WorldWideScience

Sample records for aeromonas caviae w-61

  1. Aeromonas caviae septicemia in immunocompetent gastrointestinal carriers

    Directory of Open Access Journals (Sweden)

    M. Dwivedi

    Full Text Available Aeromonas caviae strains have been isolated from blood and stool cultures of three immunocompetent patients, residents of Northern India, who presented with community acquired septicemia without any recent history of diarrhea. Cell culture infectivity test performed on Hep-2 cells have shown substantial degree of invasiveness in the isolated strains. This case unleashes a possibility of asymptomatic gastrointestinal carriage of such strains of A. caviae in a very large population of India, as several areas of India have very high rates of Aeromonas induced acute diarrhea/gastroenteritis (up to 13%. It needs to be appraised further in India as well as other countries having high rates of Aeromonas induced acute diarrhea/gastroenteritis.

  2. Pan-genome analysis of Aeromonas hydrophila, Aeromonas veronii and Aeromonas caviae indicates phylogenomic diversity and greater pathogenic potential for Aeromonas hydrophila.

    Science.gov (United States)

    Ghatak, Sandeep; Blom, Jochen; Das, Samir; Sanjukta, Rajkumari; Puro, Kekungu; Mawlong, Michael; Shakuntala, Ingudam; Sen, Arnab; Goesmann, Alexander; Kumar, Ashok; Ngachan, S V

    2016-07-01

    Aeromonas species are important pathogens of fishes and aquatic animals capable of infecting humans and other animals via food. Due to the paucity of pan-genomic studies on aeromonads, the present study was undertaken to analyse the pan-genome of three clinically important Aeromonas species (A. hydrophila, A. veronii, A. caviae). Results of pan-genome analysis revealed an open pan-genome for all three species with pan-genome sizes of 9181, 7214 and 6884 genes for A. hydrophila, A. veronii and A. caviae, respectively. Core-genome: pan-genome ratio (RCP) indicated greater genomic diversity for A. hydrophila and interestingly RCP emerged as an effective indicator to gauge genomic diversity which could possibly be extended to other organisms too. Phylogenomic network analysis highlighted the influence of homologous recombination and lateral gene transfer in the evolution of Aeromonas spp. Prediction of virulence factors indicated no significant difference among the three species though analysis of pathogenic potential and acquired antimicrobial resistance genes revealed greater hazards from A. hydrophila. In conclusion, the present study highlighted the usefulness of whole genome analyses to infer evolutionary cues for Aeromonas species which indicated considerable phylogenomic diversity for A. hydrophila and hitherto unknown genomic evidence for pathogenic potential of A. hydrophila compared to A. veronii and A. caviae.

  3. Isolation of Aeromonas caviae from yoghurt (“nono”) sold in Jos ...

    African Journals Online (AJOL)

    A total of 30 nono samples were collected from Farin Gada, Bauchi Road and Gangare markets in Jos and analysed for the presence of Aeromonas species. 3 (10%) of the 30 nono samples were positive for Aeromonas species; which was found to be Aeromonas caviae. All the isolates were obtained from non-heat treated ...

  4. Aeromonas caviae strain induces Th1 cytokine response in mouse intestinal tract

    Energy Technology Data Exchange (ETDEWEB)

    Hayes, S L; Lye, D J; McKinstry, Craig A.; Vesper, Sephen J.

    2010-01-01

    Aeromonas caviae has been associated with human gastrointestinal disease. Strains of this species typically lack virulence factors (VFs) such as enterotoxins and hemolysins that are produced by other human pathogens of the Aeromonas genus. Microarray profiling of murine small intestinal extracts, 24 hours after oral infection with an A. caviae strain, provides evidence of a Th1 type immune response. A large number of gamma-interferon (γ-IFN) induced genes are up-regulated as well as several tumor necrosis factor-alpha (TNF-α) transcripts. A. caviae has always been considered as opportunistic pathogen because it lacks obvious virulence factors. This current effort suggests that an A. caviae strain can colonize the murine intestinal tract and cause what has been described by others as a dysregulatory cytokine response. This response could explain why a number of diarrheal waterborne disease cases have been attributed to A. caviae even though it lacks obvious enteropathogenic properties.

  5. Aeromonas caviae strain induces Th1 cytokine response in mouse intestinal tract

    Science.gov (United States)

    Aeromonas caviae has been associated with human gastrointestinal disease. Strains of this species typically lack virulence factors (VFs) such as enterotoxins and hemolysins that are produced by other human pathogens of the Aeromonas genus,. Microarray profiling of...

  6. Characterisation of potential virulence markers in Aeromonas caviae isolated from polluted and unpolluted aquatic environments in Morocco

    DEFF Research Database (Denmark)

    Imziln, Boujama; Krovacek, Karel; Baloda, Suraj B.

    1998-01-01

    A total of 100 Aeromonas caviae strains isolated from river waters (38 isolates), raw sewage (30 isolates) and effluents of stabilisation ponds (i.e. treated sewage; 32 isolates) in Marrakech, Morocco, were tested for the presence of putative virulence factors to delineate differences, if any...

  7. Expression of Aeromonas caviae ST pyruvate dehydrogenase complex components mediate tellurite resistance in Escherichia coli

    International Nuclear Information System (INIS)

    Castro, Miguel E.; Molina, Roberto C.; Diaz, Waldo A.; Pradenas, Gonzalo A.; Vasquez, Claudio C.

    2009-01-01

    Potassium tellurite (K 2 TeO 3 ) is harmful to most organisms and specific mechanisms explaining its toxicity are not well known to date. We previously reported that the lpdA gene product of the tellurite-resistant environmental isolate Aeromonas caviae ST is involved in the reduction of tellurite to elemental tellurium. In this work, we show that expression of A. caviae ST aceE, aceF, and lpdA genes, encoding pyruvate dehydrogenase, dihydrolipoamide transacetylase, and dihydrolipoamide dehydrogenase, respectively, results in tellurite resistance and decreased levels of tellurite-induced superoxide in Escherichia coli. In addition to oxidative damage resulting from tellurite exposure, a metabolic disorder would be simultaneously established in which the pyruvate dehydrogenase complex would represent an intracellular tellurite target. These results allow us to widen our vision regarding the molecular mechanisms involved in bacterial tellurite resistance by correlating tellurite toxicity and key enzymes of aerobic metabolism.

  8. Aeromonas caviae alters the cytosolic and mitochondrial creatine kinase activities in experimentally infected silver catfish: Impairment on renal bioenergetics.

    Science.gov (United States)

    Baldissera, Matheus D; Souza, Carine F; Júnior, Guerino B; Verdi, Camila Marina; Moreira, Karen L S; da Rocha, Maria Izabel U M; da Veiga, Marcelo L; Santos, Roberto C V; Vizzotto, Bruno S; Baldisserotto, Bernardo

    2017-09-01

    Cytosolic and mitochondrial creatine kinases (CK), through the creatine kinase-phosphocreatine (CK/PCr) system, provide a temporal and spatial energy buffer to maintain cellular energy homeostasis. However, the effects of bacterial infections on the kidney remain poorly understood and are limited only to histopathological analyses. Thus, the aim of this study was to investigate the involvement of cytosolic and mitochondrial CK activities in renal energetic homeostasis in silver catfish experimentally infected with Aeromonas caviae. Cytosolic CK activity decreased in infected animals, while mitochondrial CK activity increased compared to uninfected animals. Moreover, the activity of the sodium-potassium pump (Na + , K + -ATPase) decreased in infected animals compared to uninfected animals. Based on this evidence, it can be concluded that the inhibition of cytosolic CK activity by A. caviae causes an impairment on renal energy homeostasis through the depletion of adenosine triphosphate (ATP) levels. This contributes to the inhibition of Na + , K + -ATPase activity, although the mitochondrial CK activity acted in an attempt to restore the cytosolic ATP levels through a feedback mechanism. In summary, A. caviae infection causes a severe energetic imbalance in infected silver catfish, which may contribute to disease pathogenesis. Copyright © 2017 Elsevier Ltd. All rights reserved.

  9. Aeromonas caviae inhibits hepatic enzymes of the phosphotransfer network in experimentally infected silver catfish: Impairment on bioenergetics.

    Science.gov (United States)

    Baldissera, M D; Souza, C F; Verdi, C M; Dos Santos, K L M; Da Veiga, M L; da Rocha, M I U M; Santos, R C V; Vizzotto, B S; Baldisserotto, B

    2018-03-01

    Several studies have been demonstrated that phosphotransfer network, through the adenylate kinase (AK) and pyruvate kinase (PK) activities, allows for new perspectives leading to understanding of disease conditions associated with disturbances in energy metabolism, metabolic monitoring and signalling. In this sense, the aim of this study was to evaluate whether experimental infection by Aeromonas caviae alters hepatic AK and PK activities of silver catfish Rhamdia quelen. Hepatic AK and PK activities decreased in infected animals compared to uninfected animals, as well as the hepatic adenosine triphosphate (ATP) levels. Also, a severe hepatic damage was observed in the infected animals due to the presence of dilation and congestion of vessels, degeneration of hepatocytes and loss of liver parenchyma architecture and sinusoidal structure. Therefore, we have demonstrated, for the first time, that experimental infection by A. caviae inhibits key enzymes linked to the communication between sites of ATP generation and ATP utilization. Moreover, the absence of a reciprocal compensatory mechanism between these enzymes contributes directly to hepatic damage and for a severe energetic imbalance, which may contribute to disease pathophysiology. © 2017 John Wiley & Sons Ltd.

  10. Isolation and identification of Aeromonas caviae strain KS-1 as TBTC- and lead-resistant estuarine bacteria.

    Science.gov (United States)

    Shamim, Kashif; Naik, Milind Mohan; Pandey, Anju; Dubey, Santosh Kumar

    2013-06-01

    Tributyltin chloride (TBTC)- and lead-resistant estuarine bacterium from Mandovi estuary, Goa, India was isolated and identified as Aeromonas caviae strain KS-1 based on biochemical characteristics and FAME analysis. It tolerates TBTC and lead up to 1.0 and 1.4 mM, respectively, in the minimal salt medium (MSM) supplemented with 0.4 % glucose. Scanning electron microscopy clearly revealed a unique morphological pattern in the form of long inter-connected chains of bacterial cells on exposure to 1 mM TBTC, whereas cells remained unaltered in presence of 1.4 mM Pb(NO₃)₂ but significant biosorption of lead (8 %) on the cell surface of this isolate was clearly revealed by scanning electron microscopy coupled with energy dispersive X-ray spectroscopy. SDS-PAGE analysis of whole-cell proteins of this lead-resistant isolate interestingly demonstrated three lead-induced proteins with molecular mass of 15.7, 16.9 and 32.4 kDa, respectively, when bacterial cells were grown under the stress of 1.4 mM Pb (NO₃)₂. This clearly demonstrated their possible involvement exclusively in lead resistance. A. caviae strain KS-1 also showed tolerance to several other heavy metals, viz. zinc, cadmium, copper and mercury. Therefore, we can employ this TBTC and lead-resistant bacterial isolate for lead bioremediation and also for biomonitoring TBTC from lead and TBTC contaminated environment.

  11. Aeromonas spp. isolated from oysters (Crassostrea rhizophorea from a natural oyster bed, Ceará, Brazil Aeromonas spp. isoladas de ostras (Crassostrea rhizophorea coletadas em um criadouro natural, Ceará, Brazil

    Directory of Open Access Journals (Sweden)

    Norma S. Evangelista-Barreto

    2006-06-01

    Full Text Available Between April and October 2002, thirty fortnightly collections of oysters (Crassostrea rhizophorea from a natural oyster bed at the Cocó River estuary in the Sabiaguaba region (Fortaleza, Ceará, Brazil were carried out, aiming to isolate Aeromonas spp. strains. Oyster samples were submitted to the direct plating (DP and the presence/absence (P/A methods. Aeromonas were identified in 15 (50% samples analyzed by the DP method and in 13 (43% analyzed by the P/A method. A. caviae, A. eucrenophila, A. media, A. sobria, A. trota, A. veronii bv. sobria, A. veronii bv. veronii and Aeromonas sp. were isolated. The predominant species was A. veronii (both biovars, which was identified in 13 (43% samples, followed by A. media in 11 (37% and A. caviae in seven (23%. From the 59 strains identified, 28 (48% presented resistance to at least one of the eight antibiotics tested.Foram realizadas 30 coletas quinzenais, entre abril e outubro de 2002, de ostras (Crassostrea rhizophorea de um criadouro natural, no estuário do rio Cocó (Fortaleza/Ceará/Brasil, objetivando-se isolar cepas de Aeromonas spp. As amostras de ostras foram submetidas aos métodos de plaqueamento direto (PD e presença/ausência (P/A. Foram identificadas Aeromonas em 15 (50% amostras analisadas pelo método PD e em 13 (43% pelo método P/A. Foram isoladas: A. caviae, A. eucrenophila, A. media, A. sobria, A. trota, A. veronii bv. sobria, A. veronii bv. veronii e Aeromonas sp. A espécie predominate foi A. veronii (ambos biovars, identificada em 13 (43% amostras, seguida de A. media em 11 (37% e A. caviae em 7 (23%. Das 59 cepas identificadas, 28 (48% apresentaram resistência a pelo menos um, dos oitos antibióticos testados.

