

    Full Text Available OBJETIVO: Relatar os achados de ressonância magnética (RM em 10 casos de astrocitoma subependimário de células gigantes (ASCG em pacientes com esclerose tuberosa (ET. MÉTODO: Foram estudados de forma retrospectiva 10 pacientes com ET e diagnóstico histológico comprovado de ASCG. Quatro pacientes eram do sexo masculino e seis do feminino, com idade média de 15,7 anos. Todos os pacientes foram investigados com RM, sendo os exames revisados por dois radiologistas, havendo decisão por consenso sobre os achados de imagem. Foram analisados os seguintes achados: localização, dimensões, intensidade de sinal em T1/T2, realce pós-contraste e outros achados associados. RESULTADOS: Todos os pacientes apresentaram lesão única sugestiva de ASCG, medindo entre 1,5 cm e 8 cm em seu maior diâmetro. Oito lesões foram encontradas junto ao forame de Monro (80% e duas adjacentes ao corpo do ventrículo lateral (20%. Os tumores apresentavam nas imagens pesadas em T1 médio sinal (70% e em T2 alto sinal (100%, com realce intenso após a administração do gadolínio (100%. CONCLUSÃO: Os astrocitomas subependimários de células gigantes em pacientes com ET em geral apresentam-se como lesão única próxima ao forame de Monro, com médio sinal nas imagens ponderadas em T1, alto sinal em T2 e realce intenso após a administração de contraste.OBJECTIVE: To report the magnetic resonance imaging (MRI findings in 10 patients with subependimal giant cell astrocytoma (SGCA and tuberous sclerosis (TS. METHOD: Ten patients were retrospectively studied, presenting TS and histologically proven SGCA. Four patients were male and six female, with mean age 15.7 years. All patients underwent MRI, which was analyzed by two radiologists, final diagnosis was reached by consensus. The following findings were studied: topography, size, signal intensity on T1/T2-weighted images, contrast enhancement and associated findings. RESULTS: All patients presented a single lesion

  13. Original Communications - Iridoid Glucosides from Turkish Phlomis tuberosa

    DEFF Research Database (Denmark)

    Calis, Ihsan; Kirmizibekmez, Hasan; Ersoz, Tayfun

    2005-01-01

    -sitosterol 3-O-beta-D-glucopyranoside and 1-methyl-O-beta-D-glucopyranoside were also obtained and characterized. The structures were elucidated on the basis of spectroscopic data. The three known phenylethanoid glycosides, verbascoside, leucosceptoside A and martynoside were identified by TLC comparison...

  14. Diagnóstico Tardio de Esclerose Tuberosa

    Directory of Open Access Journals (Sweden)

    Catarina Oliveira

    2016-03-01

    Full Text Available Tuberous sclerosis (also referred to as Tuberous Sclerosis Complex is an autosomal dominant neurocutaneous syndrome that can involve multiple organs such as the brain, heart, kidney, lung, liver, skin and eye. The diagnosis is clinical and most patients are identified during childhood, in the context of a severe epileptic or neuropsychiatric disorder. Here we report a case of TSC diagnosed in an adult woman with dermatological and vascular involvement that were only recognized as manifestations of TSC after the diagnosis of her infant daughter. This case highlights how important it is that physicians recognize the full spectrum of manifestations of TSC, including the most unusual, so not to miss the diagnosis

  15. Dicty_cDB: AFF194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gsncitkttrktktdgirdskrirkissrrsrc*rkyr l*s*rkektrri*kenagktk*skrcsktknt*r*rkrkn*irktkrkrstkrinetsne wck*w*it...All Frames) Frame A: ttttnrgdnittnik***i*ktgsncitkttrktktdgirdskrirkissrrsrc*rkyr l*s*rkektrri*kenagktk*skrcskt

  16. Dicty_cDB: AFF667 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available steine proteinase 1; ... 116 2e-25 AY336798_1( AY336798 |pid:none) Rhipicephalus haemaphysalo...ides hae... 116 2e-25 AY336797_1( AY336797 |pid:none) Rhipicephalus haemaphysaloides hae... 116

  17. Dicty_cDB: AFF763 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available diagnosing malaria and immune antigen for suppressing growth of plasmodium. 58 8e...-19 6 BD183625 |BD183625.1 Material for diagnosing malaria and immune antigen for suppressing growth of plasmodium

  18. Dicty_cDB: AFF141 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NCE, 5 ordered pieces. 36 0.14 8 BI435853 |BI435853.1 EST538614 P. infestans-challenged potato leaf, compati...0.30 1 BG591390 |BG591390.1 EST499232 P. infestans-challenged leaf Solanum tuberosum cDNA clone BPLI8D17 5' ...A clone STMCF59 3' end, mRNA sequence. 48 0.30 1 BI435340 |BI435340.1 EST538101 P. infestans-challenged leaf...DNA clone POAC219 3' end, mRNA sequence. 48 0.30 1 BI433279 |BI433279.1 EST536040 P. infestans-challenge

  19. Dicty_cDB: AFF354 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 435853 |BI435853.1 EST538614 P. infestans-challenged potato leaf, compatible reaction Solanum tuberosum cDNA... clone PPCCL22 5' sequence, mRNA sequence. 48 0.33 1 BG591390 |BG591390.1 EST499232 P. infestans-challenged ...leaf Solanum tuberosum cDNA clone BPLI8D17 5' sequence, mRNA sequence. 48 0.33 1 BI435340 |BI435340.1 EST538101 P. infestans-challeng

  20. Dicty_cDB: AFF409 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tkryisirkn**dgrsrrfgccfifkyfryqqx*fklkqx*fk qf*fqlk--- ---xxxsssssssssss*xxkxiiix...kxkxxiimkxexkxiimkxkmkmxixkxxxxxql iiiiixxxkliiixxxixxk*xkxxixxkqxkxxixxx*xxxxxxxixmkxlxxkqlxxx lxxkqlixxxxxxlkxkqxxxxlxxklfixxkxxx...kllixxxlxixxxiiiiiiiiiiii iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiklkqlikfklkq...ISFLLVLP SIVTPYRKSVEITNEEPQRDIYQLEKTNKMAEVGDLGVASFLNILDTSXSSSSSSXXSSS SSSSSSS--- ---xxxhhhhhhhhhhhexarxsssxx*rxxss*xxxx...rxss*sxr*r*xsxsxxxxxss sssssxsxs*sssxxxsxxsxxxcxsxxssxxcxsxxssxxxxxcxsx*xxsxxss*xxx sxxss*sxsxxxxsxxssxxxxsxxscssxxxxxx

  1. Dicty_cDB: AFF860 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available quence qfei**ktkniw*ryshywlifkiiwws*fpy*fh*ck*tfcc*r*fl*sif*l**yycn istrirki*vvl**nwg*sctifiriayni...kiiwws*fpy*fh*ck*tfcc*r*fl*sif*l**yycn istrirki*vvl**nwg*sctifiriayniklclrliktnnn

  2. Dicty_cDB: AFF885 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Trk_27_j08 Trunk kidney cDNA library Ictalurus punctatus cDNA 5' similar to ER-resident... chaperone calreticulin, mRNA sequence. 56 7e-04 1 AY342298 |AY342298.1 Ictalurus punctatus ER-resident

  3. Dicty_cDB: AFF681 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 36 7e-04 3 AY342298 |AY342298.1 Ictalurus punctatus ER-resident chaperone calreticulin mRNA, complete cds. ... cDNA library Ictalurus punctatus cDNA 5' similar to ER-resident chaperone calreticulin, mRNA sequence. 56 8

  4. Dicty_cDB: AFF235 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 3 CK420742 |CK420742.1 AUF_IpTrk_27_j08 Trunk kidney cDNA library Ictalurus punctatus cDNA 5' similar to ER-resident... chaperone calreticulin, mRNA sequence. 56 6e-04 1 AY342298 |AY342298.1 Ictalurus punctatus ER-resident

  5. Dicty_cDB: AFF240 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e ZMMBBb0237K14 3', genomic survey sequence. 46 0.35 1 BZ402539 |BZ402539.1 OGAAN...0577H08f ZMMBBb (HindIII) Zea mays subsp. mays genomic clone ZMMBBb0577H08 5', genomic survey sequence. 46 0...enomic clone ZMMBBb0616I12 3', genomic survey sequence. 46 0.35 1 CG830936 |CG830936.1 ZMMBBc0253J11f ZMMBBc... (EcoRI) Zea mays subsp. mays genomic clone ZMMBBc0253J11 5', genomic survey sequence. 46 0.35 1 CL285740 |C...L285740.1 ZMMBBb0630P01f ZMMBBb (HindIII) Zea mays subsp. mays genomic clone ZMMBBb0630P01 5', genomic survey

  6. Dicty_cDB: AFF515 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KDNKIHVFTLSGNNLTASH TLDNHRGAITDLSYSPCGKYLASGCSNREVIVWSGKEAKSKGWVNHTARINAVAWX**f* iccxcftr...TWEPTSVAINDTEVSVGGKDNKIHVFTLSGNNLTASH TLDNHRGAITDLSYSPCGKYLASGCSNREVIVWSGKEAKSKGWVNHTARINAVAWX**f* iccxcft

  7. Dicty_cDB: AFF786 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available raradices extra-radical mycelium Glomus intraradices cDNA clone GI05_D08 3', mRNA sequence. 60 6e-05 1 CB081...489103 |AX489103.1 Sequence 6403 from Patent WO02053728. 46 4e-05 4 BI452123 |BI452123.1 GI05_D08 Glomus int

  8. Dicty_cDB: AFF451 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 Plasmodium berghei genomic 3', DNA sequence. 68 3e-12 2 BF298951 |BF298951.1 068PbG10 Pb cDNA #20, Charles...299139 |BF299139.1 069PbF12 Pb cDNA #20, Charles Yowell and Jane Carlton Plasmodium berghei cDNA 5', mRNA se

  9. Dicty_cDB: AFF514 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 001. 6. 2 Translated Amino Acid sequence *verwyivyyylkks**tllkqfnkrkfieveh*mvqpkvii*tsntinklttrqtmsak vhrskg...lvtpttva rrkalrakkaarhtkasneaaeyaklvaqrqqakakrfrqsfkqkscxpsk Frame B: *verwyivyyylkks**tllkqfnkrkfieveh*mvqp

  10. Dicty_cDB: AFF239 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SSESD XDRFXNINNDDXDXPXXQQQPVXQPEXEXXXQEXEKVXEPIXEXXXKVEXKVEEPVAEQX XXKVXEPVXAEXXKVEEPXTEEXKVEE Translated Am...VXEPIXEXXXKVEXKVEEPVAEQX XXKVXEPVXAEXXKVEEPXTEEXKVEE Frame C: lfifvlyslfisflyidkf

  11. Dicty_cDB: AFF565 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IKTKNLIESPVDDGTDLYFEFDQS DFTLYQMIRSDKAASR--- ---STNGFAKNFFLNXPLKSXHGGIKKXIPNATEEXIEILKGMXCWNPKKXWPIEXIIQX PY...YQMIRSDKAASR--- ---STNGFAKNFFLNXPLKSXHGGIKKXIPNATEEXIEILKGMXCWNPKKXWPIEXIIQX PYFQNYCHIEXYKXDKKFXXGSPXVFHRLKA

  12. Dicty_cDB: AFF439 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available of library AX0AA from strain CBS 7064 of Pichia farinosa. 56 2e-05 2 AC090078 |AC...saccharomyces rouxii. 60 8e-05 1 AL416312 |AL416312.1 T7 end of clone AX0AA013D07 of library AX0AA from strain CBS 7064 of Pichia far...inosa. 48 1e-04 2 AZ932439 |AZ932439.1 474.dhz99a06.s1 S

  13. Dicty_cDB: AFF144 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available equence iiynlislif*wqn*k*lfil**ffvvvsnflldtkrrllhfihlqviciplliifghvi vsltktvdsvhlnaim...id sequence (All Frames) Frame A: iiynlislif*wqn*k*lfil**ffvvvsnflldtkrrllhfihlqviciplliifghvi vsltktvdsvhlnaim

  14. Dicty_cDB: AFF724 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nce update 2001. 6. 2 Translated Amino Acid sequence ynlislif*wqn*k*lfil**ffvvvsnflldtkrrllhfihlqviciplliifghvivs ltktvdsvhlnaim...: ynlislif*wqn*k*lfil**ffvvvsnflldtkrrllhfihlqviciplliifghvivs ltktvdsvhlnaimpvsm

  15. Dicty_cDB: AFF147 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available laevis retinoblastoma A as... 233 2e-60 (Q9W7I5) RecName: Full=Histone-binding protein RBBP4... Full=Histone-binding protein RBBP4-A; AltName:... 233 2e-60 ( Q09028 ) RecName: ...Full=Histone-binding protein RBBP4; AltName: F... 233 2e-60 (Q5M7K4) RecName: Full=Histone-binding protein RBBP4...; AltName: F... 233 2e-60 (Q6INH0) RecName: Full=Histone-binding protein RBBP4-B; AltName:... 233 2e-60

  16. Dicty_cDB: AFF787 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ffflcilfffpfxhin*lckfllklslvkpshwklk vxttlkmsrxkfktkkvfhqinkd*xllvnn*xmvvlfxittfkrnplsi*xlx*exvck xl*klslvkpsp*rlkvx...PGKTXPLEVEGXXNX*kxxkpksktkkgxp pxstrfhfrw*tikkxpxsx*xxtskxnplsx*xsx*kxvckxl*kpxlvkpsxwkxkvx itxkmsxpkfxtxkxfpxinkx*fxlvnn*kmvx...lslttxfkxnpxsx*xsx*kvxxksl lkx*qvkxspwkskvvxtlkmlxpkxxxxkxfpxin...nxsfslvnx*xxvgpppdxnxkrk pppx*xsd*kvx Translated Amino Acid sequence (All Frames) Frame A: iffck***liiif*ily...ffkhikiffflcilfffpfxhin*lckfllklslvkpshwklk vxttlkmsrxkfktkkvfhqinkd*xllvnn*xmvvlfxittfkrnplsi*xlx*exvck xl*klslvkpsp*rlkvx

  17. Dicty_cDB: AFF679 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VIIPDLLLNAGGVTVSYFEWLKNLSHVRFGRLNKKWEESSKKLLLEFV ESTVNKKLSEAERSLIIHGADEIDIVRSGLEDTMQNACAETRKTANEKNTDYRSAALYNA IMKX*scx...PMT PRADQILLNRGHVIIPDLLLNAGGVTVSYFEWLKNLSHVRFGRLNKKWEESSKKLLLEFV ESTVNKKLSEAERSLIIHGADEIDIVRSGLEDTMQNACAETRK

  18. Dicty_cDB: AFF388 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |AW217896.1 EST296610 tomato flower buds, anthesis, Cornell University Lycopersic...on esculentum cDNA clone cTOD1C15, mRNA sequence. 92 2e-15 2 AI778006 |AI778006.1 EST258885 tomato susceptible, Cornell...ence. 92 2e-15 2 AW219042 |AW219042.1 EST301524 tomato root during/after fruit set, Cornell University Lycop...2e-15 2 BG642411 |BG642411.1 EST355887 tomato flower buds, anthesis, Cornell University Lycopersicon esculen

  19. Dicty_cDB: AFF396 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone ...cTOD1C15, mRNA sequence. 92 2e-15 2 AI778006 |AI778006.1 EST258885 tomato susceptible, Cornell Lycopersicon ... |AW219042.1 EST301524 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA c...1.1 EST355887 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD11C15

  20. Dicty_cDB: AFF758 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AC Library) complete sequence. 42 0.070 5 AI484136 |AI484136.1 EST248943 tomato resistant, Cornell Lycopersi... 0.074 2 AI490786 |AI490786.1 EST241494 tomato shoot, Cornell Lycopersicon esculentum cDNA clone cLEB3H9 sim... EST255034 tomato resistant, Cornell Lycopersicon esculentum cDNA clone cLER8N1,

  1. Dicty_cDB: AFF350 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available otiana tabacum glutamate decarboxylase isozyme 3 mRNA, complete cds. 58 2e-07 2 CK273593 |CK273593.1 EST719671 potato abiotic..., mRNA sequence. 50 2e-07 2 CD008053 |CD008053.1 VVB082D05_335234 An expressed sequence tag database for abiotic... 64 6e-07 2 CD006712 |CD006712.1 VVB066D06_332552 An expressed sequence tag database for abiotic stressed le...A sequence. 64 6e-07 2 CD719214 |CD719214.1 VVB158G03_410335 An expressed sequence tag database for abiotic

  2. Dicty_cDB: AFF179 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available along of Medicago truncatula (barrel medic). 98 8e-20 2 BU044708 |BU044708.1 PP_LEa0020E04f Peach developing... 2 BU040616 |BU040616.1 PP_LEa0006L02f Peach developing fruit mesocarp Prunus persica cDNA clone PP_LEa0006L

  3. Dicty_cDB: AFF346 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lveslkifkvimknknmlhqkklkmlklh*inklkvllkv ikln*n Frame C: iyqtkyaypscwrnpr*cskpisr...ks*kc*c*r*rr*n*glccrtt*wgsnkrkwrrrrt kn*rrfkssirtkg*kn*ntkeykyfsfr*ywcw*kyiyfxigklfei*iigtsyescqf g*cchhs**s

  4. Dicty_cDB: AFF478 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1-0014P-A285-G05.G, mRNA sequence. 32 2e-08 4 CF400358 |CF400358.1 RTWW1_4_D05.g1_A015 Well-watered loblolly...07 2 CF400261 |CF400261.1 RTWW1_4_D05.b1_A015 Well-watered loblolly pine roots WW1 Pinus taeda cDNA clone RT

  5. Dicty_cDB: AFF828 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1027-5317 5' similar to TR:Q9ZS06 Q9ZS06 RNA HELICASE ;, mR...NA sequence. 56 8e-10 2 BF071471 |BF071471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE...yces exiguus. 38 1e-09 4 BI974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLO...e 6225 from Patent WO02053728. 40 1e-07 4 AI966749 |AI966749.1 sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS

  6. Dicty_cDB: AFF313 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available qdtlvlwl vwvkkthm*vmkpnqrevs*psntqlntvslptgmiwkksgiilstmnsvlhqkntqxs* PEAPLNPKANREKMTQIMFETXNTPXMYVAIQA--- -...rame A: is*nk*iklnkk*kwmvkmfkl*llitvlvcvkpvllvtmlhvlfshqllvvqdtlvlwl vwvkkthm*vmkpnqrevs*psntqlntvslptgmiwkksgiilstm

  7. Dicty_cDB: AFF146 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AV0AA012E03 of library AV0AA from strain CBS 379 of Saccharomyces exiguus. 44 1e-11 5 AF009965 |AF009965.1 C...n CBS 379 of Saccharomyces exiguus. 58 1e-10 3 BQ091175 |BQ091175.1 ku13g11.y1 St

  8. Dicty_cDB: AFF355 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AAAATATAAAAAAATAAAGAAA sequence update 2001. 6. 2 Translated Amino Acid sequence flccvfkiffpdlniyenikitkq**e...ysmvifqflilhlqvrkgigiki*kk* ki*kki*knke Frame B: flccvfkiffpdlniyenikitkq**eyk*ikk*kkk*KMAGDDDRNSIPMEHYDQQEL

  9. Dicty_cDB: AFF177 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 542_1( AF006542 |pid:none) Drosophila pseudoobscura bogotana ... 238 2e-61 AF0065...osophila pseudoobscura bogotana ... 238 2e-61 ( O16087 ) RecName: Full=Heat shock protein 83; AltName: Full=

  10. Dicty_cDB: AFF518 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cant alignments: (bits) Value N BU495650 |BU495650.1 PfESToab75g10.y1 Plasmodium falciparum 3D7 asexual...mRNA sequence. 78 2e-17 2 BI815262 |BI815262.1 PfESToaa16d01.y1 Plasmodium falciparum 3D7 asexual cDNA Plasm...ce. 78 2e-17 2 BI815862 |BI815862.1 PfESToaa33e12.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falci...uence. 78 3e-17 2 BQ577133 |BQ577133.1 PfESToab14c09.y1 Plasmodium falciparum 3D7 asexual... cDNA PlasmodiummRNA sequence. 78 2e-17 2 BQ596428 |BQ596428.1 PfESToab33f08.y1 Plasmodium falciparum 3D7 asexu

  11. Dicty_cDB: AFF782 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available hansenii. 52 4e-11 3 BU495506 |BU495506.1 PfESToab73g08.y1 Plasmodium falciparum 3D7 asexual...1e09.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to TR:O96260 O96260 REP...814613.1 PfESToaa40a12.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to TR

  12. Dicty_cDB: AFF221 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available _1( EU679414 |pid:none) Tetranychus cinnabarinus heat shoc... 331 4e-89 ( P09446 ) RecName: Full=Heat shock ...70 kDa protein A; &T21394(T21... 330 5e-89 EU679412_1( EU679412 |pid:none) Tetranychus cinnabarinus heat sho

  13. Dicty_cDB: AFF131 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Translated Amino Acid sequence flkkkflygvtlrq*****nsitttkknkkhiv*ifkigessiykq*fkthinkykyiks ylhik*HNKMGQLLSF... ---XXKKMGXXQKKKXIXKKKKLKENITITKYHHPPTNINIVNI Frame B: flkkkflygvtlrq*****nsitttkknkkhiv*ifkigessiykq*fkthink

  14. Struensee-affæren 1770-1772

    DEFF Research Database (Denmark)

    Olden-Jørgensen, Sebastian

    2010-01-01

    En gennemgang af Johann Friedrich Struensees vej til magten og hans fald med særlig henblik på, hvordan det kunne komme så vidt, og hvad det siger om tidens politiske kultur.......En gennemgang af Johann Friedrich Struensees vej til magten og hans fald med særlig henblik på, hvordan det kunne komme så vidt, og hvad det siger om tidens politiske kultur....

  15. Dicty_cDB: AFF743 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Sequences producing significant alignments: (bits) Value N AF305060 |AF305060.1 Dictyostelium discoideum Wiscott...oducing significant alignments: (bits) Value AF305060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott

  16. Dicty_cDB: AFF294 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available map 14, *** SEQUENCING IN PROGRESS ***, 18 unordered pieces. 46 0.60 1 U92221 |U92221.1 Legionella shakes...pearei macrophage infectivity potentiator (mip) gene, complete cds. 46 0.60 1 AF022

  17. Lymphangioleiomyomatosis and tuberous sclerosis with pulmonary involvement; Linfangioleiomiomatosis y esclerosis tuberosa afectacion pulmonar

    Energy Technology Data Exchange (ETDEWEB)

    Pedrosa, I.; Saiz, A.; Bustos, A.; Hernando, F. [Hospital cinico. San Carlos. Madrid (Spain)

    2000-07-01

    We present two cases of pulmonary lumphangioleiomyomatosis and one case of tuberous sclerosis with pulmonary involvement describing the most characteristic features according to plain chest X-ray and high-resolution computed tomography (HRCT). (Author) 14 refs.

  18. Tuberous sclerosis. Case presentation. Esclerosis tuberosa. Presentación de un caso

    Directory of Open Access Journals (Sweden)

    Graciela Caridad Cabrera Acea

    2009-03-01

    Full Text Available A mixed race female, 34 years of age was attended due to papule lesions in the facial area between one and ten mm of diameter. These lesions were flat, with skin colour, symmetrically distributed in the central part of the face (cheeks, chin and nose, of soft texture with telangiectasia. She referred to present these lesions since she was seven years of age, and three months before attending to consultation she noticed an increase in the number and size of these lesions. The patient has a normal intelligence coefficient and declared family history of these lesions. The diagnosis was sebaceous adenoma. Since this is not a frequent disease and due to the patient’s age we decided to publish this case. Se presenta el caso de una paciente femenina, de color de piel mestiza, de 34 años de edad, que acudió a consulta por lesiones papulosas localizadas en la cara, con tamaños que oscilaban entre 1-10 mm de diámetro; lisas, del mismo color de la piel, confluentes, distribuidas simétricamente en la parte central de la cara (dorso y alas de la nariz, surcos nasogenianos, mejillas y mentón, de consistencia blanda, con algunas telangectasias. Refirió que comenzaron a salirle desde los 7 años de edad, y aproximadamente 3 meses antes de asistir a consulta notó aumento en el número de lesiones y en su tamaño. Se comprobó que la paciente posee un intelecto normal. Declaró antecedentes familiares por parte de la rama paterna con lesiones similares en la cara. Se le diagnosticó como adenoma sebáceo. Por ser una enfermedad poco frecuente y por la edad de la paciente se decide publicar este caso.

  19. Isoorientin, a Selective Inhibitor of Cyclooxygenase-2 (COX-2) from the Tubers of Pueraria tuberosa.

    Science.gov (United States)

    Sumalatha, Manne; Munikishore, Rachakunta; Rammohan, Aluru; Gunasekar, Duvvuru; Kumar, Kotha Anil; Reddy, Kakularam Kumar; Azad, Rajaram; Reddanna, Pallu; Bodo, Bernard

    2015-10-01

    Bioassay-guided fraction of the methanol extract of the roots of Pueraria tuberose DC yielded puerarin, an isoflavone C-glycoside (PT-1), isoorientin, a flavone C-glycoside (PT-2) and mangiferin, a xanthone C-glycoside (PT-3). The extracts and the isolated compounds were screened for potent anti-inflammatory components inhibiting the cyclooxygenases (COX-1 and COX-2) and 5-lipoxygenase (5-LOX), the target enzymes of inflammation, by employing spectroscopic/polorographic methods. Among these, isoorientin was found to be a potent inhibitor of COX-2with an IC50 value of 39 μM. Docking studies were carried out to understand the interactions of isorientin (PT-2) with COX-2.The structures of the isolates were determined by mass spectrometry and 2D-NMR techniques including HSQC, HMBC, NOESY and 1H-1H COSY experiments. Although isoorientin and mangiferin have been reported from several plant sources, this is the first report of their isolation from a Pueraria species.

  20. Heat processing (HTST) of umbu (Spondias tuberosa Arruda Câmara) pulp

    OpenAIRE

    Emanuelle Araújo de Oliveira; Soraia Vilela Borges; Ângela Aparecida Lemos Furtado; Regina Célia Della Modesta; Ronoel de Oliveira Godoy

    2011-01-01

    Umbu pulp is an important product in the economy of the northeastern region of Brazil, and its preservation can be ensured by heat treatment. A complete factorial design with 2 factors (time and temperature) and 3 central points was used to verify the effect of the HTST process on the physicochemical, chemical, physical, microbiological, and sensory qualities of umbu pulps. The results showed that the heat treatments applied resulted in products without significant alterations on the physicoc...

  1. Heat processing (HTST of umbu (Spondias tuberosa Arruda Câmara pulp

    Directory of Open Access Journals (Sweden)

    Emanuelle Araújo de Oliveira

    2011-12-01

    Full Text Available Umbu pulp is an important product in the economy of the northeastern region of Brazil, and its preservation can be ensured by heat treatment. A complete factorial design with 2 factors (time and temperature and 3 central points was used to verify the effect of the HTST process on the physicochemical, chemical, physical, microbiological, and sensory qualities of umbu pulps. The results showed that the heat treatments applied resulted in products without significant alterations on the physicochemical, chemical, and microbiological characteristics. With respect to color, the parameters L and a* were altered by increases in temperature indicating by darkening of color. The sensory evaluation indicated that a treatment of 88 °C for 10 seconds was the best processing condition due to the greater similarity of the resulting product to the reference sample (blanched pulp.

  2. ESCLEROSIS TUBEROSA ASOCIADA A SÍNDROME NEFRÓTICO Y FALLA RENAL AGUDA

    Directory of Open Access Journals (Sweden)

    Gabriela Santos Revilla

    2014-03-01

    Full Text Available The tuberous sclerosis complex is a phakomatosis, characterized by cutaneous lesions, epilepsy and mental retardation; woth variable affectation in brain, kidneys, heart and other organs. With dominant autosomic character, there are between 60 to 70% de novo mutations. Renal lesions can be identified in up to 57.5% of patients We report the case of a 20 years old male patient from the Hospital Nacional Arzobispo Loayza. He presents cuteanousangiofibroma, Shegreen patches, subependymal calcifications, renal angiomyolipomas and mild metal retardation; along with the diverse forms of clinical-pathologic presentations of tuberous sclerosis complex.

  3. A highly diverse trilobite fauna with Avalonian affinities from the Middle Cambrian Acidusus atavus Zone (Drumian Stage) of Bornholm, Denmark

    DEFF Research Database (Denmark)

    Weidner, Thomas; Nielsen, Arne Thorshøj

    2014-01-01

    ? applanata, Acadagnostus aff. bulkurensis and Phalagnostus ovalis. A few faunal elements originally described from Bohemia and Australia are also present, viz. Hydrocephalus aff. carens, Phalagnostus nudus, Skryjagnostus pompeckji, Hypagnostus aff. clipeus, Euagnostus aff. interstrictus and Euagnostus? aff...

  4. Cockroaches as pollinators of Clusia aff. sellowiana (Clusiaceae) on inselbergs in French Guiana.

    Science.gov (United States)

    Vlasáková, Blanka; Kalinová, Blanka; Gustafsson, Mats H G; Teichert, Holger

    2008-09-01

    A report is made on a new species of Clusia related to C. sellowiana that dominates the vegetation of the Nouragues inselberg in French Guiana. The focus is on the pollination biology and on the remarkable relationship of this plant species to Amazonina platystylata, its cockroach pollinator. This appears to be only the second record of pollination by cockroaches. Pollination ecology was investigated by combining morphological studies, field observations and additional experiments. Floral scent was analysed by gas chromatography-mass spectrometry. The role of acetoin, the major component of the scent of this species of Clusia, in attracting pollinators was examined in field attraction experiments. The ability of cockroaches to perceive acetoin was investigated by electroantennography (EAG). The Clusia species studied produces seeds only sexually. Its nocturnal flowers are visited by crickets, ants, moths and cockroaches. A species of cockroach, Amazonina platystylata, is the principal pollinator. The reward for the visit is a liquid secretion produced by tissues at the floral apex and at the base of the ovary. Although the cockroaches have no structures specialized for pollen collection, their body surface is rough enough to retain pollen grains. The cockroaches show significant EAG reactions to floral volatiles and acetoin, suggesting that the floral scent is a factor involved in attracting the cockroaches to the flowers. The results suggest that the plant-cockroach interaction may be quite specialized and the plant has probably evolved a specific strategy to attract and reward its cockroach pollinators. Acetoin is a substance involved in the chemical communication of several other cockroach species and it seems plausible that the plant exploits the sensitivity of cockroaches to this compound to attract them to the flowers as part of the pollination syndrome of this species.

  5. Increased Soil Heavy Metal Concentrations Aff ect the Structure of Soil Fungus Community

    Directory of Open Access Journals (Sweden)

    Vaidilutė Dirginčiutė-volodkienė

    2011-03-01

    Elevated Cu, Zn and Pb concentrations in the soil influenced fungus community structure. Some species (Absidia glauca, Acremonium kiliense, Aspergillus fumigatus, and Alternaria alternata detected in the control soil community were eliminated, while the abundance of the other species increased. Paecillomyces genus dominated in the soil amended with either of Cu or Zn. P. farinosus, P. fumosoroseum and fungal species from the Clonostachys, Penicillium and Lecanicillium genera were Znresistant. P. lilacinus and plant pathogenic fungi, A. alternata, Fusarium oxysporum, F. solani and Phoma lingam were very abundant in soil amended with Cu salts, followed by some saprotrophic fungi such as Cunninghamella echinulata and Mucor hiemalis f. hiemalis. An overall change in the plant (cress, Lepidum sativum; wheat, Ticicum aestivum; lupine, Lupinus polyphyllus, and sunflower, Heliannthus annus seed viability was observed in comparison with control. Most deleterious effects on the seed germination were observed in case of zinc, medium – in case of copper, and the least – in case of lead. Zinc salts at used concentrations were unfavorable to both fungus populations and consequently to the seed viability.

  6. Increased Soil Heavy Metal Concentrations Aff ect the Structure of Soil Fungus Community

    Directory of Open Access Journals (Sweden)

    Vaidilutė Dirginčiutė-Volodkienė

    2011-03-01

    Full Text Available Effects of heavy metals on soil fungi populations and soil fertility incidental to it were studied under laboratory conditions. Metal-amended antroposol type soil samples were incubated for a month at 17°C under natural light regime. Copper, zinc and lead were chosen as the most common industrial pollutants. Each metal was applied either of sulfate, chloride or acetate salt (at concentration varying from 0.4 to 16.14 g kg-1 soil; control – soil without metal amendment. Fungal populations (dilution plate method were investigated and soil phytotoxicity test was performed.Elevated Cu, Zn and Pb concentrations in the soil influenced fungus community structure. Some species (Absidia glauca, Acremonium kiliense, Aspergillus fumigatus, and Alternaria alternata detected in the control soil community were eliminated, while the abundance of the other species increased. Paecillomyces genus dominated in the soil amended with either of Cu or Zn. P. farinosus, P. fumosoroseum and fungal species from the Clonostachys, Penicillium and Lecanicillium genera were Znresistant. P. lilacinus and plant pathogenic fungi, A. alternata, Fusarium oxysporum, F. solani and Phoma lingam were very abundant in soil amended with Cu salts, followed by some saprotrophic fungi such as Cunninghamella echinulata and Mucor hiemalis f. hiemalis. An overall change in the plant (cress, Lepidum sativum; wheat, Ticicum aestivum; lupine, Lupinus polyphyllus, and sunflower, Heliannthus annus seed viability was observed in comparison with control. Most deleterious effects on the seed germination were observed in case of zinc, medium – in case of copper, and the least – in case of lead. Zinc salts at used concentrations were unfavorable to both fungus populations and consequently to the seed viability.

  7. Skandalisierung korpuslinguistisch. Ein empirisch-linguistischer Blick auf die Berichterstattung zur "Wulff-Affäre"

    Directory of Open Access Journals (Sweden)

    Bubenhofer, Noah

    2013-12-01

    Full Text Available Abstract What kind of language is typical of the mass media coverage of a scandal? Which linguistic means have the effect of scandalizing a public person like a politician? The study presented in this paper uses corpus linguistic methods to investigate a specific scandal in recent German politics: Federal President Christian Wulff was accused by the media of not having informed transparently about a private loan he had taken out. Further allegations of corruption presented by the media resulted in his resignation after only two months. The paper shows how automatic language pattern analyses of a corpus of articles about Wulff in two leading German newspapers reveal the typical patterns used in a discourse of scandalization. Additionally, also characteristic grammar features like tempus forms are incorporated in the analysis. The texts scandalizing a person use more patterned language than other news texts on politics. The patterns reflect the characteristic speech acts of scandalizing like accusing, informing, or speculating on the political future of the scandalized person, but also speech acts like defending and regretting. The use of tempus shows that scandalizing texts are more dynamic and vivid compared to other political coverage.