  12. AEROMONAS SPP BACTEREMIA OF RAINBOW TROUT FRY (ONCORHYNCHUS MYKISS: BIOCHEMICAL CHARACTERIZATION OF THE CAUSATIVE ORGANISM AND ANTIMICROBIAL SUSCEPTIBILITY

    Directory of Open Access Journals (Sweden)

    Damir Kapetanović

    2004-09-01

    Full Text Available Aeromonas hydrophila and other members of Aeromonas genus are ubiquitus in aquatic environment and make part of normal bacterial flora of rainbow trout. Aeromonas spp. infections are worldwide registered. Here we present our experience and knowledge on Aeromonas bacteremia, which causes mortality of rainbow trout fry. Rainbow trout fry, 7 month old, started to die in November 2003. Fish samples (17 samples of dead and moribund fish were delivered to the Laboratory for aquaculture. With Api 20 NE tests Aeromonas hydrophila / caviae type I was identified with an average probability of 99.9 % (one test against, as well as Aeromonas hydrophila / caviae type II with an average probability of 99.5 % (one test against from liver, spleen, kidney, intestines and damaged eye. All of isolated and identified samples were tested for antibiotic susceptibility by disc diffusion method. The test showed that specimens were most sensitive on flumequin, and relatively less sensitive on chloramphenicol and enrofloxacin. Therapy was successfully applied with Flubactin®.

  13. Bactérias do gênero Aeromonas em água de matadouro bovino Aeromonas bacteria in beef slaughtering water

    Directory of Open Access Journals (Sweden)

    O.D. Rossi Jr

    2000-10-01

    Full Text Available Verificou-se a ocorrência de bactérias do gênero Aeromonas em amostras de água (abastecimento/residuária obtidas em matadouro bovino. Analisaram-se a água utilizada nas dependências internas, a água dos currais, utilizada na dessedentação, pré-higienização e tranqüilização dos animais e a água residuária da lavagem das carcaças. Das 30 amostras representativas de cada tipo, bactérias do gênero Aeromonas foram isoladas em 10 (33,3% amostras da água dos currais e em 10 (33,3% amostras da água residuária da lavagem de carcaças. Nenhuma das amostras da água tratada de abastecimento das instalações revelou-se positiva no isolamento. As espécies isoladas foram Aeromonas hydrophila em duas (2,2% e Aeromonas caviae em 19 (21,1% amostras. Uma cepa considerada atípica foi isolada da água dos currais. Os resultados evidenciaram que a água dos currais pode ser uma importante fonte de contaminação, principalmente para a pele, e através dela as Aeromonas sp. podem chegar à sala de matança.The aim of this work was to verify the occurrence of Aeromonas bacteria in samples of water (supply and residual collected at beef slaughterhouse. Water used at the internal facilities, water from corrals, drinking water, water for pre-hygiene and tranquilization of the animals and residual water from carcasses’ wash, were analyzed. From those 30 samples of each type, Aeromonas bacteria were isolated in 10 (33.3% samples of corral water and in 10 (33.3% samples of residual water from carcasses’ wash. None of the facilities treated water supply samples showed positive in isolation. The isolated species were Aeromonas hydrophila in two (2.2% and Aeromonas caviae in 19 (21.1% of the samples. One non-typical strain was isolated from corral water. The results demonstrated that corral water may be an important contamination source, mainly to the hide and, through it, Aeromonas sp. can reach the slaughter room.

  14. Aeromonas associated diarrhoeal disease in south Brazil: prevalence, virulence factors and antimicrobial resistance Aeromonas associadas a diarréias no sul do Brasil: prevalência, fatores de virulência, e resistência a antibiótico

    Directory of Open Access Journals (Sweden)

    Ivani M.F. Guerra

    2007-12-01

    Full Text Available Aeromonas were isolated from 27 (6.6% of 408 patients admitted with acute gastroenteritis in two hospitals at Rio Grande do Sul, Brazil. Isolates were classified as A. hydrophila (51.8%, A. caviae (40.8%, and A. veronii biotype sobria (7.4%. The highest prevalence of Aeromonas associated infections occurred in lactants and children. Virulence genes (aerA -aerolysin/hemolysin, ahpA -serine-protease, satA - glycerophospholipid-cholesterol acyltransferase, lipA -lipase, and ahyB -elastase and virulence factors (hemolytic, proteolitic, lipolitic activities, and biofilm formation were identified in most A. hydrophila and A. veronii biotype sobria isolates, with lower frequencies on A. caviae. All Aeromonas isolates were resistant to ampicillin, ticarcillin/clavulanic acid, cephalotin, and cephazolin, and most of them (>70% exhibited resistance to imipenem, carbenicillin, amoxillin/sulbactan, and piperacillin. Multiple-resistance, more than four antibiotics, was evidenced in 29.6% of the isolates. The most efficient antibiotics were the quinolones (ciprofloxacin and norfloxacin, and the aminoglycosides (amikacin and netilmicin.Aeromonas foram isoladas de 27 (6.6% dos 408 pacientes admitidos com gastroenterite aguda em dois hospitais do Rio Grande do Sul, Brasil. Os isolados foram classificados com A. hydrophila (51.8%, A. caviae (40.8%, e A. veronii biotype sobria (7.4%. A maior prevalência de Aeromonas ocorreu em lactantes e crianças. Genes (aerA -aerolisina/hemolisina, ahpA -serina-protease, satA - glicerofosfolipidio-colesterol aciltransferase, lipA -lipase, e ahyB -elastase e factores (atividade hemolítica, proteolítica, lipolítica, e formação de biofilme de virulência foram identificados na maioria dos isolados de A. hydrophila e A. veronii biotype sobria, com freqüências menores em A. caviae. Todos os isolados de Aeromonas apresentaram resistência a ampicilina, ticarcilina/ácido clavulânico, cefalotina e cefazolina, e a maior parte

  15. Production, characterization, and immobilization of partially purified surfactant-detergent and alkali-thermostable protease from newly isolated Aeromonas caviae.

    Science.gov (United States)

    Datta, Sumitra; Menon, Gopalakrishnan; Varughese, Bincy

    2017-04-21

    Proteolytic Aeromonas caviae P-1-1 growing at wide-ranging pH (7.0-11.0) and moderate salinity (0-5% NaCl) was isolated from cattle shed of Thanjavur, India. It produced lipase, gelatinase, and polyhydroxybutyrate. Different culture conditions, incubation time, carbon and nitrogen sources, vitamins, amino acids, surfactants, and metal ions for optimal growth and protease production of P-1-1 were examined. Maximum protease (0.128 U/mL) production was achieved with 1% fructose, 1% yeast extract, 0.1% ammonium sulfate, 3% NaCl, 0.1% CaCl 2  · 2H 2 O, 1% glycine, 0.1% vitamin E, and 0.1% Tween-40 at pH 8.0 after 42 hr of incubation at 37°C. It was active over broad range of pH (7.0-12.0), temperature (15-100°C), and salinity (0-9% NaCl) with optima at pH 10.0, 55°C, and 3% NaCl. It retained 65 and 48% activities at pH 12.0 and 100°C, respectively. Partially purified protease was highly stable (100%) within pH range 7.0-12.0 and salinities of 0-5% NaCl for 48 hr. Cu 2+ , Mn 2+ , Co 2+ , and Ca 2+ did not inhibit its activity. Its stability at extreme pHs, temperatures, and in the presence of surfactants and commercial detergents suggests its possible application in laundry detergents. Partially purified protease was immobilized and reused. This is the first report of alkali-thermotolerant, surfactant-detergent-stable partially purified extracellular protease from A. caviae.

  16. A prospective study on Aeromonas in outpatients with diarrhea in the central region of Rio Grande do Sul State

    Directory of Open Access Journals (Sweden)

    Karoline de Campos Prediger

    2012-09-01

    Full Text Available Aeromonas spp. were identified in five (2,7% of 182 diarrheal stool cultures, A. caviae was predominant, resistant mainly to ampicillin and cephalotin. This is the first study showing the presence of Aeromonas spp. in diarrheal stools of outpatients in the central region of Rio Grande do Sul State, Brazil.

  17. Incidence and virulence characteristics of Aeromonas spp. in fish

    Directory of Open Access Journals (Sweden)

    Ashraf M. Abd-El-Malek

    2017-01-01

    Full Text Available Aim: This study was conducted to evaluate the presence of Aeromonas spp. in raw and ready-to-eat (RTE fish commonly consumed in Assiut city, Egypt, and to determine virulence factors due to they play a key role in their pathogenicity. Materials and Methods: A total of 125 samples of raw and RTE fish samples were taken from different fish markets and fish restaurants in Assiut Governorate and screened for the presence of Aeromonas spp. by enrichment on tryptic soy broth then incubated at 30°C for 24 h. Plating unto the sterile Petri dishes containing Aeromonas agar base to which Aeromonas selective supplement was added. The plates were incubated at 37°C for 24 h. Presumptive Aeromonas colonies were biochemically confirmed and analyzed for pathogenicity by hemolysin production, protease, and lipase detection. Results: The results indicated that raw fish were contaminated with Aeromonas spp. (40% in wild and 36% in cultured Nile tilapia. Regarding RTE, Aeromonas spp. could be isolated with the percentage of 16%, 28% and 20% in fried Bolti, grilled Bolti and fried Bayad, respectively. Out of 35 isolates obtained, 22 were categorized as Aeromonas hydrophila, 12 were classified as Aeromonas sobria and Aeromonas caviae were found in only one isolate. The virulence factors of Aeromonas spp. were detected and the results showed that all isolates produced of hemolysin (91.4%, protease (77.1%, and lipase enzyme (17.1%. Conclusion: This study indicates that the presence of A. hydrophila with virulence potential in fresh and RTE fish may be a major threat to public health.

  18. The occurrence of Aeromonas in drinking water, tap water and the Porsuk River

    Directory of Open Access Journals (Sweden)

    Merih Kivanc

    2011-03-01

    Full Text Available The occurrence of Aeromonas spp. in the Porsuk River, public drinking water and tap water in the City of Eskisehir (Turkey was monitored. Fresh water samples were collected from several sampling sites during a period of one year. Total 102 typical colonies of Aeromonas spp. were submitted to biochemical tests for species differentiation and of 60 isolates were confirmed by biochemical tests. Further identifications of isolates were carried out first with the VITEK system (BioMe˜rieux and then selected isolates from different phenotypes (VITEK types were identified using the DuPont Qualicon RiboPrinter® system. Aeromonas spp. was detected only in the samples from the Porsuk River. According to the results obtained with the VITEK system, our isolates were 13% Aeromonas hydrophila, 37% Aeromonas caviae, 35% Pseudomonas putida, and 15% Pseudomonas acidovorans. In addition Pseudomonas sp., Pseudomonas maltophila, Aeromonas salmonicida, Aeromonas hydrophila, and Aeromonas media species were determined using the RiboPrinter® system. The samples taken from the Porsuk River were found to contain very diverse Aeromonas populations that can pose a risk for the residents of the city. On the other hand, drinking water and tap water of the City are free from Aeromonas pathogens and seem to be reliable water sources for the community.

  19. CARACTERIZAÇÃO DE AEROMONAS SPP ISOLADAS DE AMOSTRAS DE OSTRAS E ÁGUA POR MÉTODO MICROBIOLÓGICO E MOLECULAR

    Directory of Open Access Journals (Sweden)

    Ana Carolina Miranda de Melo Silva

    2014-09-01

    Full Text Available This study aimed to isolate and identify Aeromonas bacteria from samples of oysters and water, by microbiological and molecular methods. Identification of Aeromonas was performed by the conventional method and by PCR and species characterization was performed by identification key Aerokey II and by RFLP-PCR of 16S rDNA. 59 (98.3% samples of oysters and 15 (75% samples of water contaminated by Aeromonas bacteria were identified. Of the 74 isolates of Aeromonas spp. obtained by microbiological analysis, 53 (71.62%, 38 (65.51% oyster samples and 15 (100% of water samples confirmed the characterization of the genus by molecular technique. As to biochemical species identification, 59.3% (n = 35 and 40.6% (n = 24 of isolates from Aeromonas sp. obtained from oyster samples were rated as A. hydrophila and A. caviae, respectively; and from isolates obtained from water samples, 60% (n = 9 were classified as A. hydrophila and 40% (n = 6 as A. caviae; however, only the A. hydrophila was confirmed by genetic sequencing. Regarding the classification by RFLP-PCR 16S rDNA, patterns of nonspecific bands were obtained, making it impossible to identify the species by this technique. The large number of oyester samples contaminated with Aeromonas spp. and identification of A. hydrophila, demonstrate that this mollusk might present a risk to consumer health, mainly because it is consumed raw and is to a potentially pathogenic micro-organism to humans.

  20. Isolation and antibiotic sensitivity of Aeromonas from children with diarrhea

    Directory of Open Access Journals (Sweden)

    Meiyanti Meiyanti

    2016-02-01

    Full Text Available Aeromonas species are gram-negative, motile, facultative anaerobic, rod shaped, oxidase positive bacteria of the recently assigned family Aeromonadaceae. The significance of Aeromonas species as causative agent of human diarrhoea has recently been established. The aim of the present study was to investigate the distribution, and antibiotic sensitivity of Aeromonas in nonhospitalized children with diarrhea.One hundred and seventeen rectal swabs from children with diarhhea were cultured for isolation of Aeromonas organisms as the etiological agents. In addition to Aeromonas, other enteric pathogens were also isolated. Overall, the isolates of enteric pathogens amounted to 36.8%, consisting of Salmonella, Shigella, Aeromonas, and Vibrio. Aeromonas was only found in 5.1% of cultures, with a ratio of A. caviae and A. hydrophila of 2:1, while Salmonella made up the majority of causative organisms with an isolation frequency of 18.8%, followed by Shigella with 11.1%. In this study no isolates of Vibrio cholerae O1 were found as etiological agents of diarrhea; however, V. cholerae non-O1 and V. parahaemolyticus were found in small numbers (<1%. All isolates of Aeromonas were resistant to ampicillin and tetracycline, but sensitive to ciprofloxacin and ceftriaxone, as were the other enteric pathogens. Although the frequency of isolation of these enteric pathogens was higher than for Vibrio spp., their role in infective diarrhea was less clearcut in comparison with Salmonella and Shigella.

  1. Prevalence and resistance to antibiotics for Aeromonas species from retail fish in Malaysia.

    Science.gov (United States)

    Radu, Son; Ahmad, Noorlis; Ling, Foo Hooi; Reezal, Abdul

    2003-03-25

    A total of 87 market fish samples representing five types of fish were evaluated for the presence of Aeromonas spp. Of the samples examined, 69%, 55%, 11.5% and 2.3% harbored Aeromonas spp., A. veronii biovar sobria, A. hydrophila and A. caviae, respectively. The 60 isolated Aeromonas spp. strains were further examined for hemolytic activity, resistance to antimicrobial agents and presence of plasmids. Hemolytic activity varied widely among the isolated strains. Though all the isolates demonstrated resistance to three or more of the antibiotics tested, all were susceptible to ceptazidime. Thirty-four (56.7%) of the sixty isolates harbored plasmids, with sizes ranging from 2.3 to 15.7 kb. These results indicate that hemolytic, multiple antibiotic resistant and genetically diverse aeromonads are easily recovered from fish in this region.

  2. Effectiveness of radiation processing in elimination of Aeromonas from food

    Science.gov (United States)

    Nagar, Vandan; Bandekar, Jayant R.

    2011-08-01

    Genus Aeromonas has emerged as an important human pathogen because it causes a variety of diseases including gastroenteritis and extra-intestinal infections. Contaminated water, sprouts, vegetables, seafood and food of animal origin have been considered to be the important sources of Aeromonas infection. In the present study, radiation sensitivity of indigenous strains of Aeromonas spp. from different food samples was evaluated. The decimal reduction dose (D10) values of different Aeromonas isolates in saline at 0-4 °C were in the range of 0.031-0.046 kGy. The mixed sprouts, chicken and fish samples were inoculated with a cocktail of five most resistant isolates (A. salmonicida Y567, A. caviae A85, A. jandaei A514A, A. hydrophila CECT 839T and A. veronii Y47) and exposed to γ radiation to study the effectiveness of radiation treatment in elimination of Aeromonas. D10 values of Aeromonas cocktail in mixed sprouts, chicken and fish samples were found to be 0.081±0.001, 0.089±0.003 and 0.091±0.003 kGy, respectively. Radiation treatment with a 1.5 kGy dose resulted in complete elimination of 105 CFU/g of Aeromonas spp. from mixed sprouts, chicken and fish samples. No recovery of Aeromonas was observed in the 1.5 kGy treated samples stored at 4 °C up to 12 (mixed sprouts) and 7 days (chicken and fish samples), even after enrichment and selective plating. This study demonstrates that a 1.5 kGy dose of irradiation treatment could result in complete elimination of 105 CFU/g of Aeromonas spp. from mixed sprouts, chicken and fish samples.

  3. Effectiveness of radiation processing in elimination of Aeromonas from food

    International Nuclear Information System (INIS)

    Nagar, Vandan; Bandekar, Jayant R.

    2011-01-01

    Genus Aeromonas has emerged as an important human pathogen because it causes a variety of diseases including gastroenteritis and extra-intestinal infections. Contaminated water, sprouts, vegetables, seafood and food of animal origin have been considered to be the important sources of Aeromonas infection. In the present study, radiation sensitivity of indigenous strains of Aeromonas spp. from different food samples was evaluated. The decimal reduction dose (D 10 ) values of different Aeromonas isolates in saline at 0-4 o C were in the range of 0.031-0.046 kGy. The mixed sprouts, chicken and fish samples were inoculated with a cocktail of five most resistant isolates (A. salmonicida Y567, A. caviae A85, A. jandaei A514A, A. hydrophila CECT 839 T and A. veronii Y47) and exposed to γ radiation to study the effectiveness of radiation treatment in elimination of Aeromonas. D 10 values of Aeromonas cocktail in mixed sprouts, chicken and fish samples were found to be 0.081±0.001, 0.089±0.003 and 0.091±0.003 kGy, respectively. Radiation treatment with a 1.5 kGy dose resulted in complete elimination of 10 5 CFU/g of Aeromonas spp. from mixed sprouts, chicken and fish samples. No recovery of Aeromonas was observed in the 1.5 kGy treated samples stored at 4 o C up to 12 (mixed sprouts) and 7 days (chicken and fish samples), even after enrichment and selective plating. This study demonstrates that a 1.5 kGy dose of irradiation treatment could result in complete elimination of 10 5 CFU/g of Aeromonas spp. from mixed sprouts, chicken and fish samples.

  4. Effectiveness of radiation processing in elimination of Aeromonas from food

    Energy Technology Data Exchange (ETDEWEB)

    Nagar, Vandan [Food Technology Division, Bhabha Atomic Research Centre, Mumbai 400085 (India); Bandekar, Jayant R., E-mail: jrb@barc.gov.i [Food Technology Division, Bhabha Atomic Research Centre, Mumbai 400085 (India)

    2011-08-15

    Genus Aeromonas has emerged as an important human pathogen because it causes a variety of diseases including gastroenteritis and extra-intestinal infections. Contaminated water, sprouts, vegetables, seafood and food of animal origin have been considered to be the important sources of Aeromonas infection. In the present study, radiation sensitivity of indigenous strains of Aeromonas spp. from different food samples was evaluated. The decimal reduction dose (D{sub 10}) values of different Aeromonas isolates in saline at 0-4 {sup o}C were in the range of 0.031-0.046 kGy. The mixed sprouts, chicken and fish samples were inoculated with a cocktail of five most resistant isolates (A. salmonicida Y567, A. caviae A85, A. jandaei A514A, A. hydrophila CECT 839{sup T} and A. veronii Y47) and exposed to {gamma} radiation to study the effectiveness of radiation treatment in elimination of Aeromonas. D{sub 10} values of Aeromonas cocktail in mixed sprouts, chicken and fish samples were found to be 0.081{+-}0.001, 0.089{+-}0.003 and 0.091{+-}0.003 kGy, respectively. Radiation treatment with a 1.5 kGy dose resulted in complete elimination of 10{sup 5} CFU/g of Aeromonas spp. from mixed sprouts, chicken and fish samples. No recovery of Aeromonas was observed in the 1.5 kGy treated samples stored at 4 {sup o}C up to 12 (mixed sprouts) and 7 days (chicken and fish samples), even after enrichment and selective plating. This study demonstrates that a 1.5 kGy dose of irradiation treatment could result in complete elimination of 10{sup 5} CFU/g of Aeromonas spp. from mixed sprouts, chicken and fish samples.

  5. Biochemical characteristics, serogroups, and virulence factors of aeromonas species isolated from cases of diarrhoea and domestic water samples in Chennai

    Directory of Open Access Journals (Sweden)

    Alavandi S

    2003-01-01

    Full Text Available PURPOSE: The objective of the present study was to delineate the differences between the clinical and environmental Aeromonas species with respect to their biochemical characteristics, serogrouping and virulence factors, in order to find a phenotypic marker of enteropathogenicity. METHODS: A total of 55 Aeromonas spp. inclusive of 19 isolates from cases of diarrhoea, and 36 from water samples comprising, 10 isolates of A. hydrophila, 21 isolates each of A. sobria, and A. caviae, two isolates of A. jandaei and one isolate of A. veronii were subjected to analysis of their biochemical characteristics, serogrouping, and virulence factors. RESULTS: Among the differences recorded in the biochemical characteristics in the three major species, the most striking characteristic was fermentation of lactose, which was observed in all the 11 A. caviae isolates recovered from water samples. None of the 10 clinical isolates of A. caviae tested fermented lactose. The clinical Aeromonas isolates belonged to seven typable serogroups, O:13, O:14, O:16, O:21, O:27, O:32 and O:35. The environmental isolates belonged to eight different serogroups, such as, O:3, O:11, O:14, O:16, O:18, O:28, O:64 and O:78 and were predominated by serotypes O:18 and O:64. Among the virulence factors tested, 89% of the environmental isolates produced b haemolysin, while only 62.3% of clinical isolates were able to do so. There was no significant difference between the clinical and environmental aeromonads with respect to their enterotoxigenicity in suckling mice in vivo, cytotoxicity in vitro in Vero cell monolayers, and ability to produce siderophores. CONCLUSION: Efforts to delineate the differences between the clinical and environmental Aeromonas spp. did not reveal significant difference between them. However, difference was observed with respect to their ability to produce b haemolysin, wherein, higher percentage of environmental isolates was haemolytic. The results also suggest

  6. Chlorinated and ultraviolet radiation -treated reclaimed irrigation water is the source of Aeromonas found in vegetables used for human consumption

    Energy Technology Data Exchange (ETDEWEB)

    Latif-Eugenín, Fadua; Beaz-Hidalgo, Roxana; Silvera-Simón, Carolina [Unidad de Microbiología, Facultad de Medicina y Ciencias de la Salud, IISPV, Universidad Rovira i Virgili, Reus (Spain); Fernandez-Cassi, Xavi [Departamento de Microbiología, Facultad de Biología, Universidad de Barcelona, Barcelona (Spain); Figueras, María J., E-mail: mariajose.figueras@urv.cat [Unidad de Microbiología, Facultad de Medicina y Ciencias de la Salud, IISPV, Universidad Rovira i Virgili, Reus (Spain)

    2017-04-15

    Wastewater is increasingly being recognized as a key water resource, and reclaimed water (or treated wastewater) is used for irrigating vegetables destined for human consumption. The aim of the present study was to determine the diversity and prevalence of Aeromonas spp. both in reclaimed water used for irrigation and in the three types of vegetables irrigated with that water. Seven of the 11 (63.6%) samples of reclaimed water and all samples of vegetables were positive for the presence of Aeromonas. A total of 216 Aeromonas isolates were genotyped and corresponded to 132 different strains that after identification by sequencing the rpoD gene belonged to 10 different species. The prevalence of the species varied depending on the type of sample. In the secondary treated reclaimed water A. caviae and A. media dominated (91.4%) while A. salmonicida, A. media, A. allosaccharophila and A. popoffii represented 74.0% of the strains in the irrigation water. In vegetables, A. caviae (75.0%) was the most common species, among which a strain isolated from lettuce had the same genotype (ERIC pattern) as a strain recovered from the irrigation water. Furthermore, the same genotype of the species A. sanarellii was recovered from parsley and tomatoes demonstrating that irrigation water was the source of contamination and confirming the risk for public health. - Highlights: • Reclaimed water (= treated wastewater) is used for the irrigation of vegetables. • Aeromonas was found in reclaimed water and irrigated vegetables with this water. • The prevalence of Aeromonas spp. varied between irrigation water and vegetables. • Epidemiological relationships were found between irrigation water and vegetables. • The water was the source of contamination which means a risk for the public health.

  7. Chlorinated and ultraviolet radiation -treated reclaimed irrigation water is the source of Aeromonas found in vegetables used for human consumption

    International Nuclear Information System (INIS)

    Latif-Eugenín, Fadua; Beaz-Hidalgo, Roxana; Silvera-Simón, Carolina; Fernandez-Cassi, Xavi; Figueras, María J.