  8. Water status and gas exchange of umbu plants (Spondias tuberosa Arr. Cam. propagated by seeds and stem cuttings Estado hídrico e trocas gasosas de umbuzeiros (Spondias tuberosa Arr. Cam. propagados por sementes e estaquia

    Directory of Open Access Journals (Sweden)

    José Moacir Pinheiro Lima Filho

    2007-08-01

    Full Text Available The experiment was carried out at the Embrapa Semi-Árido, Petrolina-PE, Brazil, in order to study the physiological responses of umbu plants propagated by seeds and by stem cuttings under water stress conditions, based on leaf water potential and gas exchange measurements. Data were collected in one-year plants established in pots containing 30 kg of a sandy soil and submitted to twenty-day progressive soil water deficit. The evaluations were based on leaf water potential and gas exchange data collection using psychrometric chambers and a portable infra-red gas analyzer, respectively. Plants propagated by seeds maintained a significantly higher water potential, stomatal conductance, transpiration and photosynthesis under decreasing soil water availability. However, plants propagated by stem cuttings were unable to maintain a favorable internal water balance, reflecting negatively on stomatal conductance and leaf gas exchange. This fact is probably because umbu plants propagated by stem cuttings are not prone to formation of root tubers which are reservoirs for water and solutes. Thus, the establishing of umbu plants propagated by stem cuttings must be avoided in areas subjected to soil water deficit.O experimento foi realizado na Embrapa Semi-Árido, Petrolina-PE, Brasil, objetivando estudar as respostas fisiológicas de umbuzeiros propagados por sementes e por estaquia, sob condições de deficiência hídrica. Os dados foram coletados em plantas com aproximadamente um ano de idade, estabelecidas em vasos contendo 30 kg de solo de textura arenosa e submetidas a déficit progressivo de água, durante 20 dias. As avaliações foram realizadas, tomando-se como base o potencial hídrico foliar e as trocas gasosas, monitorados com auxílio de câmaras psicrométricas e um analisador portátil de gás por infravermelho, respectivamente. As plantas propagandas por sementes mantiveram valores de potencial hídrico, condutância estomática, transpiração e fotossíntese significativamente maiores, sob condições decrescentes de disponibilidade de água no solo. Entretanto, plantas propagadas por estaquia foram incapazes de manter um balanço hídrico favorável, refletindo negativamente na condutância estomática e trocas gasosas. Estes resultados estão provavelmente associados ao fato de que o umbuzeiro propagado por estaquia dificilmente apresenta túberas em suas raízes, as quais são reservatórios de água e solutos. Dessa forma, o plantio de umbuzeiros propagados por estaquia deve ser evitado em áreas sujeitas à deficiência hídrica.

  9. Pathway Analysis and Metabolites Identification by Metabolomics of Etiolation Substrate from Fresh-Cut Chinese Water Chestnut (Eleocharis tuberosa

    Directory of Open Access Journals (Sweden)

    Yi-Xiao Li

    2016-12-01

    Full Text Available Fresh-cut Chinese water chestnuts (CWC turn yellow after being peeled, reducing their shelf life and commercial value. Metabolomics, the systematic study of the full complement of small molecular metabolites, was useful for clarifying the mechanism of fresh-cut CWC etiolation and developing methods to inhibit yellowing. In this study, metabolic alterations associated with etiolation at different growth stages (0 day, 2 days, 3 days, 4 days, 5 days from fresh-cut CWC were investigated using LC–MS and analyzed by pattern recognition methods (principal component analysis (PCA, partial least squares-discriminant analysis (PLS-DA, and orthogonal projection to latent structures-discriminant analysis (OPLS-DA. The metabolic pathways of the etiolation molecules were elucidated. The main metabolic pathway appears to be the conversion of phenylalanine to p-coumaroyl-CoA, followed by conversion to naringenin chalcone, to naringenin, and naringenin then following different pathways. Firstly, it can transform into apigenin and its derivatives; secondly, it can produce eriodictyol and its derivatives; and thirdly it can produce dihydrokaempferol, quercetin, and myricetin. The eriodictyol can be further transformed to luteolin, cyanidin, dihydroquercetin, dihydrotricetin, and others. This is the first reported use of metabolomics to study the metabolic pathways of the etiolation of fresh-cut CWC.

  10. Pathway Analysis and Metabolites Identification by Metabolomics of Etiolation Substrate from Fresh-Cut Chinese Water Chestnut (Eleocharis tuberosa).

    Science.gov (United States)

    Li, Yi-Xiao; Pan, Yong-Gui; He, Feng-Ping; Yuan, Meng-Qi; Li, Shang-Bin

    2016-12-01

    Fresh-cut Chinese water chestnuts (CWC) turn yellow after being peeled, reducing their shelf life and commercial value. Metabolomics, the systematic study of the full complement of small molecular metabolites, was useful for clarifying the mechanism of fresh-cut CWC etiolation and developing methods to inhibit yellowing. In this study, metabolic alterations associated with etiolation at different growth stages (0 day, 2 days, 3 days, 4 days, 5 days) from fresh-cut CWC were investigated using LC-MS and analyzed by pattern recognition methods (principal component analysis (PCA), partial least squares-discriminant analysis (PLS-DA), and orthogonal projection to latent structures-discriminant analysis (OPLS-DA)). The metabolic pathways of the etiolation molecules were elucidated. The main metabolic pathway appears to be the conversion of phenylalanine to p-coumaroyl-CoA, followed by conversion to naringenin chalcone, to naringenin, and naringenin then following different pathways. Firstly, it can transform into apigenin and its derivatives; secondly, it can produce eriodictyol and its derivatives; and thirdly it can produce dihydrokaempferol, quercetin, and myricetin. The eriodictyol can be further transformed to luteolin, cyanidin, dihydroquercetin, dihydrotricetin, and others. This is the first reported use of metabolomics to study the metabolic pathways of the etiolation of fresh-cut CWC.

  11. White matter cysts in patients with tuberous sclerosis; Quistes de sustancia blanca en pacientes con esclerosis tuberosa

    Energy Technology Data Exchange (ETDEWEB)

    Marti-Bonmati, L.; Dosda, R. [Hospital Universitario Dr. Peset. Servicio de Resonancia Magnetica ATQ-Quiron. Valencia (Spain); Menor, F. [Hospital Infantil La Fe. Valencia (Spain); Arana, E. [Hospital Casa de La Salud. Valencia (Spain); Poyatos, C. [Hospital Universitario Dr. Peset. Valencia (Spain)

    1999-07-01

    The presence of cysts in the white matter of the central nervous system of patients with tuberous sclerosis (TS) is an uncommon finding that has been reported only recently in neuroimaging studies. This article assesses the prevalence of these lesions in a large series of patients studied by magnetic resonance imaging (MRI) and their relationship to other epidemiological and imaging findings. MRI studies were performed in 46 patients (23 males and 23 females) with a mean age of 12.7 years, and the results were examined retrospectively in the search for cortical tubers, subependymal nodules and white matter nodules, lines and cysts. Nine patients (19.6%) presented cysts in white matter. Seven had only one cyst and the remaining two patients each had two. Multiple regression analysis relating the presence of the cysts with other neuroimaging findings in these patients revealed a statistically significant relationship only with white matter nodules (odds ratio: 7.5; p=0.006). White matter cysts are small, supratentorial lesions of deep location. There is a statistically relationship between the presence of these cysts and that of nodular lesions in the white matter. This finding supports the theory that the cyst originate from white matter nodules. (Author) 17 refs.

  12. Development of a mixed drink made from hydrosoluble soybean extract, coconut water and umbu pulp (Spondias tuberosa

    Directory of Open Access Journals (Sweden)

    Luís Gomes de Moura Neto

    2016-06-01

    Full Text Available The food sector depends on consumers and their social behavior. Since currently more and more consumers seek healthy products, exotic fruits have been increasingly on demand, with great opportunities for innovation. Current study developed a ready-to-drink mixed beverage made from hydrosoluble soybean extract, coconut water and umbu pulp. Four formulations were prepared with two proportions of umbu pulp (25 and 30% and soluble solids (17 and 25º Brix. Formulations were submitted to chemical, physicochemical, microbiological and sensory analyses. The beverage was prepared with 25% of umbu pulp and the soluble solids were standardized to 25º Brix with commercial sugar for the highest scores in sensory attributes, overall impression and purchase intent. The four formulations presented pH, acidity, moisture, total sugar, vitamin C and microbiological results in accordance with current legislation.

  13. ADUBOS NITROGENADOS E POTÁSSICOS NA PRODUÇÃO DE POR TAENXERTOS DE UMBUZEIRO (Spondias tuberosa Arr. Cam.

    Directory of Open Access Journals (Sweden)

    MIGUEL WANDERLEY DE ANDRADE

    2013-01-01

    Full Text Available The objective of this work was to obtain informatio n about the best sources and doses of nitro- gen and potassium fertilizers for obtaining vigorou s rootstocks umbuzeiro in Northeastern Brazil. In s eparate experiments, we tested two sources of nitrogen, ure a and ammonium sulfate and five N rates (0, 350, 70 0, 1400 and 2800 mg.dm -3 , and two sources of potash fertilizer (potassium c hloride and potassium sulfate in five doses of K20 (0, 1.800, 3.600, 5.400 and 7.200 mg. dm -3 substrate. The experimental design was in random- ized blocks in factorial 2 (sources x 4 (doses, w ith ten treatments and four replications and ten pl ants per plot. Parameters were evaluated for the growth of seedlin gs. Doses of nitrogen and potassium applied to soi l had a negative influence in the survival of seedlings, shoot length, stem diameter and root fresh weight of seedlings.

  14. Differences in mechanical and structural properties of surface and aerial petioles of the aquatic plant Nymphaea odorata subsp. tuberosa (Nymphaeaceae).

    Science.gov (United States)

    Etnier, Shelley A; Villani, Philip J

    2007-07-01

    Lily pads (Nymphaea odorata) exhibit heterophylly where a single plant may have leaves that are submerged, floating, or above (aerial) the surface of the water. Lily pads are placed in a unique situation because each leaf form is exposed to a distinctly different set of mechanical demands. While surface petioles may be loaded in tension under conditions of wind or waves, aerial petioles are loaded in compression because they must support the weight of the lamina. Using standard techniques, we compared the mechanical and morphological properties of both surface and aerial leaf petioles. Structural stiffness (EI) and the second moment of area (I) were higher in aerial petioles, although we detected no differences in other mechanical values (elastic modulus [E], extension ratio, and breaking strength). Morphologically, aerial petioles had a thicker rind, with increased collenchyma tissue and sclereid cell frequency. Aerial petioles also had a larger cross-sectional area and were more elliptical. Thus, subtle changes in the distribution of materials, rather than differences in their makeup, differentiate petiole forms. We suggest that the growth of aerial petioles may be an adaptive response to shading, allowing aerial leaves to rise above a crowded water surface.

  15. Effects of Phosphorus Solubilizing Bacteria and Nitrogen on the Qualitative and Quantitative Properties of Tuberose (Polianthes tuberosa

    Directory of Open Access Journals (Sweden)

    T. Taher

    2016-02-01

    Full Text Available Introduction: In Iran, tuberose is ranked the forth after gladiolus, rose and carnation. These flowers are known as high quality products among which maximum exportation belongs to tuberose and gladiolus. In plant cultivation and development, adequate provision of nutrients is of crucial importance. Tuberose needs plenty of nutrients to obtain the desirable quality and flowering. Hence, tuberose balanced nutrition can play an important role in increasing the yield and quality of its flowers. Nitrogen is a deciding factor for the plant growth and physiology. This nutritional element contributes to the formation of amino acids, proteins, nucleic acids and other cellular components that are required for the construction of new cells. Bio fertilizers containing phosphate solubilizing bacteria (bacillus and pseudomonas have microorganisms which are beneficial to the soil; these bacteria are conducive to the production of biological materials and as a consequence to plant development. According to a report by Rawia Eid et al., (2009 the application of phosphate solubilizing bacteria increased the growth rate of matthiola cut flower and improved its quality. In another study on soybean, it was observed that the application of phosphate solubilizing bacteria led to a rise in the plant dry matter content. Considering the contributory role of nitrogen and phosphorous in increasing the yield and quality of ornamental plants, the aim of this research was to examine the impact of different nitrogen levels and phosphate solubilizing bacteria on the yield and qualitative properties of tuberose cut flower. Materials and Methods: This research was carried out in a greenhouse in the city of Zanjan in Iran in 2011 through a factorial-form experiment based on a randomized complete block design with three replications and twelve treatments performed on tuberose double cultivar. The treatments included bio fertilizer containing phosphate solubilizing bacteria at three levels (0, 5 and 10 kg ha-1 and nitrogen at four levels (0, 50, 100 and 200 kg ha-1 taken from urea source. Before cultivation, the bulbs, which were supposed to be inoculated with the mentioned bacteria, were placed in dense suspension (4gL-1 containing phosphate solubilizing bacteria for some minutes. After germination of the bulbs and formation of the actual leaves, the first stage of nitrogen consumption was performed during the growing season. The second stage of N consumption began 20 days after the first stage. At the end of the experiment, such parameters as flower vase life, Leaf area per plant, percentage of simultaneous opening of the florets, relative water content percentage, leaf chlorophyll index, plant biomass, dry matter percentage and leaf nitrogen and phosphorous percentages were measured. For means comparison, data variance analysis was carried out by SAS software and Duncan’s multiple-range test. Results and Discussion: According to data variance analysis, different levels of nitrogen had a significant impact on all properties except for flower vase life and leaf P percentage at the probability level of 1℅. Also, phosphate solubilizing bacteria left a significant effect on all properties except for flower vase life and leaf N and P percentages at p=1℅. The interactive effect of nitrogen and the bacteria on such traits as percentage of simultaneous opening of the florets, flower vase life, dry matter percentage and plant biomass was significant at p=1℅. Also, with rise in N levels and in bio fertilizer containing phosphate solubilizing bacteria, there occurred an increase in leaf area, relative water percentage, leaf chlorophyll index, leaf N percentage, dry matter content and plant biomass as well. The results showed that a rise in the application of nitrogen up to 200 kg ha-1 led to an increase in leaf area in bush, relative water percentage, leaf chlorophyll index, leaf N and P percentages, biomass per plant and the percentage of bulb dry matter as well. In contrast, it led to a decline in flower vase life, percentage of simultaneous opening of the florets and leaf P percentage. Maximum values for these properties were obtained when nitrogen was consumed at the level of 50 kg ha-1. The treatment of bio fertilizer containing phosphate solubilizing bacteria at the level of 10 kg ha-1 resulted in an increase in leaf area, relative water percentage, leaf chlorophyll index, leaf P percentage, plant biomass in bush and plant dry matter percentage. According to the results from this work, a consumption of 200 kg ha-1 nitrogen accompanied by 10 kg ha-1 bio fertilizer containing phosphate solubilizing bacteria is recommended. In their study on matthiola cut flower, Rawia Eid et al., (2009 showed that a rise in nitrogen level caused a reduction in the percentage of simultaneous opening of the florets, which is in accordance with our results. After examining the effects of N and P levels on tuberose single cultivar, Patel et al., (2006 reported that an application of 200 kg ha-1 P2O5 fertilizer and 400 kg ha-1 nitrogen resulted in a maximum production of plant biomass. The presence of nitrogen and phosphate solubilizing bacteria in bio fertilizers is crucial for the production of a desirable biomass and for the attainment of maximum economic yield. Sirvastava et al., (2005 conducted a research on the impact of phosphate solubilizing bacteria on gladiolus cut flower and showed that high concentration levels of the bacteria reduced the percentage of simultaneous opening of the florets

  16. Efecto del extracto de óleo de rosa mosqueda (Rosa aff. Rubiginosa en la cicatrización de heridas cutáneas - Effect of rose mosqueda extract oil (Rosa aff. Rubiginosa in cutaneous wound healing

    Directory of Open Access Journals (Sweden)

    Duvaldo Eurides

    2011-01-01

    Full Text Available ResumenSe utilizaron cuarenta y ocho ratones machos, de linaje "swis"separados en dos grupos de igual número para estudios de reparaciónde heridas cutáneas de 10,0 mm de diámetro en la región torácicadorsal con aceite de rosa mosqueta. Al grupo uno control (I se instiló diariamente solución fisiológica al 0,9%, en los animales del grupo en tratamiento (II, se instiló aceite de rosa mosqueta, durante 21 días. Fueron realizadas evaluaciones macroscópicas y mensuraciones de las heridas.SummaryForty eight male mices “swis” lineage separated in two groups with thesame number were utilized to study the tissue reparation of skinwounds with 10,0mm of diameter on thoracic dorsal region withRosehip oil. Physiologic solution 0.9% was instilled daily on controlanimals group (I and Rosehip oil on treated animals group (II.

  17. Environ: E00415 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available e, Protostemonine, Hodorine, Sessilistemonine, Tuberostemonine, Hypotuberostemonine, Oxotuberostemonine, Isotuber...ostemonine, Stenine Stemona japonica [TAX:85282], Stemona sessilifolia [TAX:339784], Stemona tuberosa [...TAX:167572] Stemonaceae Stemona japonica, Stemona sessilifolia, Stemona tuberosa

  18. Adenopatía supraclavicular como forma de presentación de un carcinoma de cérvix asociado al complejo esclerosis tuberosa con linfangioleiomiomatosis

    Directory of Open Access Journals (Sweden)

    Pablo López Mato

    2013-09-01

    Full Text Available La linfangioleiomiomatosis es una proliferación del tejido muscular broncovascular que recientemente se ha definido como una expresión incompleta de la entidad “complejo esclerosis tuberosa”, una facomatosis a la que se asocian diversas neoplasias. Presentamos un caso de carcinoma de cérvix con metástasis supraclaviculares y cervicales, asociado a linfangioleiomiomatosis en el contexto de un “complejo esclerosis tuberosa”.

  19. Adenopatía supraclavicular como forma de presentación de un carcinoma de cérvix asociado al complejo esclerosis tuberosa con linfangioleiomiomatosis

    OpenAIRE

    Pablo López Mato; Alfonso Varela Fariña; Elena Seco Hernández; Antonio J. Chamorro Fernández

    2013-01-01

    La linfangioleiomiomatosis es una proliferación del tejido muscular broncovascular que recientemente se ha definido como una expresión incompleta de la entidad “complejo esclerosis tuberosa”, una facomatosis a la que se asocian diversas neoplasias. Presentamos un caso de carcinoma de cérvix con metástasis supraclaviculares y cervicales, asociado a linfangioleiomiomatosis en el contexto de un “complejo esclerosis tuberosa”.

  20. Estimativas de polinização cruzada em população de Spondias tuberosa Arruda (Anacardiaceae usando marcador AFLP

    Directory of Open Access Journals (Sweden)

    Carlos Antonio Fernandes Santos

    2011-06-01

    Full Text Available O umbuzeiro é uma das espécies mais importantes do semiárido brasileiro, devido à sua capacidade de produzir frutos em ambiente de estresse hídrico. O objetivo deste estudo foi estimar taxas de polinização cruzada em umbuzeiro (, considerando-se a frequência de heterozigotos observada e esperada nas populações maternal e de descendentes (M1, respectivamente, e a estimativa de multilocos (M2, de forma a orientar programas de preservação e melhoramento genético da espécie. Amostras de DNA extraído de uma população maternal de 96 plantas, estabelecidas no campo em 1991, em Petrolina, PE, bem como DNA de um indivíduo descendente de cada planta-mãe, foram analisadas para 16 bandas polimórficas das combinações de primer de AFLPAAA_CTG e AAA_CTC. No M1, considerou-se a frequência de heterozigotos estimada pela raiz quadrada de 1 menos a frequência de ausência de fragmentos AFLP, tanto para a população maternal (frequência observada quanto para a população de descendentes (frequência esperada, enquanto no M2 a estimativa foi obtida por estimativa multilocos (m. As estimativas de no M1 variaram de 1,74 a 0,50, com média de 1,063. Como valores de acima de 1,0 são biologicamente inaceitáveis, ficou demonstrado que M1 não foi apropriado para estimar . As frequências de óvulos e pólen para 15 locos de AFLP foram iguais, indicando boa adequação do modelo de acasalamento misto no M2. A taxa m obtida pelo M2 foi de 0,719, próxima de estimativas prévias com isoenzimas em outras populações da espécie. Os resultados indicam que o umbuzeiro é predominantemente de polinização cruzada e há necessidade de amostras amplas para preservar a variabilidade genética da espécie.

  1. Adenopatía supraclavicular como forma de presentación de un carcinoma de cérvix asociado al complejo esclerosis tuberosa con linfangioleiomiomatosis

    OpenAIRE

    Pablo López Mato; Alfonso Varela Fariña; Elena Seco Hernández; Antonio J. Chamorro Fernández

    2013-01-01

    La linfangioleiomiomatosis es una proliferación del tejido muscular broncovascular que recientemente se ha definido como una expresión incompleta de la entidad “complejo esclerosis tuberosa”, una facomatosis a la que se asocian diversas neoplasias. Presentamos un caso de carcinoma de cérvix con metástasis supraclaviculares y cervicales, asociado a linfangioleiomiomatosis en el contexto de un “complejo esclerosis tuberosa”.

  2. Physiological aff'mity of nurse seed grafted union of Camellia oleifera%油茶芽苗砧嫁接体的亲和性生理

    Institute of Scientific and Technical Information of China (English)

    冯金玲; 杨志坚; 陈辉; 陈世品; 刘玉宝

    2011-01-01

    通过对油茶芽苗砧嫁接体发育过程中的死亡率、可溶性糖含量、相对电导率和超氧化物歧化酶(SOD)、过氧化物酶(POD)、过氧化氢酶(CAT)活性的测定,研究嫁接体的亲和性生理.结果表明,嫁接体与对照实生苗的各项生理生化指标差异很大.嫁接体的死亡率在嫁接后16 d达到最高;CAT活性峰值出现在嫁接后20 d,是对照的339%;POD活性在嫁接后18d达到最高,是对照的187%;SOD活性在嫁接后26 d达到最高,是对照的136%;可溶性糖含量在嫁接后24 d达到最高.是对照的118%;相对电导率在嫁接后6和24 d出现2个高峰,分别是对照的107%和121%.可见,嫁接后的前26 d是嫁接体发育的关键时期.相关分析显示,嫁接体的死亡率与POD活性呈极显著正相关,与相对电导率呈显著正相关,与SOD活性不相关,表明POD活性可能是影响嫁接成活的关键指标.%For inquiring into the mechanism of physiological affinity, the death rate, soluble sugar content, the relative conductivity, superoxide dismutase (SOD), peroxidase (POD), catalase (CAT) activity of Camellia oleifera nurse seed grafted union were studied. The results showed that changes of biophysical and chemical indices had obvious differences between the grafted union and the control. The death rate reached the peak value at the sixteenth day after 8rafting; the CAT activity reached the peak value at the twentieth day, which was 339% compared with the control; the POD activity reached the peak value at the eishteenth day, 187% of the control; the SOD activity reached the peak value that was 136% compared with the control at the twenty-sixth day; the soluble sugar content reached the peak value which was 118% of the control at the twenty-fourth day; the relative conductivity had the two peaks value at the sixth and twenty-fourth day, which were 107% and 121% compared with the control; so the twenty-sixth day after 8rafting was the critical period for the nurse seed 8rafted union. The death rate was extremely significantly and significantly positive correlation with the POD activity and the relative conductivity respectively, but had no significant correlation with the SOD activity.It indicated that the POD activity was probably a key indicator to survival rate in nurse seed 8rafted union.

  3. Cloning and characterization of a norbelladine 4'-O-methyltransferase involved in the biosynthesis of the Alzheimer's drug galanthamine in Narcissus sp. aff. pseudonarcissus.

    Directory of Open Access Journals (Sweden)

    Matthew B Kilgore

    Full Text Available Galanthamine is an Amaryllidaceae alkaloid used to treat the symptoms of Alzheimer's disease. This compound is primarily isolated from daffodil (Narcissus spp., snowdrop (Galanthus spp., and summer snowflake (Leucojum aestivum. Despite its importance as a medicine, no genes involved in the biosynthetic pathway of galanthamine have been identified. This absence of genetic information on biosynthetic pathways is a limiting factor in the development of synthetic biology platforms for many important botanical medicines. The paucity of information is largely due to the limitations of traditional methods for finding biochemical pathway enzymes and genes in non-model organisms. A new bioinformatic approach using several recent technological improvements was applied to search for genes in the proposed galanthamine biosynthetic pathway, first targeting methyltransferases due to strong signature amino acid sequences in the proteins. Using Illumina sequencing, a de novo transcriptome assembly was constructed for daffodil. BLAST was used to identify sequences that contain signatures for plant O-methyltransferases in this transcriptome. The program HAYSTACK was then used to identify methyltransferases that fit a model for galanthamine biosynthesis in leaf, bulb and inflorescence tissues. One candidate gene for the methylation of norbelladine to 4'-O-methylnorbelladine in the proposed galanthamine biosynthetic pathway was identified. This methyltransferase cDNA was expressed in E. coli and the protein purified by affinity chromatography. The resulting protein was found to be a norbelladine 4'-O-methyltransferase (NpN4OMT of the proposed galanthamine biosynthetic pathway.

  4. Arboreal ant colonies as 'hot-points' of cryptic diversity for myrmecophiles: the weaver ant Camponotus sp. aff. textor and its interaction network with its associates.

    Directory of Open Access Journals (Sweden)

    Gabriela Pérez-Lachaud

    Full Text Available INTRODUCTION: Systematic surveys of macrofaunal diversity within ant colonies are lacking, particularly for ants nesting in microhabitats that are difficult to sample. Species associated with ants are generally small and rarely collected organisms, which makes them more likely to be unnoticed. We assumed that this tendency is greater for arthropod communities in microhabitats with low accessibility, such as those found in the nests of arboreal ants that may constitute a source of cryptic biodiversity. MATERIALS AND METHODS: We investigated the invertebrate diversity associated with an undescribed, but already threatened, Neotropical Camponotus weaver ant. As most of the common sampling methods used in studies of ant diversity are not suited for evaluating myrmecophile diversity within ant nests, we evaluated the macrofauna within ant nests through exhaustive colony sampling of three nests and examination of more than 80,000 individuals. RESULTS: We identified invertebrates from three classes belonging to 18 taxa, some of which were new to science, and recorded the first instance of the co-occurrence of two brood parasitoid wasp families attacking the same ant host colony. This diversity of ant associates corresponded to a highly complex interaction network. Agonistic interactions prevailed, but the prevalence of myrmecophiles was remarkably low. CONCLUSIONS: Our data support the hypothesis of the evolution of low virulence in a variety of symbionts associated with large insect societies. Because most myrmecophiles found in this work are rare, strictly specific, and exhibit highly specialized biology, the risk of extinction for these hitherto unknown invertebrates and their natural enemies is high. The cryptic, far unappreciated diversity within arboreal ant nests in areas at high risk of habitat loss qualifies these nests as 'hot-points' of biodiversity that urgently require special attention as a component of conservation and management programs.

  5. Accumulation of toxic metals (Pb and Cd) in the sea urchin Diadema aff. antillarum Philippi, 1845, in an oceanic island (Tenerife, Canary Islands).

    Science.gov (United States)

    Hernández, Ofelia Dolores; Gutiérrez, Angel José; González-Weller, Dailos; Lozano, Gonzalo; Melón, Enrique García; Rubio, Carmen; Hardisson, Arturo

    2010-06-01

    This document shows the results obtained from a study on the concentration of toxic heavy metals in the internal tissue and exoskeleton of sea urchins, collected from their natural habitat. The levels of lead and cadmium were measured by Graphite Furnace Atomic Absorption Spectrometry. The mean concentrations of lead and cadmium in the internal tissue were 304.04 and 260.54 microg/kg respectively, whereas in the shell they were 185.02 and 142.48 microg/kg. We also performed a statistical analysis of the differences in the distribution of metals between their exoskeleton and their internal content, a correlation study of the metal content in internal tissue and shell and sampling areas, and a correlation study between the metal content and sample size. Since the sea urchin Diadema antillarum presents a wide range of variation in metal content, this study suggests that this species is an excellent bioindicator of heavy metal contamination.

  6. Arboreal Ant Colonies as ‘Hot-Points’ of Cryptic Diversity for Myrmecophiles: The Weaver Ant Camponotus sp. aff. textor and Its Interaction Network with Its Associates

    Science.gov (United States)

    Pérez-Lachaud, Gabriela; Lachaud, Jean-Paul

    2014-01-01

    Introduction Systematic surveys of macrofaunal diversity within ant colonies are lacking, particularly for ants nesting in microhabitats that are difficult to sample. Species associated with ants are generally small and rarely collected organisms, which makes them more likely to be unnoticed. We assumed that this tendency is greater for arthropod communities in microhabitats with low accessibility, such as those found in the nests of arboreal ants that may constitute a source of cryptic biodiversity. Materials and Methods We investigated the invertebrate diversity associated with an undescribed, but already threatened, Neotropical Camponotus weaver ant. As most of the common sampling methods used in studies of ant diversity are not suited for evaluating myrmecophile diversity within ant nests, we evaluated the macrofauna within ant nests through exhaustive colony sampling of three nests and examination of more than 80,000 individuals. Results We identified invertebrates from three classes belonging to 18 taxa, some of which were new to science, and recorded the first instance of the co-occurrence of two brood parasitoid wasp families attacking the same ant host colony. This diversity of ant associates corresponded to a highly complex interaction network. Agonistic interactions prevailed, but the prevalence of myrmecophiles was remarkably low. Conclusions Our data support the hypothesis of the evolution of low virulence in a variety of symbionts associated with large insect societies. Because most myrmecophiles found in this work are rare, strictly specific, and exhibit highly specialized biology, the risk of extinction for these hitherto unknown invertebrates and their natural enemies is high. The cryptic, far unappreciated diversity within arboreal ant nests in areas at high risk of habitat loss qualifies these nests as ‘hot-points’ of biodiversity that urgently require special attention as a component of conservation and management programs. PMID:24941047

  7. Identifying Incomplete Atypical Femoral Fractures With Single-Energy Absorptiometry: Declining Prevalence

    LENUS (Irish Health Repository)

    McKenna, Malachi

    2017-03-01

    Atypical femur fractures (AFFs) are associated with long-term bisphosphonate (BP) therapy. Early identification of AFF prior to their completion provides an opportunity to intervene, potentially reducing morbidity associated with these fractures. Single-energy X-ray absorptiometry (SE) is an imaging method recently shown to detect incomplete AFF (iAFF) prior to fracture completion.

  8. Crescimento e nutrição mineral de mudas de umbuzeiro (Spondias tuberosa Arr. Cam. submetidas a níveis de salinidade em solução nutritiva Growth and mineral nutrition of umbuzeiro seedlings (Spondias tuberosa Arr. Cam. under salt stress in nutrient solution

    Directory of Open Access Journals (Sweden)

    Orlando Sílvio Caires Neves

    2004-10-01

    Full Text Available Para avaliar o crescimento e a nutrição mineral de mudas de umbuzeiro em solução nutritiva com diferentes níveis de NaCl, conduziu-se este experimento em casa-de-vegetação do Departamento de Ciência do Solo da Universidade Federal de Lavras. Adotou-se o delineamento em blocos casualizados com quatro repetições e seis doses de NaCl (0, 20, 40, 60, 80 e 100 mmol L-1. As mudas foram adaptadas na solução de Hoagland a 25%, 33% e 50% da sua força iônica, permanecendo durante 15 dias em cada concentração. Após esse período, conduziram-se as plantas por 60 dias em solução com 100% da força iônica e os tratamentos com NaCl. A troca das soluções foi feita quinzenalmente. O NaCl na solução nutritiva afetou negativamente o crescimento das mudas de umbuzeiro. O umbuzeiro foi classificado como moderadamente tolerante à salinidade quando cultivado em até 31 mmol L-1 de NaCl na solução nutritiva, sendo a compartimentalização nas raízes o possível mecanismo de tolerância à salinidade. A ordem de acumulação dos macronutrientes foi: N > K > Ca > P > S > Mg e N > Ca > K > P > S > Mg, na ausência e com 100 mmol L-1, respectivamente, e a dos micronutrientes, exceto o Cl, foi: Fe > B > Mn > Zn > Cu, independente da concentração de NaCl no meio.To evaluate the growth and the mineral nutrition of umbuzeiro seedlings, under salt stress, an experiment in nutrient solution was conducted, under greenhouse conditions in the Soil Science Department of the Federal University of Lavras, Brazil. The experimental design was randomized blocs, with four replications and six doses of NaCl (0, 20, 40, 60, 80, and 100 mmol L-1. The seedlings were adapted in the Hoagland solution to 25, 33 and 50% of ionic forces, staying for fifteen days in each concentration. After this period the seedlings were conduced for 60 days in nutrient solution with 100% of the ionic force and the treatments with NaCl. The change of the solutions was made biweekly. The NaCl in the nutrient solution affected negatively the growth of the umbuzeiro seedlings. The umbuzeiro was classified as moderately tolerant to salinity when cultivated below 31 mmol L-1 of NaCl. The roots compartmentalization is the possible mechanism of tolerance to salt in umbuzeiro seedlings. The order of macronutrient accumulation was: N > K > Ca > P > S > Mg and N > Ca > K > P > S > Mg, in the absence and with 100 mmol L-1, respectively and the micronutrient accumulation, except Cl, was: Fe > B > Mn > Zn > Cu, independent of the concentration of NaCl in the solution.

  9. MIDDLE TRIASSIC BRACHIOPODS FROM VAL PARINA, BERGAMASC ALPS, ITALY

    Directory of Open Access Journals (Sweden)

    VALENTINA TORTI

    1997-07-01

    Full Text Available The Middle Triassic Esino Limestone of Val Parina yields a rich brachiopod fauna associated with bivalves, gastropods, corals, and ammonoids. The brachiopod fauna of the Esino Limestone includes ubiquitous species (P. fragilis, A. aff. posterior, M. mentzeli, D. cf. dinarica, L. praepunctata and A. angustaeformis, species exclusive to the back reef (T. cf. intervallata, A. aff. ladina and A. aff. raxana and species exclusive to the shelf margin (C. aff. altaplecta, V. vivida, A. aff. dilatata, H. aff. ambitiosa, T. trigonella, M. ampla, A. aff. canaliculata. The age of the Val Parina brachiopods spans from latest Anisian to Late Ladinian.  

  10. EFEITO DO ESTÁDIO DE MATURAÇÃO DO FRUTO E DO TEMPO DE PRÉ-EMBEBIÇÃO DE ENDOCARPOS NA GERMINAÇÃO DE SEMENTES DE UMBUZEIRO (Spondias tuberosa Arr. Câm.

    Directory of Open Access Journals (Sweden)

    COSTA NIVÂNIA PEREIRA DA

    2001-01-01

    Full Text Available O umbuzeiro é uma fruteira nativa do Nordeste brasileiro, cujos frutos são usados na alimentação humana, tendo, portanto, grande potencial de exploração agroindustrial. A lenta germinação das sementes limita a produção de mudas, daí a realização deste trabalho que objetivou estudar o efeito dos diferentes estádios de maturação do fruto e tempos de pré-embebição dos endocarpos em água na germinação das sementes de umbu. Os frutos foram despolpados manualmente, e os endocarpos pré-embebidos em água destilada substituída a cada 24 horas. Utilizou-se o delineamento experimental inteiramente ao acaso, em fatorial (4´4´2, sendo os fatores: estádios de maturação dos frutos (verde, de vez, maduro e maturação avançada, tempos de pré-embebição dos endocarpos em água (0, 48, 96 e 144 horas e tipos de umbuzeiros (azedo e doce, com quatro repetições e dez endocarpos/parcela. Os endocarpos foram semeados em bandejas de isopor contendo Areia Quartzosa Distrófica. Pelos resultados, concluiu-se que o tipo de umbu e o estádio de maturação do fruto influenciaram na germinação. Entretanto, a pré-embebição dos endocarpos em água não influenciou na germinação das sementes de umbuzeiro.