    2017-01-01

    Wastewater is increasingly being recognized as a key water resource, and reclaimed water (or treated wastewater) is used for irrigating vegetables destined for human consumption. The aim of the present study was to determine the diversity and prevalence of Aeromonas spp. both in reclaimed water used for irrigation and in the three types of vegetables irrigated with that water. Seven of the 11 (63.6%) samples of reclaimed water and all samples of vegetables were positive for the presence of Aeromonas. A total of 216 Aeromonas isolates were genotyped and corresponded to 132 different strains that after identification by sequencing the rpoD gene belonged to 10 different species. The prevalence of the species varied depending on the type of sample. In the secondary treated reclaimed water A. caviae and A. media dominated (91.4%) while A. salmonicida, A. media, A. allosaccharophila and A. popoffii represented 74.0% of the strains in the irrigation water. In vegetables, A. caviae (75.0%) was the most common species, among which a strain isolated from lettuce had the same genotype (ERIC pattern) as a strain recovered from the irrigation water. Furthermore, the same genotype of the species A. sanarellii was recovered from parsley and tomatoes demonstrating that irrigation water was the source of contamination and confirming the risk for public health. - Highlights: • Reclaimed water (= treated wastewater) is used for the irrigation of vegetables. • Aeromonas was found in reclaimed water and irrigated vegetables with this water. • The prevalence of Aeromonas spp. varied between irrigation water and vegetables. • Epidemiological relationships were found between irrigation water and vegetables. • The water was the source of contamination which means a risk for the public health.

  8. Species Distribution and Prevalence of Putative Virulence Factors in Mesophilic Aeromonas spp. Isolated from Fresh Retail Sushi

    Directory of Open Access Journals (Sweden)

    Sunniva Hoel

    2017-05-01

    Full Text Available Aeromonas spp. are ubiquitous bacteria that have received increasing attention as human pathogens because of their widespread occurrence in food, especially seafood and vegetables. The aim of this work was to assess the species identity and phylogenetic relationship of 118 Aeromonas strains isolated from fresh retail sushi from three producers, and to characterize the isolates with respect to genetic and phenotypic virulence factors. We also evaluate the potential hazard associated with their presence in ready-to-eat seafood not subjected to heat treatment. Mesophilic Aeromonas salmonicida was most prevalent (74%, followed by A. bestiarum (9%, A. dhakensis (5%, A. caviae (5%, A. media (4%, A. hydrophila (2%, and A. piscicola (1%. All isolates were considered potentially pathogenic due to the high prevalence of genes encoding hemolysin (hlyA (99%, aerolysin (aerA (98%, cytotoxic enterotoxin (act (86%, heat-labile cytotonic enterotoxin (alt (99%, and heat-stable cytotonic enterotoxin (ast (31%. The shiga-like toxins 1 and 2 (stx-1 and stx-2 were not detected. Moreover, there was heterogeneity in toxin gene distribution among the isolates, and the combination of act/alt/hlyA/aerA was most commonly detected (63%. β-hemolysis was species-dependent and observed in 91% of the isolates. All A. media and A. caviae strains were non-hemolytic. For isolates belonging to this group, lack of hemolysis was possibly related to the absence of the act gene. Swimming motility, linked to adhesion and host invasion, occurred in 65% of the isolates. Partial sequencing of the gyrB gene demonstrated its suitability as a genetic marker for Aeromonas species identification and for assessment of the phylogenetic relationship between the isolates. The gyrB sequence divergence within a given species ranged from 1.3 to 2.9%. A. bestiarum, A. salmonicida, and A. piscicola were the most closely related species; their sequences differed by 2.7–3.4%. The average gyrB sequence

  9. Prevalência de Aeromonas ssp em fezes diarréicas de crianças menores de 5 anos de idade na cidade de Goiânia, Goiás, no biênio 1995 - 1996

    Directory of Open Access Journals (Sweden)

    Idalina Thiomi Inumaru Nojimoto

    1997-10-01

    Full Text Available Foram analisadas 163 amostras de fezes de crianças com idade abaixo de 5 anos no período de 1995 a 1996, sendo 91 de fezes diarréicas e 72 de fezes não diarréicas. O material foi coletado em meio para transporte e submetido ao processo de enriquecimento a 4oC por 7 dias. Para o isolamento primário foi utilizado ágar amido ampicilina e incubado a 35oC por 18 a 24 horas. Foram isoladas 20 (21,9% das seguintes espécies: Aeromonas A. caviae (7,7%, A. salmonicida salmonicida (6,6%, A. sobria (4,3%, A. hydrophila (2,2% e Salmonicida achromogenes (1,1%. Nenhuma Aeromonas spp foi isolada dos 72 pacientes-controles. A susceptibilidade das amostras de Aeromonas spp aos antimicrobianos foi maior com a ciprofloxacina, diminuindo gradativamente com cloranfenicol, gentamicina, ampicilina e eritromicina.From 1995 through 1996, 163 fecal specimens of children aged under 5 years were analysed, 91 being from diarrhea feces and 72 without diarrhea. The material was collected in transport medium and submitted to the enrichment procedure at 4oC for 7 days. For the primary isolation starch ampicillin agar was used and incubated at 35oC for 18 to 24 hours. Twenty (20.9% from the following specimens were isolated: Aeromonas A. caviae (7.7%, A. salmonicida salmonicida (6.6%, A. sobria (4.3%, A. hydrophila (2.2% e Salmonicida achromogenes (1.1%. No Aeromonas spp was isolated from the 72 control subjects. The Aeromonas spp susceptibility to antimicrobian was greater with ciprofloxacin, being this susceptibility gradually diminished with chloranphenicol, gentamicin, ampicillin and erythromycin.

  10. Genospecies and virulence factors of Aeromonas species in different sources in a North African country

    Directory of Open Access Journals (Sweden)

    Khalifa Sifaw Ghenghesh

    2014-09-01

    Full Text Available Introduction: Aeromonads of medical importance have been reported from numerous clinical, food, and water sources, but identification of genospecies and virulence factors of Aeromonas species from countries in North Africa and the Middle East are few. Methods: In total 99 Aeromonas species isolates from different sources (diarrheal children [n=23], non-diarrheal children [n=16], untreated drinking water from wells [n=32], and chicken carcasses [n=28] in Tripoli, Libya, were included in the present investigation. Genus identification was confirmed by biochemical analysis, and genospecies were determined using a combination of 16S rDNA variable region and gyrB sequence analysis. Polymerase chain reaction (PCR was used to detect genes encoding toxins from 52 of the isolates. Results: We identified 44 isolates (44% as A. hydrophila (3 [3.0%] subspecies anaerogenes, 23 [23%] subspecies dhakensis, and 18 [18%] subspecies ranae; 27 isolates (27% as A. veronii; 23 isolates (23% as A. caviae; and 5 isolates (5.0% as other genospecies. The genes encoding aerolysin (aer, cytolytic enterotoxin (act, and A. hydrophila isolate SSU enterotoxin (ast were detected in 45 (87%, 4 (7.7%, and 9 (17% of the 52 isolates tested, respectively. The gene encoding an extracellular lipase (alt was not detected. Conclusion: The majority of aeromonads from Libya fall within three genospecies (i.e. A. hydrophila, A. veronii, and A. caviae, and genes coding for toxin production are common among them.

  11. Clinical manifestations of bacteremia caused by Aeromonas species in southern Taiwan.

    Directory of Open Access Journals (Sweden)

    Hung-Jen Tang

    Full Text Available This study is conducted to investigate the clinical characteristics of patients with bacteremia caused by Aeromonas species.Patients with bacteremia caused by Aeromonas species during the period 2009 to 2013 were identified from a computerized database of a regional hospital in southern Taiwan. The medical records of these patients were retrospectively reviewed.A total of 91 patients with bacteremia due to Aeromonas species were identified. In addition to 16 (17.6% primary bacteremia, the most common source of secondary infection is peritonitis (n = 27, 29.7%, followed by biliary tract infection (n = 18, 19.8%, and SSTI (n = 12, 13.2%, pneumonia (n = 9, 9.9%, catheter-related bloodstream infection (n =  5, 5.5%, and genitourinary tract infection (n = 4, 4.4%. A. hydrophila (n = 35, 38.5% was the most common pathogen, followed by A. veronii biovar sobria (n = 31, 34.1%, A. caviae (n = 14, 15.4%, and A. veronii biovar veronii (n = 9, 9.9%. Forty-three (47.3% patients were classified as healthcare-associated infections (HCAI causes by Aeromonas species, and patients with HCAI were more likely to have cancer, and receive immunosuppressant than patients with community-acquired bacteremia. The overall outcomes, including rate of ICU admission, acute respiratory failure, and mortality were 33.3%, 28.6%, and 23.1%, respectively. Multivariate analysis showed that the in-hospital day mortality was significantly associated only with underlying cancer (P <.001, and initial shock (P <.001.Aeromonas species should be considered one of the causative pathogens of healthcare-associated bacteremia, especially in immunocompromised patients. In addition, it can be associated with high fatality. Cancer and initial shock were the poor prognostic factors.

  12. Prevalence of fur mites (Chirodiscoides caviae) in pet guinea pigs (Cavia porcellus) in southern Italy.

    Science.gov (United States)

    d'Ovidio, Dario; Santoro, Domenico

    2014-04-01

    Chirodiscoides caviae is the most common fur mite affecting guinea pigs; infestation is generally asymptomatic. No studies have been published on the prevalence of such mites in guinea pigs in southern Italy. We sought to evaluate the prevalence and the clinical signs of C. caviae infestation in guinea pigs in southern Italy. Clinical records of guinea pigs evaluated from August 2012 to July 2013 were retrospectively searched. In this retrospective matched case-control study, records of guinea pigs with evidence of C. caviae infestation were selected. The prevalence of C. caviae infestation was evaluated and exposure variables were assessed among guinea pigs with and without infestation using stepwise conditional logistic regression. Guinea pigs seen during the same time period, but without a diagnosis of C. caviae, were included as control animals. The prevalence of C. caviae was 32% (42 of 131); 66.6% of affected guinea pigs (28 of 42) originated from pet shops, whereas 28% (14 of 42) were privately owned. Thirty-one guinea pigs (73.8%) were asymptomatic, whereas 11 (26.1%) showed clinical signs (pruritus, alopecia, erythema and scaling). The most frequently affected area was the lumbosacral region (38 of 42). Guinea pigs in pet shops were more likely to be affected by C. caviae than owned guinea pigs (odds ratio, 5.12; 95% confidence interval, 2.32-11.29; P guinea pigs in southern Italy. Chirodiscoides mites should be sought in guinea pigs, particularly in animals coming from pet shops. © 2014 ESVD and ACVD.

  13. A molecular study on the prevalence and virulence potential of Aeromonas spp. recovered from patients suffering from diarrhea in Israel.

    Directory of Open Access Journals (Sweden)

    Yigal Senderovich

    Full Text Available BACKGROUND: Species of the genus Aeromonas are native inhabitants of aquatic environments and have recently been considered emerging human pathogens. Although the gastrointestinal tract is by far the most common anatomic site from which aeromonads are recovered, their role as etiologic agents of bacterial diarrhea is still disputed. Aeromonas-associated diarrhea is a phenomenon occurring worldwide; however, the exact prevalence of Aeromonas infections on a global scale is unknown. METHODOLOGY/PRINCIPAL FINDINGS: The prevalence and virulence potential of Aeromonas in patients suffering from diarrhea in Israel was studied using molecular methods. 1,033 diarrheal stools were sampled between April and September 2010 and Aeromonas species were identified in 17 (∼2% patients by sequencing the rpoD gene. Aeromonas species identity and abundance was: A. caviae (65%, A. veronii (29% and Aeromonas taiwanensis (6%. This is the first clinical record of A. taiwanensis as a diarrheal causative since its recent discovery from a wound infection in a patient in Taiwan. Most of the patients (77% from which Aeromonas species were isolated were negative for any other pathogens. The patients ranged from 1 to 92 years in age. Aeromonas isolates were found to possess different virulence-associated genes: ahpB (88%, pla/lip/lipH3/apl-1 (71%, act/hlyA/aerA (35%, alt (18%, ast (6%, fla (65%, lafA (41%, TTSS ascV (12%, TTSS ascF-ascG (12%, TTSS-dependent ADP-ribosylating toxins aexU (41% and aexT (6% in various combinations. Most of the identified strains were resistant to beta-lactam antibiotics but susceptible to third-generation cephalosporin antibiotics. CONCLUSIONS: Aeromonas may be a causative agent of diarrhea in patients in Israel and therefore should be included in routine bacteriological screenings.