  11. Garfagem e diâmetro de porta-enxerto na obtenção de mudas de umbuzeiro do acesso Laranja Graft and diameter of stock on obtainning seedlingsof umbuzeiro (Spondias tuberosa from the Orange access

    Directory of Open Access Journals (Sweden)

    Wiara de Assis Gomes

    2010-09-01

    Full Text Available O objetivo do trabalho foi verificar a eficiência de diferentes métodos de garfagem em umbuzeiro, realizadas sobre dois diâmetros de porta-enxerto. Os tratamentos foram dispostos em delineamento inteiramente casualizado, em esquema fatorial 2 x 2, sendo os fatores: diâmetros (0,5-0,7 cm e 0,75-1,0 cm e métodos de garfagem (em fenda cheia e à inglesa simples, com 3 repetições e 8 plantas por parcela. Avaliaram-se o percentual de pegamento dos enxertos, bem como o crescimento das brotações. O método de garfagem à inglês simples mostrou pegamento de enxertos superior à garfagem em fenda cheia. O maior diâmetro de porta-enxerto possibilitou maior percentual de pegamento da enxertia e maior comprimento e diâmetro das brotações dos enxertos de umbuzeiro.The objective of this study was to verify the efficiency of different methods of grafting in umbuzeiro, as well as, to observe the behavior of different diameter of stock. The treatments were arranged in a randomized design in factorial 2 x 2 factors, in which the factors were: diameters (0,5-0,7 cm and 0,75-1,0 cm and grafting (cleft graft and splice graft, using three repetitions, with eight plants per parcel. The percentage of grafting success and growth of shoots were evaluated. The splice grafting showed higher fixation than the cleft grafting. The largest diameter of the stock allowed a higher percentage of grafting and a greater length and diameter of the graft shoots of umbuzeiro.

  12. Dicty_cDB: Contig-U15666-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 042 1 ( AF472418 ) Gracilaria aff. tepocensis strain Sao Paulo4B 18S... 54 0.042 ...1 ( AF472417 ) Gracilaria aff. tepocensis strain Sao Paulo2B 18S... 54 0.042 1 ( AF472416 ) Gracilaria aff. ...laria sp. Buzios 18S ribosomal RNA gene, par... 54 0.042 1 ( AF468914 ) Gracilaria aff. mammillaris strain Sao Paulo

  13. Enhance performance of micro direct methanol fuel cell by in situ CO2 removal using novel anode flow field with superhydrophobic degassing channels

    Science.gov (United States)

    Liang, Junsheng; Luo, Ying; Zheng, Sheng; Wang, Dazhi

    2017-05-01

    Capillary blocking caused by CO2 bubbles in anode flow field (AFF) is one of the bottlenecks for performance improvement of a micro direct methanol fuel cell (μDMFC). In this work, we present a novel AFF structure with nested layout of hydrophilic fuel channels and superhydrophobic degassing channels which can remove most of CO2 from AFF before it is released to the fuel channels. The new AFFs are fabricated on Ti substrates by using micro photochemical etching combined with anodization and fluorination treatments. Performance of the μDMFCs with and without superhydrophobic degassing channels in their AFF is comparatively studied. Results show that the superhydrophobic degassing channels can significantly speed up the exhaust of CO2 from the AFF. CO2 clogging is not observed in the new AFFs even when their comparison AFFs have been seriously blocked by CO2 slugs under the same operating conditions. 55% and 60% of total CO2 produced in μDMFCs with N-serpentine and N-spiral AFF can be respectively removed by the superhydrophobic degassing channels. The power densities of the μDMFCs equipped with new serpentine and spiral AFFs are respectively improved by 30% and 90% compared with those using conventional AFFs. This means that the new AFFs developed in this work can effectively prevent CO2-induced capillary blocking in the fuel channels, and finally significantly improve the performance of the μDMFCs.

  14. Challenges Associated with Technological Aspects for Modernization of Alkaline-Fermented Foods

    NARCIS (Netherlands)

    Linnemann, A.R.; Hansen, E.B.; Lelieveld, H.L.M.; Heising, J.K.; Dekker, M.

    2014-01-01

    Among the new generations, the awareness and appreciation of indigenous healthy foods including alkaline-fermented foods (AFFs) needs to be enhanced. AFFs are considered to be old-fashioned. In fact, some of the food processing techniques are outdated with low hygiene and quality standards. Some AFF

  15. Interspecies Interactions and Potential Influenza A Virus Risk in Small Swine Farms in Peru

    Science.gov (United States)

    2012-03-15

    Highway, Suite 1204, Arlington VA 22202-4302. Respondents should be aware that notwithstanding any other provision of law, no person shall be subject...Same as Report (SAR) 18. NUMBER OF PAGES 9 19a. NAME OF RESPONSIBLE PERSON a. REPORT unclassified b. ABSTRACT unclassified c. THIS PAGE...Angela M Bayer,Aff1 Aff4 Aff8 Corresponding Affiliation: Aff8 Email: angelabayerx@gmail.com Aff1 Asociación Benéfica Proyectos en Informática, Salud

  16. "en este aff ösel" in Visby : Ösel and Estland in the Gotlandic account books of Ivar Axelsson Tott 1585-87 and Sören Norby 1524-25 / Jan-Christian Schlüter

    Index Scriptorium Estoniae

    Schlüter, Jan-Christian, 1979-

    2008-01-01

    Ojamaa ja Saaremaa kontaktidest on vähe teada perioodist Saksa ordu ja Rootsi kuningate valitsemisaja vahel. Ivar Axelsson Totti ja Sören Nörby arveraamatutes mainitud kohanimede seas on Eestiga seotud nimedel küllalt suur osakaal. Ka esineb kaptenite palgaarvetel Eestist pärit isikute nimesid

  17. Nigeria’s Quest to Recover Looted Assets: The Abacha Affair Die Bemühungen Nigerias um Rückgabe geraubter Vermögenswerte: die Abacha-Affäre

    Directory of Open Access Journals (Sweden)

    David U. Enweremadu

    2013-01-01

    Full Text Available After a successful transition to democratic rule in 1999, Nigeria launched a high-profile campaign aimed at securing the repatriation of looted public funds being held in foreign banks. This campaign was championed by President Olusegun Obasanjo, a long-standing critic of corrupt military regimes and co-founder of the global anti-corruption NGO Transparency International, throughout his eight-year tenure. By the time Obasanjo left office in May 2007, he had secured the recovery of approximately 2 billion USD in assets and triggered some vital international initiatives against money laundering. However, his efforts were hampered by a combination of local and external obstacles. Externally, the campaign was marked by the absence of sufficient international political will. While at the domestic level, it was undermined by a lack of transparency, the excessive fixation with the Abacha loot, inadequate legal and accounting skills, the uncooperative attitude of accused persons and limited domestic political will. This paper illustrates how these issues have combined to frustrate moves to recover Nigeria’s stolen billions sitting in the West.Nach dem erfolgreichen Übergang zur Demokratie im Jahr 1999 wurde in Nigeria eine hochkarätige Kampagne zur Repatriierung geraubten und bei ausländischen Banken angelegten öffentlichen Vermögens ins Leben gerufen. Präsident Olusegun Obasanjo selbst – langjähriger Kritiker korrupter Militärregime und Mitgründer von Transparency International – setzte sich während seiner achtjährigen Amtszeit dafür ein. Als Obasanjo im Mai 2007 sein Amt aufgab, war die Rückgabe von Anlagevermögen in Höhe von etwa 2 Milliarden USD gesichert und es waren einige wichtige internationale Initiativen gegen Geldwäsche auf den Weg gebracht worden. Doch der Erfolg seiner Bemühungen war durch ein Zusammenwirken interner und externer Hindernisse erheblich eingeschränkt: Im Ausland erfuhr seine Kampagne keine ausreichende politische Unterstützung. Und innerhalb Nigerias scheiterte sie an mangelnder Transparenz, der Konzentration auf das von Abacha geraubte Vermögen, ungenügenden juristischen und finanztechnischen Kenntnissen, mangelnder Kooperation beschuldigter Personen und unzureichendem politischem Willen. Der Autor dieses Beitrags zeigt auf, wie die Bemühungen um Rückgabe nigerianischen Vermögens in Milliardenhöhe, das bei westlichen Banken angelegt worden war, durch die Kombination all dieser Faktoren ins Leere liefen.

  18. Evaluer et prioriser les technologies d’adaptation au changement climatique. Orientations pratiques pour une analyse multicritères et l’identification et évaluation de critères afférents

    DEFF Research Database (Denmark)

    Trærup, Sara Lærke Meltofte; Bakkegaard, Riyong Kim

    L'objectif de ce guide est de guider les consultants, les décideurs et les experts techniques sur la façon de faciliter les discussions pour prioriser les technologies d'adaptation, et de soutenir les parties prenantes dans l'identification des critères appropriés pour cette analyse....

  19. "en este aff ösel" in Visby : Ösel and Estland in the Gotlandic account books of Ivar Axelsson Tott 1585-87 and Sören Norby 1524-25 / Jan-Christian Schlüter

    Index Scriptorium Estoniae

    Schlüter, Jan-Christian, 1979-

    2008-01-01

    Ojamaa ja Saaremaa kontaktidest on vähe teada perioodist Saksa ordu ja Rootsi kuningate valitsemisaja vahel. Ivar Axelsson Totti ja Sören Nörby arveraamatutes mainitud kohanimede seas on Eestiga seotud nimedel küllalt suur osakaal. Ka esineb kaptenite palgaarvetel Eestist pärit isikute nimesid

  20. Libre circulation des marchandises (janvier 2007-septembre 2008)

    OpenAIRE

    Sibony, Anne-Lise; Defossez, Alexandre

    2008-01-01

    CJCE 8 nov. 2007, Stadtgemeinde Frohnleiten et Gemeindebetriebe Frohnleiten GmbH, aff. C-221/06 CJCE 8 avr. 2008, Commission c/ Suède, aff. C-167/05 CJCE 21 févr. 2008, Netto Supermarkt, aff. C-271/06 CJCE 27 sept. 2007, Teleos e.a., aff. C-409/04 CJCE 12 janv. 2006, Optigen e.a., aff. C-354/03, C-355/03 et C-484/03 CJCE 5 juin 2007, Klas Rosengren e.a c./ Risksaklågaren, aff. C-170/04 CJCE 15 mars 2007, Commission c/ Finlande, aff. C-54/05 CJCE 5 juin 2008, Commission c/...

  1. Tuberous Sclerosis Alliance

    Science.gov (United States)

    ... Your Journey with TSC: You Are Not Alone Tuberous Sclerosis Alliance Overview La Esclerosis Tuberosa (Spanish Intro to ... History Database Research Resources International Scientific Advisory Board Tuberous Sclerosis Alliance Support Community The information you obtain at ...

  2. heterokonta de ambientes estuariales y salinos de la Argentina

    Directory of Open Access Journals (Sweden)

    Silvina M. Rosa

    2006-01-01

    Full Text Available Se presentan y describen cinco cepas de Thraustochytriales aisladas de dos ambientes: uno salino continental y otro estuarial. Debido a que las observaciones no coincidieron exactamente con las descripciones originales, tanto en lo morfológico como en lo ecológico, las cepas se determinaron como Thraustochytrium aff. antarcticum, Ulkenia aff. radiata y U. aff. visurgensis. Estos registros constituyen las primeras citas de Labyrinthulomycetes para Argetnina.

  3. Atypical subtrochanteric and diaphyseal femoral fractures: second report of a task force of the American Society for Bone and Mineral Research.

    Science.gov (United States)

    Shane, Elizabeth; Burr, David; Abrahamsen, Bo; Adler, Robert A; Brown, Thomas D; Cheung, Angela M; Cosman, Felicia; Curtis, Jeffrey R; Dell, Richard; Dempster, David W; Ebeling, Peter R; Einhorn, Thomas A; Genant, Harry K; Geusens, Piet; Klaushofer, Klaus; Lane, Joseph M; McKiernan, Fergus; McKinney, Ross; Ng, Alvin; Nieves, Jeri; O'Keefe, Regis; Papapoulos, Socrates; Howe, Tet Sen; van der Meulen, Marjolein C H; Weinstein, Robert S; Whyte, Michael P

    2014-01-01

    Bisphosphonates (BPs) and denosumab reduce the risk of spine and nonspine fractures. Atypical femur fractures (AFFs) located in the subtrochanteric region and diaphysis of the femur have been reported in patients taking BPs and in patients on denosumab, but they also occur in patients with no exposure to these drugs. In this report, we review studies on the epidemiology, pathogenesis, and medical management of AFFs, published since 2010. This newer evidence suggests that AFFs are stress or insufficiency fractures. The original case definition was revised to highlight radiographic features that distinguish AFFs from ordinary osteoporotic femoral diaphyseal fractures and to provide guidance on the importance of their transverse orientation. The requirement that fractures be noncomminuted was relaxed to include minimal comminution. The periosteal stress reaction at the fracture site was changed from a minor to a major feature. The association with specific diseases and drug exposures was removed from the minor features, because it was considered that these associations should be sought rather than be included in the case definition. Studies with radiographic review consistently report significant associations between AFFs and BP use, although the strength of associations and magnitude of effect vary. Although the relative risk of patients with AFFs taking BPs is high, the absolute risk of AFFs in patients on BPs is low, ranging from 3.2 to 50 cases per 100,000 person-years. However, long-term use may be associated with higher risk (∼100 per 100,000 person-years). BPs localize in areas that are developing stress fractures; suppression of targeted intracortical remodeling at the site of an AFF could impair the processes by which stress fractures normally heal. When BPs are stopped, risk of an AFF may decline. Lower limb geometry and Asian ethnicity may contribute to the risk of AFFs. There is inconsistent evidence that teriparatide may advance healing of AFFs.

  4. Two NASA Dryden F/A-18's land on the Edwards Air Force Base runway after completion of an Autonomous

    Science.gov (United States)

    2001-01-01

    Two NASA Dryden F/A-18's land on the Edwards Air Force Base runway after completion of an Autonomous Formation Flight (AFF) mission. The goal of the AFF project is to demonstrate sustained 10 percent fuel savings by the trailing aircraft during cruise flight. Data suggests savings as high as 15 percent are achievable.

  5. Environ: E00410 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available E00410 Homalomena rhizome Homalonemae rhizoma Crude drug Homalomena aff. Sagittaefolia, Homalomena... [TAX:174172] Araceae (arum family) Homalomena aff. sagittaefolia or assortative plants rhizo...me (dried) Crude drugs [BR:br08305] Monocot plants Araceae (arum family) E00410 Homalomena rhizome ...

  6. Genetic Etiology and Clinical Consequences of Cone Disorders

    NARCIS (Netherlands)

    A.A.H.J. Thiadens (Alberta)

    2011-01-01

    textabstractHereditary retinal disorders constitute a large heterogeneous group of diseases in which the photoreceptors are primarily aff ected. When cone cells are aff ected, one cannot see details or perceive color. In this thesis, we focused on the three most important diseases in which the

  7. The relation between attitudes toward functional foods and satisfaction with food-related life

    DEFF Research Database (Denmark)

    Schnettler, Berta; Adasme-Berríos, Cristian; Grunert, Klaus G;

    2016-01-01

    Purpose The purpose of this paper is to assess the effect of attitudes towards functional foods (AFF) on university students’ satisfaction with food-related life (SWFL) and to distinguish student typologies, considering that the AFF are not homogeneous among consumers. Design/methodology/approach...

  8. Atypical femoral fracture in an osteogenesis imperfecta patient successfully treated with teriparatide

    DEFF Research Database (Denmark)

    Holm, Jakob; Eiken, Pia; Hyldstrup, Lars;

    2014-01-01

    OBJECTIVE: We report a case of a successfully healed atypical femoral fracture (AFF) following treatment with teriparatide in a patient with osteogenesis imperfecta (OI). To our knowledge, no successful treatment of AFFs with teriparatide in this subpopulation has ever been described. METHODS...

  9. Experiment list: SRX573031 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available INTS11 || antibody=non-commercial rabbit anti-AFF4 Ref PMID 20159561 || source=IP with non-commercial... || cell line=HeLa || treatment=AFF4 was profiled in a Hela cell clone upon EGF stimulation and depletion of

  10. Experiment list: SRX573028 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ion of INTS11 || antibody=non-commercial rabbit anti-AFF4 Ref PMID 20159561 || source=IP with non-commerci...al rabbit anti-AFF4 Ref PMID 20159561 || sample type=ChIP-seq http://dbarchive.bios

  11. Experiment list: SRX573033 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available INTS11 || antibody=non-commercial rabbit anti-AFF4 Ref PMID 20159561 || source=IP with non-commercial...|| cell line=HeLa || treatment=AFF4 was profiled in a Hela cell clone upon EGF stimulation and depletion of

  12. Experiment list: SRX573029 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available INTS11 || antibody=non-commercial rabbit anti-AFF4 Ref PMID 20159561 || source=IP with non-commercial... || cell line=HeLa || treatment=AFF4 was profiled in a Hela cell clone upon EGF stimulation and depletion of

  13. Genetic Etiology and Clinical Consequences of Cone Disorders

    NARCIS (Netherlands)

    A.A.H.J. Thiadens (Alberta)

    2011-01-01

    textabstractHereditary retinal disorders constitute a large heterogeneous group of diseases in which the photoreceptors are primarily aff ected. When cone cells are aff ected, one cannot see details or perceive color. In this thesis, we focused on the three most important diseases in which the cones

  14. Peri-operative Anesthetic Innovations During Pediatric Cardiac Surgery

    NARCIS (Netherlands)

    T.V. Scohy (Thierry)

    2011-01-01

    textabstractCongenital heart disease (CHD) refers to a series of birth defects that aff ect the heart and thoracic vessels, aff ecting 6 to 8 out of 1,000 babies being born. In 40% of these children no treatment is indicated because of minimal eff ect on hemodynamics and outcome. In 60% treatment

  15. Immunological and virological changes during treatment for hepatitis C virus infections

    NARCIS (Netherlands)

    Arends, J.E.

    2010-01-01

    Chronic HCV aff ects millions of people worldwide with major impact on the morbidity and mortality of the people aff ected. In HCV-infected patients coinfected with HIV, an 156 accelerated progression of liver fi brosis is seen, even with successful suppression of HIV due to combination

  16. Prebiotic potential of Agave angustifolia Haw fructans with different degrees of polymerization.

    Science.gov (United States)

    Velázquez-Martínez, José Rodolfo; González-Cervantes, Rina M; Hernández-Gallegos, Minerva Aurora; Mendiola, Roberto Campos; Aparicio, Antonio R Jiménez; Ocampo, Martha L Arenas

    2014-08-19

    Inulin-type fructans are the most studied prebiotic compounds because of their broad range of health benefits. In particular, plants of the Agave genus are rich in fructans. Agave-derived fructans have a branched structure with both β-(2→1) and β-(2→6) linked fructosyl chains attached to the sucrose start unit with a degree of polymerization (DP) of up to 80 fructose units. The objective of this work was to assess the prebiotic potential of three Agave angustifolia Haw fructan fractions (AFF) with different degrees of polymerization. The three fructan fractions were extracted from the agave stem by lixiviation and then purified by ultrafiltration and ion exchange chromatography: AFF1, AFF2 and AFF3 with high (3-60 fructose units), medium (2-40) and low (2-22) DP, respectively. The fructan profile was determined with high-performance anion exchange chromatography with pulsed amperometric detection (HPAEC-PAD), which confirmed a branched fructan structure. Structural elucidation was performed by Fourier Transform Infra-Red Spectroscopy. The AFF spectrum shows characteristic fructan bands. The prebiotic effect of these fractions was assessed in vitro through fermentation by Bifidobacterium and Lactobacillus strains. Four growth patterns were observed. Some bacteria did not grow with any of the AFF, while other strains grew with only AFF3. Some bacteria grew according to the molecular weight of the AFF and some grew indistinctly with the three fructan fractions.

  17. Prebiotic Potential of Agave angustifolia Haw Fructans with Different Degrees of Polymerization

    Directory of Open Access Journals (Sweden)

    José Rodolfo Velázquez-Martínez

    2014-08-01

    Full Text Available Inulin-type fructans are the most studied prebiotic compounds because of their broad range of health benefits. In particular, plants of the Agave genus are rich in fructans. Agave-derived fructans have a branched structure with both β-(2→1 and β-(2→6 linked fructosyl chains attached to the sucrose start unit with a degree of polymerization (DP of up to 80 fructose units. The objective of this work was to assess the prebiotic potential of three Agave angustifolia Haw fructan fractions (AFF with different degrees of polymerization. The three fructan fractions were extracted from the agave stem by lixiviation and then purified by ultrafiltration and ion exchange chromatography: AFF1, AFF2 and AFF3 with high (3–60 fructose units, medium (2–40 and low (2–22 DP, respectively. The fructan profile was determined with high-performance anion exchange chromatography with pulsed amperometric detection (HPAEC-PAD, which confirmed a branched fructan structure. Structural elucidation was performed by Fourier Transform Infra-Red Spectroscopy. The AFF spectrum shows characteristic fructan bands. The prebiotic effect of these fractions was assessed in vitro through fermentation by Bifidobacterium and Lactobacillus strains. Four growth patterns were observed. Some bacteria did not grow with any of the AFF, while other strains grew with only AFF3. Some bacteria grew according to the molecular weight of the AFF and some grew indistinctly with the three fructan fractions.

  18. Immunological and virological changes during treatment for hepatitis C virus infections

    NARCIS (Netherlands)

    Arends, J.E.

    2010-01-01

    Chronic HCV aff ects millions of people worldwide with major impact on the morbidity and mortality of the people aff ected. In HCV-infected patients coinfected with HIV, an 156 accelerated progression of liver fi brosis is seen, even with successful suppression of HIV due to combination antiretrovir

  19. Determination of Trace Lead in 4Carbonated Drinks by Cloud Point Extraction ﹣ Flame Atomic Absorption Spectrometry(CPE ﹣ AFFS)%浊点萃取﹣火焰原子吸收法(CPE ﹣ AFFS)测定碳酸饮料中痕量铅

    Institute of Scientific and Technical Information of China (English)

    杨葵华; 朱瑶

    2015-01-01

    The cloud Point extraction was used for Preconcentration of the trace lead in carbonated drinks after the formation of a comPlex with 8 ﹣ hydroxyquinoline ethanol in the Presence of surfactant TritonX ﹣ 100,and then the flame atomic absorPtion sPectrometry was aPPlied to determine the content of lead. The affecting condition,in-cluding extraction temPerature and time,PH,dosage of extraction agent and comPlex agent,the amount of satu-rated sodium chloride and ionic strength were oPtimized. The results show that the lead detection limit was 4. 39 ng / mL and the RSD was 7. 4% ,while the recovery was between 98. 7% ~ 99. 7% ,the linear range was 200 ~500 ng / mL at the oPtimum conditions. Ⅰt was revealed that the method is simPle,safe,efficient,agile,and effi-cient.%以8﹣羟基喹啉﹣非离子表面活性剂 TritonX ﹣100为萃取体系测定碳酸饮料中痕量铅的含量.考察了温度、时间、PH 值、8﹣羟基喹啉用量、TritonX ﹣100用量、饱和氯化钠用量、离子强度等因素对萃取效果的影响.结果表明:在最佳条件下测定方法的检测限为4.39 ng/ mL,RSD 为7.4%,回收率在98.7%~99.7%,线性范围为200~500 ng/ mL,结果可靠,为碳酸饮料的质量控制提供参考.

  20. Sincronização fótica e não fótica dos ritmos circadianos em roedores subterrâneos (Ctenomys aff. knighti) e roedores modelo de laboratório (Mus musculus)

    OpenAIRE

    Danilo Eugênio de França Laurindo Flôres

    2016-01-01

    Nosso grupo de pesquisa estuda ritmos circadianos em um roedor subterrâneo do gênero Ctenomys, o tuco-tuco. Nesta tese, apresentarei dados sobre sincronização fótica e não-fótica dos ritmos circadianos em tuco-tucos, e sobre sincronização não-fótica em camundongos. Investigamos a sincronização fótica em tuco-tucos por meio de uma abordagem conjunta de campo e laboratório. Inicialmente medimos o ciclo claro/escuro natural percebido por animais mantidos em áreas cercadas em campo, utilizando ap...

  1. Bisphosphonates and risk of subtrochanteric, femoral shaft, and atypical femur fracture: a systematic review and meta-analysis.

    Science.gov (United States)

    Gedmintas, Lydia; Solomon, Daniel H; Kim, Seoyoung C

    2013-08-01

    Although there is strong evidence that bisphosphonates prevent certain types of osteoporotic fractures, there are concerns that these medications may be associated with rare atypical femoral fractures (AFF). Recent published studies examining this potential association are conflicting regarding the existence and strength of this association. We conducted a systematic review and meta-analysis of published studies examining the association of bisphosphonates with subtrochanteric, femoral shaft, and AFF. The random-effects model was used to calculate the pooled estimates of adjusted risk ratios (RR). Subgroup analysis was performed by study design, for studies that used validated outcome definitions for AFF, and for studies reporting on duration of bisphosphonate use. Eleven studies were included in the meta-analysis: five case-control and six cohort studies. Bisphosphonate exposure was associated with an increased risk of subtrochanteric, femoral shaft, and AFF, with adjusted RR of 1.70 (95% confidence interval [CI], 1.22-2.37). Subgroup analysis of studies using the American Society for Bone and Mineral Research criteria to define AFF suggests a higher risk of AFF, with bisphosphonate use with RR of 11.78 (95% CI, 0.39-359.69) as compared to studies using mainly diagnosis codes (RR, 1.62; 95% CI, 1.18-2.22), although there is a wide confidence interval and severe heterogeneity (I(2)  = 96.15%) in this subgroup analysis. Subgroup analysis of studies examining at least 5 years of bisphosphonate use showed adjusted RR of 1.62 (95% CI, 1.29-2.04). This meta-analysis suggests there is an increased risk of subtrochanteric, femoral shaft, and AFF among bisphosphonate users. Further research examining the risk of AFF with long-term use of bisphosphonates is indicated as there was limited data in this subgroup. The public health implication of this observed increase in AFF risk is not clear.

  2. New records of two spider-parasitoids of the genus Polysphincta (Hymenoptera, Ichneumonidae, Ephialtini from Central Europe, with notes on their host interactions

    Directory of Open Access Journals (Sweden)

    Korenko, Stanislav

    2017-09-01

    Full Text Available A polysphinctine wasp Polysphincta longa, associated with the orb web building spider Araneus angulatus, was recorded for the first time in Slovakia. Further, the congener Polysphincta tuberosa was recorded in association with a new spider host Araneus sturmi. New distribution records of Polysphincta species from the Czech and Slovak Republics are presented. The final stage larva of both, P. longa and P. tuberosa, induced a specific alteration in web architecture: the spider constructed a unique 3D tangle of silk – so called “cocoon web” – to protect the parasitoid during the pupal stage. The host range of wasps belonging to the genus Polysphincta in Europe is discussed.

  3. The relation between attitudes toward functional foods and satisfaction with food-related life

    DEFF Research Database (Denmark)

    Schnettler, Berta; Adasme-Berríos, Cristian; Grunert, Klaus G

    2016-01-01

    Purpose The purpose of this paper is to assess the effect of attitudes towards functional foods (AFF) on university students’ satisfaction with food-related life (SWFL) and to distinguish student typologies, considering that the AFF are not homogeneous among consumers. Design....../methodology/approach A survey was applied to 372 university students (mean age=20.4 years, SD=2.4) in Southern Chile. The questionnaire included the AFF questionnaire and the SWFL scale, questions about consumption and knowledge about functional food (FF) and socio-demographic characteristics. Findings Using confirmatory...

  4. Impending Atypical Femoral Fracture in Patients With Medullary Thyroid Cancer With Skeletal Metastasis Treated With Long-term Bisphosphonate and Denosumab.

    Science.gov (United States)

    Koizumi, Mitsuru; Gokita, Tabu; Toda, Kazuhisa

    2017-02-24

    Atypical femoral fractures (AFFs) occur in osteoporosis patients receiving long-term bisphosphonate. Atypical femoral fractures also occur in cancer patients receiving long-term bisphosphonate or denosumab, but the prevalence is low. We describe a 53-year-old woman with a history of medullary thyroid cancer and skull metastasis who was prescribed bisphosphonate for 6 years and denosumab for 1.5 years, consecutively. Bone scintigraphy performed because of spontaneous groin pain showed uptake in the lateral aspect of the left femur, which was confirmed as impending AFF. In oncological patients receiving long-term bisphosphonate or denosumab, AFF should be included as a differential diagnosis with focal femoral findings.

  5. Primmorphs from seven marine sponges : formation and structure

    NARCIS (Netherlands)

    Sipkema, D.; Wielink, van R.; Lammeren, van A.A.M.; Tramper, J.; Osinga, R.; Wijffels, R.H.

    2003-01-01

    Primmorphs were obtained from seven different marine sponges: Stylissa massa, Suberites domuncula, Pseudosuberites aff. andrewsi, Geodia cydonium, Axinella polypoides, Halichondria panicea and Haliclona oculata. The formation process and the ultra structure of primmorphs were studied. A positive

  6. Miocene to Pleistocene Hipparions of Kenya, Tanzania and Ethiopia

    NARCIS (Netherlands)

    Hooijer, D.A.

    1975-01-01

    CONTENTS Introduction and acknowledgements............ 3 Some notes on working methods............. 5 Species of Hipparion in Africa............. 6 Hipparion primigenium (Von Meyer)............ 12 Hipparion turkanense Hooijer & Maglio........... 19 Hipparion? aff. sitifense Pomel............. 22 The

  7. Drug: D04486 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available e biosynthesis map07047 Osteoporosis drugs Therapeutic category of drugs in Japan [BR:br08301] 3 Agents affe...hate synthetase inhibitor [HSA:2224] [KO:K00787] hsa00900(2224) Terpenoid backbon

  8. Bisphenol A activates EGFR and ERK promoting proliferation, tumor spheroid formation and resistance to EGFR pathway inhibition in estrogen receptornegative inflammatory breast cancer cells

    Science.gov (United States)

    Background: Inflammatory breast cancer (IBC) is a distinct and the deadliest breast cancer variant, which shows a rapid rate of progression and acquired therapeutic resistance. Epidemiological studies suggest that chemical exposure in the environment and consumer products can aff...

  9. On the Geological Age of the Sundyr Faunal Assemblage of Permian Tetrapods from the East European Platform

    Directory of Open Access Journals (Sweden)

    Golubev V.K.

    2015-03-01

    Full Text Available A new Sundyr faunal assemblage of Permian tetrapods was discovered in Eastern Europe. It includes dinocephalians Titanosuchia fam. indet., tapinocephalians aff. Ulemosauridae, anomodontians aff. Suminia, therocephalians, gorgonopians Burnetioidea fam. indet., diapsids ? Eosuchia, chroniosuchians Suchonica vladimiri Golubev, enosuchids aff. Enosuchus, seymouriamorphs Microphon exiguus Ivachnenko and Leptoropha aff. talonophora, batrachomorphs Dvinosaurus sp. The Sundyr assemblage is a transitional one from the Isheevo to Sokolki assemblages. It is described as the last stage of evolution undergone by the dinocephalian community of tetrapods in Eastern Europe. Based on the bio- and magnetostratigraphic data, the beds with Sundyr tetrapod fauna pertain to the lower part of the Upper Severodvinian (= Putyatinian regional stage. These strata were distinguished into a new Suchonica vladimiri tetrapod assemblage zone. In the Sukhona River basin, the beds with Sundyr tetrapod fossils were distinguished into a new Ustpoldarsa Member of the Poldarsa Formation.

  10. Reference: 613 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available of sumoylation and mRNA export in plants and that defects in these processes aff...ect the signaling events of flowering time regulation and additional developmental processes. NUCLEAR PORE A

  11. 76 FR 71371 - James L. Hooper, M.D.; Decision and Order

    Science.gov (United States)

    2011-11-17

    ... suitability to maintain a COR, not the Maryland Board. See Edmund Chein, M.D., 72 FR 6580, 6590 (2007... delegated exclusively to the DEA, not to entities within state government), aff'd, Chein v. DEA, 533...

  12. Primmorphs from seven marine sponges : formation and structure

    NARCIS (Netherlands)

    Sipkema, D.; Wielink, van R.; Lammeren, van A.A.M.; Tramper, J.; Osinga, R.; Wijffels, R.H.

    2003-01-01

    Primmorphs were obtained from seven different marine sponges: Stylissa massa, Suberites domuncula, Pseudosuberites aff. andrewsi, Geodia cydonium, Axinella polypoides, Halichondria panicea and Haliclona oculata. The formation process and the ultra structure of primmorphs were studied. A positive cor

  13. Atypical subtrochanteric and diaphyseal femoral fractures

    DEFF Research Database (Denmark)

    Shane, Elizabeth; Burr, David; Abrahamsen, Bo

    2014-01-01

    Bisphosphonates (BPs) and denosumab reduce the risk of spine and nonspine fractures. Atypical femur fractures (AFFs) located in the subtrochanteric region and diaphysis of the femur have been reported in patients taking BPs and in patients on denosumab, but they also occur in patients...... with no exposure to these drugs. In this report, we review studies on the epidemiology, pathogenesis, and medical management of AFFs, published since 2010. This newer evidence suggests that AFFs are stress or insufficiency fractures. The original case definition was revised to highlight radiographic features...... that distinguish AFFs from ordinary osteoporotic femoral diaphyseal fractures and to provide guidance on the importance of their transverse orientation. The requirement that fractures be noncomminuted was relaxed to include minimal comminution. The periosteal stress reaction at the fracture site was changed from...