  14. Phenotypic and Genetic Diversity of Aeromonas Species Isolated from Fresh Water Lakes in Malaysia.

    Directory of Open Access Journals (Sweden)

    Wei Ching Khor

    Full Text Available Gram-negative bacilli of the genus Aeromonas are primarily inhabitants of the aquatic environment. Humans acquire this organism from a wide range of food and water sources as well as during aquatic recreational activities. In the present study, the diversity and distribution of Aeromonas species from freshwater lakes in Malaysia was investigated using glycerophospholipid-cholesterol acyltransferase (GCAT and RNA polymerase sigma-factor (rpoD genes for speciation. A total of 122 possible Aeromonas strains were isolated and confirmed to genus level using the API20E system. The clonality of the isolates was investigated using ERIC-PCR and 20 duplicate isolates were excluded from the study. The specific GCAT-PCR identified all isolates as belonging to the genus Aeromonas, in agreement with the biochemical identification. A phylogenetic tree was constructed using the rpoD gene sequence and all 102 isolates were identified as: A. veronii 43%, A. jandaei 37%, A. hydrophila 6%, A. caviae 4%, A. salmonicida 2%, A. media 2%, A. allosaccharophila 1%, A. dhakensis 1% and Aeromonas spp. 4%. Twelve virulence genes were present in the following proportions--exu 96%, ser 93%, aer 87%, fla 83%, enolase 70%, ela 62%, act 54%, aexT 33%, lip 16%, dam 16%, alt 8% and ast 4%, and at least 2 of these genes were present in all 102 strains. The ascV, aexU and hlyA genes were not detected among the isolates. A. hydrophila was the main species containing virulence genes alt and ast either present alone or in combination. It is possible that different mechanisms may be used by each genospecies to demonstrate virulence. In summary, with the use of GCAT and rpoD genes, unambiguous identification of Aeromonas species is possible and provides valuable data on the phylogenetic diversity of the organism.

  15. Potential enterotoxicity and antimicrobial resistance pattern of Aeromonas species isolated from pet turtles and their environment.

    Science.gov (United States)

    Wimalasena, S H M P; Shin, Gee-Wook; Hossain, Sabrina; Heo, Gang-Joon

    2017-05-23

    To investigate the potential enterotoxicity and antimicrobial resistance of aeromonads from pet turtles as a risk for human infection, one hundred and two Aeromonas spp. were isolated from the feces, skin and rearing environments of pet turtles and identified by biochemical and gyrB sequence analyses. Aeromonas enteropelogenes was the predominant species among the isolates (52.9%) followed by A. hydrophila (32.4%), A. dharkensis (5.9%), A. veronii (4.9%) and A. caviae (3.9%). Their potential enterotoxicities were evaluated by PCR assays for detecting genes encoding cytotoxic enterotoxin (act) and two cytotonic enterotoxins (alt and ast). 75.8% of A. hydrophila isolates exhibited the act + /alt + /ast + genotype, whereas 94.4% of A. enteropelogenes isolates were determined to be act - /alt - /ast - . In an antimicrobial susceptibility test, most isolates were susceptible to all tested antibiotics except amoxicillin, ampicillin, cephalothin, chloramphenicol and tetracycline. Non-susceptible isolates to penicillins (ampicillin and amoxicillin) and fluoroquinolones (ciprofloxacin and norfloxacin) were frequently observed among the A. enteropelogenes isolates. Few isolates were resistant to imipenem, amikacin, ceftriaxone and cefotaxime. Collectively, these results suggest that pet turtles may pose a public health risk of infection by enterotoxigenic and antimicrobial resistant Aeromonas strains.

  16. İnek Sütlerinin Hareketli Aeromonas Türleri Yönünden İncelenmesi

    Directory of Open Access Journals (Sweden)

    Mustafa Alişarlı

    2015-02-01

    Full Text Available Bu çalışmada, çiğ sütlerde hareketli Aermonas türlerinin bulunma sıklığını ortaya koymak ve ilk sağılan sütün kontaminasyondaki rolünü belirlemek amaçlanmaştır. Bu amaçla, 100 adet sağmal inekten direkt el sağımı ile alınan süt örnekleri incelenmiştir. İncelenen Örneklerin 8 tanesinde (%8 Aeromonas spp.izole edilmiş olup bunlardan 3'ü (%37,5 hareketli Aeromonas olarak belirlenmiştir. Hareketli Aeromonas'ların 2'si (%66,6 A. hydrophila ve1'i (%33,3 A. caviae olarak identifiye edilmiştir. Bu araştırmanın verileri, süt işletmelerine tanker ve güğümlerle getirilen çiğ sütlerden sağlanan örneklerdeki araştırma bulgularıyla kıyaslandığında daha düşük bulunmuştur. Bu da, eğer sağım sonrası hijyen kurallarına gerekli özen gösterilmezse çiğ sütlerin Aeromonas'lar ile kontaminasyon riskinin yüksek olacağını göstermektedir.

  17. Treatment and control of Trixacarus caviae infestation in a conventional guinea pig (Cavia porcellus) breeding colony

    OpenAIRE

    Nath, Anjan Jyoti

    2015-01-01

    A case of sarcoptic mange caused by Trixacarus caviae in a conventional guinea pig breeding colony is reported. The infestation was reported in a large colony of guinea pigs during the month of July, 2013 affecting 30 breeder guinea pigs. Severely infested animals were treated individually with subcutaneous injection of ivermectin 1 % w/v (Neomec®) at the rate of 400 µg/kg body weight 10 days apart. Three doses of ivermectin were sufficient to eliminate the parasite which tested negative afte...

  18. Aeromonas spp. e Plesiomonas shigelloides isoladas a partir de mexilhões (Perna perna in natura e pré-cozidos no Rio de Janeiro, RJ Aeromonas spp. and Plesiomonas shigelloides isolated from in natura and precooked mussels (Perna perna in Rio de Janeiro, RJ, Brazil

    Directory of Open Access Journals (Sweden)

    Christiane Soares Pereira

    2004-12-01

    Full Text Available O ecossistema aquático é o habitat de mexilhões (Perna perna, animais filtradores que refletem a qualidade ambiental através de análise microbiológica de sua carne. No presente trabalho avaliou-se a presença de patógenos emergentes (Aeromonas hydrophila e Plesiomonas shigelloides, em mexilhões in natura e pré-cozidos coletados por pescadores da Estação Experimental de Cultivo de Mexilhões situada em Jurujuba, Niterói, Rio de Janeiro. Foram analisadas 86 amostras de mexilhões (43 in natura e 43 pré-cozidos as quais foram submetidas a enriquecimento em Água Peptonada Alcalina (APA acrescida de 1 e 3% de Cloreto de Sódio (NaCl e em solução Salina de Butterfield, incubadas a 37ºC por 24 horas. Em seguida, foram semeadas em Ágar Seletivo para Pseudomonas-Aeromonas (GSP, Ágar Tiossulfato Citrato Bile Sacarose (TCBS e Ágar Inositol Bile Verde Brilhante (IBB. A análise geral dos resultados permitiu a identificação de Areomonas spp e Plesiomonas shigelloides em 86% das amostras de mexilhões in natura e pré-cozidas avaliadas. A posterior caracterização bioquímica permitiu a identificação das espécies Aeromonas media (37,10%, A. hydrophila (15,50%, A. caviae (14,80%, A. veronii biogrupo veronii (11,60%, Aeromonas sp. (7,36%, A. sobria (4,20%, A. trota (4,20%, A. schubertii (1,31%, A. jandaei (1,31%, A. veronii biogrupo sobria (0,52% e Plesiomonas shigelloides (2,10%. A relevância epidemiológica desses microrganismos em casos de gastrenterite humana, após consumo de mexilhões crus ou parcialmente cozidos, revela a importância de alertar as autoridades de Saúde Pública no Brasil, sobre a presença desses patógenos na cadeia alimentar e seus riscos para a saúde humana.The aquatic ecosystem is the habitat of mussels, filtrating animals that reflect the ambient quality through microbiological analysis. In the present investigation, we evaluated the presence of emergent pathogens (Aeromonas hydrophila and Plesiomonas

  19. Occurrence of potential pathogenic Aeromonas species in tropical seafood, aquafarms and mangroves off Cochin coast in South India

    Directory of Open Access Journals (Sweden)

    Alphonsa Vijaya Joseph

    2013-12-01

    Full Text Available Background: The genus Aeromonas include gram-negative, motile, facultative anaerobic, rod shaped and oxidase positive bacteria comprising several species, associated with the aquatic environment. Aeromonas species have been implicated in human pathogenesis and are linked with gastroenteritis, muscle infections, septicemia, and skin diseases. In fish they are renowned as enteric pathogens causing haemorrhagic septicemia, fin rot, soft tissue rot and furunculosis resulting in major die-offs and fish kills. Aim: This study reports the occurrence of potential pathogenic Aeromonas sp. in tropical seafood (Squids, Prawns and Mussels, aquafarms and mangroves of Cochin, Kerala, South India. Materials and Methods :Tropical seafood (Squid, Prawn and Mussel, sediment and water samples from aquafarms and associated mangroves were screened for Aeromonas contamination. The isolates were identified by 16S rDNA sequence analysis and subjected to morphological and biochemical characterization. Haemolytic assay was used for determining pathogenicity of the organisms. Antibiotic susceptibility against 12 antibiotics were performed and the MAR index was calculated. Results: A total of 134 isolates were recovered from the samples of which 15 were identified as Aeromonas species by 16S rDNA sequence analysis and were assigned to 5 species namely, A. hydrophila, A. enteropelogenes, A. caviae, A. punctataand A. aquarorium. Morphological, biochemical and phylogenetic analyses revealed relatedness and variability among the strains. All the isolates were haemolytic on blood agar indicating their pathogenicity. The isolates exhibited varying degrees of resistance to vancomycin (86.66%, ampicillin (46.66%, nalidixic acid (20%, tetracycline (6.66%, co-trimaxozole (6.66% and rifampicin (6.66% and were susceptible to antibiotics like gentamycin, streptomycin, trimethoprim, azithromycin, cefixime and chloramphenicol. 20% of Aeromonas sp. showed MAR index > 0.2 indicative of the

  20. Cavia porcellus

    African Journals Online (AJOL)

    SARAH

    30 sept. 2017 ... quality during early development on body weight and reproductive maturation of guinea pigs. (Cavia porcellus). Gen. Comp. Endocrin. 161,. 384-389 ;. Chauca de Zaldivar 1999 Produccion de cuyes en crianzas familiares en Peru. In : V Congreso. Latino americano de Cuyicultura, Venezuela,. Memorias…

  1. Treatment and control of Trixacarus caviae infestation in a conventional guinea pig (Cavia porcellus) breeding colony.

    Science.gov (United States)

    Nath, Anjan Jyoti

    2016-12-01

    A case of sarcoptic mange caused by Trixacarus caviae in a conventional guinea pig breeding colony is reported. The infestation was reported in a large colony of guinea pigs during the month of July, 2013 affecting 30 breeder guinea pigs. Severely infested animals were treated individually with subcutaneous injection of ivermectin 1 % w/v (Neomec ® ) at the rate of 400 µg/kg body weight 10 days apart. Three doses of ivermectin were sufficient to eliminate the parasite which tested negative after 30 days of the first treatment. The entire colony was given preventive dose of ivermectin spray (2 mg/ml solution) following the same schedule. Strict hygienic measures were followed. New hair growth in the severely affected animals was evidenced on 30th day of treatment.

  2. The involvement of tetA and tetE tetracycline resistance genes in plasmid and chromosomal resistance of Aeromonas in Brazilian strains

    Directory of Open Access Journals (Sweden)

    Ilana Teruszkin Balassiano

    2007-11-01

    Full Text Available This study analyzed the involvement of tetA and tetE genes in the tetracycline resistance of 16 strains of genus Aeromonas, isolated from clinical and food sources. Polymerase chain reactions revealed that 37.5% of the samples were positive for tetA, and also 37.5% were tetE positive. One isolate was positive for both genes. Only the isolate A. caviae 5.2 had its resistance associated to the presence of a plasmid, pSS2. The molecular characterization of pSS2 involved the construction of its restriction map and the determination of its size. The digestion of pSS2 with HindIII originated two fragments (A and B that were cloned separately into the pUC18 vector. The tetA gene was shown to be located on the HindIII-A fragment by PCR. After transforming a tetracycline-sensitive strain with pSS2, the transformants expressed the resistance phenotype and harbored a plasmid whose size was identical to that of pSS2. The results confirmed the association between pSS2 and the tetracycline resistance phenotype, and suggest a feasible dissemination of tetA and tetE among strains of Aeromonas. This study suggests the spreading tetA and tetE genes in Aeromonas in Brazil and describes a resistance plasmid that probably contributes to the dissemination of the resistance.

  3. Functional genomic characterization of virulence factors from necrotizing fasciitis-causing strains of Aeromonas hydrophila.

    Science.gov (United States)

    Grim, Christopher J; Kozlova, Elena V; Ponnusamy, Duraisamy; Fitts, Eric C; Sha, Jian; Kirtley, Michelle L; van Lier, Christina J; Tiner, Bethany L; Erova, Tatiana E; Joseph, Sandeep J; Read, Timothy D; Shak, Joshua R; Joseph, Sam W; Singletary, Ed; Felland, Tracy; Baze, Wallace B; Horneman, Amy J; Chopra, Ashok K

    2014-07-01

    The genomes of 10 Aeromonas isolates identified and designated Aeromonas hydrophila WI, Riv3, and NF1 to NF4; A. dhakensis SSU; A. jandaei Riv2; and A. caviae NM22 and NM33 were sequenced and annotated. Isolates NF1 to NF4 were from a patient with necrotizing fasciitis (NF). Two environmental isolates (Riv2 and -3) were from the river water from which the NF patient acquired the infection. While isolates NF2 to NF4 were clonal, NF1 was genetically distinct. Outside the conserved core genomes of these 10 isolates, several unique genomic features were identified. The most virulent strains possessed one of the following four virulence factors or a combination of them: cytotoxic enterotoxin, exotoxin A, and type 3 and 6 secretion system effectors AexU and Hcp. In a septicemic-mouse model, SSU, NF1, and Riv2 were the most virulent, while NF2 was moderately virulent. These data correlated with high motility and biofilm formation by the former three isolates. Conversely, in a mouse model of intramuscular infection, NF2 was much more virulent than NF1. Isolates NF2, SSU, and Riv2 disseminated in high numbers from the muscular tissue to the visceral organs of mice, while NF1 reached the liver and spleen in relatively lower numbers on the basis of colony counting and tracking of bioluminescent strains in real time by in vivo imaging. Histopathologically, degeneration of myofibers with significant infiltration of polymorphonuclear cells due to the highly virulent strains was noted. Functional genomic analysis provided data that allowed us to correlate the highly infectious nature of Aeromonas pathotypes belonging to several different species with virulence signatures and their potential ability to cause NF. Copyright © 2014, American Society for Microbiology. All Rights Reserved.

  4. Identificação e resistência a antimicrobianos de espécies de Aeromonas móveis isoladas de peixes e ambientes aquáticos Identification and antimicrobial resistance of motile Aeromonas isolated from fish and aquatic environment

    Directory of Open Access Journals (Sweden)

    Daniela Hirsch

    2006-12-01

    Full Text Available Com o objetivo de se verificar a diversidade de espécies de Aeromonas móveis e seu perfil de susceptibilidade a antimicrobianos em pisciculturas comerciais, foram selecionadas oito tilapiculturas localizadas na região do Alto Rio Grande, Minas Gerais. De cada propriedade foram coletadas três amostras de peixes em estádio de pré-abate (vivos e saudáveis, uma amostra de água do tanque e uma amostra da água de abastecimento do sistema. De cada peixe foram coletadas amostras de lavado superficial e do parênquima renal. Diluições seriadas adequadas de cada amostra foram plaqueadas em TSA-ampicilina (10 mg/l e as amostras de rim em Ágar Sangue de cavalo a 5%. A partir de colônias isoladas positivas para o teste da oxidase foram realizados testes para identificação do gênero (testes presuntivos e das espécies de Aeromonas (testes bioquímicos. O perfil de antibiograma foi obtido pelo teste de difusão de discos de antibióticos em Ágar Mueller Hinton. Foram obtidos 75 isolados diferenciados em nove espécies de Aeromonas: A. jandaei, A. hydrophila, A. trota, A. caviae, A. sobria, A. eucrenophila, A. veronii bt veronii, A. schubertii, A. media, além de amostras classificadas como Aeromonas atípicas. Do total isolado, oito amostras foram provenientes da superfície corpórea de peixes, 14 da água de abastecimento e 53 da água do tanque. Não houve isolamento a partir dos espécimes de parênquima renal. Em relação ao perfil de resistência, 93% dos isolados foram resistentes à eritromicina, 36% à tetraciclina, 13% ao ác. nalidíxico, 9% à gentamicina, 8% à nitrofurantoína, 8% à canamicina, 5% à norfloxacina, 4% ao cloranfenicol e 3% às sulfonamidas. Dentre os isolados analisados, 43% apresentaram índice de múltipla resistência a antimicrobianos (MAR igual ou superior a 22%, ou seja, resistência a dois ou mais drogas das nove testadas. Os dados apontam para um risco iminente, tanto pelo isolamento de amostras

  5. Relation of chironomids with Aeromonas species

    Directory of Open Access Journals (Sweden)

    Sivan eLaviad

    2016-05-01

    Full Text Available Chironomids (Diptera: Chironomidae, also known as non-biting midges, are one of the most abundant groups of insects in aquatic habitats. They undergo a complete metamorphosis of four life stages of which three are aquatic (egg, larva, pupa, and the adult emerges into the air. Chironomids serve as a natural reservoir of Aeromonas and Vibrio cholerae species. Here we review existing knowledge about the mutual relations between Aeromonas species and chironomids. Using 454-pyrosequencing of the 16S rRNA gene, we found that the prevalence of Aeromonas species in the insects’ egg masses and larvae was 1.6% and 3.3% of the insects’ endogenous microbiota, respectively. Aeromonas abundance per egg mass remained stable during a six-month period of bacterial monitoring. Different Aeromonas species were isolated and some demonstrated the ability to degrade the insect’s egg masses and to prevent eggs hatching. Chitinase was identified as the enzyme responsible for the egg mass degradation. Different Aeromonas species isolated from chironomids demonstrated the potential to protect their host from toxic metals. Aeromonas is a causative agent of fish infections. Fish are frequently recorded as feeding on chironomids. Thus, fish might be infected with Aeromonas species via chironomid consumption. Aeromonas strains are also responsible for causing gastroenteritis and wound infections in humans. Different virulence genes were identified in Aeromonas species isolated from chironomids. Chironomids may infest drinking water reservoirs, hence be the source of pathogenic Aeromonas strains in drinking water. Chironomids and Aeromonas species have a complicated mutual relationship.

  6. Feasibility of same-day identification of members of the family Vibrionaceae by the API 20E system.

    OpenAIRE

    Overman, T L; Overley, J K

    1986-01-01

    Sixty isolates, comprising nine species of the family Vibrionaceae, were tested with the API 20E 5-h same-day procedure (Analytab Products, Plainview, N.Y.). Included were 27 Aeromonas hydrophila isolates, 10 Aeromonas sobria isolates, 7 Aeromonas caviae isolates, 3 Plesiomonas shigelloides isolates, 3 Vibrio alginolyticus isolates, 3 Vibrio cholerae isolates, 1 Vibrio fluvialis isolate, 5 Vibrio parahaemolyticus isolates, and 1 Vibrio vulnificus isolate. The 5-h profile numbers were specific...

  7. Characterization of Aeromonas hydrophila wound pathotypes by comparative genomic and functional analyses of virulence genes.

    Science.gov (United States)

    Grim, Christopher J; Kozlova, Elena V; Sha, Jian; Fitts, Eric C; van Lier, Christina J; Kirtley, Michelle L; Joseph, Sandeep J; Read, Timothy D; Burd, Eileen M; Tall, Ben D; Joseph, Sam W; Horneman, Amy J; Chopra, Ashok K; Shak, Joshua R

    2013-04-23

    Aeromonas hydrophila has increasingly been implicated as a virulent and antibiotic-resistant etiologic agent in various human diseases. In a previously published case report, we described a subject with a polymicrobial wound infection that included a persistent and aggressive strain of A. hydrophila (E1), as well as a more antibiotic-resistant strain of A. hydrophila (E2). To better understand the differences between pathogenic and environmental strains of A. hydrophila, we conducted comparative genomic and functional analyses of virulence-associated genes of these two wound isolates (E1 and E2), the environmental type strain A. hydrophila ATCC 7966(T), and four other isolates belonging to A. aquariorum, A. veronii, A. salmonicida, and A. caviae. Full-genome sequencing of strains E1 and E2 revealed extensive differences between the two and strain ATCC 7966(T). The more persistent wound infection strain, E1, harbored coding sequences for a cytotoxic enterotoxin (Act), a type 3 secretion system (T3SS), flagella, hemolysins, and a homolog of exotoxin A found in Pseudomonas aeruginosa. Corresponding phenotypic analyses with A. hydrophila ATCC 7966(T) and SSU as reference strains demonstrated the functionality of these virulence genes, with strain E1 displaying enhanced swimming and swarming motility, lateral flagella on electron microscopy, the presence of T3SS effector AexU, and enhanced lethality in a mouse model of Aeromonas infection. By combining sequence-based analysis and functional assays, we characterized an A. hydrophila pathotype, exemplified by strain E1, that exhibited increased virulence in a mouse model of infection, likely because of encapsulation, enhanced motility, toxin secretion, and cellular toxicity. Aeromonas hydrophila is a common aquatic bacterium that has increasingly been implicated in serious human infections. While many determinants of virulence have been identified in Aeromonas, rapid identification of pathogenic versus nonpathogenic

  8. CAViaR-based forecast for oil price risk

    International Nuclear Information System (INIS)

    Huang, Dashan; Yu, Baimin; Fabozzi, Frank J.; Fukushima, Masao

    2009-01-01

    As a benchmark for measuring market risk, value-at-risk (VaR) reduces the risk associated with any kind of asset to just a number (amount in terms of a currency), which can be well understood by regulators, board members, and other interested parties. This paper employs a new VaR approach due to Engle and Manganelli [Engle, R.F., Manganelli, S., 2004. CAViaR: Conditional Autoregressive Value at Risk by Regression Quantiles. Journal of Business and Economic Statistics 22, 367-381] to forecasting oil price risk. In doing so, we provide two original contributions by introducing a new exponentially weighted moving average CAViaR model and developing a mixed data regression model for multi-period VaR prediction. (author)

  9. Molecular diversity among domestic guinea-pigs (Cavia porcellus and their close phylogenetic relationship with the Andean wild species Cavia tschudii Diversidad molecular entre cuyes domésticos (Cavia porcellus y su relación filogenética cercana con la especie silvestre andina Cavia tschudii

    Directory of Open Access Journals (Sweden)

    ÁNGEL E SPOTORNO

    2004-06-01

    Full Text Available To investigate the origin and diversity of domestic guinea-pigs Cavia porcellus (Linnaeus, 1758; Rodentia, Caviidae, we sequenced the mitochondrial cytochrome b gene of 12 domestic and 10 wild specimens from six species, including the two presumed as ancestral to the domestic one: Cavia tschudii and Cavia aperea. All maximum parsimony and maximum likelihood analyses grouped C. porcellus with C. tschudii (mean K2P distance = 3.2 %; best trees had 609 steps (CI = 0.796; Bremer support Index (SI = 28, and a _Ln = 4419.52, with 100 % and 97 % bootstrap support respectively. This clade, supported by three substitutions and 96 % bootstrap, is also obtained in the cladistic analysis of corresponding amino acids. When the C. aperea node was forced to join C. porcellus, these trees were consistently longer, less likely and robust, and with less defining characters than the optimal one. All C. porcellus sequences also clustered in a node defined by 15 substitutions. The sub-node containing animals from city markets, pet shops and laboratories was characterized by four substitutions (one non-silent, SI = 7, and 91 % bootstrap. Some South American C. porcellus, called "criollos" (creoles by local breeders, were more diverse. Probably, a particular clade from southern Peru and Chile may represent a pre-Columbian lineage. Mean K2P distance between C. tschudii and C. aperea was rather large, 7.7 %. Cavia appeared as a robust node (100 % bootstrap. These results indicate that C. tschudii is the species most closely related to C. porcellusPara investigar el origen y la divergencia de los cuyes domésticos Cavia porcellus (Linnaeus, 1758; Rodentia, Caviidae, secuenciamos el gen mitocondrial para citocromo b de 12 especímenes domésticos y 10 silvestres de seis especies, incluyendo las dos que se presumen como ancestro de la doméstica: C. tschudii y C. aperea. Todos los análisis de máxima parsimonia y máxima verosimilitud agruparon a C. porcellus con C

  10. Aeromonas spp.: an emerging pathogen?

    Directory of Open Access Journals (Sweden)

    Andrea Bartolini

    2015-12-01

    Full Text Available The aim of this study is to identify and monitor the presence of Aeromonas spp. strains in stool cultures. We analyzed 5564 stool cultures from September 2012 to August 2013. Sixty-three patients were positive for Aeromonas spp. The most frequent symptoms were: diarrhea (46.0% and abdominal pain (12.7%. Pediatric subjects were 28. Samples’ microscopic examination showed leukocytes in 38.1% of cases. It is still controversial whether Aeromonas are responsible for human gastroenteritis, but their presence in faecies of symptomatic patients supports their etiologic role. We propose search for toxins by polymerase chain reaction to identify strains that require an antibiotic therapy.

  11. Chlamydia caviae infection alters abundance but not composition of the guinea pig vaginal microbiota.

    Science.gov (United States)

    Neuendorf, Elizabeth; Gajer, Pawel; Bowlin, Anne K; Marques, Patricia X; Ma, Bing; Yang, Hongqiu; Fu, Li; Humphrys, Michael S; Forney, Larry J; Myers, Garry S A; Bavoil, Patrik M; Rank, Roger G; Ravel, Jacques

    2015-06-01

    In humans, the vaginal microbiota is thought to be the first line of defense again pathogens including Chlamydia trachomatis. The guinea pig has been extensively used as a model to study chlamydial infection because it shares anatomical and physiological similarities with humans, such as a squamous vaginal epithelium as well as some of the long-term outcomes caused by chlamydial infection. In this study, we aimed to evaluate the guinea pig-C. caviae model of genital infection as a surrogate for studying the role of the vaginal microbiota in the early steps of C. trachomatis infection in humans. We used culture-independent molecular methods to characterize the relative and absolute abundance of bacterial phylotypes in the guinea pig vaginal microbiota in animals non-infected, mock-infected or infected by C. caviae. We showed that the guinea pig and human vaginal microbiotas are of different bacterial composition and abundance. Chlamydia caviae infection had a profound effect on the absolute abundance of bacterial phylotypes but not on the composition of the guinea pig vaginal microbiota. Our findings compromise the validity of the guinea pig-C. caviae model to study the role of the vaginal microbiota during the early steps of sexually transmitted infection. © FEMS 2015.