  14. Comparative feeding ecology and habitats use of Crenicichla species (Perciformes: Cichlidae in a Venezuelan floodplain river

    Directory of Open Access Journals (Sweden)

    Carmen G. Montaña

    2009-06-01

    Full Text Available Feeding behavior and habitat use of two species of pike cichlids, or mataguaros, (Crenicichla lugubris and C. aff. wallacii were studied in the río Cinaruco, a floodplain river in the Venezuelan llanos. We examined 309 individuals of C. lugubris and 270 individuals of C. aff. wallacii from both the main channel and lagoons throughout the falling-water phase of the annual hydrological cycle. Crenicichla lugubris was common within habitats that contained rocks or woody debris, whereas C. aff. wallacii was more abundant in lagoons than the main channel, especially within shallow areas containing leaf litter. Although we did not capture C. aff. wallacii in rocky shoals, they sometimes were observed in these habitats. Crenicichla lugubris was larger than C. aff. wallacii (198.4 mm and 44.6 mm, respectively. Analysis of stomach contents showed that larger specimens (> 100 mm SL C. lugubris fed mostly on small fishes (e. g. characids, cichlids, but juveniles (O comportamento alimentar e o uso de habitat de duas espécies de "joanas", ou "mataguaros", (Crenicichla lugubris e C. aff. wallacii foram estudados no río Cinaruco, uma planície de alagamento nos llanos Venezuelanos. Examinamos 309 indivíduos de C. lugubris e 270 de C. aff. wallacii do canal principal e lagoas ao longo da fase de vazante de um ciclo hidrológico anual. Crenicichla lugubris foi comum em ambientes que continham rochas, galhos e troncos, enquanto que C. aff. wallacii foi mais abundante em lagoas do que no canal principal, especialmente em áreas rasas contendo folhiço. Embora não tenhamos capturado C. aff. wallacii em cardumes em meio às rochas, em algumas ocasiões eles foram observados nestes ambientes. Crenicichla lugubris foi maior do que C. aff. wallacii (198,4 mm e 44,6 mm CP, respectivamente. Análise dos conteúdos estomacais de C. lugubris revelou que os indivíduos maiores (> 100 mm CP se alimentaram principalmente de peixes pequenos (e. g. caracídeos e cicl

  15. Karyotypic diversity among three species of the genus Astyanax (Characiformes: Characidae).

    Science.gov (United States)

    Nishiyama, P B; Vieira, M M R; Porto, F E; Borin, L A; Portela-Castro, A L B; Santos, I C M

    2016-06-01

    The group Incertae sedis within the Characidae family currently includes 88 genera, previously included in the subfamily Tetragonopterinae. Among them is the genus Astyanax comprising a group of species with similar morphology and widely distributed in the Neotropics. Thus, the present study aimed to analyze the karyotype diversity in Astyanax species from different watersheds by conventional Giemsa staining, C-banding and fluorescence in situ hybridization (FISH rDNA 18S) probe.specimens of Astyanax aff. paranae belonging to the "scabripinnis complex", Astyanax asunsionensis and Astyanax aff. bimaculatus were analyzed". Two sympatric karyomorphs were observed in Astyanax.aff paranae, one of them having2n=48andthe other one with 2n=50 chromosomes. Other population of this same species also presented 2n=50 chromosomes, but differing in the karyotype formula and with macro supernumerary chromosome found in 100% of the cells in about 80%of females analyzed. Two population of A. asuncionensis and one population of Astyanax. aff. bimaculatus, also showed a diploid number of 50 chromosomes, but also differing in their karyotype formulas. Therefore, A. asuncionensis was also characterized by intraspecific chromosome diversity. The C-banding analysis was able to demonstrate a distinctable to demonstrate a distinct pattern of heterochromatin differing A. asuncionensis from Astyanax aff. paranae and Astyanax aff. bimaculatus. The supernumerary chromosome of Astyanax aff. paranae proved completely heterochromatic. Only Astyanax.aff. bimaculatus multiple showed multiple sites of nucleolar organizing regions. The other species were characterized by having a simple system of NOR. These data contributes to the know ledge of the existing biodiversity in our fish fauna, here highlighted by the inter- and intraspecific chromosomal diversity in the genus Astyanax.

  16. Central motor conduction in brachial monomelic amyotrophy

    Directory of Open Access Journals (Sweden)

    Pal Pramod

    2008-01-01

    Full Text Available Background: Prevalence of subclinical involvement of motor pathways in clinically diagnosed Brachial Monomelic Amyotrophy (BMMA is unknown. Aims: To determine the prevalence of subclinical involvement of central motor pathways in BMMA using transcranial magnetic stimulation. Setting and Design: Prospective case-control study. Materials and Methods: Central motor conduction time (CMCT was determined by ′F′ wave method using figure-of-eight coil attached to Magstim 200 stimulator, in 17 patients with BMMA. Motor evoked potentials were recorded from first dorsal interosseous of the affected (AFF and unaffected upper limbs (UNAFF at rest and during partial contraction. Comparison was made with data from 10 healthy controls (CTRL. Statistical Analysis: Descriptive analysis and Analysis of Variance (ANOVA. Results: Compared to controls, the mean CMCT of AFF was significantly prolonged, both at rest and contraction: (a Rest: AFF-6.68±1.78 ms, UNAFF-6.36±1.16 ms, CTRL-5.71±1.02 ms; Fisher′s PLSD for AFF vs. CTRL: P =0.037, (b Contraction: AFF-5.78±1.62 ms, UAFF - 4.86±1.38 ms, CTRL-4.06±0.80 ms; Fisher′s PLSD for AFF vs. CTRL; P =0.0002, AFF vs. UNAFF- P =0.044. Prolonged CMCT (>mean+2SD of controls was observed in 29.4% of AFF and 6.25% of UNAFF at rest, and in 47.1% and 23.5% respectively during contraction. Conclusions: Dysfunction of central motor pathways was observed in both affected and unaffected upper limbs of some patients with BMMA of upper limbs. The dysfunction was more pronounced during voluntary contraction. A larger study is needed to validate the significance of these findings.

  17. Dicty_cDB: Contig-U15795-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ... 60 2e-07 EF527414_1( EF527414 |pid:none) Aspergillus tubingensis strain V-0.....yces hygroscopicus strain... 59 5e-07 EF527413_1( EF527413 |pid:none) Aspergillus aff. tubingensis V-04-... ...00113_4409( CP000113 |pid:none) Myxococcus xanthus DK 1622, com... 59 7e-07 EF527412_1( EF527412 |pid:none) Aspergillus aff. tubinge

  18. Feasibility Study of Shoreline Protection and Lake Level Regulation for Lake Ontario. Reconnaissance Report. Volume II. Appendices.

    Science.gov (United States)

    1981-11-01

    midges) Isopoda, (aquatic sow bug ), Hirudinea (leeches), and Gastropoda (snails) (IJC 1969; Casy, Fisher, Kleveno, 1973). A-2-79 A 0 , 1-a vC C V, a C...also a nondocumented sighting of orange- milkweed (Asclepias tuberosa) (Corps 1975) in this area. It is probable that other protected plants may be

  19. Ethylene production and post-pollination development in Dendrobium flowers treated with foreign pollen

    NARCIS (Netherlands)

    Ketsa, S.; Bunya-Atichart, K.; Doorn, van W.G.

    2001-01-01

    Dendrobium ‘Pompadour’ flowers fade early following pollination. This is associated with increased ethylene production and early epinasty. These effects are also produced by application of 1-aminocyclopropane-1-carboxylic acid (ACC) on the stigma. Pollen (one anther each) from Ruellia tuberosa L. (A

  20. Ethylene production and post-pollination development in Dendrobium flowers treated with foreign pollen

    NARCIS (Netherlands)

    Ketsa, S.; Bunya-Atichart, K.; Doorn, van W.G.

    2001-01-01

    Dendrobium ‘Pompadour’ flowers fade early following pollination. This is associated with increased ethylene production and early epinasty. These effects are also produced by application of 1-aminocyclopropane-1-carboxylic acid (ACC) on the stigma. Pollen (one anther each) from Ruellia tuberosa L.

  1. Dermatologia comparativa Comparative Dermatology

    Directory of Open Access Journals (Sweden)

    Hiram Larangeira de Almeida Jr

    2005-06-01

    Full Text Available Demonstra-se o quadro exuberante dos angiofibromas faciais em paciente do sexo masculino, de 32 anos, com esclerose tuberosa, os quais podem ser comparados com amoras.The impressive facial angiofibromas, from a 32 year-old male paciente, with the classical features of tuberous sclerosis, were compared with mulberries.

  2. Novel synthetic products from the common milkweed (Asclepias syriaca L) and their potential in the rural farm economy

    Science.gov (United States)

    The common milkweed is of the family Asclepiadaceae which comprises over 200 genera and 2500 species including Asclepias syriaca L and its near relatives, A. speciosa and A. tuberosa. Asclepias syriaca, or the common milkweed, is a perennial that is native to the Americas and is so named because of...

  3. Demineralized Bone Matrix Add-On for Acceleration of Bone Healing in Atypical Subtrochanteric Femoral Fracture: A Consecutive Case-Control Study

    Directory of Open Access Journals (Sweden)

    Noratep Kulachote

    2016-01-01

    Full Text Available Background. Delayed union and nonunion are common complications in atypical femoral fractures (AFFs despite having good fracture fixation. Demineralized bone matrix (DBM is a successfully proven method for enhancing fracture healing of the long bone fracture and nonunion and should be used in AFFs. This study aimed to compare the outcome after subtrochanteric AFFs (ST-AFFs fixation with and without DBM. Materials and Methods. A prospective study was conducted on 9 ST-AFFs patients using DBM (DBM group during 2013-2014 and compared with a retrospective consecutive case series of ST-AFFs patients treated without DBM (2010–2012 (NDBM group, 9 patients. All patients were treated with the same standard guideline and followed up until fractures completely united. Postoperative outcomes were then compared. Results. DBM group showed a significant shorter healing time than NDBM group (28.1 ± 14.4 versus 57.9 ± 36.8 weeks, p=0.04. Delayed union was found in 4 patients (44% in DBM group compared with 7 patients (78% in NDBM group (p>0.05. No statistical difference of nonunion was demonstrated between both groups (DBM = 1 and NDBM = 2, p>0.05. Neither postoperative infection nor severe local tissue reaction was found. Conclusions. DBM is safe and effective for accelerating the fracture healing in ST-AFFx and possibly reduces nonunion after fracture fixation. Trial registration number is TCTR20151021001.

  4. Spatial distribution of calcareous dinoflagellate cysts in surface sediments of the Atlantic Ocean between 13 degrees N and 36 degrees S.

    Science.gov (United States)

    Zonneveld; Brune; Willems

    2000-09-01

    To enhance the limited information available about the palaeo-ecological significance of calcareous dinoflagellates, we have studied their lateral distribution in surface sediments of the equatorial and south Atlantic between 13 degrees N and 36 degrees S. Calcareous dinoflagellate cysts appear to be widely distributed throughout the studied area. In the surface sediments, concentrations (cyst per gram dry sediment) of the vegetative stage Thoracosphaera heimii are generally higher than that of the (presumably) calcareous resting cysts. Distribution patterns in surface sediments of Orthopithonella granifera (Fütterer) Keupp and Versteegh, Rhabdothorax spp. Kamptner., Sphaerodinella albatrosiana (Kamptner) Keupp and Versteegh S. albatrosiana praratabulated, Sphaerodinella tuberosa var. 1 (Kamptner) Keupp and Versteegh and S. tuberosa var. 2 and the ratios between these species have been compared with temperature, salinity, density and stratification gradients in the upper water column. Rhabdothorax spp. is characteristically present in sediments of more temperate regions characterized by high seasonality. Dinoflagellates producing these cysts are able to tolerate high nutrient concentrations, and mixing of the water column. S. albatrosiana is abundant in regions characterized by high sea surface temperatures and oligotrophic surface water conditions. In contrast, the distribution of S. tuberosa var. 2 is negatively related to temperature. The other cyst species did not show a characteristic pattern in relation to the studied environmental gradients.The ratio of Sphaerodinella tuberosa var. 2 to Orthopithonella granifera can be used for reconstructing the presence of stratification in the upper 50m of the water column, whereas the ratios of S. tuberosa var. 2 to Sphaerodinella albatrosiana and of O. granifera to Rhabdothorax spp. might be used for palaeotemperature reconstructions. Calcareous dinoflagellate cysts are abundant in oligotrophic areas and may be useful

  5. Atypische niedrig-traumatische Femurfrakturen – Zusammenhang mit Komorbiditäten, internistischen und knochenspezifischen Therapien // Atypical femoral fractures – comorbidities and association with bone-specific therapies

    Directory of Open Access Journals (Sweden)

    Muschitz Ch

    2016-01-01

    Full Text Available iIntroduction:/i Although atypical femoral fractures (AFF are generally rare events, several studies have indicated a potential link between AFF and long-term bone specific therapies (BST. The aim of this study was to analyze the frequency of AFF and potential associations with prior or ongoing BST. iMethods:/i 8.851 caucasian female and male patients with de novo hip fractures treated in the largest Austrian level 1 trauma center from 2000–2013 were selected. iResults:/i 194 patients with a de novo lowtraumatic subtrochanteric/shaft fractures were identified: 35 atypical and 159 typical fractures. Of these patients, concomitant diseases, medication, previous fractures and survival were retrieved and analyzed. Female patients in both groups were significantly older. The median survival was significantly shorter in patients with AFF (9 vs. 18 months; p 0.0001. Cardiovascular disease, sarcopenia, chronic kidney disease, type 2 diabetes, smoking (past or current history and prevalent fragility fractures were more frequent in AFF patients, as well as the concomitant use of phenprocoumon, furosemide, and sulfonylurea. Though the number of patients with current BST was low in (14.5% both groups, more patients in the AFF group were previously treated with BST (71% vs 49%; p = 0.016, and they received these therapies for a longer time period. iDiscussion:/i A combination of severe comorbidities, long-term pharmaceutical therapies and a history of previous or ongoing BST were associated with an increased individual risk for AFF. p bKurzfassung:/b iEinleitung:/i Atypische Femurfrakturen (AFF sind in der Regel seltene Ereignisse; mehrere Studien haben einen möglichen Zusammenhang zwischen AFF und langfristigen knochenspezifischen Therapien (KST angegeben. Das Ziel dieser Studie war es, die Häufigkeit der AFF und potentielle Assoziationen mit früheren oder laufenden KST zu analysieren. iMethoden:/i Analyse von 8.851 kaukasischen weiblichen und m

  6. Microindentation for in vivo measurement of bone tissue material properties in atypical femoral fracture patients and controls.

    Science.gov (United States)

    Güerri-Fernández, Roberto C; Nogués, Xavier; Quesada Gómez, José M; Torres Del Pliego, Elisa; Puig, Lluís; García-Giralt, Natalia; Yoskovitz, Guy; Mellibovsky, Leonardo; Hansma, Paul K; Díez-Pérez, Adolfo

    2013-01-01

    Atypical femoral fractures (AFF) associated with long-term bisphosphonates (LTB) are a growing concern. Their etiology is unknown, but bone material properties might be deteriorated. In an AFF series, we analyzed the bone material properties by microindentation. Four groups of patients were included: 6 AFF, 38 typical osteoporotic fractures, 6 LTB, and 20 controls without fracture. Neither typical osteoporotic fractures nor controls have received any antiosteoporotic medication. A general laboratory workup, bone densitometry by dual-energy X-ray absorptiometry (DXA), and microindentation testing at the tibia were done in all patients. Total indentation distance (Total ID), indentation distance increase (IDI), and creep indentation distance (Creep ID) were measured (microns). Age-adjusted analysis of covariance (ANCOVA) was used for comparisons. Controls were significantly younger than fracture groups. Bisphosphonate exposure was on average 5.5 years (range 5 to 12 years) for the AFF and 5.4 years (range 5 to 8 years) for the LTB groups. Total ID (microns) showed better material properties (lower Total ID) for controls 36 (± 6; mean ± SD) than for AFF 46 (± 4) and for typical femoral fractures 47 (± 13), respectively. Patients on LTB showed values between controls and fractures, 38 (± 4), although not significantly different from any of the other three groups. IDI values showed a similar pattern 13 (± 2), 16 (± 6), 19 (± 3), and 18 (± 5). After adjusting by age, significant differences were seen between controls and typical (p Creep ID between groups. Our data suggest that patients with AFF have a deep deterioration in bone material properties at a tissue level similar to that for the osteoporotic fracture group. The LTB group shows levels that are in between controls and both type of fractures, although not statistically different. These results suggest that bisphosphonate therapy probably does not put the majority of patients at risk

  7. OBTENCIÓN DE CEPAS Y PRODUCCIÓN DE INÓCULO DE CINCO ESPECIES DE HONGOS SILVESTRES COMESTIBLES DE ALTA MONTAÑA EN EL CENTRO DE MÉXICO

    Directory of Open Access Journals (Sweden)

    Yolanda Arana-Gabriel

    2014-01-01

    Full Text Available Se obtuvieron cepas de Psathyrella spadicea , Floccularia aff. luteovirens , Clitocybe squamulosa , Flammulina mexicana y Lyophyllum aff. shimeji , cuyos esporomas son recolectados y consumi - dos por habitantes del Nevado de Toluca, México. Las cepas se estudiaron in vitro en seis medios de cultivo (ACP: Agar croquetas de perro, AM: Agar maíz, PDA-PL: Agar papa dextrosa-pepto - na y levadura, EMA-PL: Agar extracto de malta-peptona y levadura, PDA y EMA a 18 °C y 25 °C. Las especies se desarrollaron satisfactoriamente a 18 °C , siendo F. mexicana y L . aff. shimeji las que tuvieron mayor velocidad de crecimiento y producción de biomasa. Flammulina mexicana solo se desarrolló a 18 °C, presentando mayor crecimiento y producción de biomasa en ACP. La cepa de L. aff. shimeji creció a 18 y 25 °C, la mayor velocidad de crecimiento se registró en medio PDA a 18 °C y la mayor producción de biomasa en EMA-PL a 18 °C. Considerando las mejores condiciones para el desarrollo de micelio in vitro, se produjo inóculo primario de F. mexicana y L . aff. shimeji en trigo y sorgo. La mayor densidad del micelio y porcentaje de grano cubierto se obtuvieron con el sustrato de trigo.

  8. Collaborative design and use of an agency feedback form for student clinical practicum experience in community/public health nursing.

    Science.gov (United States)

    Reilly, Janet Resop; Collier, Jill; Edelstein, Janice; Vandenhouten, Chris; Hovarter, Rebecca; Hansen, Judith M; Stewart, Stephanie; Turner, Mary Jo

    2012-01-01

    Evaluation of students in community and public health (C/PH) nursing clinical practica is a challenge, especially when preceptors are expected to evaluate students from different academic nursing programs. The need for a standardized student evaluation tool was identified during federally funded collaborative meetings held between C/PH academic and practice partners in Northeastern Wisconsin. This article focuses on the development and appraisal of the standardized Agency Feedback Form (AFF) for Student Practicum Experience in Community/Public Health Nursing, which was designed to meet the identified need. Four baccalaureate nursing programs implemented the AFF for 3 purposes: (1) to provide a consistent and easy evaluation form for preceptors to complete; (2) to communicate useful information about students' individual professional behaviors observed during practicum; and (3) to increase students' and preceptors' understanding of the population-based nursing interventions, using the Public Health Intervention Wheel. Future uses and implications of the AFF are also discussed.

  9. Chromosome counts of some Zingiberaceous species from Thailand

    Directory of Open Access Journals (Sweden)

    Ladda Eksomtramage

    2002-04-01

    Full Text Available The data on chromosome numbers of 22 species belonging to 10 genera of Zingiberaceae distributed in Thailand were investigated. The somatic numbers range from 20 to 48 showing diploidy and polyploidy. Ten of these species are firstly reported here, i.e. Alpinia purpurata (Vielli K. Schum. (2n = 48, Boesenbergia aff. rotunda (2n = 20, Cornukaempferia aurantiflora J. Mood & K. Larsen (2n = 46, Curcuma aff. oligantha Trimen (2n = 42, C. rhabdota Sirirugsa & M.F. Newman (2n = 24, Etlingera elatior (Jack. R.M. Smith (white form (2n = 48, E. hemisphaerica (Bl. R.M. Smith (2n = 48, Hedychium gomezianum Wall. (2n = 34, H. longicornutum Bak. (2n = 34 and Zingiber aff. wrayi (2n = 22

  10. Prototypframställning för tidrapportering i Oracle E-Business Suite R12

    OpenAIRE

    Chau, Nikki

    2012-01-01

    Detta examensarbete har genomförts på företaget Navigate Consulting Business Solutions AB, ett konsultbolag som erbjuder tjänster inom affärssystem, såsom val av affärssystemslösning, implementering och förvaltning. Företaget vill utöka sitt framtida affärssystem, Oracle E-Business Suite R12, genom att lägga till tidrapporteringsmodulen Oracle Time and Labor. För att ta reda på om tidsrapporteringsmodulen möter verksamhetens krav och förväntningar är det nödvändigt att företaget får en uppfat...

  11. Construct Failure in an Atypical Femoral Fracture treated with Intramedullary Nailing: A Case Report

    Directory of Open Access Journals (Sweden)

    L Bonifacio

    2014-03-01

    Full Text Available The aim of this paper is to document a rare case of construct failure in a 68-year old Filipina who sustained an atypical femoral fracture (AFF in her left subtrochanteric area. The patient previously had a 40-month history of alendronate 70mg + vitamin D 5600u therapy for osteoporosis and underwent closed intramedullary nailing for the AFF. Six months postoperatively, she began to experience progressive pain in her operated thigh. Radiographs revealed a broken nail at the proximal screw hole and non-union of the AFF. The patient was treated with exposure of the fracture site, removal of the broken device, exchange intramedullary nailing, and iliac bone grafting. She had radiographic and clinical union and was full weight bearing after three months.

  12. Nanometric Finishing on Biomedical Implants by Abrasive Flow Finishing

    Science.gov (United States)

    Subramanian, Kavithaa Thirumalai; Balashanmugam, Natchimuthu; Shashi Kumar, Panaghra Veeraiah

    2016-01-01

    Abrasive flow finishing (AFF) is a non-conventional finishing technique that offers better accuracy, efficiency, consistency, economy in finishing of complex/difficult to machine materials/components and provides the possibility of effective automation as aspired by the manufacturing sector. The present study describes the finishing of a hip joint made of ASTM grade Co-Cr alloy by Abrasive Flow Machining (AFM) process. The major input parameters of the AFF process were optimized for achieving nanometric finishing of the component. The roughness average (Ra) values were recorded during experimentation using surface roughness tester and the results are discussed in detail. The surface finished hip joints were characterized using Scanning Electron Microscopy (SEM), Atomic Force Microscopy (AFM) and residual stress analysis using X-Ray Diffraction (XRD). The discussion lays emphasis on the significance, efficacy and versatile nature of the AFF process in finishing of bio-medical implants.

  13. Assessing Installation Ethnobotanical Resources Using Land Condition Trend Analysis (LCTA) Data: A Fort Riley, Kansas, Case Study

    Science.gov (United States)

    1998-07-01

    incarnata S F Carya illinoensis G L Asclepias stenophylla S B Ceanothus herbaceus S B Asclepias syriaca S B Ceanothus oliganthus S L Asclepias tuberosa S...cannabinum S B Carex retroflexa G F Argemone polyanthemos S F Carex vulpinoidea S F Artemisia ludoviciana S B Carya cordiformis S B Asclepias...longipilum G B Descurainia pinnata S F Hordeum pusillum G F Descurainia sophia S F Hymenopappus scabiosaeus G B Desmanthus illinoensis S B Hypericum

  14. Nature, source and composition of volcanic ash in sediments from a fracture zone trace of Rodriguez Triple Junction in the Central Indian Basin

    Digital Repository Service at National Institute of Oceanography (India)

    Mascarenhas-Pereira, M.B.L.; Nath, B.N.; Borole, D.V.; Gupta, S.M.

    the biostratigraphic and radiochemical methods. While the fossil zonations of radiolarian assemblages were used for biostratigraphic dating, excess 230Th method (230Th excess portion of the 230Th that is not supported by the decay of 234U in the sediments... was datable biostratigraphically, since the deeper section was devoid of radiolarians. This section contained two late Quaternary radiolarian index fossils 1) Buccinosphaera invaginata (Haeckel) and 2) Collosphaera tuberosa (Haeckel). Among them, B...

  15. [Control of epilepsy in adult patients with tuberous sclerosis].

    Science.gov (United States)

    Gallardo-Tur, Alejandro; García-Martín, Guillermina; Chamorro-Muñoz, María Isabel; Romero-Godoy, Jorge; Romero-Acebal, Manuel

    2013-06-01

    Introduccion. La esclerosis tuberosa es una enfermedad genetica cuyas manifestaciones principales son la formacion de tumores neuroectodermicos, que asocia epilepsia secundaria muy frecuentemente. Objetivo. Describir el perfil epileptico, el control, la frecuencia de crisis y la efectividad del tratamiento en pacientes adultos con esclerosis tuberosa. Pacientes y metodos. Estudio descriptivo en el que se han incluido pacientes adultos (mayores de 14 anos) con diagnostico confirmado de esclerosis tuberosa. Se ha analizado la frecuencia y tipos de crisis. Se ha realizado un estudio y contabilizacion de los diferentes farmacos antiepilepticos en cada paciente, la frecuencia de uso de cada principio activo y un estudio comparativo entre control de crisis y tipo de terapia. Resultados. De 19 adultos estudiados, tuvieron crisis epilepticas 16 (84%). Presentaron control de crisis completo, crisis esporadicas y crisis frecuentes el 44%, 25% y 31%, respectivamente. Hubo frecuencia de crisis focales, generalizadas y ambas en el 38%, 6% y 25%, respectivamente. Estaban en tratamiento con farmacos antiepilepticos en monoterapia, biterapia y triterapia el 38%, 44% y 19%, respectivamente. El mas consumido globalmente fue el levetiracetam, seguido de la carbamacepina y el acido valproico. En monoterapia, el mas frecuente fue la carbamacepina, con mayor proporcion de control completo. Conclusiones. La epilepsia en la esclerosis tuberosa es relativamente benigna, y se consigue un aceptable control en la mayoria de casos con un numero de antiepilepticos acorde con lo aconsejado en las guias de tratamiento. Se observa estabilidad de lesiones, y no hay malignizacion en nuestra serie. El bajo numero de la muestra limita el estudio, pero se observan proporciones similares de efectividad del tratamiento respecto a otra serie publicada.

  16. Mosquito larvicidal potential of four common medicinal plants of India

    OpenAIRE

    Anjali Rawani; Anupam Ghosh; Goutam Chandra

    2014-01-01

    Background & objectives: Mosquitoes transmit serious human health diseases, causing millions of deaths every year. Plants may be sources of alternative mosquito control agents. The present study was carried out to assess the role of larvicidal activities of the crude extracts of four plants viz. Alternanthera sessilis L. (Amaranthaceae), Trema orientalis L. (Cannabaceae), Gardenia carinata Smith. (Rubiaceae) and Ruellia tuberosa L. (Acanthaceae) against Culex quinquefasciatus Say in laborator...

  17. The Multileveled Regulation of the Human Cholinesterase Genes and Their Protein Products

    Science.gov (United States)

    1993-09-30

    present in all members of the Solanua plant family, including Solanin tuberosa (potatoes), and are likely to be present in extremely high and toxic ...and solanine -derived alkaloids 120 33. Conservation of substrate specificity and loss of substrate activation in AChE-BuChE chimera 121 34. Inhibition...for inhibition of the insect enzyme, with particular emphasis on low toxicity to humans. In addition, cholinesterase (ChZ) inhibitors are employed

  18. Effect of alcohol fermented feed on lactating performance, blood metabolites, milk Fatty Acid profile and cholesterol content in holstein lactating cows.

    Science.gov (United States)

    Li, X Z; Park, B K; Yan, C G; Choi, J G; Ahn, J S; Shin, J S

    2012-11-01

    A feeding experiment with 40 lactating Holstein cows and 4 dietary treatments was conducted to investigate supplementation with different levels of alcohol fermented feed to the TMR on lactating performance, blood metabolites, milk fatty acid profile and cholesterol concentration of blood and milk. Forty Holstein lactating cows (106±24 d post-partum; mean±SD) were distributed into four groups and randomly assigned to one of four treatments with each containing 10 cows per treatment. The treatment supplemented with TMR (DM basis) as the control (CON), and CON mixed with alcohol-fermented feeds (AFF) at a level of 5%, 10% and 15% of the TMR as T1, T2 and T3, respectively. Dry matter intake and milk yield were not affected by supplementation of AFF. An increased 4% FCM in the milk occurred in cows fed T3 diet compared with CON, while T1 and T2 diets decreased 4% FCM in a dose dependent manner. Supplementation of AFF increased the concentration of albumin, total protein (TP), ammonia, and high density lipoprotein-cholesterol in serum compared with CON. In contrast, supplementation with AFF clearly decreased concentration of blood urea nitrogen (BUN) and total cholesterol (TC) compare with CON. AFF supplementation increased the proportion of C18:1n9 and C18:2n6 compared to CON. A decrease in the concentration of saturated fatty acid (SFA) for T1, T2 and T3 resulted in an increased unsaturated fatty acid (USFA) to SFA ratio compared to CON. Concentration of cholesterol in milk fat was reduced in proportion to the supplemental level of AFF. Feeding a diet supplemented with a moderate level AFF to lactating cows could be a way to alter the feed efficiency and fatty acid profile of milk by increasing potentially human consumer healthy fatty acid without detrimental effects on feed intake and milk production. A substantially decreased cholesterol proportion in milk induced by supplementation AFF suggests that alcohol fermented feed may improve milk cholesterol levels

  19. THE TRACE SPACE INVARIANT AND UNITARY GROUP OF C*-ALGEBRA

    Institute of Scientific and Technical Information of China (English)

    方小春

    2003-01-01

    Let A be a unital C*-algebra, n ∈ N ∪ {∞}. It is proved that the isomorphism △n :Un0(A)/DUn0(A) → AffT(A)/△n0(π1(Un0(A))) is isometric for some suitable distances. Asan application, the author has the split exact sequence 0 → AffT(A)/△n0(π1(Un0(A))) iA→Un(A)/DUn(A) πA→ Un(A)/Un0(A) → 0 with iA contractive (and isometric if n = ∞) under certain condition of A.

  20. Syrebrist och ambulansfärd av tårta

    DEFF Research Database (Denmark)

    Hedlund, Frank Huess

    2016-01-01

    En 58-årig affärsresenär kom till akutmottagningen i ambulans med andnöd, yrsel och illamående. Detta och andra fall/tillbud visar att man ska ha respekt för koldioxid.......En 58-årig affärsresenär kom till akutmottagningen i ambulans med andnöd, yrsel och illamående. Detta och andra fall/tillbud visar att man ska ha respekt för koldioxid....

  1. Sperm ultrastructure in three different families of weakly electric fishes (Teleostei: Gymnotiformes

    Directory of Open Access Journals (Sweden)

    Júlia Giora

    Full Text Available This study presents details of sperm ultrastructure for Gymnotus aff. carapo (Gymnotidae, Eigenmannia trilineata (Sternopygidae, and three Brachyhypopomus species (B. draco, B. bombilla, and B. gauderio - Hypopomidae from southern Brazil. Differences were found among the representatives of the different families. For example, nuclear rotation was present in E. trilineata and in the Brachyhypopomus species, but absent in Gymnotus aff. carapo, and the presence of flagellar fins was only observed in E. trilineata. Some intraspecific variations could also be noticed among the Brachyhypopomus species analyzed. Most of the characters found in the spermatozoa of the species studied herein are shared with species of Gymnotiformes previously analyzed.

  2. Effect of Alcohol Fermented Feed on Lactating Performance, Blood Metabolites, Milk Fatty Acid Profile and Cholesterol Content in Holstein Lactating Cows

    Directory of Open Access Journals (Sweden)

    X. Z. Li

    2012-11-01

    Full Text Available A feeding experiment with 40 lactating Holstein cows and 4 dietary treatments was conducted to investigate supplementation with different levels of alcohol fermented feed to the TMR on lactating performance, blood metabolites, milk fatty acid profile and cholesterol concentration of blood and milk. Forty Holstein lactating cows (106±24 d post-partum; mean±SD were distributed into four groups and randomly assigned to one of four treatments with each containing 10 cows per treatment. The treatment supplemented with TMR (DM basis as the control (CON, and CON mixed with alcohol-fermented feeds (AFF at a level of 5%, 10% and 15% of the TMR as T1, T2 and T3, respectively. Dry matter intake and milk yield were not affected by supplementation of AFF. An increased 4% FCM in the milk occurred in cows fed T3 diet compared with CON, while T1 and T2 diets decreased 4% FCM in a dose dependent manner. Supplementation of AFF increased the concentration of albumin, total protein (TP, ammonia, and high density lipoprotein-cholesterol in serum compared with CON. In contrast, supplementation with AFF clearly decreased concentration of blood urea nitrogen (BUN and total cholesterol (TC compare with CON. AFF supplementation increased the proportion of C18:1n9 and C18:2n6 compared to CON. A decrease in the concentration of saturated fatty acid (SFA for T1, T2 and T3 resulted in an increased unsaturated fatty acid (USFA to SFA ratio compared to CON. Concentration of cholesterol in milk fat was reduced in proportion to the supplemental level of AFF. Feeding a diet supplemented with a moderate level AFF to lactating cows could be a way to alter the feed efficiency and fatty acid profile of milk by increasing potentially human consumer healthy fatty acid without detrimental effects on feed intake and milk production. A substantially decreased cholesterol proportion in milk induced by supplementation AFF suggests that alcohol fermented feed may improve milk cholesterol

  3. Aerial organ anatomy of Smilax syphilitica (Smilacaceae

    Directory of Open Access Journals (Sweden)

    João Marcelo Silva

    2012-09-01

    Full Text Available Smilax L. in Brazil is represented by 32 taxa and it is a taxonomically difficult genus because the plants are dioecious and show wide phenotypic variation. The analysis and use of leaf anatomy characters is recognized as a frequently successful taxonomic method to distinguish between individual taxon, when floral material is absent or minute differences in flowers and foliage exist such as in Smilax. The aim of this study was to characterize the anatomical features of the aerial organs in Smilax syphilitica collected from the Atlantic Rainforest, in Santa Teresa-ES and the Smilax aff. syphilitica from the Amazon Rainforest, in Manaus, Brazil. For this, a total of three samples of Smilax were collected per site. Sample leaves and stems were fixed with FAA 50, embedded in historesin, sectioned on a rotary microtome, stained and mounted in synthetic resin. Additionally, histochemical tests were performed and cuticle ornamentation was analyzed with standard scanning electron microscopy. S. syphilitica and S. aff. syphilitica differed in cuticle ornamentation, epidermal cell arrangement and wall thickness, stomata type and orientation, calcium oxalate crystal type, and position of stem thorns. Leaf blades of S. syphilitica from the Amazon Rainforest have a network of rounded ridges on both sides, while in S. aff. syphilitica, these ridges are parallel and the spaces between them are filled with numerous membranous platelets. Viewed from the front, the epidermal cells of S. syphilitica have sinuous walls (even more pronounced in samples from the Amazon; while in S. aff. syphilitica, these cells are also sinuous but elongated in the cross-section of the blade and arranged in parallel. Stomata of S. syphilitica are paracytic, whereas in S. aff. syphilitica, are both paracytic and anisocytic, and their polar axes are directed towards the mid-vein. Calcium oxalate crystals in S. syphilitica are prisms, whereas in S. aff. syphilitica, crystal sand. Thorns

  4. Investment decisions under uncertainties: a case of nuclear power plants

    NARCIS (Netherlands)

    Jain, S.

    2014-01-01

    This thesis discusses the role of flexibility of decisions when investing in projects that are affected by economic uncertainties. It uses the theory of real options to value such investment decisions. The thesis focuses on investment decisions related to nuclear power plants, which usually are aff

  5. Rural Utopi i Urban Tidsalder

    DEFF Research Database (Denmark)

    Bagger-Petersen, Mai Corlin

    2015-01-01

    Den kinesiske filmskaber, redaktør, kurator og kunstner Ou Ning udformede i 2010 notesbogen Hvordan man laver sin egen utopi; en forestilling om en intellektuel genoplivning af et tabt, ruralt fællesskab i landsbyen Bishan i den østlige del af Centralkina. Notesbogen er et montageværk, som afføde...

  6. Influenza Vaccination in dutch Nursing Homes: is tacit consent morally justified?

    NARCIS (Netherlands)

    Verweij, M.F.; Hoven, M.A. van den

    2005-01-01

    Objectives: Efficient procedures for obtaining informed (proxy) consent may contribute to high influenza vaccination rates in nursing homes. Yet are such procedures justified? This study’s objective was to gain insight in informed consent policies in Dutch nursing homes; to assess how these may affe

  7. Efficacy of early controlled motion of the ankle compared with no motion after non-operative treatment of an acute Achilles tendon rupture

    DEFF Research Database (Denmark)

    Barfod, Kristoffer Weisskirchner; Hansen, Maria Swennergren; Holmich, Per;

    2016-01-01

    BACKGROUND: Early controlled ankle motion is widely used in the non-operative treatment of acute Achilles tendon rupture, though its safety and efficacy have never been investigated in a randomized setup. The objectives of this study are to investigate if early controlled motion of the ankle affe...

  8. Characterization of Poly(A)-Protein Complexes Isolated from Free and Membrane-Bound Polyribosomes of Ehrlich Ascites Tumor Cells

    NARCIS (Netherlands)

    Janssen, Dick B.; Counotte-Potman, Anda D.; Venrooij, Walther J. van

    1976-01-01

    Proteins present in messenger ribonucleoprotein particles were labeled with [35S]-methionine in Ehrlich ascites tumor cells in which synthesis of new ribosomes was inhibited. Poly(A)-protein complexes were isolated from free and membrane-bound polyribosomes by sucrose gradient centrifugation and aff

  9. 78 FR 73424 - Retirement of Requirements in Reliability Standards

    Science.gov (United States)

    2013-12-06

    ...,062, order on reh'g and compliance, 117 FERC ] 61,126 (2006), aff'd sub nom. Alcoa Inc. v. FERC, 564 F...\\ 18 CFR 380.4(a)(2)(ii) (2013). V. Regulatory Flexibility Act 35. The Regulatory Flexibility Act of... modify a possible for DSM standard. to meet equivalent requirements as conventional generators...

  10. Yeast Interacting Proteins Database: YPL203W, YIL033C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available ected by(YPD) - Interologs 1 Expression similarity (BRITE) - Alternative path with ...iation (0 or 1,YPD) 0 Complex (0 or 1,YPD) 1 Synthetic lethality (0 or 1,YPD) 0 Co-induced by (YPD) - Co-repressed by (YPD) - Not aff

  11. Yeast Interacting Proteins Database: YIL053W, YPL201C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available ation (0 or 1,YPD) 0 Complex (0 or 1,YPD) 0 Synthetic lethality (0 or 1,YPD) 0 Co-induced by (YPD) - Co-repressed by (YPD) - Not affe...cted by(YPD) - Interologs - Expression similarity (BRITE) - Alternative path with 1

  12. Effects of facial hard tissue surgery on facial aesthetics: changes in facial content and frames.

    Science.gov (United States)

    Choi, Jin-Young; Lee, Sang-Hoon; Baek, Seung-Hak

    2012-11-01

    Aesthetic units of the face can be divided into facial content (FC; eyes, nose, lips, and mouth), anterior facial frame (AFF; a contour line from the trichion, the temporal line of the frontal bone, the lateral orbital rim, the most lateral line of the anterior part of the zygomatic body, the anterior border of the masseter muscle, to the inferior border of the chin), and posterior facial frame (PFF; a contour line from the hairline, the zygomatic arch, to the ramus and gonial angle area of the mandible). The size and shape of each FC and the balance and proportion between FCs create a unique appearance for each person. The facial form can be determined through the combination of AFF and PFF. In the Asian population, clinicians frequently encounter problems of FC (eg, acute nasolabial angle, protrusive and everted lips, nonconsonant lip line, or lip canting), AFF (eg, midface hypoplasia, protrusive and asymmetric chin, vertical deficiency/excess of the anterior maxilla and symphysis, or prominent zygoma), and PFF (eg, square mandibular angle). These problems can be efficiently and effectively corrected through the combination of hard tissue surgery such as anterior segmental osteotomy, genioplasty, mandibular angle reduction, malarplasty, and orthognathic surgery. Therefore, the purposes of this article were to introduce the concepts of FC, AFF, and PFF, and to explain the effects of facial hard tissue surgery on facial aesthetics.

  13. Experiment list: SRX823728 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available rep2; Mus musculus; ChIP-Seq source_name=ES cell culture || strain=TC1 || cell type=mouse embryonic stem cell || antibody=Aff3 (Homem...ade#182) http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/eachData/bw/SRX823728.bw ht

  14. Experiment list: SRX823727 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available rep1; Mus musculus; ChIP-Seq source_name=ES cell culture || strain=TC1 || cell type=mouse embryonic stem cell || antibody=Aff3 (Homem...ade#182) http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/eachData/bw/SRX823727.bw ht

  15. 76 FR 55300 - Companies Engaged in the Business of Acquiring Mortgages and Mortgage-Related Instruments

    Science.gov (United States)

    2011-09-07

    ... Republican congressman from California, is suing the Carlyle Group and its co-founder, David Rubenstein, over... equity. See SEC v. Patrick Quinlan, 2008 Fed. Sec. L. Rep. (CCH) ] 95,005 (E.D. Mich. Nov. 7, 2008), aff... Senate Comm. on Banking and Currency on S. 3580, 76th Cong., 3d. at 182 (1940) (statement of...

  16. What is the importance of open habitat in a predominantly closed forest area to the dung beetle (Coleoptera, Scarabaeinae assemblage?

    Directory of Open Access Journals (Sweden)

    Fábio C. Costa

    2013-09-01

    Full Text Available What is the importance of open habitat in a predominantly closed forest to the dung beetle assemblage? The Atlantic Forest in Brazil is one of the most highly disturbed ecosystems and is mainly represented by fragmented areas. However, in places where human disturbances have ceased, certain areas are showing a natural regeneration pattern. The aim of the present study was to determine how the dung beetle assemblage responds to distinct habitat structures in a fragment of Atlantic Forest. For such, open and closed forest areas were sampled in a fragment of the Atlantic Forest in the northeastern region of Brazil. Pitfall traps baited with excrement and carrion were used to collect the beetles. A total of 7,267 individuals belonging to 35 species were captured. Canthon chalybaeus and C. mutabilis were restricted to open areas. Nearly 90% of the individuals of C. aff. simulans and Deltochilum aff. irroratum were identified in these areas. A higher percentage (> 50% of Canthon staigi, Dichotomius aff. depressicolis and D. aff. sericeus occurred in closed areas. Abundance differed between areas, with higher values in closed areas. Richness was not influenced by the habitat structure. NMDS ordination exhibited the segregation of areas and ANOSIM confirmed that this variable explained the assemblage of dung beetle species. The findings of the present study validate that open areas are associated to more restrictive conditions, limiting a higher abundance of dung beetle. Although situated near preserved fragments, the studied open areas increase the heterogeneity of the general landscape.

  17. Prevalence of Batrachochytrium dendrobatidis in a Nicaraguan, micro-endemic Neotropical salamander, Bolitoglossa mombachoensis

    NARCIS (Netherlands)

    Stark, Tariq; Laurijssens, Carlijn; Weterings, Martijn; Martel, An; Köhler, Gunther; Pasmans, Frank

    2017-01-01

    Amphibians are the most threatened terrestrial vertebrates on the planet and are iconic in the global biodiversity crisis. Their global decline caused by the fungal agent Batrachochytrium dendrobatidis (Bd) is well known. Declines of Mesoamerican salamanders of the family Plethodontidae, mainly affe

  18. Entering behavior of Gasteruption brachychaetum Schrottky (Hymenoptera, Gasteruptiidae into a nest of Hylaeus Fabricius (Hymenoptera, Colletidae Comportamento de entrada de Gasteruption brachychaetum Schrottky (Hymenoptera, Gasteruptiidae em um ninho de Hylaeus Fabricius (Hymenoptera, Colletidae

    Directory of Open Access Journals (Sweden)

    Antonio Carlos Cruz Macedo

    2012-09-01

    Full Text Available Nests of Hylaeus aff. guaraniticus (Schrottky, 1906 were parasited by females of Gasteruption brachychaetum Schrottky, 1906 in trap nests in São Paulo (Brazil. This is thefirst host record of a Gasteruptiidae in the Neotropical Region. The behavior of a G.brachychaetum female entering a host's nest is described as follows: an inquiline female hovered near the host's nest, landed and detected that a female of H. aff. guaraniticus was inside the nest, waited for the host female to fly out, entered backwards into the nest, remained there for almost six minutes, and then went out the nest. The development time of immature stages of G.brachychaetum varied between 16 and 299 days.Ninhos de Hylaeus aff. guaraniticus (Schrottky, 1906foram parasitados por fêmeas de Gasteruption brachychaetum Schrottky, 1906 em ninhos-armadilha em São Paulo (Brasil. Este é o primeiro registro de hospedeiro de um Gasteruptiidae na região Neotropical. O comportamento de uma fêmea entrando no ninho do hospedeiro é descrito: a fêmea inquilina pairou sobre o ninho do hospedeiro, pousou e detectou que a fêmea de H. aff. guaraniticus estava dentro do ninho, esperou a fêmea hospedeira voar para fora do ninho, entrou de costas no ninho, permanecendo no local por quase seis minutos, em seguida, partiu voando. O tempo de desenvolvimento dos imaturos de G.brachychaetum variou entre 16 e 229 dias.

  19. Når det private bliver offentligt …

    DEFF Research Database (Denmark)

    Bonde, Karin Kjærgaard

    Titel: Når det private bliver offentligt… Baggrund: Sygeplejestuderende finder det svært at indsamle data gennem samtale og observation af patienters udskillelse af afføring, og at hjælpe patienter med toiletbesøg og nedre toilette. At kunne anlægge et patientperspektiv er beskrevet som en kompeten...... meningskondensering. Resultater: Informanterne opfatter afføring som noget meget privat, der bevirker flov-hed. Det er informanternes ønske, at sygeplejersker møder dem med naturlighed. At have brug for hjælp bevirker oplevelse af afhængighed, at være til besvær og at blive tingsliggjort. Informanterne har oplevet...... at få både engageret og distanceret hjælp, og at få hjælp uden forudgående øjenkontakt og information. Konklusion: Den dominerende flovhed og opfattelsen af afføring som noget privat kan på baggrund af forskning forstås som udtryk for at afføring er tabu. For at sygeplejer-sken kan agere med naturlighed...

  20. Ukarakteristiske symptomer hos patienter med debut af kolorektal cancer i almen praksis

    DEFF Research Database (Denmark)

    Juul, Jakob Søgaard; Vedsted, Peter

    2012-01-01

    symptomer, og disse omfatter fx lav blodprocent, vekslende afføring, maveproblemer, træthed og vægttab. En kommende screeningskampagne vil identificere en række af disse tumorer tidligere i forløbet, men stadig skal 75 % af alle tyktarmscancere skulle diagnosticeres vha. symptomer og den praktiserende læge...

  1. Connecting the family with awareness systems

    NARCIS (Netherlands)

    Romero, N.; Markopoulos, P.; Baren, J. van; Ruyter, B.E.R. de; IJsselsteijn, W.A.; Farshchian, B.

    2007-01-01

    Awareness systems have attracted significant research interest for their potential to support interpersonal relationships. Investigations of awareness systems for the domestic environment have suggested that such systems can help individuals stay in touch with dear friends or family and provide affe

  2. Differential induction of total IgE by two Salmonella enterica serotypes

    DEFF Research Database (Denmark)

    Ktsoyan, Zhanna A.; Mkrtchyan, Mkhitar S.; Zakharyan, Magdalina K.;

    2015-01-01

    The main goal of this study was to establish how the inflammation caused by infection with two different Salmonella enterica serotypes, S. Typhimurium and S. Enteritidis, may lead to the predisposition to allergy as measured by total IgE level in the blood. Infection by S. Typhimurium did not aff...

  3. Localized cortical thickening of the femoral diaphysis captured on an X-ray before alendronate therapy in two cases of atypical femoral fracture

    Energy Technology Data Exchange (ETDEWEB)

    Iizuka, Yoichi [Gunma University Graduate School of Medicine, Department of Orthopedic Surgery, Maebashi, Gunma (Japan); Shibukawa General Hospital, Department of Orthopedic Surgery, Shibukawa, Gunma (Japan); Takechi, Rumi [Gunma University Graduate School of Medicine, Department of Orthopedic Surgery, Maebashi, Gunma (Japan); Gunma Cardiovascular Center, Department of Orthopaedic Surgery, Maebashi, Gunma (Japan); Iizuka, Haku; Takagishi, Kenji [Gunma University Graduate School of Medicine, Department of Orthopedic Surgery, Maebashi, Gunma (Japan); Omodaka, Takuya [Gunma University Graduate School of Medicine, Department of Orthopedic Surgery, Maebashi, Gunma (Japan); Gunma Central Hospital, Department of Orthopedic Surgery, Maebashi, Gunma (Japan)

    2016-10-15

    We herein report two cases of atypical femoral fracture (AFF). X-ray examinations at the first visit of these two female patients showed a complete fracture of the femoral diaphysis diagnosed as an atypical femoral fracture (AFF). X-rays of these two cases also showed localized cortical thickening of the femoral diaphysis. Both patients had been taking alendronate for more than 3 years because of postmenopausal osteoporosis. We assumed that both of the fractures were associated with the long-term use of alendronate. However, we retrospectively identified localized cortical thickening of the femoral diaphysis on an X-ray taken before the alendronate therapy in both of these cases. Therefore, we suspected a pathogenesis of AFFs in which preexisting stress or an insufficient fracture unrelated to bisphosphonate (BP) therapy and subsequent suppression of bone turnover due to BP administration led to the occurrence of an AFF. The patient underwent surgery using intramedullary nails in both of these cases, followed by the administration of teriparatide, and they were able to walk without any support at the final follow-up examination. (orig.)

  4. Novas ocorrências de gastrópodes e bivalves marinhos no Brasil (Mollusca

    Directory of Open Access Journals (Sweden)

    Absalão Ricardo Silva

    2003-01-01

    Full Text Available The gastropods Costaclis egregia (Dall, 1889, Thaleia nisonis (Dall, 1889, Tjaernoeia michaeli Engl, 2001 and the bivalves Bathyarca sp., Myonera aff. ruginosa (Jeffreys, 1882 are recorded for the first time in Brazilian waters. This paper presents a brief description of these species and also include ilustrations.

  5. "My family's always been in meat"

    DEFF Research Database (Denmark)

    Toft-Nielsen, Claus

    2003-01-01

    Tobe Hoopers berømte og ikke mindst berygtede horrorfilm The Texas Chain Saw Massacre har siden premieren i 1974 haft et omtumlet eftermæle: Hvor samtidens brede publikum affærdigede filmen og videocensuren underlagde den totalforbud, har en stadig voksende fanskare øjnet dens kvaliteter og dyrket...

  6. Erratum to

    NARCIS (Netherlands)

    He, Shuangyan; He, Mingxia; Fischer, Jürgen; Yuan, Dongliang; Xu, Peng; Xu, Tengfei; Yang, Xianping; Sokoletsky, Leonid; Wei, Xiaodao; Shen, Fang; Zou, Juhong; Guo, Maohua; Cui, Songxue; Zhou, Wu; Gao, Dalu; Jin, Guangzhen; Lü, Xianqing; Qiu, Fuwen; Fang, Wendong; Pan, Aijun; Cha, Jing; Zhang, Shanwu; Huang, Jiang; Wang, Tao; Cheng, Yongzhou; Chen, Xiaoyan; Liu, Zhaopu; Long, Xiaohua; Hou, Zhishuai; Wen, Haishen; Li, Jifang; He, Feng; Liu, Qun; Wang, Jinhuan; Guan, Biao; Wang, Qinglong; Shahjahan, Md; Kabir, Md Farajul; Sumon, Kizar Ahmed; Bhowmik, Lipi Rani; Rashid, Harunur; Li, Shu; Yu, Kefu; Zhao, Jianxin; Feng, Yuexing; Chen, Tianran; Zhou, Shun; Ren, Yichao; Pearce, Christopher M.; Dong, Shuanglin; Tian, Xiangli; Gao, Qinfeng; Wang, Fang; Liu, Liming; Du, Rongbin; Zhang, Xiaoling; Dong, Shuanglin; Sun, Shichun; Feng, Song; Lin, Jianing; Sun, Song; Zhang, Fang; Zhang, Zhipeng; Tang, Xuexi; Tang, Haitian; Song, Jingjing; Zhou, Jian; Liu, Hongjun; Wang, Qixiang; Qian, Kuimei; Liu, Xia; Chen, Yuwei; Sun, Chengjun; Jiang, Fenghua; Gao, Wei; Li, Xiaoyun; Yu, Yanzhen; Yin, Xiaofei; Wang, Yong; Ding, Haibing; Sun, Zhongmin; Wang, Yongqiang; Yan, Pengcheng; Guo, Hui; Yao, Jianting; Tanaka, Jiro; Kawai, Hiroshi; Song, Na; Chen, Muyan; Gao, Tianxiang; Yanagimoto, Takashi; Lu, Xia; Luan, Sheng; Kong, Jie; Hu, Longyang; Mao, Yong; Zhong, Shengping; Liu, Yan; Zhao, Weihong; Li, Caiyan; Miao, Hui

    2017-01-01

    Unfortunately for all articles of Vol. 35 No. 1 the future journal title “Journal of Oceanology and Limnology” was used instead of the current journal title “Chinese Journal of Oceanology and Limnology”. All articles in the issue are aff ected. Please make sure to cite the articles with the followin

  7. Providing feedback on emotional experiences and decision making

    NARCIS (Netherlands)

    Machajdik, J.; Stöttinger, J.; Danelova, E.; Pongratz, M.; Kavicky, L.; Valenti, R.; Hanbury, A.

    2011-01-01

    We present a novel lifelog system concept created to provide a human user with feedback on their conscious and unconscious emotional reactions and encourage the process of self-reflection by looking into an affective mirror. The emotion of the user is deduced from biometric data and enhanced by affe

  8. Perceived sleep quality is worse than objective parameters of sleep in pregnant women with a mental disorder

    NARCIS (Netherlands)

    L.M. Van Ravesteyn (Leontien M.); J.H.M. Tulen (Joke); A.M. Kamperman (Astrid); M.E. Raats; A.J. Schneider; E. Birnie (Erwin); E.A.P. Steegers (Eric); W.J.G. Hoogendijk (Witte); H.W. Tiemeier (Henning); M.P. Lambregtse-van den Berg (Mijke)

    2014-01-01

    textabstractObjective: Disturbed sleep during pregnancy is associated with adverse obstetric outcomes and less mental well-being. In pregnant women with a mental disorder, who frequently suffer from sleep problems, it is unknown whether predominantly objective or subjective sleep quality is more aff

  9. Evaluation of the subjects' response to antipsychotics questionnaire

    NARCIS (Netherlands)

    Wolters, HA; Knegtering, R; Wiersma, D; van den Bosch, RJ

    2006-01-01

    The present study reports on the development of a new self-administered instrument to assess patients' responses to antipsychotic medication. The Subjects' Response to Antipsychotics (SRA) Questionnaire is a 74-item instrument with eight scales (Recovery, Weight Gain, Sexual Anhedonia, Sedation, Aff

  10. A 7-d exercise program increases high-molecular weight adiponectin in obese adults

    DEFF Research Database (Denmark)

    Kelly, Karen R; Blaszczak, Alecia; Haus, Jacob M;

    2012-01-01

    High-molecular weight (HMW) adiponectin is the biologically active form of adiponectin and is related to enhanced insulin sensitivity and metabolic function. Previously, we found that 7 d of exercise improves insulin sensitivity in obese subjects; however, whether short-term exercise training aff...

  11. The olfactory receptor OR51E1 is present along the gastrointestinal tract of pigs and is modulated by intestinal microbiota

    NARCIS (Netherlands)

    Priori, D.; Clavenzani, P.; Jansman, A.J.M.; Lalles, J.P.; Trivisil, P.; Bosi, P.

    2015-01-01

    The relevance of the butyrate-sensing olfactory receptor OR51E1 for gastrointestinal (GIT) functioning has not been considered so far. We investigated in young pigs the distribution of OR51E1 along the GIT, its relation with some endocrine markers, its variation with age and after interventions affe

  12. Sequence Classification: 890918 [

    Lifescience Database Archive (English)

    Full Text Available ane protein of the early Golgi apparatus, may function to promote retention of proteins in the early Golgi compartment; mutation affe...cts protein N-glycosylation and cell wall integrity; Svp26p || http://www.ncbi.nlm.nih.gov/protein/6321975 ...

  13. Sequence Classification: 522284 [

    Lifescience Database Archive (English)

    Full Text Available Non-TMB Non-TMH TMB Non-TMB Non-TMB Non-TMB >gi|62178697|ref|YP_215114.1| D-alanine-D-alanine ligase B, affe...cts cell division || http://www.ncbi.nlm.nih.gov/protein/62178697 ...

  14. The genus Echinostelium (Myxomycetes in Lithuania

    Directory of Open Access Journals (Sweden)

    Gražina Adamonytė

    2013-12-01

    Full Text Available Seven species of the genus – Echinostelium apitectum, E. arboreum, E. brooksii, E. colliculosum, E. corynophorum, E. aff. elachiston, E. minutum – are reported from Lithuania. Their morphological peculiarities are discussed; a key to the species, pictures and distribution maps are given.

  15. The Cova des Pas de Vallgornera (Llucmajor, Mallorca: a singular deposit bearing an exceptional well preserved Early Pleistocene vertebrate fauna

    Directory of Open Access Journals (Sweden)

    Pere Bover

    2014-05-01

    Full Text Available The Cova des Pas de Vallgornera is the longest cave of Mallorca (Balearic Islands, Western Mediterranean and one of the 30 longest caves in the world. The exploration of one of the galleries allowed the discovery of a fossiliferous deposit of vertebrate remains in a remarkable preservation state. The fossil faunal complex found in this gallery is composed of up to 5 mammalian species (Myotragus aff. kopperi, Hypnomys onicensis, Nesiotites aff. ponsi, Rhinolophus aff. mehelyi and Pipistrellus sp., at least 14 bird species (among them two Mallorcan endemic taxa: Pica mourerae and Athene vallgornerensis, one reptile (Podarcis aff. lilfordi and one amphibian (Discoglossus sp.. This faunal composition is similar to the one recorded in the Pedrera de s’Ònix, a well known deposit from the Early Pleistocene of Mallorca, and shared morphological characteristics between taxa of both deposits suggest that the chronology of the Cova des Pas de Vallgornera should be considered Early Pleistocene as well. Both taxonomical analysis and chronology of this fauna furnished information on some speleological aspects of the cave.

  16. Heated hatha yoga to target cortisol reactivity to stress and affective eating in women at risk for obesity-related illnesses: A randomized controlled trial

    NARCIS (Netherlands)

    Hopkins, L.B.; Medina, J.L.; Baird, S.O.; Rosenfield, D.; Powers, M.B.; Smits, J.A.J.

    2016-01-01

    Objective: Cortisol reactivity to stress is associated with affective eating, an important behavioral risk factor for obesity and related metabolic diseases. Yoga practice is related to decreases in stress and cortisol levels, thus emerging as a potential targeted complementary intervention for affe

  17. Briefs & Events

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    Total installation capacity exceeds 800 GW in China At the National Power Working Conference held on August 16,it was declared that the Unit 6 of Laxiwa Hydropower Station aff iliated to China Power Investment Corporation was commissioned,which marks the milestone of 800 GW total generation capacity in China.

  18. The effect of osteoporosis treatments on fatigue properties of cortical bone tissue

    Directory of Open Access Journals (Sweden)

    Garry R. Brock

    2015-06-01

    Full Text Available Bisphosphonates are commonly prescribed for treatment of osteoporosis. Long-term use of bisphosphonates has been correlated to atypical femoral fractures (AFFs. AFFs arise from fatigue damage to bone tissue that cannot be repaired due to pharmacologic treatments. Despite fatigue being the primary damage mechanism of AFFs, the effects of osteoporosis treatments on fatigue properties of cortical bone are unknown. To examine if fatigue-life differences occur in bone tissue after different pharmacologic treatments for osteoporosis, we tested bone tissue from the femurs of sheep given a metabolic acidosis diet to induce osteoporosis, followed by treatment with a selective estrogen reception modulator (raloxifene, a bisphosphonate (alendronate or zoledronate, or parathyroid hormone (teriparatide, PTH. Beams of cortical bone tissue were created and tested in four-point bending fatigue to failure. Tissue treated with alendronate had reduced fatigue life and less modulus loss at failure compared with other treatments, while tissue treated with PTH had a prolonged fatigue life. No loss of fatigue life occurred with zoledronate treatment despite its greater binding affinity and potency compared with alendronate. Tissue mineralization measured by microCT did not explain the differences seen in fatigue behavior. Increased fatigue life with PTH suggests that current treatment methods for AFF could have beneficial effects for restoring fatigue life. These results indicate that fatigue life differs with each type of osteoporosis treatment.

  19. Attention-Affect Check List: A self-report measure of acute mental stress.

    Science.gov (United States)

    Sawada, YUKIHIRO; Tanaka, GOHICHI

    2004-05-01

    Given a hint from Lang, Bradley, and Cutbert's (1997) defense cascade, two cognitive processes, instead of passive versus active behavioral coping, which seem to have differential effects on the provocation of vascular- versus cardiac-dominant reaction pattern during mental stress were advocated: attention (Attent) versus unpleasant affect (UnplAff). Based on this notion the Attention-Affect Check List (AACL) was developed as a self-report measure. In addition, items on uncontrollability (Uncontr) were prepared for the purpose of checking whether heightened Attent and UnplAff are accompanied by alterations in Uncontr. Two hundred and eighty-four students underwent two kinds of mental stress, which seemed to specifically heighten Attent and UnplAff. Four factors with four items each were extracted from the AACL item pool: concentrated and allocated Attent, UnplAff, and pleasant affect. Also, one factor with four items was extracted from the Uncontr item pool. For both the mental stresses, each scale, although very brief, had quite reasonable alpha reliability. Accountability of each scale for the total variance was reasonably high. Some problems are discussed in relation to the validity of AACL.

  20. Reference: 143 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available of AtMYB32 and AtMYB4 expression may influence pollen development by changing the flux along the phenylpropanoid pathways, affe...for normal pollen development in Arabidopsis thaliana. 6 979-95 15584962 2004 Dec The Plant journal Heazlewood Joshua|Li Song Feng|Parish Roger W|Preston Jeremy|Wheeler Janet

  1. ELEMENTI DI GEOMETRIE FINITE

    Directory of Open Access Journals (Sweden)

    Stefania Ferri

    1996-02-01

    Full Text Available Si fa vedere come si può costruire la geometria analitica su un piano affìne finito. Vengono riportati risultati classici che però sono stati esposti in modo da essere compresi dagli alunni delle Scuole Medie Secondarie.

  2. New data on carnivores from the Middle Miocene (Upper Aragonian, MN 6 of Arroyo del Val area (Villafeliche, Zaragoza Province, Spain

    Directory of Open Access Journals (Sweden)

    Morales, J.

    2006-12-01

    Full Text Available Several new fossil remains of Carnivora from the aragonian (MN 6, local zone G2 localities of Arroyo del Val and La Barranca (near the village of Villafeliche, Zaragoza province are studied in the present paper. These fossil sites are very closely located, and probably belonging to the same level. The faunal list of Carnivora of both sites includes the following taxa: Hemicyon sp. aff. H. sansaniensis, Plithocyon armagnacensis, Amphicyon giganteus, Plioviverrops sp., Martes sp., Pseudaelurus lorteti, Pseudaelurus quadridentatus, and Protictitherium sp. aff. P. crassum.En el presente trabajo se estudian los restos fósiles de Carnivora procedentes de los yacimientos aragonienses (MN 6, Zona local G2 de Arroyo del Val y La Barranca, ambas situadas en las proximidades de Villafeliche (Zaragoza. Estos yacimientos se encuentran situados muy cerca uno del otro, y es más que probable que se correspondan con los mismos niveles. La lista faunística de carnívoros está compuesta de los siguientes taxa: Hemicyon sp. aff. H. sansaniensis, Plithocyon armagnacensis, Amphicyon giganteus, Plioviverrops sp., Martes sp., Pseudaelurus lorteti, Pseudaelurus quadridentatus y Protictitherium sp. aff. P. crassum.

  3. Liver diseases and aging : friends or foes?

    NARCIS (Netherlands)

    Sheedfar, Fareeba; Di Biase, Stefano; Koonen, Debby; Vinciguerra, Manlio

    2013-01-01

    The liver is the only internal human organ capable of natural regeneration of lost tissue, as little as 25% of a liver can regenerate into a whole liver. The process of aging predisposes to hepatic functional and structural impairment and metabolic risk. Therefore, understanding how aging could affe

  4. 77 FR 10492 - Order Reaffirming Commission Policy and Terminating Proceeding; Analysis of Horizontal Market...

    Science.gov (United States)

    2012-02-22

    ..., participation, or other influence over decisions that affect competitive strategy.\\75\\ Similarly, FTC Staff... information regarding (a) planned maintenance windows, (b) outages, (c) marketing strategies, (d) contracts...), aff'd sub nom. Montana Consumer Counsel v. FERC, 659 F.3d 910 (9th Cir. 2011). \\14\\ Id. P 13, 62....

  5. Impact of heating and current drive mix on the ITER hybrid scenario

    NARCIS (Netherlands)

    Citrin, J.; Artaud, J. F.; Garcia, J.; Hogeweij, G. M. D.; Imbeaux, F.

    2010-01-01

    Hybrid scenario performance in ITER is studied with the CRONOS integrated modelling suite, using the GLF23 anomalous transport model for heat transport prediction. GLF23 predicted core confinement is optimized through tailoring the q-profile shape by a careful choice of current drive actuators, affe

  6. Experiment list: SRX1078839 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ssue Diagnosis=Carcinoma 65406531,94.9,5.1,1928 GSM1727069: AFF4 shPAF1.1 HCT116 rep1 ChIPSeq; Homo sapiens; ChIP-Seq source_name=HCT...116 || cell type=colorectal cancer cell line || cell line=HCT116 || shRNA=PAF1 shRN

  7. Experiment list: SRX1078842 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ssue Diagnosis=Carcinoma 35526860,96.0,4.3,1125 GSM1727072: AFF4 shSCR HCT116 rep2 ChIPSeq; Homo sapiens; ChIP-Seq source_name=HCT116... || cell type=colorectal cancer cell line || cell line=HCT116 || shRNA=Scramble shR

  8. Experiment list: SRX1078841 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ssue Diagnosis=Carcinoma 66173509,95.8,5.1,1649 GSM1727071: AFF4 shSCR HCT116 rep1 ChIPSeq; Homo sapiens; ChIP-Seq source_name=HCT116... || cell type=colorectal cancer cell line || cell line=HCT116 || shRNA=Scramble shR

  9. Experiment list: SRX1078840 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ssue Diagnosis=Carcinoma 38688984,94.8,4.8,1158 GSM1727070: AFF4 shPAF1.1 HCT116 rep2 ChIPSeq; Homo sapiens; ChIP-Seq source_name=HCT...116 || cell type=colorectal cancer cell line || cell line=HCT116 || shRNA=PAF1 shRN

  10. Reference: 437 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available , increased shoot branching, and reduced root waving and fertility, traits that are reminiscent of some muta...two putatively null T-DNA alleles. Inflorescence size and fertility were more affe...ems to arise from an early patterning defect. We found that HVE/CAND1 binds to CULLIN1, and that the venatio

  11. DNA-based tunable THz oscillator

    NARCIS (Netherlands)

    Malyshev, A. V.; Malyshev, V. A.; Dominguez-Adame, F.

    2009-01-01

    The intrinsic helix conformation of the DNA strands is known to be the key ingredient of control of the electric current through the molecule by the perpendicular (gate) electric field. We show theoretically that Bloch oscillations in periodic systems with helical conformation are also strongly affe

  12. PROBLEMS OF DEVELOPMENT OF THE EXCHANGE ENVIRONMENT IN RUSSIA

    Directory of Open Access Journals (Sweden)

    S. D. Nosov

    2013-01-01

    Full Text Available Brief annotation: In an article, based on a thorough analysis of the theoretical material and practical evaluation of financial market experts, the author gives an overview of the current state of the Russian securities market, makes it a comparative analysis of theU.S.market, followed by the identification of the problems aff ecting the development of the industry

  13. Heated hatha yoga to target cortisol reactivity to stress and affective eating in women at risk for obesity-related illnesses: A randomized controlled trial

    NARCIS (Netherlands)

    Hopkins, L.B.; Medina, J.L.; Baird, S.O.; Rosenfield, D.; Powers, M.B.; Smits, J.A.J.

    2016-01-01

    Objective: Cortisol reactivity to stress is associated with affective eating, an important behavioral risk factor for obesity and related metabolic diseases. Yoga practice is related to decreases in stress and cortisol levels, thus emerging as a potential targeted complementary intervention for affe

  14. Multi-criteria university selection: Formulation and implementation using a fuzzy AHP

    NARCIS (Netherlands)

    Salimi, N.; Rezaei, J.

    2015-01-01

    Collaboration with universities as ‘knowledge factories’ is increasingly perceived to be an effective and viable solution for firms to gain competitive advantage. One of the main challenges firms face in this area is how to select the best university for collaboration. This selection undoubtedly aff

  15. Prion protein self-interaction in prion disease therapy approaches

    NARCIS (Netherlands)

    Rigter, A.; Priem, J.; Langeveld, J.P.M.; Bossers, A.

    2011-01-01

    Transmissible spongiform encephalopathies (TSEs) or prion diseases are unique disorders that are not caused by infectious micro-organisms (bacteria or fungi), viruses or parasites, but rather seem to be the result of an infectious protein. TSEs are comprised of fatal neurodegenerative disorders affe

  16. Low Friction Cryostat for HTS Power Cable of Dutch Project

    NARCIS (Netherlands)

    Chevtchenko, O.; Zuijderduin, R.; Smit, J.; Willen, D.; Lentge, H.; Thidemann, C.; Traeholt, C.

    2012-01-01

    Particulars of 6 km long HTS AC power cable for Amsterdam project are: a cable has to fit in an annulus of 160 mm, with only two cooling stations at the cable ends [1]. Application of existing solutions for HTS cables would result in excessively high coolant pressure drop in the cable, possibly affe

  17. Host and microbiological factors related to dental caries development

    NARCIS (Netherlands)

    De Soet, J.J.; van Gemert-Schriks, M.C.M.; Laine, M.L.; van Amerongen, W.E.; Morré, S.A.; van Winkelhoff, A.J.

    2008-01-01

    Studies on dental caries suggest that in severe cases it may induce a systemic immune response. This occurs particularly when caries progresses into pulpal inflammation and results in abscess or fistula formation (AFF). We hypothesized that severe dental caries will affect the general health of chil

  18. First Report of a New Phytoplasma Subgroup, 16SrIII-S, Associated with Decline Disease Affecting Sweet and Sour Cherry Trees

    Science.gov (United States)

    During July 2007, we observed sweet cherry (Prunus avium) and sour cherry (Prunus cerasus) trees exhibiting disease symptoms suggestive of possible phytoplasma infection in a large orchard in the Kaunas region of Lithuania. Samples of leaf tissue were collected from sweet cherry trees that were aff...

  19. Effects of hypophysectomy and ACTH1–10 on responsiveness to electric shock in rats

    NARCIS (Netherlands)

    Gispen, W.H.; Wimersma Greidanus, T.B. van; Wied, D. de

    1967-01-01

    Response behavior of rats to unescapable electric shock was studied in intact and hypophysectomized animals. The threshold for flinch, jerk, run and jump was significantly lowered in hypophysectomized rats as compared to that of intact controls. Treatment with the ACTH analogue ACTH1–10 did not affe

  20. Migraine Trainers as Models: the effectiveness of Lay trainerswith migraine for behavioural attack prevention

    NARCIS (Netherlands)

    S.Y.M. Mérelle (Saskia)

    2008-01-01

    textabstractMigraine is a chronic brain disorder, characterized by attacks of severe headache accompanied by nausea, vomiting and sensitivity to light, sound and smell. Attacks can be preceded by premonitory symptoms such as fatigue, muscular stiff ness or negative aff ect. It has been shown that co

  1. From data-poor to data-rich: system dynamics in the era of big data

    NARCIS (Netherlands)

    Pruyt, E.; Cunningham, S.; Kwakkel, J.H.; De Bruijn, J.A.