  12. Use of a chiA probe for detection of chitinase genes in bacteria from the Chesapeake Bay

    Digital Repository Service at National Institute of Oceanography (India)

    Ramaiah, N.; Hill, R.T.; Chun, J.; Ravel, J.; Matte, M.H.; Straube, W.L.; Colwell, R.R.

    PCR primers specific for the chiA gene were designed by alignment and selection of highly conserved regions of chiA sequences from Serratia marcescens, Alteromonas sp., Bacillus circulans and Aeromonas caviae. These primers were used to amplify a...

  13. Characterization of Aeromonas hydrophila Wound Pathotypes by Comparative Genomic and Functional Analyses of Virulence Genes

    Science.gov (United States)

    Grim, Christopher J.; Kozlova, Elena V.; Sha, Jian; Fitts, Eric C.; van Lier, Christina J.; Kirtley, Michelle L.; Joseph, Sandeep J.; Read, Timothy D.; Burd, Eileen M.; Tall, Ben D.; Joseph, Sam W.; Horneman, Amy J.; Chopra, Ashok K.; Shak, Joshua R.

    2013-01-01

    ABSTRACT Aeromonas hydrophila has increasingly been implicated as a virulent and antibiotic-resistant etiologic agent in various human diseases. In a previously published case report, we described a subject with a polymicrobial wound infection that included a persistent and aggressive strain of A. hydrophila (E1), as well as a more antibiotic-resistant strain of A. hydrophila (E2). To better understand the differences between pathogenic and environmental strains of A. hydrophila, we conducted comparative genomic and functional analyses of virulence-associated genes of these two wound isolates (E1 and E2), the environmental type strain A. hydrophila ATCC 7966T, and four other isolates belonging to A. aquariorum, A. veronii, A. salmonicida, and A. caviae. Full-genome sequencing of strains E1 and E2 revealed extensive differences between the two and strain ATCC 7966T. The more persistent wound infection strain, E1, harbored coding sequences for a cytotoxic enterotoxin (Act), a type 3 secretion system (T3SS), flagella, hemolysins, and a homolog of exotoxin A found in Pseudomonas aeruginosa. Corresponding phenotypic analyses with A. hydrophila ATCC 7966T and SSU as reference strains demonstrated the functionality of these virulence genes, with strain E1 displaying enhanced swimming and swarming motility, lateral flagella on electron microscopy, the presence of T3SS effector AexU, and enhanced lethality in a mouse model of Aeromonas infection. By combining sequence-based analysis and functional assays, we characterized an A. hydrophila pathotype, exemplified by strain E1, that exhibited increased virulence in a mouse model of infection, likely because of encapsulation, enhanced motility, toxin secretion, and cellular toxicity. PMID:23611906

  14. Plasmid-cured Chlamydia caviae activates TLR2-dependent signaling and retains virulence in the guinea pig model of genital tract infection.

    Science.gov (United States)

    Frazer, Lauren C; Darville, Toni; Chandra-Kuntal, Kumar; Andrews, Charles W; Zurenski, Matthew; Mintus, Margaret; AbdelRahman, Yasser M; Belland, Robert J; Ingalls, Robin R; O'Connell, Catherine M

    2012-01-01

    Loss of the conserved "cryptic" plasmid from C. trachomatis and C. muridarum is pleiotropic, resulting in reduced innate inflammatory activation via TLR2, glycogen accumulation and infectivity. The more genetically distant C. caviae GPIC is a natural pathogen of guinea pigs and induces upper genital tract pathology when inoculated intravaginally, modeling human disease. To examine the contribution of pCpGP1 to C. caviae pathogenesis, a cured derivative of GPIC, strain CC13, was derived and evaluated in vitro and in vivo. Transcriptional profiling of CC13 revealed only partial conservation of previously identified plasmid-responsive chromosomal loci (PRCL) in C. caviae. However, 2-deoxyglucose (2DG) treatment of GPIC and CC13 resulted in reduced transcription of all identified PRCL, including glgA, indicating the presence of a plasmid-independent glucose response in this species. In contrast to plasmid-cured C. muridarum and C. trachomatis, plasmid-cured C. caviae strain CC13 signaled via TLR2 in vitro and elicited cytokine production in vivo similar to wild-type C. caviae. Furthermore, inflammatory pathology induced by infection of guinea pigs with CC13 was similar to that induced by GPIC, although we observed more rapid resolution of CC13 infection in estrogen-treated guinea pigs. These data indicate that either the plasmid is not involved in expression or regulation of virulence in C. caviae or that redundant effectors prevent these phenotypic changes from being observed in C. caviae plasmid-cured strains.

  15. Plasmid-cured Chlamydia caviae activates TLR2-dependent signaling and retains virulence in the guinea pig model of genital tract infection.

    Directory of Open Access Journals (Sweden)

    Lauren C Frazer

    Full Text Available Loss of the conserved "cryptic" plasmid from C. trachomatis and C. muridarum is pleiotropic, resulting in reduced innate inflammatory activation via TLR2, glycogen accumulation and infectivity. The more genetically distant C. caviae GPIC is a natural pathogen of guinea pigs and induces upper genital tract pathology when inoculated intravaginally, modeling human disease. To examine the contribution of pCpGP1 to C. caviae pathogenesis, a cured derivative of GPIC, strain CC13, was derived and evaluated in vitro and in vivo. Transcriptional profiling of CC13 revealed only partial conservation of previously identified plasmid-responsive chromosomal loci (PRCL in C. caviae. However, 2-deoxyglucose (2DG treatment of GPIC and CC13 resulted in reduced transcription of all identified PRCL, including glgA, indicating the presence of a plasmid-independent glucose response in this species. In contrast to plasmid-cured C. muridarum and C. trachomatis, plasmid-cured C. caviae strain CC13 signaled via TLR2 in vitro and elicited cytokine production in vivo similar to wild-type C. caviae. Furthermore, inflammatory pathology induced by infection of guinea pigs with CC13 was similar to that induced by GPIC, although we observed more rapid resolution of CC13 infection in estrogen-treated guinea pigs. These data indicate that either the plasmid is not involved in expression or regulation of virulence in C. caviae or that redundant effectors prevent these phenotypic changes from being observed in C. caviae plasmid-cured strains.

  16. Assessment of toxicity of a glyphosate-based formulation using bacterial systems in lake water.

    Science.gov (United States)

    Amorós, I; Alonso, J L; Romaguera, S; Carrasco, J M

    2007-05-01

    A new Aeromonas bioassay is described to assess the potential harmful effects of the glyphosate-based herbicide, Roundup, in the Albufera lake, a protected area near Valencia. Viability markers as membrane integrity, culturability and beta-galactosidase production of Aeromonas caviae were studied to determine the influence of the herbicide in the bacterial cells. Data from the multifactor analysis of variance test showed no significant differences (P>0.05) between A. caviae counts of viability markers at the studied concentrations (0, 50 and 100 mg l-1 of glyphosate). The effects of Roundup on microbial biota present in the lake were assessed by measuring the number of indigenous mesophilic Aeromonas in presence of different amounts of the herbicide at 0, 50 and 100 mg l-1 of glyphosate. In samples containing 50 and 100 mg l-1 of glyphosate a significant (PAlbufera lake water to Microtox luminescent bacterium (Vibrio fischeri) also was determined. The EC50 values obtained were 36.4 mg l-1 and 64.0 mgl-1 of glyphosate respectively. The acidity (pH 4.5) of the herbicide formulation was the responsible of the observed toxicity.

  17. The effect of infectious dose on humoral and cellular immune responses in Chlamydophila caviae primary ocular infection.

    Directory of Open Access Journals (Sweden)

    Ana Filipovic

    Full Text Available Following infection, the balance between protective immunity and immunopathology often depends on the initial infectious load. Several studies have investigated the effect of infectious dose; however, the mechanism by which infectious dose affects disease outcomes and the development of a protective immune response is not known. The aim of this study was to investigate how the infectious dose modulates the local and systemic humoral and the cellular immune responses during primary ocular chlamydial infection in the guinea pig animal model. Guinea pigs were infected by ocular instillation of a Chlamydophila caviae-containing eye solution in the conjunctival sac in three different doses: 1×102, 1×104, and 1×106 inclusion forming units (IFUs. Ocular pathology, chlamydial clearance, local and systemic C. caviae-specific humoral and cellular immune responses were assessed. All inocula of C. caviae significantly enhanced the local production of C. caviae-specific IgA in tears, but only guinea pigs infected with the higher doses showed significant changes in C. caviae-specific IgA levels in vaginal washes and serum. On complete resolution of infection, the low dose of C. caviae did not alter the ratio of CD4+ and CD8+ cells within guinea pigs' submandibular lymph node (SMLN lymphocytes while the higher doses increased the percentages of CD4+ and CD8+ cells within the SMLN lymphocytes. A significant negative correlation between pathology intensity and the percentage of CD4+ and CD8+ cells within SMLN lymphocyte pool at selected time points post-infection was recorded for both 1×104, and 1×106 IFU infected guinea pigs. The relevance of the observed dose-dependent differences on the immune response should be further investigated in repeated ocular chlamydial infections.

  18. Antimicrobial resistance prevalence of Aeromonas hydrophila isolates from motile Aeromonas septicemia disease

    Science.gov (United States)

    Kusdarwati, R.; Rozi; Dinda, N. D.; Nurjanah, I.

    2018-04-01

    Fish suffer, from bacteria, fungi, virus and parasites or by physical ailments. Gurami (Osphronemus gouramy), nila (Oreochromis niloticus), carp (Cyprinus carpio), catfish (Clarias sp.) were the most reported infections caused by Aeromonas are bacterial hemorrhagic septicemia or Motile Aeromonas Septicemia (MAS). Antibiotics are drugs of natural or synthetic origin that have the capacity to kill or to inhibit the growth of micro-organisms included MAS. However, the use of antibiotics in the long term can cause negative impacts, among others, feared the occurrence of bacterial resistance in certain antibiotics. The results showed five of isolates were sensitive to antibiotics of chloramphenicol, gentamycin, oxytetracycline, cefradoxil and nalidixic acid but resistant to vancomycin colistin sulphate, rifampisin, cephalosporin and novobiocin.

  19. Performances de production des cobayes (Cavia porcellus L.) en ...

    African Journals Online (AJOL)

    Production performance of guinea pigs (Cavia porcellus L.) in function of dietary protein level. ABSTRACT. In Cameroon, guinea pigs raising is still practiced in kitchens and on the ground and their food is ... females were previously crossed with 12 males for a period of 31 days according to a factorial design of three.

  20. Genética poblacional de cobayas de Colombia, Cavia spp. (Rodentia: Caviidae con marcadores moleculares RAPD

    Directory of Open Access Journals (Sweden)

    Héctor Aníbal Campos

    2008-09-01

    Full Text Available En el presente estudio, mostramos los primeros resultados moleculares de formas colombianas de Cavia. Claramente, la población silvestre de C. anolaimae fue genéticamente diferenciada de la forma doméstica, C. porcellus, tal como ha sido demostrado por otros autores utilizando resultados morfométricos, osteológicos y cariotípicos. Ambas especies mostraron un considerable nivel de diversidad genética, aunque el segundo taxon mostró niveles mayores de esta diversidad. Los niveles de heterogeneidad genética también fueron mayores entre las poblaciones de C. porcellus (F ST = 0.254 que entre las poblaciones de C. anolaimae (F ST = 0.118. Esos niveles significativos de heterogeneidad genética, y los consiguientes bajos niveles de flujo génico, fueron discutidos comparativamente con los resultados por otros autores analizando otros marcadores moleculares (citocromo-b mitocondrial. Los resultados aquí mostrados son coherentes con un complejo proceso de domesticación en Cavia porcellus.Population genetics of Colombian Guinea Pigs, Cavia spp. (Rodentia: Caviidae with RAPD molecular markers. The genus Cavia occurs in South America, mainly in grasslands.. We collected blood samples from 97 individuals in six field populations and analyzed them with RAPD molecular markers. One wild type (C. anolaimae was differentiated from the domestic form (C. porcellus, in agreement with other authors who used morphological, osteological and karyotipic results. Genetic diversity was considerable in both species, but higher in C. porcellus. The levels of genetic heterogeneity were also higher among the populations of C. porcellus (F ST = 0.254 than among the populations of C. anolaimae (F ST = 0.118. These significant levels of genetic heterogeneity, and the low levels of gene flow, were consistent with a complex domestication process for Cavia porcellus. Rev. Biol. Trop. 56 (3: 1481-1501. Epub 2008 September 30.