    2014-01-01

    Human-computer and human-system interaction has already received extensive attention from HCI research communities, yet there are a number of issues that has not been addressed so far. In this paper we propose a novel vision on future human-system interaction that is governed by the principle of aff

  2. Wine and vinegar-based attractants for the African fig fly (Diptera: Drosophilidae)

    Science.gov (United States)

    The African fig fly (AFF), Zaprionus indianus Gupta (Diptera: Drosophilidae), is an invasive fruit pest that has spread rapidly through much of the eastern United States after first being detected in Florida in 2005. This drosophilid is a primary pest of figs in Brazil, so there were initial concern...

  3. Liver diseases and aging : friends or foes?

    NARCIS (Netherlands)

    Sheedfar, Fareeba; Di Biase, Stefano; Koonen, Debby; Vinciguerra, Manlio

    2013-01-01

    The liver is the only internal human organ capable of natural regeneration of lost tissue, as little as 25% of a liver can regenerate into a whole liver. The process of aging predisposes to hepatic functional and structural impairment and metabolic risk. Therefore, understanding how aging could affe

  4. Undergraduate Experiences of Division I Athlete Science, Technology, Engineering, and Mathematics (STEM) Graduates

    Science.gov (United States)

    Comeaux, Eddie; Bachman, Tina; Burton, Rena M.; Aliyeva, Aida

    2017-01-01

    Employing the conceptual model developed by Comeaux and Harrison ("Coll Stud Aff J" 30(1):75-87, 2011), this study explored the undergraduate experience of Division I athlete STEM graduates. Data collection involved 17 in-depth interviews with former athletes at two research-intensive, public institutions. Results revealed that…

  5. Ostracoda from Vestfold Hill lake terraces, Antarctica

    Digital Repository Service at National Institute of Oceanography (India)

    Setty, M.G.A.P.

    Six species of ostracodes are recorded from two transects of terraces of Deep Lake, Vestfold Hills, Antarctica. Two species (@iXesteleberis@@ sp. and @iBradleya dictyon@@) range from Cretaceous to Recent, @iPoseidonamicus aff. P. major@@ ranges from...

  6. Epigallocatechin-3-gallate inhibits expression of receptors for T cell regulatory cytokines and their downstream signaling in mouse CD4+ T cells

    Science.gov (United States)

    We previously showed a suppressive effect of epigallocatechin-3-gallate (EGCG) on T cell cycling and expansion as well as a paradoxical effect on IL-2 levels (up-regulating) and IL-2 receptor (IL-2R)alpha expression (down-regulating). Thus, in the current study we tested the hypothesis that EGCG aff...

  7. Targeting Transcription Elongation Machinery for Breast Cancer Therapy

    Science.gov (United States)

    2016-05-01

    molecules. We have employed the CRISPR /Cas9 genome-editing tool to knock out the gene encoding the SEC component AFF4 or knock in a mutant cyclin T1 (AAG...for RNA Pol II. The potential role of a Super Enhancer will also be tested by knocking down the mediator complex in these breast cancer cells and

  8. Genetic variants in IL15 associate with progression of joint destruction in rheumatoid arthritis : a multicohort study

    NARCIS (Netherlands)

    Knevel, R.; Krabben, A.; Brouwer, E.; Posthumus, M. D.; Wilson, A. G.; Lindqvist, E.; Saxne, T.; de Rooy, D.; Daha, N.; van der Linden, M. P. M.; Stoeken, G.; van Toorn, L.; Koeleman, B.; Tsonaka, R.; Zhernakoza, A.; Houwing-Duistermaat, J. J.; Toes, R.; Huizinga, T. W. J.; van der Helm-van Mil, A.

    2012-01-01

    Background Interleukin (IL)-15 levels are increased in serum, synovium and bone marrow of patients with rheumatoid arthritis (RA). IL-15 influences both the innate and the adaptive immune response; its major role is activation and proliferation of T cells. There are also emerging data that IL-15 aff

  9. NMR-based metabolomic profiling of overweight adolescents – an elucidation of the effects of inter-/intra-individual differences, gender, pubertal development and physical activity

    DEFF Research Database (Denmark)

    Zheng, Hong; Yde, Christian Clement; Arnberg, Karina

    2014-01-01

    The plasma and urine metabolome of 192 overweight 12-15-year-old adolescents (BMI of 25.4 ± 2.3 kg/m(2)) were examined in order to elucidate gender, pubertal development measured as Tanner stage, physical activity measured as number of steps taken daily, and intra-/interindividual differences aff...

  10. Developing Health Literate Businesses: A Qualitative Study

    NARCIS (Netherlands)

    Sorensen, K.; Czabanowska, K.; Brand, H.

    2015-01-01

    [PDF] Developing Health Literate Businesses: A Qualitative Study K Sørensen, K Czabanowska, H Brand - Occup Med Health Aff, 2015 ... Corresponding author: Kristine Sørensen, Assistant Professor, Department of International Health/CAPHRI, Maastricht University, the Netherlands.Tel: +31433881717; Fax

  11. Masking interrupts figure-ground signals in V1

    NARCIS (Netherlands)

    Lamme, V.A.F.; Zipser, K.; Spekreijse, H.

    2002-01-01

    In a backward masking paradigm, a target stimulus is rapidly (<100 msec) followed by a second Stimulus. This typically results in a dramatic decrease in the visibility of the target stimulus. It has been shown that masking reduces responses in V1. It is not known, however, which process in V1 is aff

  12. Food-resource partitioning among fish species from a first-order stream in northwestern Paraná, Brazil

    Directory of Open Access Journals (Sweden)

    Jislaine Cristina da Silva

    Full Text Available This study addressed the feeding ecology of fish fauna from a first-order stream located in a rural area. The purposes were to evaluate the influence of interspecific, seasonal and spatial factors on the diet, examine the dietary overlap, and determine the predominant food sources. Sampling was conducted in December 2007, September 2008, and March 2009, in three 50-m stretches of Itiz stream (upstream, intermediate, and downstream, through electrofishing. A total of 1,102 stomach contents were analyzed from 14 species, by the volumetric method. In general, allochthonous resources were predominant in the diets. Astyanax aff. fasciatus, Astyanax aff. paranae, Astyanax bockmanni, and Bryconamericus aff. iheringi consumed a higher proportion of plant remains, and Bryconamericus stramineus consumed predominantly Hymenoptera. The diets of Cetopsorhamdia iheringi, Characidium aff. zebra, Imparfinis schubarti, and Trichomycterus sp. consisted of aquatic insects, especially immature forms of Trichoptera, Ephemeroptera, Plecoptera, and Diptera. Hypostomus ancistroides, Hisonotus sp., Poecilia reticulata, and Rineloricaria aff. pentamaculata exploited mainly detritus, while Rhamdia quelen used a variety of items, predominantly terrestrial insects. Detrended Correspondence Analysis (DCA showed a clear distinction among the species, with different morphology and feeding tactics. The Multi-Response Permutation Procedure (MRPP supported this differentiation, and also indicated significant spatial and temporal variations in the dietary composition; the Indicator Value Method (IndVal indicated the main items that contributed to these differences. The diet overlap among species was low (< 0.4 to around 78% of pairs, and the mean value did not vary significantly among the sites or between hydrological periods within each site. According to the null model of Pianka’s index, the values for dietary overlap were significantly higher than expected at random, showing

  13. Low dose effects of fibrous and non-fibrous mineral dusts on the proliferation of mammalian cells in vitro.

    Science.gov (United States)

    Fischer, A B; Kaw, J L; Diemer, K; Eikmann, T

    1998-08-01

    This report presents preliminary results of studies on the growth stimulating properties of mineral dusts. The studies were carried out with Syrian hamster diploid embryonic fibroblasts and Chinese hamster fibroblasts, line B14F28. Toxicity testing was done by the determination of the plating efficiency as a measure of growth and viability. The following dusts were used: the modified UICC asbestos fibres amosite, (AFF) crocidolite (KFF), chrysotile (KFF): in addition glass fibre (GFF), corundum and quartz DQ12. Concentrations > 2 microg/cm2 of AFF, CFF, KFF and GFF depressed the plating efficiency of B14F28 cells in a dose-dependent manner, but all of the fibres and corundum increased colony sizes at concentrations of 0.16-0.33 microg/cm2, in the case of corundum, AFF, KFF, and CFF also at up to 0.66 or 1.32 microg/cm2. DQ12 did not enhance colony growth. The stimulation of proliferation could be demonstrated both in terms of colony size (diameter) and cell numbers. The factor(s) responsible for proliferation stimulation reside in the supernatant, since the medium of dust-treated cell cultures was able to stimulate colony growth after removal of the dusts by filtration. The results indicate the induction of growth factors (cytokines) by low concentrations of the mineral dusts. Experiments concerning the effect of dusts on embryonic golden hamster fibroblasts yielded similar results. The plating efficiency was inhibited by concentrations of GFF and CFF > 0.25 microg cm2 and by AFF, KFF, GFF and corundum at concentrations > 5 microg/cm2, but colony counts were significantly increased by AFF, KFF and corundum at concentrations of 0.25-3 microg/cm2. This biological reaction which was observed in different cell types appears to be especially relevant in the context of environmental exposure where low dust concentrations prevail.

  14. Specific interactions versus counterion condensation. 1. Nongelling ions/polyuronate systems.

    Science.gov (United States)

    Donati, Ivan; Cesàro, Attilio; Paoletti, Sergio

    2006-01-01

    The characteristics of the interaction between nongelling divalent cations (typically Mg(2+)) and polyuronates have been explored by means of isothermal calorimetry. In particular, three polyuronates mimicking separately guluronan (polyguluronate, polyG), mannuronan (polymannuronate, polyM), and polyalternating (polyMG), the three block-components of natural alginate samples, have been treated with divalent ions, and the enthalpy of mixing was determined for different values of the [M(2+)]/[Polym](rep.unit) ratio. Despite the absence of a site-specific chemical bonding between the two, as confirmed by circular dichroism spectroscopy, a substantial deviation of the experimental enthalpy of mixing from the theoretical behavior, as predicted by the classical counterion condensation (CC) theory, was observed. Such deviation has been interpreted in terms of a "generic" nonbonding affinity of the condensed divalent counterion for the polyelectrolytes. The mathematical formalism of the CC theory was extended to include a contribution to the (reduced) free energy and enthalpy arising from the counterion affinity, g(aff,0) and h(aff,0), and allowed the parametrical calculation of the fraction of divalent counterions condensed as function of the reduced thermodynamic quantity g(aff,0). A best fit procedure of the experimental enthalpy of mixing allowed the g(aff,0) and h(aff,0) pair to be estimated for each of the different polyuronates considered, revealing differences in the three samples. In qualitative terms, the results obtained seem to suggest a notable contribution of the desolvation process (i.e., release of structured water as a consequence of the interaction between the divalent counterion and the uronate group) to the enthalpy of affinity for polyM which is counterbalanced and overcome by an ion pairing term (i.e., partial formation of ion-ion and/or ion-dipole bonds) for polyG and polyMG, respectively.

  15. Pseudoscorpionida (Arachnida em galerias de colônias de Passalidae (Coleoptera, Insecta em troncos caídos em floresta de terra firme da Amazônia, Brasil Pseudoscorpionida (Arachnida found in the galleries made by Passalidae (Coleoptera, Insecta colonies inside fallen wood of the Amazonian terra firme forest, Brazil

    Directory of Open Access Journals (Sweden)

    Nair Otaviano Aguiar

    2011-01-01

    Full Text Available Em sete municípios do Amazonas, um de Rondônia e um de Roraima, foram examinadas 71 colônias de 24 espécies de Passalidae (Coleoptera, pertencentes aos gêneros: Passalus Fabricius, 1792 (14 espécies; Paxillus Mac Leay, 1819 (três; Popilius Kaup, 1871 (três; Spasalus Kaup, 1869 (uma; Verres Kaup, 1871 (uma; Veturius Kaup, 1871 (duas. Foram registradas doze espécies de pseudoscorpiões, incluindo nove gêneros e cinco famílias, listadas a seguir: Chernetidae - Americhernes aff. incertus Mahnert, 1979, Cordylochernes scorpioides (Linnaeus 1758, Lustrochenes similis (Balzan 1892, L. aff. reimoseri Beier, 1932, L. intermedius (Balzan 1892, Phymatochernes crassimanus Mahnert 1979; Chthoniidae - Pseudochthonius homodentatus Chamberlin, 1929; Lechytiidae - Lechytia chthoniiformis (Balzan 1887; Tridenchthoniidae - Tridenchthonius mexicanus Chamberlin & Chamberlin 1945; Withiidae - Cacodemonius sp., Dolichowithius (D. emigrans (Tullgren 1907, D. (D. mediofasciatus Mahnert, 1979. Dentre as espécies mais freqüentes (T. mexicanus, L. intermedius e L. aff. reimoseri, ocorreram todos os estágios de desenvolvimento. Foram coletadas de uma a três espécies de pseudoscorpiões em cada colônia individual de besouros passalídeos. T. mexicanus foi a única espécie encontrada em todos os municípios, ocorrendo em 45 colônias de dezenove espécies de passalídeos, sendo a maioria dos exemplares encontrado no subcórtex. L. intermedius foi a segunda espécie mais abundante, ocorrendo em colônias de 11 espécies de Passalidae, a maioria também no subcórtex. L. aff reimoseri ocorreu em 13 colônias de Passalidae, sob a casca, alburno e cerne. L. aff. reimoseri foi a única espécie coletada somente no cerne.Seventy-one colonies from 24 species of Coleoptera, Passalidae, belonging respectively to the genera Passalus Fabricius, 1792 (14 species, Paxillus Mac Leay, 1819 (three species, Popilius Kaup, 1871 (three species, Spasalus Kaup, 1869 (one species

  16. Comparative anthelmintic activity investigation of selected ethno-medicinal weeds

    Science.gov (United States)

    Pueblos, Kirstin Rhys S.; Bajalla, Mark; Pacheco, Dixie; Ganot, Sheila; Paig, Daisy; Tapales, Radyn; Lagare, Jeanne; Quimque, Mark Tristan J.

    2017-01-01

    Helminth infections are one of the seriously neglected potent diseases in many parts of the world. The problems of parasitic helminthes becoming resistant to currently available anthelmintic drugs pose a challenge for the search - relying on natural products - for new and better anthelmintics. In this paper, four abundant Philippine weeds: Chrysopogon aciculatus Trin. Cyperus brevifolius Rottb., Ruellia tuberosa Linn. and Saccharum spontaneum Linn. were investigated for their anthelmintic activities to establish basis of their folkloric claim. The hexane-soluble and chloroform-soluble extracts were obtained through sequential solvent partitioning of the crude ethanolic extract of the air-dried aerial part of each plant sample. Meanwhile, the decoction was obtained from fresh aerial part of the plant samples. All extracts were then subjected to in vitro anthelmintic screening at different concentration as per method of Ghosh, et al. against African nightcrawler earthworms (Eudrillus euginiae) in which the activity of the extracts was determined by correlation with time. The anthelmintic bioassay results revealed a dose-dependent toxicity relationship. It indicated relatively low anthelmintic activities of the decoction of the four plant samples as compared to their corresponding crude ethanol extracts. Among the crude ethanol extracts, C. brevifolius (CBE) gave fastest time to bring about paralysis and death to the test organisms at all concentrations tested. For the hexane extracts, R. tuberosa (RTH) gave better activity among other plant samples. Lastly, among the chloroform-soluble extracts, both that of C. brevifolius (CBC) and R. tuberosa (RTC) comparably showed strongest anthelmintic activities at all tested concentrations, thus, exhibited best anthelmintic activity that is remarkably comparable to the positive control, Mebendazole at the highest concentration tested. In fact, CBC and RTC showed highest anthelmintic potential compared to all extracts tested in

  17. Espécies de Gorybia Pascoe (Coleoptera, Cerambycidae, Piezocerini ocorrentes na Bolívia

    Directory of Open Access Journals (Sweden)

    Maria Helena M. Galileo

    2013-03-01

    Full Text Available Species of Gorybia Pascoe (Coleoptera, Cerambycidae, Piezocerini occurring in Bolivia. The genus Gorybia (Cerambycinae, Piezocerini consists of 45 described species with seven species recorded from Bolivia. Nine new species are described herein from Bolivia: G. abnormalis sp. nov.; G. alveolata sp. nov.; G. asyka sp. nov.; G. florida sp. nov.; G. inarmata sp. nov.; G. longithorax sp. nov.; G. guenda sp. nov.; G. tuberosa sp. nov. and G. wappesi sp. nov. A key to the species now known to occur in Bolivia is included.

  18. Buried in time: Culturable fungi in a deep-sea sediment core from the Chagos Trench, Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Raghukumar, C.; Raghukumar, S.; Sheelu, G.; Gupta, S.M.; Nath, B.N.; Rao, B.R.

    was estimated from 25-30 microscopic fields, each containing 15-20 spores (Raghukumar and Raghukumar, 1998). 3. Results Biostratigraphic dating using radiolarian fossil index species showed three distinct litho-biounits of the sediment core (Table 1... was not found below 280 cm. Therefore, this unit of the core up to 280 cm, was estimated to be younger than 7 0.18 Ma. Collosphaera tuberosa was found to occur up to a depth of 370 cm, while the fossil species Stylatractus universus, with a last appearance...

  19. Espécies de Gorybia Pascoe (Coleoptera, Cerambycidae, Piezocerini ocorrentes na Bolívia Species of Gorybia Pascoe (Coleoptera, Cerambycidae, Piezocerini occurring in Bolivia

    Directory of Open Access Journals (Sweden)

    Maria Helena M. Galileo

    2013-03-01

    Full Text Available Species of Gorybia Pascoe (Coleoptera, Cerambycidae, Piezocerini occurring in Bolivia. The genus Gorybia (Cerambycinae, Piezocerini consists of 45 described species with seven species recorded from Bolivia. Nine new species are described herein from Bolivia: G. abnormalis sp. nov.; G. alveolata sp. nov.; G. asyka sp. nov.; G. florida sp. nov.; G. inarmata sp. nov.; G. longithorax sp. nov.; G. guenda sp. nov.; G. tuberosa sp. nov. and G. wappesi sp. nov. A key to the species now known to occur in Bolivia is included.

  20. Influence of tree species on the herbaceous understory and soil chemical characteristics in a silvopastoral system in semi-arid northeastern Brazil

    Directory of Open Access Journals (Sweden)

    R. S. C. Menezes

    1999-12-01

    Full Text Available Studies from some semi-arid regions of the world have shown the beneficial effect of trees in silvopastoral systems, by promoting the formation of resource islands and increasing the sustainability of the system. No data are available in this respect for tree species of common occurrence in semi-arid Northeastern Brazil. In the present study, conducted in the summer of 1996, three tree species (Zyziphus joazeiro, Spondias tuberosa and Prosopis juliflora: found within Cenchrus ciliaris pastures were selected to evaluate differences on herbaceous understory and soil chemical characteristics between samples taken under the tree canopy and in open grass areas. Transects extending from the tree trunk to open grass areas were established, and soil (0-15 cm and herbaceous understory (standing live biomass in 1 m² plots samples were taken at 0, 25, 50, 100, 150 and 200% of the average canopy radius (average radius was 6.6 ± 0.5, 4.5 ± 0.5, and 5.3 ± 0.8 m for Z. joazeiro, P. juliflora, and S. tuberosa , respectively. Higher levels of soil C, N, P, Ca, Mg, K, and Na were found under the canopies of Z. joazeiro and P. juliflora: trees, as compared to open grass areas. Only soil Mg organic P were higher under the canopies of S. tuberosa trees, as compared to open grass areas. Herbaceous understory biomass was significantly lower under the canopy of S. tuberosa and P. juliflora trees (107 and 96 g m-2, respectively relatively to open grass areas (145 and 194 g m-2. No herbaceous biomass differences were found between Z. joazeiro canopies and open grass areas (107 and 87 g m-2, respectively. Among the three tree species studied, Z. joazeiro was the one that presented the greatest potential for use in a silvopastoral system at the study site, since it had a larger nutrient stock in the soil without negatively affecting herbaceous understory biomass, relatively to open grass areas.

  1. Almidón retrogradado para uso en compresión directa. I. Caracterización y pregelatinización del almidón de chayote

    OpenAIRE

    María de Lourdes Garzón S.

    2006-01-01

    Los excipientes para compresión directa han demostrado ser muy eficientes, por lo que algunos de ellos se han elaborado a partir de diferentes fuentes de almidón. El almidón extraído de las raíces tuberosas del chayote (Sechium edule), puede ser atractivo en aplicaciones farmacéuticas ya que presenta alta viscosidad y mayor proporción de amilosa que otros almidones tradicionales. Con objeto de impartirle propiedades de compactación, fue sometido a un proceso hidrotérmico de pregelatinización ...

  2. Bagaço e fécula de mandioca na elaboração de farinhas cruas e pré-gelatinizadas, snacks e macarrões instantâneos com amaranto

    OpenAIRE

    Fiorda, Fernanda Assumpção

    2011-01-01

    A mandioca é uma tuberosa amilácea de grande potencial energético, podendo ser utilizada tanto para o consumo in natura como para industrialização, gerando quantidades significativas de bagaço, que apresenta potencialidade de uso como fonte de fibra alimentar. A tecnologia de extrusão vem sendo explorada nos últimos anos para o desenvolvimento de novos produtos alimentícios como massas alimentícias que estão incorporadas à cozinha brasileira, servindo como prato principal ou complemento, em m...

  3. 水生蔬菜种质资源研究概况

    Institute of Scientific and Technical Information of China (English)

    柯卫东; 黄新芳; 李双梅; 叶元英; 刘玉平; 孔庆东

    2001-01-01

    水生蔬菜是指在淡水中生长的、其产品可供蔬菜食用的维管束植物,我国传统的水生蔬菜共有12大类,即:莲藕[Nelumbo nucifera Gaertn]、茭白[Zizania caduciflora Hand-Mazz.]、芋[Colocasia esculenta Schott]、慈姑[Sagittaria L.]、荸荠[Eleocharis tuberosa Roem et.schult]、莼菜[Brasenia Schreberi Gmel]、菱角[Trap Spp.]、蒲菜[Typha Spp.],

  4. Danza Movimiento Terapia y desarrollo preverbal del sí mismo : estudio de caso de un niño con una enfermedad congénita grave

    OpenAIRE

    Bas Baslé, Teresa

    2015-01-01

    Treball de recerca que exposa un procés de Dansa Moviment Teràpia i estudi de cas dut a terme per una dansa moviment terapeuta amb un nen que pateix Esclerosis Tuberosa. Es parteix de l'anàlisi i observació del moviment que mostra l'infant en 3 fases (inici, meitat i final) de la intervenció a través de la Dansa Moviment Teràpia i s'exposen alguns canvis significatius en el perfil de moviment i el desenvolupament preverbal del self de l'infant.

  5. Mixoma cardíaco con diagnóstico prenatal. Presentación de un caso y revisión de literatura.

    OpenAIRE

    Ríos, Josías; Médico residente del Servicio de Cirugía Cardiovascular y Tórax. Instituto Nacional Cardiovascular (INCOR), EsSalud. Lima.; Chávarri, Fernando; Médico asistente del Departamento de Cardiopediatría. Instituto Nacional Cardiovascular (INCOR), EsSalud. Lima,; Morales, Gabriela; Médico asistente del Departamento de Cardiopediatría. Instituto Nacional Cardiovascular (INCOR), EsSalud. Lima,; Vera, Luis; Médico asistente del Departamento de Cardiopediatría. Instituto Nacional Cardiovascular (INCOR), EsSalud. Lima,; Zapatel, Carlos; Médico residente del Servicio de Cirugía Cardiovascular y Tórax. Hospital Hipólito Unanue. Lima.; Adrianzén, Manuel; Médico asistente del Departamento de Cardiopediatría. Instituto Nacional Cardiovascular (INCOR), EsSalud. Lima.

    2012-01-01

    El mixoma es la tumoración cardíaca más frecuente en el adulto, constituyendo aproximadamente el 50% de las mismas. En la edad pediátrica el tumor cardíaco más frecuente es el rabdomioma, generalmente asociado a esclerosis tuberosa. La presentación del mixoma en pacientes pediátricos es muy rara y más aun en la etapa neonatal. Presentamos el caso de una paciente de sexo femenino que fue sometida a cirugía a los 8 días de nacida por presentar dos tumoraciones intracardiacas diagnosticadas en l...

  6. Avaliação dos achados ao exame dos potenciais evocados do tronco cerebral em indivíduos com síndrome de West Evaluation of the brainstem evoked potentials in West syndrome

    OpenAIRE

    Alfredo Lopes Pereira Filho; Diego Augusto de Brito Malucelli; Líscia Lamenha Apolinario Ferreira; Fabiana Gonçalez-D'Ottaviano; José Alexandre Médicis da Silveira

    2004-01-01

    A síndrome de West é um tipo de espasmo infantil caracterizado por encefalopatia epiléptica associado a espasmos em flexão e deficiência mental de instalação no primeiro ano de vida e de etiologia incerta. Acredita-se ser determinada por diferentes fatores etiológicos como infeção intrauterina, esclerose tuberosa, asfixia perinatal ou afecções pós-natais. FORMA DE ESTUDO: Observacional coorte com corte transversal. MATERIAL E MÉTODO: No presente estudo dez pacientes com Síndrome de West foram...

  7. Tuberous sclerosis in a term newborn with opisthotonus - The value of ultrasound.

    Science.gov (United States)

    Poggiani, C; Laiolo, A; Bellini, M; Cavalli, P

    2008-03-01

    Sommario INTRODUZIONE: Vengono descritti il caso clinico e le anomalie ecografiche cerebrali di un neonato affetto da sclerosi tuberosa complessa, quadro malformativo raro con interessamento neurocutaneo e implicazioni genetiche. La diagnosi si basa sull'esame clinico, sulle indagini per imaging. METODI: Vengono confrontati i risultati ottenuti con le metodiche di indagine di riferimento (RM e US). Gli autori enfatizzano il fatto che, in assenza di una segnalazione ecografica prenatale, è importante fare affidamento sui segni clinici e impostare un corretto completamento diagnostico in epoca neonatale. CONCLUSIONI: L'ecografia transfontanellare occupa un ruolo importante anche nel neonato a termine.

  8. Propriedades físicas de solo e crescimento de batata-doce em diferentes sistemas de preparo

    Directory of Open Access Journals (Sweden)

    Amarílis Beraldo Rós

    2013-02-01

    Full Text Available Trabalhos sobre preparo reduzido em solos cultivados com raízes e tubérculos são escassos e controversos. Assim, este trabalho teve por objetivo avaliar o impacto de sistemas de preparo em propriedades físicas de um Argissolo Vermelho-Amarelo e no crescimento de raízes tuberosas de batata-doce. Para avaliação das propriedades físicas do solo, foi instalado experimento em blocos ao acaso, esquema de parcelas subdivididas. As parcelas corresponderam aos tratamentos: preparo convencional, com confecção de leiras, e preparo reduzido, com manutenção de palhada superficial e as subparcelas, às épocas de coleta: 120 e 180 dias após o plantio (DAP da cultura de batata-doce. Foram avaliados os atributos físicos densidade do solo, porosidade total, macro e microporosidade, resistência do solo à penetração e umidade gravimétrica do solo. Para avaliação do crescimento de raízes tuberosas de batata-doce, montou-se experimento em que as parcelas corresponderam às formas de manejo do solo, e as subparcelas às quatro épocas de colheita: 90, 120, 150 e 180 DAP. Avaliaram-se as relações comprimento/diâmetro e massa fresca individual/comprimento de raízes tuberosas. O preparo convencional do solo com confecção de leiras, em oposição ao preparo reduzido, promoveu menores valores de densidade do solo, resistência do solo à penetração e microporosidade, maiores valores de porosidade total e macroporosidade; proporcionou menor manutenção de água na camada superior do solo (0-0,15 m; e permitiu maior crescimento vertical de raízes tuberosas de plantas de batata-doce.

  9. Entering behavior of Gasteruption brachychaetum Schrottky (Hymenoptera, Gasteruptiidae into a nest of Hylaeus Fabricius (Hymenoptera, Colletidae

    Directory of Open Access Journals (Sweden)

    Antonio Carlos Cruz Macedo

    2012-09-01

    Full Text Available Nests of Hylaeus aff. guaraniticus (Schrottky, 1906 were parasited by females of Gasteruption brachychaetum Schrottky, 1906 in trap nests in São Paulo (Brazil. This is thefirst host record of a Gasteruptiidae in the Neotropical Region. The behavior of a G.brachychaetum female entering a host's nest is described as follows: an inquiline female hovered near the host's nest, landed and detected that a female of H. aff. guaraniticus was inside the nest, waited for the host female to fly out, entered backwards into the nest, remained there for almost six minutes, and then went out the nest. The development time of immature stages of G.brachychaetum varied between 16 and 299 days.

  10. Integrative study of a new cold-seep mussel (Mollusca: Bivalvia) associated with chemosynthetic symbionts in the Marmara Sea

    Science.gov (United States)

    Ritt, Bénédicte; Duperron, Sébastien; Lorion, Julien; Sara Lazar, Cassandre; Sarrazin, Jozée

    2012-09-01

    Recently, small Idas-like mussels have been discovered living on carbonate crusts associated with cold-seeps in the Marmara Sea. These mussels, here referred to as Idas-like nov. sp., differ morphologically and genetically from another species identified as Idas aff. modiolaeformis, living in the same type of ecosystem in the Nile Deep-Sea Fan (eastern Mediterranean Sea). A phylogenetic analysis confirms the distinction between the two species, which belong to highly divergent lineages. Carbon stable isotope values, as well as the detection of thiotroph-related bacteria in the gill tissue, support the presence of a symbiotic, thiotroph-derived nutrition. In contrast, Idas aff. modiolaeformis displays six different types of symbionts. Finally our size-frequency data suggest that the recruitment is continuous in the examined area. The present study extends the documented distribution of symbiont-bearing mussels to the Marmara Sea, and contributes to the characterisation of biological communities in this recently explored area.

  11. Magnetic phase transitions and magnetocaloric effect in layered intermetallic La0.75Sm0.25Mn2Si2 compound

    Science.gov (United States)

    Mushnikov, N. V.; Gerasimov, E. G.; Terentev, P. B.; Gaviko, V. S.; Yazovskikh, K. A.; Aliev, A. M.

    2017-10-01

    Magnetic and magnetothermal properties have been studied for the La0.75Sm0.25Mn2Si2 compound which has the spontaneous first-order antiferromagnetic to ferromagnetic (AF-F) transition at a temperature of 160 K. The transition is accompanied by the anisotropic lattice distortion. Isothermal entropy change has been estimated for different magnetic states using the heat capacity and magnetization data. Direct measurements of the adiabatic temperature change have been performed in the fields applied both along the easy c-axis and in the basal plane of a quasi-single crystal. Near the transition temperature, the AF-F transition can be realized in low magnetic fields, which makes such compounds attractive for magnetoelastic and magnetothermal applications.

  12. Science.gov (United States)

    De Quintana Sancho, A; Piris García, X; Valle García, J N; Hierro Cámara, M

    2016-12-30

    La alopecia frontal fibrosante (AFF) es un tipo de alopecia cicatricial cuya incidencia está aumentando de forma significativa en nuestro país. Se caracteriza por un retroceso en la línea de implantación del pelo a nivel frontotemporal que afecta mayoritariamente a mujeres postmenopaúsicas, con un impacto negativo en su calidad de vida. Se asocia a menopausia precoz en un 14% de los casos y a hipotiroidismo en un 15%. Con respecto al tratamiento, son los inhibidores de la 5α-reductasa, los fármacos que han demostrado mejoría de la enfermedad en un mayor número de casos. Presentamos un caso de AFF en una mujer de 77 años tratada con éxito con finasteride a dosis de 2,5mg/día.

  13. The micromammals (Lagomorpha, Eulipotyphla and Rodentia) from the Middle Pleistocene site of Cuesta de la Bajada (Teruel, Spain): Systematic study and paleoenvironmental considerations

    Energy Technology Data Exchange (ETDEWEB)

    Sese, C.; Soto, E.; Santonja, M.; Perez-Gonzalez, A.; Dominguez-Rodrigo, M.

    2016-07-01

    The micromammal association established in this work is the following: Lagomorpha: Oryctolagus cuniculus; Eulipotyphla: Crocidura cf. russula, cf. Sorex sp., Neomys sp., Soricidae indet. and Talpa sp.; and Rodentia: Eliomys quercinus, Apodemus cf. sylvaticus, Cricetulus (Allocricetus) bursae, Arvicola aff. sapidus, Microtus (Iberomys) brecciensis and Microtus (Terricola duodecimcostatus. This association is characteristic of the Middle Pleistocene. The morphological state of Cricetulus (A.) bursae, Arvicola aff. sapidus and Microtus (I.) brecciensis allows to place it in the advanced, but not final, Middle Pleistocene, which agrees with the numerical data of the site (243–337 ka) that places it in the MIS 8 or 9. The micromammals indicate the predominance of the open spaces with abundant vegetation mainly of herbaceous and bushes but also with some areas with trees. The climate would be of Mediterranean type, similar to the actual or perhaps a little milder and more humid. (Author)

  14. ASSESSMENT OF IN VIVO MECHANICAL MUSCLE FUNCTION IN PATIENTS WITH OSTEOARTHRITIS (OA) OF THE HIP; RELIABILITY

    DEFF Research Database (Denmark)

    Jensen, Carsten; Overgaard, Søren; Aagaard, Per

    2009-01-01

    -joint strength and power a novel setup. MATERIAL AND METHODS Isokinetic contractions for both knee and hip muscles were performed. Reliability for isometric muscle contractions in vivo was recorded and evaluated by use of within subject variability (CVW-S), Spearman correlation and Limits of Agreement (Lo......INTRODUCTION Muscle function in patients with hip OA is not well-studied. We established a new setup of tests in order to monitor patients before and after surgery with total hip arthroplasty (THA). A test-retest protocol was designed to evaluate the reproducibility of single- and multi......A). Both explosive muscle force characteristics (Rate of force development) and maximal isometric force (MVC) were obtained for the affected (aff) and non-affected (n-aff) leg (only data MVC for affected side in this abstract). 20 patients, (age 55.9 ± 4.8; height 174 ± 8; BMI 27.1 ± 4.5) with unilateral...

  15. A new species of Cacatuocotyle (Monogenea, Dactylogyridae) parasitizing two species of Astyanax (Ostariophysi, Characidae) in southern Brazil.

    Science.gov (United States)

    Gallas, Moisés; Calegaro-Marques, Cláudia; Amato, Suzana B

    2014-10-01

    A new species of Cacatuocotyle is described from the external surface of Astyanax aff. fasciatus and Astyanax jacuhiensis from Lake Guaíba, State of Rio Grande do Sul, Brazil. It differs from the other three species of the genus, recorded from Mexico and the State of Paraná, Brazil, by possessing an accessory piece with a long proximal portion, a U-shaped bar with irregular posterior margin in its midportion, and a haptor containing two circular thickenings with muscular anterior margins. Only one monogenean species, Urocleidoides astyanacis (= Characithecium costaricensis) was recorded for the host Astyanax aff. fasciatus, whereas none were known for A. jacuhiensis. This paper records a new host (A. jacuhiensis) for monogeneans in southern Brazil and extends southward with the geographical distribution of the genus Cacatuocotyle to the State of Rio Grande do Sul, Brazil.

  16. Cytogenetic divergence in two sympatric fish species of the genus Astyanax Baird and Girard, 1854 (Characiformes, Characidae) from northeastern Brazil

    Science.gov (United States)

    Medrado, Aline Souza; Ribeiro, Mavione Souza; Affonso, Paulo Roberto Antunes de Mello; Carneiro, Paulo Luíz Souza; Costa, Marco Antônio

    2012-01-01

    The fish genus Astyanax is widespread throughout the Neotropical region and is one of the most species-rich genera of the Characiformes. Cytogenetic studies of Astyanax have revealed marked intra- and interspecific diversity, with the identification of various species complexes. In this report, we describe the karyotypic structure of two sympatric species of Astyanax (Astyanax sp. and Astyanax aff. fasciatus) from the Middle Contas River basin in the northeastern Brazilian state of Bahia. Both species had 2n = 48 but differed in their karyotypic formulae. Small heterochromatic blocks and multiple nucleolar organizer regions (NORs) were identified in both species. Terminal CMA3+/DAPI− signals were observed in Astyanax sp. and A. aff. fasciatus, mostly coincident with NORs. These results show that chromosomal markers can be used to identify species in this fish complex. These markers can provide useful information for evolutionary studies and investigations on the mechanisms of chromosomal diversity in Astyanax. PMID:23271941

  17. New contribution in the study of the Pontian flora from Batoti (Mehedinti county

    Directory of Open Access Journals (Sweden)

    Florina Diaconu

    2004-09-01

    Full Text Available In Early Pontian deposits from Batoţi (Mehedinţi county has been described a macroflora formed, until now, of 35 taxa, many other being in course of determination. By this paper the floristic epitome is filled with other 10 taxa: Pinus sp. binae, Magnolia sp. aff. M. acuminata Linné, Sassafras subtriloba (Konno Tanai et Onoe, Ostrya sp. aff. O. virginiana (Miller C. Koch, Castanea gigas (Goepp. Iljinsk., Quercus cf. meuhlenbergii Engelmann, Juglans acuminata Al. Braun, Acer tricuspidatum Bronn, A. cf. campestre L. and Berchemia multinervis (Al. Br. Heer. The stage of knowledge of the Pontian flora from Batoţi contains 45 taxa. Trough the listed taxa the degree of confidence of the paleoecologycal and paleophytocenotical rendering grows.

  18. Quiver Varieties and Branching

    Directory of Open Access Journals (Sweden)

    Hiraku Nakajima

    2009-01-01

    Full Text Available Braverman and Finkelberg recently proposed the geometric Satake correspondence for the affine Kac-Moody group Gaff [Braverman A., Finkelberg M., arXiv:0711.2083]. They conjecture that intersection cohomology sheaves on the Uhlenbeck compactification of the framed moduli space of Gcpt-instantons on $R^4/Z_r$ correspond to weight spaces of representations of the Langlands dual group $G_{aff}^{vee}$ at level $r$. When $G = SL(l$, the Uhlenbeck compactification is the quiver variety of type $sl(r_{aff}$, and their conjecture follows from the author's earlier result and I. Frenkel's level-rank duality. They further introduce a convolution diagram which conjecturally gives the tensor product multiplicity [Braverman A., Finkelberg M., Private communication, 2008]. In this paper, we develop the theory for the branching in quiver varieties and check this conjecture for $G = SL(l$.

  19. Positive magnetoresistance and large magnetostriction at first-order antiferro ferromagnetic phase transitions in RMn2Si2 compounds

    Science.gov (United States)

    Gerasimov, E. G.; Mushnikov, N. V.; Koyama, K.; Kanomata, T.; Watanabe, K.

    2008-11-01

    The magnetostriction and magnetoresistance associated with the field-induced and spontaneous first-order antiferro-ferromagnetic (AF-F) phase transitions have been studied for quasi-single-crystalline samples of La0.25Sm0.75Mn2Si2, La0.25Y0.75Mn2Si2 and La0.27Y0.73Mn2Si2 compounds with natural layered ThCr2Si2-type structure. It was found that both the spontaneous and field-induced AF-F transitions are accompanied by a large volume magnetostriction ΔV/V≈2 × 10-3 and anisotropic linear changes of the lattice parameters Δa/a≈1.6 × 10-3, Δc/c≈-0.75 × 10-3. The field-induced AF-F magnetic phase transition has been observed in magnetic fields applied both along the c-axis and in the basal plane, and the magnetostriction value is virtually independent of the direction of applied field. It has been found also that the magnetoresistance is positive in these compounds (the value of the electrical resistance in the ferromagnetic state is higher than that in the antiferromagnetic state) for the fields applied both along the c-axis and in the basal plane. The value of the magnetoresistance observed along the c-axis is 30 times as high as that in the basal plane. The obtained results indicate that the electronic band structure changes are likely responsible for the AF-F magnetic phase transitions observed in the RMn2X2 compounds.

  20. Tro og Viden

    DEFF Research Database (Denmark)

    Pedersen, Jens Olaf Pepke

    2015-01-01

    tid at være forskere og troende kristne. Georges Lemaître kunne således som professor i astronomi udvikle Big Bang teorien, samtidig med at han var katolsk præst.Det har affødt en kritisk kommentar (den 24. juli) fra Torben Smith Sørensen, der har opfattet det, som om Lemaître blandede naturvidenskab...

  1. NETWORK SECURITY AT FMCG SECTOR

    OpenAIRE

    J. SZENDI

    2016-01-01

    FMCG plans might be suspended as a temporary solution in case poor economical climate. Many cases only some divisions of the factory need to be closed the rest can produce further. This situation usually affects the supply chain integrity procedures. Nowadays most of the plants are using computerised corporate governance, but this systems are usually developed as a bundle for the original factory layout. As soon as we take away a major part from the system, most of the procedures might be aff...

  2. Production of probiotic fresh white cheese using co-culture with Streptococcus thermophilus

    OpenAIRE

    Oktay Yerlikaya; Elif Ozer

    2014-01-01

    In this research, the probiotic Streptococcus thermophilus was inoculated into milk as co-culture to produce probiotic cheese. The effects of using Streptococcus thermophilus with other probiotic bacteria on cheese composition, and microbiological viability during 28 days of storage were investigated. Sensorial properties were determined only at 1st and 28th days of storage. The results showed that the use of Streptococcus thermophilus as co-culture in probiotic cheese production did not affe...

  3. Finding Bureaucracy

    OpenAIRE

    Rønningstad, Chris Andre

    2015-01-01

    This thesis will use survey data from Norwegian managers to answer the following research question: Are managers in public administrations more bureaucratic in their attitudes toward structure and values than managers in private enterprises? I will argue that the classical bureaucracy, as described by Max Weber, can be understood as defined by structure and values. One often disparages the structural elements of bureaucracy and forgets about the bureaucratic values. The mean scores from AFF's...

  4. Emergency units’ team leadership in case of increased workload

    OpenAIRE

    Kristjan Jovanov; Vasja Roblek

    2016-01-01

    Research Question: Are there any statistically significant differences in the characteristics of the management in emergency activities in cases of increased scope of workd depending on location institutions and by sex and age of the team members? Purpose: The purpose of the research was to find out what are the opinions from the members of the emergency team about managerial and communication skills of leaders of emergency teams in crisis situations, which in turn affe...

  5. 自己効力感に関する研究の展望と今後の課題 : 展望的自己効力感の提唱

    OpenAIRE

    西村, 薫; 野村, 亮太; 丸野, 俊一

    2012-01-01

    Changing self-efficacy is important for clinical support. Nonetheless, the past studies on self-efficacy do not explain (1) taking actions with low self-efficacy, (2) process of self-efficacy promotion, or (3) process of self-efficacy declination. To solve these issues, we proposed “Perspective Self-efficacy”, which includes ambiguous expectations that the future self can be positively changed. Perspective self-efficacy refers to ambiguous feelings that the self, as future prospects, can affe...

  6. Bovidae (artiodactyla, mammalia del mioceno medio de Tarazona de Aragon (depresión del Ebro, provincia de Zaragoza

    Directory of Open Access Journals (Sweden)

    Pereda-Suberbiola, X.

    2001-04-01

    Full Text Available In this paper cranial, dental and postcraneal fossil remains of the Bovidae family from Tarazona de Aragón are described. There are two forms in this Middle Miocene paleontological site of the Ebro Basin according to the metric and morphological characteristics of the dentition and hom cores. One form is referred to Eotragus and classified as E. aff. sansaniensis, showing more developed features than the other Iberian forms of the same genus. The other form is classified provisionally as aff. Tethytragus because it is quite similar to the Iberian Tethytragus langai and differs from Eotragus. The two bovids from Tarazona show differences in size, hypsodoncy and dental morphology, especially the differences of development and prominence of the styles/stylideds and ribs are obvious.Se describen restos fósiles dentarios, craneales y postcraneales pertenecientes a la familia Bovidae del yacimiento de Tarazona de Aragón. Según las características morfológicas y métricas de la dentición y los núcleos óseos, existen dos formas en este yacimiento del Mioceno medio de la Cuenca del Ebro. Una ha sido atribuida al género Eotragus y clasificada como E. aff. sansaniensis, mostrando características más derivadas que el resto de las formas ibéricas del mismo género. La otra se clasifica, provisionalmente, como aff. Tethytragus, ya que guarda similitudes con la especie ibérica Tethytragus langai y diferencias evidentes con respecto a Eotragus. Los dos taxones se diferencian netamente respecto a la talla, hipsodoncia y morfología de la dentición; sobre todo, las diferencias de desarrollo y prominencia de los estilos/estílidos y costillas mismos son evidentes.

  7. Effect of pregnancy on plasma phenobarbital concentrations in rats.

    OpenAIRE

    Moriyama,Masahiro; Domoto, Haruyo; Yamashita, Syoichi; Furuno,Katsushi; Oishi, Ryozo; Kawasaki,Hiromu; Gomita, Yutaka

    1995-01-01

    We examined the pharmacokinetics of phenobarbital before and during pregnancy in rats. Animals were divided into four groups: (a) control, (b) pregnant, (c) phenobarbital-treated, and (d) phenobarbital-treated pregnant groups. The increase in body weight of nonpregnant or pregnant rats was not influenced by long-term phenobarbital treatment. Plasma phenobarbital concentrations during the period of long-term phenobarbital treatment with a fixed dosage by body weight were not significantly affe...

  8. Psycho-neuro-endocrine-immune mechanisms of action of yoga in type II diabetes

    OpenAIRE

    Singh, Vijay Pratap; Khandelwal, Bidita; Sherpa, Namgyal T.

    2015-01-01

    Yoga has been found to benefit all the components of health viz. physical, mental, social and spiritual well being by incorporating a wide variety of practices. Pathophysiology of Type II DM and co-morbidities in Type II DM has been correlated with stress mechanisms. Stress suppresses body's immune system and neuro-humoral actions thereby aff ecting normal psychological state. It would not be wrong to state that correlation of diabetes with stress, anxiety and other psychological factors are ...

  9. Identifikace s organizační kulturou jako faktor pracovní spokojenosti

    OpenAIRE

    NOVÁKOVÁ, Andrea

    2013-01-01

    4 Abstract The bachelor thesis deals with the identification with an organisational culture as a job satisfaction factor. It is focused on the concept of organisational culture, its content, structure, formation, determinants, function and some specific typologies, then on the concept of organisational identification where there are emphasized its factors and its distinctive manifestations and as last on the concept of job satisfaction. The main attention is paid again to the factors that aff...

  10. Velfærdsteknologiske kompetencer på tegnebrættet

    DEFF Research Database (Denmark)

    Eriksen, Kathrine Krageskov; Schlüntz, Ditte Annette; Sillesen, Agnete Oline

    2015-01-01

    I de senere år er velfærdsteknologi blevet fremhævet som et væsentligt element i at skabe bedre og mere effektive løsninger på velfærdsområderne. Den velfærdsteknologiske udvikling og andre udviklingstendenser afføder kontinuerligt krav om ændringer af professionsuddannelserne. Med udgangspunkt i...

  11. The first recorded bloom of Pseudochattonella farcimen (Dictyochophyceae, Heterokonta, (Riisberg I., 2008 in the Gulf of Gdańsk

    Directory of Open Access Journals (Sweden)

    Maria Łotocka

    2009-03-01

    Full Text Available In April 2001 a local bloom of the heterokont phytoflagellate Pseudochattonella farcimen (Riisberg I., 2008 (initially named Chattonella aff. verruculosa was observed for the first time in the southern part of the Gulf of Gdańsk.The species occurred in high cell densities: the count was 11.5 × 106 cells dm-3 and the biomass 927.5 µgC dm-3.

  12. Reference: 794 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available rt was not completely eliminated in the NRT1.5 knockout mutant, and reduction of NRT1.5 in the nrt1.1 background did not affe... step. Mutation of the Arabidopsis NRT1.5 nitrate transporter causes defective root-to-shoot nitrate transpo...rt. 9 2514-28 18780802 2008 Sep The Plant cell Canivenc Geneviève|Gojon Alain|Hsu Po-Kai|Kuo Hui-Fe

  13. Paradokshåndtering og ritualproduktion

    DEFF Research Database (Denmark)

    Qvortrup, Lars

    Kan et moderne menneske tro på Gud? Og kan kirken give et sprog til denne tro? Disse spørgsmål afføder yderligere spørgsmål: Hvad mener vi med "tro", og hvad betyder "Gud"? Hvis "Gud" står for det, der er hinsides menneskelig viden, og hvis "tro" er overbevisning om, at ikke-viden findes, så kan ...

  14. Comparative analysis of conflict dynamics within private and public sector organizations / Werner Havenga

    OpenAIRE

    Havenga, Werner

    2004-01-01

    In South Africa, private and public sector organizations have been experiencing conflict at an increasing rate during the past few decades and especially the last ten years. The prominence and high level with which conflict is regarded in this new democracy has made the study of this phenomenon more relevant. Especially within business organizations, between individuals, groups, and at management level, the influence of transformation and affirmative action has steadily affe...

  15. Location of fractures and the characteristics of patients with atypical femoral fractures: analyses of 38 Japanese cases.

    Science.gov (United States)

    Hyodo, Kojiro; Nishino, Tomofumi; Kamada, Hiroshi; Nozawa, Daisuke; Mishima, Hajime; Yamazaki, Masashi

    2017-03-01

    The purpose of this study was to determine fracture location and the characteristics of patients with atypical femoral fractures (AFFs). We studied 38 AFFs in 34 patients admitted to our institution between November 2007 and July 2013. The diagnostic criteria for the AFFs were based on 2014 American Society of Bone and Mineral Research guidelines. We classified the fracture location as proximal, middle, or distal to trisect the femoral diaphysis from just distal to the lesser trochanter to just proximal to the supracondylar flare. Bowing was defined as a line through the inside of the tip of the great trochanter and a condylar center that was outside the medullary cavity. We investigated the fracture's location, existence of coronal bowing, and bisphosphonates (BPs), glucocorticoids (GCs), and proton pump inhibitors therapy. We analyzed associations between fracture location and demographic and clinical factors. Twelve fractures were proximal, 25 were middle, and one was distal. Nineteen limbs showed femoral bowing. Thirty-one patients received BP treatment-20 patients received alendronic acid, eight risedronic acid, and three minodronic acid. Fourteen patients received a GC, and 16 received a proton pump inhibitor. There was a significant association between coronal bowing and middle fracture locations, GC therapy and proximal fracture locations, and older age and middle fracture locations. Tall height and heavy weight had an association with proximal fracture location, and short height and light weight had an association with middle fracture location. In conclusion, we provide evidence supporting a causal relationship between BP-related severely suppressed bone turnover and AFFs. We also provide evidence supporting additional influences from altered distribution of mechanical stress with femoral bowing and various factors, such as GC therapy, age, body weight, and height, which might negatively affect bone intensity and quality and result in fracture.

  16. Primary ciliary dyskinesia: Kartagener syndrome in a family with a novel DNAH5 gene mutation and variable phenotypes

    OpenAIRE

    2015-01-01

    Background: Primary ciliary dyskinesia is a genetically heterogeneous autosomal recessive disorder with variable clinical manifestations, including chronic rhinosinusitis, otitis media, bronchitis, pneumonia, bronchiectasis, situs inversus totalis, reduced fertility in female patients and male infertility. The condition occurs as a result of abnormal ciliary structure and function. It is presented in early life with an estimated incidence of approximately 1/16,000–20,000. About 50% of the aff...

  17. Extracellular polysaccharides are involved in the attachment of Azospirillum brasilense and Rhizobium leguminosarum to arbuscular mycorrhizal structures

    OpenAIRE

    V Bianciotto; Andreotti, S.; Balestrini, R; Bonfante, P.; Perotto, S

    2009-01-01

    Arbuscular mycorrhizal (AM) fungi, one of the most important component of the soil microbial community, establish physical interactions with naturally occurring and genetically modified bacterial biofertilizers and biopesticides, commonly referred to as plant growth-promoting rhizobacteria (PGPR). We have used a genetic approach to investigate the bacterial components possibly involved in the attachment of two PGPR (Azospirillum and Rhizobium) to AM roots and AM fungal structures. Mutants aff...

  18. Extracción artesanal de colorantes naturales, una alternativa de aprovechamiento de la diversidad biológica del chocó, colombia

    OpenAIRE

    Pino Chalá, Wilber; Guerrero, Jair Enrique; Castro Rivas, Alvinxon; Castro, Anilio Alberto; Palacios, Jhon Arley; Castro, Anatilde

    2011-01-01

    Este trabajo muestra la extracción artesanal de colorantes naturales de 5 especies vegetales, Justicia chlorostachya (Insulina), Persea americana(Aguacate), Genipa americana (Jagua), Gliricidia sepium (Matarraton) y Solanum aff. Incomptum (Saúco), utilizadas tradicionalmente con esta finalidad en el municipio de Quibdó, Colombia, con el propósito de identificar y dar a conocer, nuevas alternativas de aprovechamiento sostenible de la diversidad biológica y de los recursos del Pacífico colombia...

  19. Theodor Adorno & Alban Berg: correspondence: 1925–1935, edited by Henri Lonitz, review

    OpenAIRE

    Dwyer, Benjamin

    2007-01-01

    This is an in-depth review of Theodor Adorno & Alban Berg: Correspondence: 1925–1935, edited by Henri Lonitz (Polity, 2005). The article explores the numerous musical contexts, and socio-political and cultural backgrounds to the letters between the composer and his pupil, Adorno. Among these are the numerous attempts by Adorno to influence Berg’s creative decisions through attempts to inject political agency into his work. The broader political currents of the war years, especially those aff...

  20. Positive magnetoresistance and large magnetostriction at first-order antiferro-ferromagnetic phase transitions in RMn{sub 2}Si{sub 2} compounds

    Energy Technology Data Exchange (ETDEWEB)

    Gerasimov, E G; Mushnikov, N V [Institute of Metals Physics, Ural Division of the Russian Academy of Science, Sofia Kovalevskaya Street, 18, 620041 Ekaterinburg (Russian Federation); Koyama, K; Watanabe, K [High Field Laboratory for Superconducting Materials HFLSM, Institute for Materials Research, Tohoku University, Sendai 980-8577 (Japan); Kanomata, T [Department of Applied Physics, Faculty of Engineering, Tohoku Gakuin University, Tagajo, Miyagi 985 (Japan)], E-mail: gerasimov@imp.uran.ru

    2008-11-05

    The magnetostriction and magnetoresistance associated with the field-induced and spontaneous first-order antiferro-ferromagnetic (AF-F) phase transitions have been studied for quasi-single-crystalline samples of La{sub 0.25}Sm{sub 0.75}Mn{sub 2}Si{sub 2}, La{sub 0.25}Y{sub 0.75}Mn{sub 2}Si{sub 2} and La{sub 0.27}Y{sub 0.73}Mn{sub 2}Si{sub 2} compounds with natural layered ThCr{sub 2}Si{sub 2}-type structure. It was found that both the spontaneous and field-induced AF-F transitions are accompanied by a large volume magnetostriction {delta}V/V{approx}2 x 10{sup -3} and anisotropic linear changes of the lattice parameters {delta}a/a{approx}1.6 x 10{sup -3}, {delta}c/c{approx}-0.75 x 10{sup -3}. The field-induced AF-F magnetic phase transition has been observed in magnetic fields applied both along the c-axis and in the basal plane, and the magnetostriction value is virtually independent of the direction of applied field. It has been found also that the magnetoresistance is positive in these compounds (the value of the electrical resistance in the ferromagnetic state is higher than that in the antiferromagnetic state) for the fields applied both along the c-axis and in the basal plane. The value of the magnetoresistance observed along the c-axis is 30 times as high as that in the basal plane. The obtained results indicate that the electronic band structure changes are likely responsible for the AF-F magnetic phase transitions observed in the RMn{sub 2}X{sub 2} compounds.

  1. Die Messung von psychosozialen Belastungen (Stress) in der Schwangerschaft als prognostische Faktoren für Schwangerschaftskomplikationen

    OpenAIRE

    2012-01-01

    Problem Pregnancy is a sensitive period in the life of a woman. Changes occur to organic, hormonal, and immunologic processes of adaptation prior to the development of the birth of the child. Complications often arise at this stage of pregnancy, such as abort, whose cause is often not medically explainable. It is assumed that psychosocial stress factors such as stress, have a decisive influence on the development of the fetus, especially the biological processes in the body can also be aff...

  2. Testbed for Advanced Mobile Solutions

    OpenAIRE

    Apell, Maria; Erman, David; Popescu, Adrian

    2010-01-01

    This paper describes the implementation of an IMS testbed, based on open source technologies and operating systems. The testbed provides rich communication services, i.e., Instant Messaging, Network Address Book and Presence as well as VoIP and PSTN interconnectivity. Our validation tests indicate that the performance of the testbed is comparable to similar testbeds, but that operating system virtualization signi ficantly aff ects signalling delays.

  3. Medical education research in GCC countries

    OpenAIRE

    Meo, Sultan Ayoub; Hassan, Asim; Aqil, Mansoor; Usmani, Adnan Mahmood

    2015-01-01

    Background Medical education is an essential domain to produce physicians with high standards of medical knowledge, skills and professionalism in medical practice. This study aimed to investigate the research progress and prospects of GCC countries in medical education during the period 1996–2013. Methods In this study, the research papers published in various global scientific journals during the period 1996–2013 were accessed. We recorded the total number of research documents having an aff...

  4. Factors that affect cancer patient compliance to oral anti-neoplastic therapy Factores que influyen en la adhesión de pacientes con cáncer a la terapia antineoplásica oral Fatores que influenciam a adesão de pacientes com câncer à terapia antineoplásica oral

    OpenAIRE

    Patrícia Andréa Crippa Marques; Angela Maria Geraldo Pierin

    2008-01-01

    OBJECTIVES: To identify factors that can affect compliance to treatment with neoplastic oral drugs in a group of cancer patients. METHODS: Interviews were performed on 61 patients diagnosed with cancer and under anti-neoplastic oral therapy in a private hospital. The interviews were carried out using instruments to assess compliance. RESULTS: Most patients (95%) reported the oral treatment was not difficult. The Morisky and Green Test were positive in 28% of the patients. Factors that may aff...

  5. Factors that affect cancer patient compliance to oral anti-neoplastic therapy

    OpenAIRE

    Marques,Patrícia Andréa Crippa; Pierin, Angela Maria Geraldo

    2008-01-01

    OBJECTIVES: To identify factors that can affect compliance to treatment with neoplastic oral drugs in a group of cancer patients. METHODS: Interviews were performed on 61 patients diagnosed with cancer and under anti-neoplastic oral therapy in a private hospital. The interviews were carried out using instruments to assess compliance. RESULTS: Most patients (95%) reported the oral treatment was not difficult. The Morisky and Green Test were positive in 28% of the patients. Factors that may aff...

  6. Atypical femoral fractures bilaterally in a patient receiving bisphosphonate: a case report

    Science.gov (United States)

    Moghnie, Alessandro; Scamacca, Veronica; De Fabrizio, Giovanni; Valentini, Roberto

    2016-01-01

    Summary Atypical femoral fractures are often associated with prolonged bisphosphonate use. The American Society for Bone and Mineral Research (ASBMR) has set the diagnosis criteria for atypical subtrochanteric and diaphyseal femoral fractures by classifying them according to their major and minor criteria. Prolonged bisphosphonate use is correlated with AFF, but the pathogenetic mechanism that causes this kind of fracture has not been defined yet. We describe simultaneous bilaterally femoral fractures in a 76-year-old woman. PMID:27252749

  7. Position Auctions with Externalities and Brand Effects

    OpenAIRE

    Hummel, Patrick; McAfee, R. Preston

    2014-01-01

    This paper presents models for predicted click-through rates in position auctions that take into account two possibilities that are not normally considered---that the identities of ads shown in other positions may affect the probability that an ad in a particular position receives a click (externalities) and that some ads may be less adversely affected by being shown in a lower position than others (brand effects). We present a general axiomatic methodology for how click probabilities are aff...

  8. A Computer-Based Information System for the Issue/Receipt Control Branch, Supply Department, Naval Postgraduate School.

    Science.gov (United States)

    1982-12-01

    relati ve urgency of this requirement against standards prescribed by the Uniform Material Movement and Issue Priority System (UHIVIPS). raz 01mma (j -i...Laccetti Joseph N. and Dorsey *Jpshua W., "MAP 11 ute~ X~ ton SI§tem, -3v~si. 3, Sq-T- aff- ~ !anage we -7uN if!I -2~r~ c nT eliIl -roup, Inc., 31 may

  9. The Relation between Attitudes toward Functional Foods and Satisfaction with Food-Related Life

    OpenAIRE

    Schnettler, B.; Adasme-Berríos , C.; K. G. Grunert; Márquez , M.P.; Lobos , G.; Salinas-Oñate, N.; Orellana, L; Sepúlveda, J

    2016-01-01

    Purpose – To assess the effect of attitudes towards functional foods (FF) on university students’ satisfaction with food-related life and to distinguish student typologies, considering that the attitudes towards FF are not homogeneous among consumers. Design/methodology - A survey was applied to 372 university students (mean age=20.4 years, SD=2.4) in southern Chile. The questionnaire included the Attitudes towards Functional Foods (AFF) questionnaire and the Satisfaction with Food-related Li...

  10. Sobre la presencia de Paraptenodytes y Palaeospheniscus (Aves: Sphenisciformes en la Formación Bahía Inglesa, Chile On the precense of Paraptenodytes y Palaeospheniscus (Aves: Sphenisciformes on the Bahia Inglesa Formation, Chile

    Directory of Open Access Journals (Sweden)

    MARTÍN F CHÁVEZ

    2007-06-01

    Full Text Available El presente comentario fue motivado por el artículo de Acosta-Hospitaleche & Canto (2005 y de la observación directa de algunos especímenes de Spheniscidae previamente reportados para la Formación Bahía Inglesa, en la región de Atacama, Chile. La falta de caracteres morfológicos que permitan la diferenciación con el género Spheniscus y de restos diagnósticos asociados, descartan la asignación de materiales craneales a Palaeospheniscus. Igualmente no es posible corroborar la asignación de especímenes a Paraptenodytes, sugiriéndose el uso de Spheniscidae indet. aff. Paraptenodytes para un tarsometatarso aislado. Se sugiere también el uso de Spheniscus spp. para los especímenes previamente referidos a S. cf. chilensis y S. aff. humboldti. De este modo, el número de pingüinos registrados en la formación se reduce de nueve a sieteThe present comment was motivated by the article by Acosta-Hospitaleche & Canto (2005, and from the direct observation of some specimens of Sphenicidae previously reported for the Bahia Inglesa Formation, in the Atacama region, Chile. The lack of morphological characters that they allow the differentiation with the genus Spheniscus and of associate diagnostic remains discard the assignment of cranial materials to Palaeospheniscus. Equally it is not possible to corroborate the assignment of specimens to Paraptenodytes, being suggested the use of Spheniscidae indet. aff. Paraptenodytes for an isolated tarsometatarsus. It is also suggested the use of Spheniscus spp. for the specimens previously referred to S. cf. chilensis and S. aff. humboldti. This way, the number of penguins registered in the formation decreases from nine to seven

  11. New records of Forcipomyia (Pterobosca) incubans (Diptera: Ceratopogonidae) parasitizing wings of Odonata in Brazil

    OpenAIRE

    Guillermo-Ferreira, Rhainer; Vilela,Diogo Silva

    2013-01-01

    Forcipomyia (Pterobosca) incubans Macfie (1937) (Diptera: Ceratopogonidae) is recorded here for the first time for Brazil. Females were collected in the Brazilian Neotropical Savanna parasitizing the wings of Erythrodiplax juliana Ris (1911), Erythrodiplax aff. anomala Brauer (1865) and Erythemis credula Hagen (1861), all Libellulidae dragonflies. A map of potential distribution of this species in the New World is also provided. The results suggest that its distribution may range from souther...

  12. Proceedings (Supplement), AFCRL Scientific Balloon Symposium (8th) 30 September to 3 October 1974

    Science.gov (United States)

    1974-12-02

    fiberglass shell with a rigid PVC foam plastic core. (See Figure 12.) These materials are relatively non-sensitive to ultraviolet degradation. The...rot ’rh 1-1ectica Fil ,Cv-u l ldh ilio isu Iýigure 19. plýutf_)tN.pe (),)tic-; sNAcri Te.-ited During Fine [A)(,k Program Olt, Aff Amon ITIV FiE

  13. Évaluation de la toxicité de pesticides sur quatre niveaux trophiques marins : microalgues, échinoderme, bivalves et poisson

    OpenAIRE

    Amara, Anis

    2012-01-01

    This work aims to study the effects of a few pesticides and one adjuvant on marine organisms, representatives of four trophic levels : micro-algae, echinoderm, bivalves and fish. Analysis of the pollu-sensitivity was based on the utilisation of existing bio-assays or adapted to this study.Phytotoxic assessments were conducted on three phytoplanktonic species (Chaetoceros calcitrans, Isochrysis aff. Galbana et Tetraselmis suecica) using the fungicide epoxiconazole and the adjuvant nonylphenol....

  14. Assessing Stop-Loss Policy Options through Personnel Flow Modeling

    Science.gov (United States)

    2014-01-01

    precipitated the adoption of stop-loss and that can aff ect decisions regarding its replacement. Performance of Base-Case Systems with Stop-Loss 21...SANTA MONICA, CA 90407-2138 OFFICES SANTA MONICA, CA WASHINGTON, DC PITTSBURGH, PA NEW ORLEANS, LA/JACKSON, MS BOSTON, MA DOHA, QA ABU DHABI, AE CAMBRIDGE, UK BRUSSELS, BE REPRESENTATIVE OFFICE MEXICO CITY, MX www.rand.org

  15. TLC-image analysis of non-chromophoric tuberostemonine alkaloid derivatives in Stemona species.

    Science.gov (United States)

    Kongkiatpaiboon, Sumet; Keeratinijakal, Vichien; Gritsanapan, Wandee

    2013-08-01

    A simple, selective, precise, and accurate thin-layer chromatographic (TLC) image analytical method was developed and validated for simultaneous quantification of the major components in the root extracts of Stemona tuberosa (tuberostemonine, tuberostemonine N and neotuberostemonine)), and S. phyllantha (tuberostemonine and tuberostemonine A). The analysis was performed by TLC on silica gel 60 F254 aluminum plates using a mixture of dichloromethane: ethyl acetate: methanol: ammonium hydroxide (50:45:4:1) as mobile phase. Post-derivatization was employed by dipping the TLC plate into Dragendorff's reagent to visualize the spots. Image analysis of the scanned TLC plate was performed to detect the contents of tuberostemonine derivatives. The polynomial regression data for the calibration plots showed good linear relationships within the concentration range of 2-7 microg/spot. The method gave satisfactory precision, accuracy, selectivity and could simultaneously quantify tuberostemonine, tuberostemonine A, tuberostemonine N and neotuberostemonine. Dried powdered roots of S. tuberosa grown in Thailand contained 1.31 +/- 0.28, 1.63 +/- 0.18 and 1.24 +/- 0.27% tuberostemonine, tuberostemonine N, and neotuberostemonine (dry weight), respectively, while S. phyllantha roots contained 1.39 +/- 0.14% tuberostemonine and 0.39 +/- 0.08% tuberostemonine A (dry weight). The proposed method was simple, inexpensive, and more accessible to apply for many local authorities and small laboratories.

  16. Deficiência nutricional em mudas de umbuzeiro decorrente da omissão de macronutrientes Nutritional deficiency in "umbuzeiro" seedlings caused by the omission of macronutrients

    Directory of Open Access Journals (Sweden)

    Francisco César Gonçalves

    2006-06-01

    Full Text Available O objetivo deste trabalho foi avaliar o crescimento e os sintomas visuais de deficiência de macronutrientes em mudas de umbuzeiro, Spondias tuberosa, cultivadas em solução nutritiva completa e com omissão individual de N, P, K, Ca, Mg e S. As ausências de Ca, N, Mg e K provocaram redução do crescimento das mudas. A omissão de macronutrientes provocou alterações morfológicas características da deficiência nutricional. Observa-se maior exigência em N, K, Ca e Mg na fase inicial de crescimento e a redução na massa de matéria seca total segue a ordem: Ca > N > K > Mg > S > P.The objective of this work was to evaluate the growth and the visual symptoms of macronutrients deficiency in "umbuzeiro" seedlings (Spondias tuberosa cultivated on complete nutritive solution and on solution with individual omission of N, P, K, Ca, Mg and S. The absences of Ca, N, Mg and K caused a reduction in seedling growth. The omission of individual macronutrients conducted to morphological disorders related to the nutritional deficiency. A higher requirement of N, K, Ca and Mg is observed during the initial phase of the growth, and the reduction in total dry matter follows the order: Ca > N > K > Mg > S > P.

  17. Crescimento e desenvolvimento de clones de cajazeira cultivados na chapada do Apodi, Ceará Growth and development of clones hogplum cultived in Apodi Plateau, Ceará, Brazil

    Directory of Open Access Journals (Sweden)

    Francisco Xavier de Souza

    2006-12-01

    randomized block design was used with a factorial 5x2 (5 scions on 2 rootstocks, with 4 replicates and 4 plants per plot. Scions stem from superior plants collected in the counties of Caucaia (Capuan locality, Pacajus (Curimatã locality, Maranguape (Gereau e Ladeira Grande localities and Fortaleza (Lagoa Redonda locality. Rootstocks were prepared from seeds of S. mombin L. and S. tuberosa Arruda. All scions and rootstocks were collected in Ceará State. The parameters assessed were the vegetative growth and fruit setting. Clones Gereau and Lagoa Redonda were the most vigorous, higher (3.9 m and with bigger stem girth (57 cm. Ladeira Grande showed the poorest peformance in hight (2.2 m and stem girth (49 cm and, being statistically different from the others. As far as the root-stocks are concerned those from S. mombim were superior to S. tuberosa. The stem girth ratio was less than 1.0 for S. mombin rootstocks and higher than 1.0 for S. tuberosa rootstocks. The number of fruits per bunch of studied clones presented values of raged from 8 to 76. Some plants of Lagoa Redonda and Gereau clones on S. tuberosa yielded from 100 to 300 bunches. Final results confirmed that scions of S. mombin grafted on rootstocks of S. mombin and S. tuberosa produced combinations with the following characterists: vigorous clones with distinct phenotypic and morphological features such as low hight, uniform canopies and standardized main stem growth; S. mombin rootstocks allowed the formation of plants with more vigorous stems compared with rootstocks of S. tuberosa; the stem girth, graft and rootstock ratios were higher for combinations on S. tuberosa, but without indications of grafting incompatibility; the rootstock of S. tuberosa increase plant hight, productive and precocious of clones Gereau e Lagoa Redonda, and clone Ladeira Grande showed the lowest hight.

  18. MOSCAS-DAS-FRUTAS (DIPTERA: TEPHRITIDAE EM POMARES DA ÁREA URBANA NO NORTE DE MINAS GERAIS

    Directory of Open Access Journals (Sweden)

    CLARICE DINIZ ALVARENGA

    2010-01-01

    Full Text Available The aim this work was know the species of fruit fly and host plants in orchards in the urban area in the north of Minas Gerais. Were selected 10 orchards with wide variety of fruit species, which were distributed in equidistant way in the urban area of Janaúba, MG. Weekly, were collected systematically fruit flies through trap type McPhail and ripe fruit and in ripening one, on those orchards. Were collected 7.016 tephritid obtained from trap (5.226 and fruit (1.790, from which 1.044 belonged to genus Anastrepha and 5.972 were Ceratitis capitata. The specimens number of C. capitata (85.1% was around six times superior to Anastrepha spp. (14.9%, demonstrating the preference of this species for urban orchards. Eight species of Anastrepha occur in urban orchards of Janaúba, MG. Ceratitis capitata was found infesting 10 species of host fruits, being the main S. purpurea and guava. In fruits were collected three species of Anastrepha (A. obliqua, A. sororcula and A. zenildae which were associated with five species of fruit (Malpighia glabra L, Psidium guayava L, S. dulcis, S. purpurea and S. tuberosa. The predominant species of Anastrepha was A. obliqua, and S. tuberosa and S. purpurea being the main hosts of this species in the urban area of Janaúba, MG.

  19. Functionality of Selected Aromatic Lamiaceae in Attracting Pollinators in Central Spain.

    Science.gov (United States)

    Barbir, Jelena; Azpiazu, Celeste; Badenes-Pérez, Francisco R; Fernández-Quintanilla, César; Dorado, José

    2016-04-01

    Planting floral margins in agricultural landscapes has been shown to increase the abundance of pollinators in agro-ecosystems. However, to create efficient margins, it is necessary to use attractive, not weedy native plants with different blooming periods to prolong the availability of floral resources. Six native perennial plants of the Lamiaceae with different blooming periods were studied in a randomized block design, with the final aim to select the most efficient plants in floral mixtures by studying relationships between their floral phenology, floral density, and attractiveness to pollinators in Central Spain. In addition, their spatial expansion, i.e., potential weediness, was estimated under the field conditions, as the final purpose of the plants is to be implemented within the agro-ecosystems. The results showed that plant species with higher floral density (Nepeta tuberosa L. and Hyssopus officinalis L.) showed significantly higher attractiveness to pollinators and enhanced the attractiveness of floral mixtures. Species that bloomed in early spring (Salvia verbenaca L.) and in summer (Melissa officinalis L. and Thymbra capitata L.) did not efficiently contribute to the attractiveness of the mixtures to pollinators. In addition, besides high floral density of Salvia officinalis L. and N. tuberosa in the spring, warm and dry weather in spring 2012 enhanced the activity of bees, while cold and rainy weather in spring 2013 enhanced the activity of hoverflies. None of the plants showed weedy growth and so posed no danger of invading adjacent crops.

  20. Activity of Medicinal Plant Extracts on Multiplication of Mycobacterium tuberculosis under Reduced Oxygen Conditions Using Intracellular and Axenic Assays

    Directory of Open Access Journals (Sweden)

    Purva D. Bhatter

    2016-01-01

    Full Text Available Aim. Test the activity of selected medicinal plant extracts on multiplication of Mycobacterium tuberculosis under reduced oxygen concentration which represents nonreplicating conditions. Material and Methods. Acetone, ethanol and aqueous extracts of the plants Acorus calamus L. (rhizome, Ocimum sanctum L. (leaf, Piper nigrum L. (seed, and Pueraria tuberosa DC. (tuber were tested on Mycobacterium tuberculosis H37Rv intracellularly using an epithelial cell (A549 infection model. The extracts found to be active intracellularly were further studied axenically under reducing oxygen concentrations. Results and Conclusions. Intracellular multiplication was inhibited ≥60% by five of the twelve extracts. Amongst these 5 extracts, in axenic culture, P. nigrum (acetone was active under aerobic, microaerophilic, and anaerobic conditions indicating presence of multiple components acting at different levels and P. tuberosa (aqueous showed bactericidal activity under microaerophilic and anaerobic conditions implying the influence of anaerobiosis on its efficacy. P. nigrum (aqueous and A. calamus (aqueous and ethanol extracts were not active under axenic conditions but only inhibited intracellular growth of Mycobacterium tuberculosis, suggesting activation of host defense mechanisms to mediate bacterial killing rather than direct bactericidal activity.

  1. Cytogenetic analysis of three sea catfish species (Teleostei, Siluriformes, Ariidae) with the first report of Ag-NOR in this fish family

    Science.gov (United States)

    2010-01-01

    Despite their ecological and economical importance, fishes of the family Ariidae are still genetically and cytogenetically poorly studied. Among the 133 known species of ariids, only eight have been karyotyped. Cytogenetic analyses performed on Genidens barbus and Sciades herzbergii revealed that both species have 2n = 56 chromosomes and Cathorops aff. mapale has 2n = 52 chromosomes: Genidens barbus has 10 Metacentrics (M), 14 Submetacentrics (SM), 26 Subtelocentrics (ST), and 6 Acrocentrics (A), Sciades herzbergii has 14M, 20SM, 18ST and 4A, whereas Cathorops aff. mapale has 14M, 20SM, and 18ST. The nucleolus organizer regions (NORs) were found in a single chromosome pair on the short arm of a large-sized ST pair in Genidens barbus and on the short arm of a middle-size SM pair in Cathorops aff. mapale. Multiple NORs on the short arms of two large-sized ST pairs were found in Sciades herzbergii. The occurrence of diploid numbers ranging from 2n = 52 through 56 chromosomes and the presence of different karyotypic compositions, besides the number and position of NORs suggest that several numeric and structural chromosome rearrangements were fixed during the evolutionary history of this fish family. PMID:21637480

  2. Punição corporal aplicada por funcionários de duas escolas públicas brasileiras: prevalence in two public schools

    Directory of Open Access Journals (Sweden)

    Ana Carina Stelko-Pereira

    2011-12-01

    Full Text Available Esse estudo identificou casos de alunos vítimas de agressões físicas por parte de funcionários de escolas brasileiras e verificou sua relação com características demográficas, depressão e engajamento escolar. Responderam ao Questionário de Investigação de Prevalência de Violência Escolar, ao Inventário de Depressão Infantil e à Escala de Engajamento Escolar 396 estudantes de duas escolas públicas. No total, 21 alunos foram agredidos fisicamente por funcionários (AFF. Houve diferenças significativas entre o grupo AFF e o dos que não foram agredidos fisicamente (NAFF. No primeiro houve maior proporção de alunos do sexo feminino, de alunos violentos com os pares e de alunos vítimas de colegas, e maior índice de depressão. Não houve diferenças significativas entre os grupos quanto aos aspectos idade, escolaridade, reprovação e engajamento escolar. Supõe-se que o aluno AFF apresente comportamentos de agressão aos colegas e funcionários da escola e que por isso seja agredido, o que o levaria a continuar sendo agressivo com os outros. Tal hipótese deve ser investigada em estudos futuros.

  3. Bilateral Incomplete Atypical Femoral Fracture due to Long-Term Bisphosphonate Use: A Case Report

    Directory of Open Access Journals (Sweden)

    Sibel Başaran

    2017-08-01

    Full Text Available Although the overall safety profile of bisphosphonates (BP is favorable, adverse effects associated with long-term use have came up during recent years. In this report, a case of bilateral incomplete atypical femoral fracture (AFF due to prolonged BP use was presented. A 69-year-old patient, who has been in surgical menopause for 20 years and was started on BP following vertebral fracture almost 10 years ago, was admitted with thigh pain, which was increased two weeks ago. On physical examination, she had antalgic gait, increased thoracic kyphosis and tenderness to percussion over the thoracolumbar region. Lateral cortical thickness in the subtrochanteric region of both femurs and cortical radiolucency on the left femur were observed on plain radiography. Loss of height in L3 and L4 vertebrae was detected on vertebral radiography. Serum 25-hydroxy vitamin D [25(OHD], parathyroid hormone, alkaline phosphatase and calcium levels, along with osteoporosis markers were all within the normal ranges. As the patient was diagnosed with AFF, BP therapy was terminated and vitamin D-calcium supplementation was continued. Since she did not have severe pain, conservative management (limited weight bearing, using a walking stick was recommended for 3 months. Teriparatide therapy was started and she was discharged with recommendations. AFF, which is a rare disorder, should be kept in mind in patients on long-term BP treatment who are admitted with thigh pain and, necessary interventions should be tailored before the occurrence of complete fracture.

  4. Atypical subtrochanteric femoral shaft fractures: role for mechanics and bone quality.

    Science.gov (United States)

    van der Meulen, Marjolein C H; Boskey, Adele L

    2012-08-29

    Bisphosphonates are highly effective agents for reducing osteoporotic fractures in women and men, decreasing fracture incidence at the hip and spine up to 50%. In a small subset of patients, however, these agents have recently been associated with 'atypical femoral fractures' (AFFs) in the subtrochanteric region or the diaphysis. These fractures have several atypical characteristics, including occurrence with minimal trauma; younger age than typical osteoporotic fractures; occurrence at cortical, rather than cancellous sites; early radiographic appearance similar to that of a stress fracture; transverse fracture pattern rather than the familiar spiral or transverse-oblique morphologies; initiation on the lateral cortex; and high risk of fracture on the contralateral side, at the same location as the initial fracture. Fracture is a mechanical phenomenon that occurs when the loads applied to a structure such as a long bone exceed its load-bearing capacity, either due to a single catastrophic overload (traumatic failure) or as a result of accumulated damage and crack propagation at sub-failure loads (fatigue failure). The association of AFFs with no or minimal trauma suggests a fatigue-based mechanism that depends on cortical cross-sectional geometry and tissue material properties. In the case of AFFs, bisphosphonate treatment may alter cortical tissue properties, as these agents are known to alter bone remodeling. This review discusses the use of bisphosphonates, their effects on bone remodeling, mechanics and tissue composition, their significance as an effective therapy for osteoporosis, and why these agents may increase fracture risk in a small population of patients.

  5. Odor discrimination in classical conditioning of proboscis extension in two stingless bee species in comparison to Africanized honeybees.

    Science.gov (United States)

    Mc Cabe, S I; Hartfelder, K; Santana, W C; Farina, W M

    2007-11-01

    Learning in insects has been extensively studied using different experimental approaches. One of them, the proboscis extension response (PER) paradigm, is particularly well suited for quantitative studies of cognitive abilities of honeybees under controlled conditions. The goal of this study was to analyze the capability of three eusocial bee species to be olfactory conditioned in the PER paradigm. We worked with two Brazilian stingless bees species, Melipona quadrifasciata and Scaptotrigona aff. depilis, and with the invasive Africanized honeybee, Apis mellifera. These three species present very different recruitment strategies, which could be related with different odor-learning abilities. We evaluated their gustatory responsiveness and learning capability to discriminate floral odors. Gustatory responsiveness was similar for the three species, although S. aff. depilis workers showed fluctuations along the experimental period. Results for the learning assays revealed that M. quadrifasciata workers can be conditioned to discriminate floral odors in a classical differential conditioning protocol and that this discrimination is maintained 15 min after training. During conditioning, Africanized honeybees presented the highest discrimination, for M. quadrifasciata it was intermediate, and S. aff. depilis bees presented no discrimination. The differences found are discussed considering the putative different learning abilities and procedure effect for each species.

  6. THE APPEARANCE OF THE GENUS DESHAYESITES (KAZANSKY, 1914, AMMONOIDEA IN THE LOWERMOST APTIAN (LOWER CRETACEOUS OF LA BÉDOULE (SE FRANCE

    Directory of Open Access Journals (Sweden)

    FABRIZIO CECCA

    1999-07-01

    Full Text Available New palaeontological and biostratigraphic investigations were carried out at La Bédoule (SE France, which is the stratotype-area of the Bedoulian (Lower Aptian. The levels that directly overlie the last Barremian Pseudocrioceras-bearing bed revealed the occurrence of a fauna characterized by previously undescribed macroconchs of the genus Deshayesites, that we included in Deshayesites bedouliensis n. sp. and in D. aff. consobrinus (d’Orbigny. These forms are associated with the species Deshayesites antiquus Bogdanova, D. oglanlensis Bogdanova, D. cf. weissiformis Bogdanova, D. aff. weissiformis Bogdanova in Delanoy, D. cf. planicostatus Bogdanova, and D. aff. normani Casey. These ammonites characterize the basal Aptian Deshayesites tuarkyricus Zone. This Zone was defined in Turkmenistan but its recognition in the Mediterranean Tethys is confirmed by the present study. Contrary to previous assertions, the genus Prodeshayesites (which pre-dates Deshayesites in northern Germany and southern England, whose FAD was taken to mark the base of the Aptian, is absent at La Bédoule. Prodeshayesites is absent also in Turkmenistan and in all other Mediterranean localities. The FAD of the genus Deshayesites is taken to mark the base of the Aptian in the Mediterranean area. 

  7. Adjuvant Teriparatide Therapy for Surgical Treatment of Femoral Fractures; Does It Work?

    Science.gov (United States)

    Kim, Jung Taek; Jeong, Hyung Jun; Lee, Soong Joon; Kim, Hee Joong

    2016-01-01

    Purpose Atypical femoral fracture (AFF), periprosthetic femoral fracture (PPFF) and femoral nonunion (FNU) are recalcitrant challenges for orthopedic surgeons. Teriparatide (TPTD) had been demonstrated to have anabolic effects on bone in various studies. We postulated that adjuvant TPTD after operation would enhance biologic stimulation for bone formation. We investigated (1) whether the adjuvant TPTD could achieve satisfactory union rate of surgically challenging cases such as displaced AFF, PPFF and FNU; (2) whether the adjuvant TPTD could promote development of abundant callus after surgical fixation; (3) whether the adjuvant TPTD had medically serious adverse effects. Materials and Methods Thirteen patients who agreed to off label use of TPTD in combination of operation were included in this retrospective case series. Median patients' age was 68.7 years, and there were three male and ten female patients. Their diagnoses were nonunion in six patients and acute fracture in seven. Medical records and radiographic images were reviewed. Results Twelve of thirteen fractures were united both clinically and radiologically within a year after adjuvant TPTD. Union completed radiologically median 5.4 months and clinically 5.7 months after the medication, respectively. Callus appeared abundantly showing median 1.4 of fracture healing response postoperatively. There was no serious adverse reaction of medication other than itching, muscle cramp, or nausea. Conclusion Even appropriate surgical treatment is a mainstay of treatment for AFF, PPFF, and FNU, the current report suggested that adjuvant TPTD combined with stable fixation results in satisfactory outcome for the challenging fractures of femur. PMID:27777917

  8. Extração de ecdisterona em raízes de ginseng brasileiro Extraction of ecdysterone from roots of Brazilian ginseng

    Directory of Open Access Journals (Sweden)

    Rejane Flores

    2009-07-01

    Full Text Available Este estudo teve como objetivo otimizar a extração de ecdisterona em raízes de ginseng brasileiro. Primeiramente, para se avaliar a eficiência do solvente extrator, amostras de raízes dois acessos (BRA e JB-UFSM de P. glomerata foram extraídas em Soxhlet com metanol e clorofórmio, separadamente, durante 4 horas. No segundo ensaio, com o intuito de se escolher o método extrator, a extração foi conduzida em Soxhlet e em ultrassom, utilizando metanol como solvente. Em P. tuberosa, as amostras foram extraídas com metanol, e a extração foi conduzida em Soxhlet e em banho ultrasônico. O conteúdo de ecdisterona foi determinado em Cromatógrafo Líquido de Alta Eficiência (CLAE. Em ambas as espécies, um maior conteúdo de ecdisterona foi detectado nas amostras extraídas com metanol e em Soxhlet. A metodologia proposta mostrou-se eficaz para a quantificação da ecdisterona a partir das raízes de P. glomerata e P. tuberosa, podendo ser aplicada no controle de qualidade de drogas vegetais e/ou fitoterápicos.This study aimed at optimizing the extraction method from ecdysterone of Brazilian ginseng. Root samples of two accessions (BRA and JB-UFSM of P. glomerata were extracted in a Soxhlet with methanol or chloroform for 4h. In the second trial, the extration was conduced in a Soxhlet or ultrasonic using metanol as a solvent. In P. tuberosa, the roots samples were extracted with methanol in a Soxhlet or in ultrasonic. The ecdysterone content was determinated using high efficiency liquid chromatography methods. In both studied species, the highest ecdisterone content was detected from samples extracted in a Soxhlet and using methanol as a solvent. This extration method has been successfully applied for determination of ecdysterone content from roots of Brazilian ginseng, and could be useful for the quality control of drugs and pharmaceutical formulations.

  9. Caracterização morfoagronômica e coeficientes de trilha de caracteres componentes da produção em mandioca Morphoagronomic characterization and path analysis of production components in cassava clones

    Directory of Open Access Journals (Sweden)

    Carlos Nick Gomes

    2007-08-01

    Full Text Available Os objetivos deste trabalho foram caracterizar agronomicamente cem clones de mandioca (Manihot esculenta Crantz e calcular os coeficientes de trilha entre a produção de raízes tuberosas e cinco componentes da produção, de modo a auxiliar na seleção de clones superiores. O experimento foi conduzido em área experimental da Universidade Federal de Lavras, em 2005 e 2006. Cem clones de mandioca foram avaliados em delineamento látice quadrado 10x10. A unidade experimental foi constituída por quatro plantas espaçadas de 1,0x0,6 m. As análises estatísticas foram realizadas considerando-se as oito características individualmente, utilizando-se o teste de Scott-Knott para agrupamento das médias. Os clones 87 e 88 mostraram-se promissores tanto para serem utilizados em cruzamentos quanto para fixação como novas cultivares em virtude do excelente desempenho nas características comprimento, número e produção de raízes tuberosas por planta. A análise de trilha mostrou que o número de raízes por planta e o peso total da parte aérea podem ser utilizados como critérios na seleção indireta para produção de raízes tuberosas em mandioca.The objectives of this work were to perform the agronomic characterization of 100 cassava plants (Manihot esculenta Crantz and to obtain path coefficients analysis between the storage root production (basic variable and five production components (explanative variable. The experiment was conducted at a research farm of Universidade Federal de Lavras, Minas Gerais State, Brazil, in square lattice (10x10, with two replications, using 100 clones and four plants per plot. Statistical analyses were accomplished considering the eight characteristics individually. The Scott-Knott's test was used for grouping the means. Clones 87 and 88 showed to be promising both to be used in crossings and to be fixed as new cultivate, due to their excellent performance in the characteristics: length, number and storage

  10. Avaliação de clones de batata-doce em Vitória da Conquista Evaluation of sweet potato clones in Vitória da Conquista

    Directory of Open Access Journals (Sweden)

    Adriana D. Cardoso

    2005-12-01

    Full Text Available Clones de batata-doce foram avaliados em Vitória da Conquista, em experimento, composto por 16 clones oriundos de Janaúba (MG, de Viçosa (MG, Bom Jardim de Minas (MG, Gurupi (TO, Santo Antônio da Platina (PR, Holambra II (SP, Vitória da Conquista (BA e Condeúba (BA. Os clones avaliados foram: 1; 2; 7; 9; 14; 15; 17; 19; 23; 25; 29; 30; 36; 38; 44 e 100. Utilizou-se o delineamento em blocos casualizados, com 16 tratamentos e 3 repetições. Foram avaliadas as características das raízes tuberosas: produtividade total, peso médio total, produtividade comercial, peso médio comercial, comprimento, diâmetro e formato. Ainda avaliou-se: resistência a insetos de solo e peso de ramas. Os dados foram submetidos à análise de variância e as médias comparadas pelo teste de ScottKnott a 5% de probabilidade. Os clones 1; 7; 25; 29 e 38 destacaram-se em produtividade de raízes tuberosas e os clones 1; 2; 7; 9; 17; 25; 29 e 36 em peso de ramas. Os clones 1; 25 e 36 apresentaram melhor comportamento para o comprimento de raízes tuberosas.Sweet potato clones were evaluated in Vitória da Conquista, Bahia State, Brazil. Sixteen clones (1; 2; 7; 9; 14; 15; 17; 19; 23; 25; 29; 30; 36; 38; 44 and 100, originating from Janaúba, Viçosa, Bom Jardim de Minas, Gurupi, Santo Antônio da Platina, Holambra II, Vitória da Conquista and Condeúba were analyzed. Random plots were utilized with 16 treatments and three repetitions. The following characteristics were evaluated: total root yield, average root weight; commercial root yield; average commercial root weight; length, diameter and form of the roots; resistance to soil insects and branch weight. The data were submitted to variance analysis and ScottKnott test with 5% probability. Clones 1; 7; 25; 29 and 38 stood out in root yield and the clones 1; 2; 7; 9; 17; 25; 29 and 36 stood out in branch weight. Clones 1; 25 and 36 presented the best results concerning the length of roots.

  11. Efeito do nitrogênio em características agronômicas da mandioca Effect of nitrogen in the agronomic characteristics of cassava

    Directory of Open Access Journals (Sweden)

    Nelson dos Santos Cardoso Júnior

    2005-01-01

    Full Text Available Para avaliar o efeito do nitrogênio em características agronômicas de mandioca (Manihot esculenta Crantz foi desenvolvido um experimento na Universidade Estadual do Sudoeste da Bahia, em Vitória da Conquista (BA, no período de abril de 2002 a março de 2003. Estudou-se a aplicação de seis doses de nitrogênio (0, 50, 100, 200, 300 e 400 kg ha-1 de N em duas variedades de mandioca, Sergipe e Lisona, adotando-se o delineamento experimental em blocos casualizados, com os tratamentos arranjados segundo um esquema fatorial (2x6. Foi verificado efeito do nitrogênio na altura das plantas, na produção da parte aérea, produtividade de raízes tuberosas, porcentagem de matéria seca e de amido em raízes tuberosas e rendimento de farinha. O número de brotações por planta, o índice de colheita e o índice de área foliar não foram influenciados pelo nitrogênio. Na variedade Sergipe observaram-se resultados superiores aos da variedade Lisona para as características produtividade de parte aérea, produtividade de raízes tuberosas, produção de matéria seca e amido da raiz e rendimento de farinha.With the objective of evaluating the effect of nitrogen on agronomic characteristics of cassava (Manihot esculenta Crantz, an experiment was conducted at the State University of Southwestern Bahia (UESB, Vitória da Conquista, Bahia, Brazil. In the experiment, conducted in the field, the application of six doses of nitrogen (0, 50, 100, 200, 300 and 400 kg ha-1 N was studied in two varieties of cassava (Sergipe and Lisona, adopting a randomized block experimental design, with treatments in a factorial arrangement. The results demonstrate that nitrogen affected height of plants, production of aerial parts of the plants, tuber yield, dry matter and starch contents in roots, and flour yield. Number of shoot per plant, harvest index, and leaf area index were not affect by nitrogen. Sergipe variety showed greater results than Lisona variety for aerial

  12. Dry matter production and distribution in three cassava (Manihot esculenta Crantz cultivars during the second vegetative plant cycle

    Directory of Open Access Journals (Sweden)

    Edvaldo Sagrilo

    2008-12-01

    Full Text Available A study was carried out in Araruna County, State of Paraná, to understand the relationship between the total dry matter yield and its proportion allocated to the storage roots of cassava (Manihot esculenta Crantz plants in the second vegetative cycle. The experimental design was a randomized complete block in split-plot scheme with four replications. The plots consisted of the Mico, IAC 13 and IAC 14 cultivars and the monthly harvesting dates were assessed in the sub-plots. The results showed that the Mico and IAC 13 cultivars were more efficient in allocating dry matter to the storage roots. The IAC 14 cultivar allocated a higher proportion of assimilates to stems compared with the other two cultivars. With regard to the influence of harvesting time, the lowest harvest indexes were observed in the periods of more intense vegetative growth. However, the highest carbohydrate proportions were allocated to the storage roots during periods of low vegetative growth.Com o objetivo de uma melhor compreensão da relação entre a produtividade total de massa seca e a proporção de alocação desta nas raízes tuberosas em plantas de mandioca, foi conduzido no município de Araruna-PR, um experimento em delineamento de blocos casualizados, em esquema de parcelas subdivididas com quatro repetições. Nas parcelas foram dispostas três cultivares (Mico, IAC 13 e IAC 14, e nas subparcelas dez épocas de colheita mensais, a partir do início do segundo ciclo vegetativo das plantas. As cultivares Mico e IAC 13 foram mais eficientes do que a IAC 14 em alocar massa seca nas raízes tuberosas, ao passo que esta última alocou maior proporção de massa seca em suas hastes. Em relação às épocas, os menores índices de colheita ocorreram em períodos de mais intenso crescimento vegetativo das plantas, ao passo que a maior proporção de carboidratos foi alocada nas raízes tuberosas em períodos de baixo crescimento vegetativo.

  13. Aerial organ anatomy of Smilax syphilitica (Smilacaceae

    Directory of Open Access Journals (Sweden)

    João Marcelo Silva

    2012-09-01

    Full Text Available Smilax L. in Brazil is represented by 32 taxa and it is a taxonomically difficult genus because the plants are dioecious and show wide phenotypic variation. The analysis and use of leaf anatomy characters is recognized as a frequently successful taxonomic method to distinguish between individual taxon, when floral material is absent or minute differences in flowers and foliage exist such as in Smilax. The aim of this study was to characterize the anatomical features of the aerial organs in Smilax syphilitica collected from the Atlantic Rainforest, in Santa Teresa-ES and the Smilax aff. syphilitica from the Amazon Rainforest, in Manaus, Brazil. For this, a total of three samples of Smilax were collected per site. Sample leaves and stems were fixed with FAA 50, embedded in historesin, sectioned on a rotary microtome, stained and mounted in synthetic resin. Additionally, histochemical tests were performed and cuticle ornamentation was analyzed with standard scanning electron microscopy. S. syphilitica and S. aff. syphilitica differed in cuticle ornamentation, epidermal cell arrangement and wall thickness, stomata type and orientation, calcium oxalate crystal type, and position of stem thorns. Leaf blades of S. syphilitica from the Amazon Rainforest have a network of rounded ridges on both sides, while in S. aff. syphilitica, these ridges are parallel and the spaces between them are filled with numerous membranous platelets. Viewed from the front, the epidermal cells of S. syphilitica have sinuous walls (even more pronounced in samples from the Amazon; while in S. aff. syphilitica, these cells are also sinuous but elongated in the cross-section of the blade and arranged in parallel. Stomata of S. syphilitica are paracytic, whereas in S. aff. syphilitica, are both paracytic and anisocytic, and their polar axes are directed towards the mid-vein. Calcium oxalate crystals in S. syphilitica are prisms, whereas in S. aff. syphilitica, crystal sand. Thorns

  14. Antibacterial activity of essential oils from palmarosa, evening primrose, lavender and tuberose

    Directory of Open Access Journals (Sweden)

    Lodhia M

    2009-01-01

    Full Text Available Essential oils extracted from flower petals of palmarosa ( Cymbopogon martini , evening primrose ( Primula rosea , lavender ( Lavandula angustifolia and tuberose ( Polianthus tuberosa were tested for their antibacterial activities against gram-positive and gram-negative bacteria. Different concentrations of each essential oil ranging from 10-100% were tested. Both gram-positive and gram-negative bacteria were found susceptible to the studied flower essential oils. With increase in concentration of essential oil, increase in zone of inhibition was observed thus dose-dependent response was clear for each essential oil. Essential oil extracted from Cymbopogon martini showed the highest activity against both gram positive and gram negative bacteria among the tested essential oils.

  15. Effects of in situ climate warming on monarch caterpillar (Danaus plexippus) development.

    Science.gov (United States)

    Lemoine, Nathan P; Capdevielle, Jillian N; Parker, John D

    2015-01-01

    Climate warming will fundamentally alter basic life history strategies of many ectothermic insects. In the lab, rising temperatures increase growth rates of lepidopteran larvae but also reduce final pupal mass and increase mortality. Using in situ field warming experiments on their natural host plants, we assessed the impact of climate warming on development of monarch (Danaus plexippus) larvae. Monarchs were reared on Asclepias tuberosa grown under 'Ambient' and 'Warmed' conditions. We quantified time to pupation, final pupal mass, and survivorship. Warming significantly decreased time to pupation, such that an increase of 1 °C corresponded to a 0.5 day decrease in pupation time. In contrast, survivorship and pupal mass were not affected by warming. Our results indicate that climate warming will speed the developmental rate of monarchs, influencing their ecological and evolutionary dynamics. However, the effects of climate warming on larval development in other monarch populations and at different times of year should be investigated.

  16. PERÍODO DE DORMÊNCIA DE SEMENTES DE IMBUZEIRO

    Directory of Open Access Journals (Sweden)

    Nilton de Brito Cavalcanti

    2006-01-01

    Full Text Available The objective of this work was to study the influence of the seeds storage period of the Imbu Tree (Spondias tuberosa Arruda in the germination percentage and germination velocity index. The study was carried out from January to December 2004 in a greenhouse with 50% shadowing screen, under room temperature, at Embrapa Tropical Semi-Arid, Petrolina, Pernambuco State, Brazil, in a randomized complete block design, with six treatments and four replications. The treatments consisted of seeds harvested in six different crops. The germination percentage and germination velocity index were evaluated at 30, 60, 90 and 120 days after sowing through daily counts. The seeds of 2001 and 2002 crops had the best performance in terms of emergence and germination velocity index.

  17. Candida sergipensis, a new asexual yeast species isolated from frozen pulps of tropical fruits.

    Science.gov (United States)

    Trindade, Rita C; Resende, Maria A; Pimenta, Raphael S; Lachance, Marc-André; Rosa, Carlos A

    2004-07-01

    Sixteen strains of the new yeast species Candida sergipensis have been isolated from frozen pulps of the tropical fruits umbú ( Spondias tuberosa Avr. Cam.) and mangaba ( Hancornia speciosa Gom.). Candida sergipensis was one of the prevalent species in the yeast community of these substrates. The new asexual ascomycetous yeast is phylogenetically related to Candida spandovensis and Candida sorbophila, species belonging to the Wickerhamiella clade, as evidenced by the sequences of the D1/D2 domains of their large subunit ribosomal DNAs. The species C. sergipensis and C. spandovensis can be separated on the basis of growth on 50% glucose agar, xylose and succinate, negative for the first species and positive for the second. The type culture is strain UFMG-R188 (CBS 9567).

  18. Antiviral activities of extracts and phenolic components of two Spondias species against dengue virus

    Directory of Open Access Journals (Sweden)

    Ara Silva

    2011-01-01

    Full Text Available In recent years, the search for natural plant products to fight viral diseases has been increasing. In this work, two Spondias species, namely S. mombin and S. tuberosa, found in Ceará state (Brazil, and their main phenolic components were evaluated against dengue virus. In vitro antiviral tests were performed against type-2 dengue virus by the MTT method and standard cytopathic effect reduction assay in C6/36 cells. Cytotoxicity was also evaluated by MTT. The presence of phenolic compounds quercetin, rutin, and ellagic acid in plant extracts was characterized by HPLC analysis. Both Spondias species extracts and components were nontoxic to the cells whereas rutin and quercetin displayed relevant antiviral activity with IC50 of 362.68 µg/mL and 500 µg/mL, respectively.

  19. Parasitismo natural em moscas-das-frutas (Diptera: Tephritidae no semiárido do sudoeste da Bahia, Brasil

    Directory of Open Access Journals (Sweden)

    Ricardo Falcão de Sá

    2012-12-01

    Full Text Available Parasitoides são importantes agentes de controle natural de tefritídeos, e os conhecimentos sobre as relações tritróficas podem subsidiar o manejo destas pragas. Este trabalho objetivou estimar índices de parasitismo em moscas-das-frutas, em 21 espécies vegetais, e identificar as espécies de parasitoides associados, nas condições do semiárido do sudoeste da Bahia. Oito hospedeiros apresentaram infestação por Anastrepha spp. e, destes, em quatro, ocorreu parasitismo superior a 20,0%, sendo: 20,8% (Ziziphus joazeiro L.; 21,3% (Spondias tuberosa L.; 32,4% (Spondias purpurea L. e 57,1% (Malpighia emarginata L.. Os parasitoides coletados pertencem à família Braconidae, sendo 89% de Doryctobracon areolatus e 11% de Asobara anastrephae.

  20. Efeito da época de colheita no crescimento vegetativo, na produtividade e na qualidade de raízes de três cultivares de mandioca Effect of the harvesting time in the vegetative growth, yield and quality of the storage roots of three cassava cultivars

    Directory of Open Access Journals (Sweden)

    Edvaldo Sagrilo

    2002-08-01

    Full Text Available Com o objetivo de determinar o efeito da época de colheita no crescimento vegetativo, na produtividade e na qualidade de raízes tuberosas de três cultivares de mandioca (Manihot esculenta Crantz, desenvolveu-se em Araruna, Noroeste do Estado do Paraná, um experimento em área de Latossolo Vermelho Distrófico, no período de outubro de 1997 a maio de 1999. O delineamento experimental utilizado foi o de blocos completos casualizados, em esquema de parcelas subdivididas, com quatro repetições, sendo os tratamentos principais as cultivares Mico, IAC 13 e IAC 14 e os tratamentos secundários, dez épocas de colheita, realizadas mensalmente a partir do início do segundo ciclo de crescimento das plantas. A produção da parte aérea apresentou, no segundo ciclo, aumentos de 50,0% em relação a um único ciclo vegetativo. O bom desenvolvimento da estrutura vegetativa das plantas levou ao acúmulo de material de reserva nas raízes tuberosas, aumentando a sua produtividade. Os maiores índices de colheita ocorreram dos 19 aos 21 meses de idade, com valores, em média, superiores a 54,0%. As cultivares não diferiram entre si quanto à produção de raízes tuberosas, de massa seca e de amido. Para todas as cultivares, a segunda fase de repouso fisiológico das plantas mostrou-se mais propícia à colheita, em face da maior produção de raízes tuberosas (92,5%, de massa seca (125,0% e de amido (144,0%.With the objective of determining the effect of harvesting time in the vegetative growth, yield and quality of storage roots of three cassava cultivars (Manihot esculenta Crantz, an experiment was carried out in an area of red distrophic Red Latosol in Araruna, Northwest of Paraná state, from October, 1997 to May, 1999. The experimental design was a randomized complete blocks with four replications and treatments arranged in split plots. The main treatments were the cassava cultivars Mico, IAC 13 and IAC 14 and the secondary treatments were ten