  1. Multilocus genetics to reconstruct aeromonad evolution

    Directory of Open Access Journals (Sweden)

    Roger Frédéric

    2012-04-01

    Full Text Available Abstract Background Aeromonas spp. are versatile bacteria that exhibit a wide variety of lifestyles. In an attempt to improve the understanding of human aeromonosis, we investigated whether clinical isolates displayed specific characteristics in terms of genetic diversity, population structure and mode of evolution among Aeromonas spp. A collection of 195 Aeromonas isolates from human, animal and environmental sources was therefore genotyped using multilocus sequence analysis (MLSA based on the dnaK, gltA, gyrB, radA, rpoB, tsf and zipA genes. Results The MLSA showed a high level of genetic diversity among the population, and multilocus-based phylogenetic analysis (MLPA revealed 3 major clades: the A. veronii, A. hydrophila and A. caviae clades, among the eleven clades detected. Lower genetic diversity was observed within the A. caviae clade as well as among clinical isolates compared to environmental isolates. Clonal complexes, each of which included a limited number of strains, mainly corresponded to host-associated subsclusters of strains, i.e., a fish-associated subset within A. salmonicida and 11 human-associated subsets, 9 of which included only disease-associated strains. The population structure was shown to be clonal, with modes of evolution that involved mutations in general and recombination events locally. Recombination was detected in 5 genes in the MLSA scheme and concerned approximately 50% of the STs. Therefore, these recombination events could explain the observed phylogenetic incongruities and low robustness. However, the MLPA globally confirmed the current systematics of the genus Aeromonas. Conclusions Evolution in the genus Aeromonas has resulted in exceptionally high genetic diversity. Emerging from this diversity, subsets of strains appeared to be host adapted and/or “disease specialized” while the A. caviae clade displayed an atypical tempo of evolution among aeromonads. Considering that A. salmonicida has been

  2. Genospecies and virulence factors of Aeromonas species in ...

    African Journals Online (AJOL)

    Introduction: Aeromonads of medical importance have been reported from numerous clinical, food, and water sources, but identification of genospecies and virulence factors of Aeromonas species from countries in North Africa and the Middle East are few. Methods: In total 99 Aeromonas species isolates from different ...

  3. A 9.61-W, b-cut Tm,Ho:YAP laser in Q-switched mode operation

    Science.gov (United States)

    Li, Guoxing; Yang, Xining; Zhang, Ziqiu; Zhang, Hongda; Zhang, Liang

    2018-02-01

    A high energy of b-cut Tm, Ho:YAlO3 laser is reported in the paper. The laser operated in acousto-optical Qswitched mode at 2.12 μm. The output average power of 9.61 W was achieved at the pulse repetition frequency of 10 kHz ,and the power of 11.6 W was acquired in continuous wave mode. Moreover, the energy per pulse of 0.961 mJ in 64.4 ns was acquired at 10 kHz with a 14.92-kW peak power.

  4. Purification and characterization of the chitosanase from Aeromonas ...

    African Journals Online (AJOL)

    Purification and characterization of the chitosanase from Aeromonas sp. HG08. Y Sun, J Zhang, S Wang. Abstract. In this work, the characterization of a chitosanase-producing bacterium isolated from soil was reported and this strain was grouped under the genus Aeromonas by virtue of its morphological, physiological ...

  5. NDM 1 Gene Carrying Gram negative Bacteria Isolated from Rats ...

    African Journals Online (AJOL)

    In this study, we screened 56 Gram negative bacteria comprising: 3 isolates of Enterobacter ludwigii, 30 Pseudomonas aeruginosa, 22 Proteus mirabilis, and 1 Aeromonas caviae isolated from oral cavity and rectum of rats captured from commercial poultry houses in Ibadan, Oyo State, Nigeria that were resistant to at least ...

  6. NIGERIAN VETERINARY JOURNAL

    African Journals Online (AJOL)

    ADEYEYE

    In this study, we screened 56 Gram negative bacteria comprising: 3 isolates of Enterobacter ludwigii, 30 Pseudomonas aeruginosa, 22. Proteus mirabilis, and 1 Aeromonas caviae isolated from oral cavity and rectum of rats captured from commercial poultry houses in Ibadan, Oyo State, Nigeria that were resistant to at least ...

  7. Sanitary evaluation of domestic water supply facilities with storage tanks and detection of Aeromonas, enteric and related bacteria in domestic water facilities in Okinawa Prefecture of Japan.

    Science.gov (United States)

    Miyagi, Kazufumi; Sano, Kouichi; Hirai, Itaru

    2017-08-01

    To provide for temporary restrictions of the public water supply system, storage tanks are commonly installed in the domestic water systems of houses and apartment buildings in Okinawa Prefecture of Japan. To learn more about the sanitary condition and management of these water supply facilities with storage tanks (hereafter called "storage tank water systems") and the extent of bacterial contamination of water from these facilities, we investigated their usage and the existence of Aeromonas, enteric and related bacteria. Verbal interviews concerning the use and management of the storage tank water systems were carried out in each randomly sampled household. A total of 54 water samples were collected for bacteriological and physicochemical examinations. Conventional methods were used for total viable count, fecal coliforms, identification of bacteria such as Aeromonas, Enterobacteriaceae and non-fermentative Gram-negative rods (NF-GNR), and measurement of residual chlorine. On Aeromonas species, tests for putative virulence factor and an identification using 16S rRNA and rpoB genes were also performed. Water from the water storage systems was reported to be consumed directly without boiling in 22 of the 54 houses (40.7%). 31 of the sampled houses had installed water storage tanks of more than 1 cubic meter (m 3 ) per inhabitant, and in 21 of the sampled houses, the tank had never been cleaned. In all samples, the total viable count and fecal coliforms did not exceed quality levels prescribed by Japanese waterworks law. Although the quantity of bacteria detected was not high, 23 NF-GNR, 14 Enterobacteriaceae and 5 Aeromonas were isolated in 42.6%, 7.4% and 3.7% of samples respectively. One isolated A. hydrophila and four A. caviae possessed various putative virulence factors, especially A. hydrophila which had diverse putative pathogenic genes such as aer, hlyA, act, alt, ast, ser, and dam. Many bacteria were isolated when the concentration of residual chlorine

  8. Interlaboratorium vergelijking van het onderzoek naar Aeromonas spp. in drinkwater (tweede onderzoek)

    NARCIS (Netherlands)

    Versteegh JFM; During M; Heisterkamp SH; Havelaar AH

    1988-01-01

    Door middel van kwantitatief onderzoek naar Aeromonas-bacterien in drie verschillende monsters water (De Bilt, De Meent en De Laak) werd een vergelijking gemaakt van de resultaten van Aeromonas onderzoek in 15 laboratoria in het kader van het deelproject: "Aeromonas in drinkwater".

  9. Susceptibility of Aeromonas Hydophila Isolates to Antimicrobial Drugs

    Directory of Open Access Journals (Sweden)

    Igor Stojanov

    2010-05-01

    Full Text Available Aeromonas hydrophila is a microorganism widely distributed in nature: in water, soil, food. It is also part of the normal bacterial flora of many animals. As an opportune microorganism it is a secondary biological agent that contributes to the occurrence of a fish disease and its deterioration. Frequently, its presence is an indication of bad zoohygiene and zootechnical conditions in fish ponds. Reduced quality and quantity of feed, mechanical injuries, parasitosis, seasonal oscillation in temperature present some of the factors that produce favorable conditions for bacterial proliferation of aeromonas in fish ponds, so clinical symptoms of the disease occur. Aeromonas is almost always present in clinical isolates and may be unjustly accused for bad health of fish. Antibiotic therapy is applied even when the clinical findings are clear, what certainly effects the susceptibility to chemotherapeutics. The subject of our work was bacteriological examination of the material obtained from the carps with the observed skin changes and the carps without these changes. Also, antimicrobial susceptibility of Aeromonas hydrophila was tested. The aim of this research was to determined the presence of Aeromonas hydrophilia in the carp ponds and to test antibiotic susceptibility. The material consisted of the samples from the fish ponds where the carps were with and without changed skin. The method the isolation of Aeromonas hydrophila was used. The diffusion disk technique was used for testing antibiotic susceptibility. The isolates were tested for their susceptibility to Florephenikol, Flumequine, Olaqindox and Oxitetracycline. The obtained results point that antimicrobial susceptibility was the same regardless of the origin of the samples, i.e. the resistance was the same for both groups of samples (the strains isolated from the fish with skin changes and the strains from fish without changes on skin. The strains were highly resistant: 35% were resistant to

  10. Quorum Sensing Regulation in Aeromonas hydrophila

    DEFF Research Database (Denmark)

    Garde, Christian; Bjarnsholt, Thomas; Givskov, Michael

    2010-01-01

    We present detailed results on the C4-HSL-mediated quorum sensing (QS) regulatory system of the opportunistic Gram-negative bacterium Aeromonas hydrophila. This bacterium contains a particularly simple QS system that allows for a detailed modeling of kinetics. In a model system (i.e., the Escheri......We present detailed results on the C4-HSL-mediated quorum sensing (QS) regulatory system of the opportunistic Gram-negative bacterium Aeromonas hydrophila. This bacterium contains a particularly simple QS system that allows for a detailed modeling of kinetics. In a model system (i...

  11. Quantitative Recovery of Aeromonas hydrophila from Nsukka Sewage

    African Journals Online (AJOL)

    Sewage samples were analyzed for the recovery of Aeromonas hydrophila. The pH of the samples ranged from 8.2 - 9.6 and the temperature from 20.0 – 28.7. Samples were enriched in alkaline peptone water medium (pH 8.4) before plating on different selective media. Media tested for the recovery of Aeromonas ...

  12. IDENTIFIKASI NEMATODA PARASIT PADA SALURAN PENCERNAAN MARMUT (Cavia cobaya SEBAGAI SUMBER BELAJAR BIOLOGI PADA MATERI INVERTEBRATA

    Directory of Open Access Journals (Sweden)

    Septia Nurhasanah

    2014-05-01

    Full Text Available The research was conducted in the Laboratory of Science Education, University of Muhammadiyah Metro. The research is a descriptive analysis, morphological observations were made by identifying the nematode parasite found that Trichostrongylus sp, Strongyloides sp, Trichuris sp, Trichuris sp. The results showed the prevalence and intensity values is the large number of guinea pigs to parasites divided by the number of guinea pigs that are 100% inspected. While the intensity is seen from the total number of nematode parasites that infect in the number of guinea pigs infected with a parasite that is 2,3. The population in this study was 10 cows pigs (Cavia cobaya . This study took a part in the digestion of marmots (Cavia cobaya the intestines and stomach , then cut and taken part in the large intestine and be Indian ink or coloring 2-3 drops to be easily identified microscopically . Put the preparations into a petri dish , and given alcohol as much as 96 % with 2-3 drops . Taking part in the examination of the large intestine to taste then used the nematode worm structure with Indian ink dye to be observed , and placed in the glass object . Observed with a microscope. Document if the parasites are found by using the camera Erlina 2008. Identification of the observations made have found 3 types of parasites that attack the guinea pig (Cavia cobaya is Strongyloides sp on samples 1,2,3,4,5,6 , dan10 . Then parasite Trichuris sp species found in samples 8 and 9. Trichostrongylus sp parasite species found in sample 7 . Parasitic nematodes found were 3 types of Trichostrongylus sp, Strongyloides sp, Trichuris sp. Number of samples that have been observed as many as 10 cows pigs (Cavia cobaya , with the overall result is as much as 23 tails parasites.               Kata kunci: nematode parasit, marmut (Cavia cobaya, sumber belajar biologi.

  13. Aeromonas spp. IN PRODUCTS OF ANIMAL ORIGIN AND DRINKING WATER OF GOIÂNIA-GO Aeromonas spp. EM PRODUTOS DE ORIGEM ANIMAL E EM ÁGUA DE CONSUMO DE GOIÂNIA - GO

    Directory of Open Access Journals (Sweden)

    Albenones José de Mesquita

    2007-09-01

    Full Text Available

    A total of 53 samples of products from animal origin and drinking water was examined for the presence of Aeromonas spp. Aeromonas occurred in 26.41% (14/53 of the samples. The raw products showed high frequency of contamination and relatively high count Aeromonas hydrophila was the dominating species, 57.5%, being followed of A. veroni (22.5%, A. sobria (17.5% and A. media (2.5%. None of the Aeromonas spp. was isolated from chlorinated or unchlorinated drinking water.

    KEY-WORDS: Aeromonas; animal origin products; drinking water.

    Um total de 53 amostras de produtos de origem animal e água de consumo foi examinado para se verificar a presença de Aeromonas spp. Desse total, 14/53 (26,41% amostras foram positivas para Aeromonas. Os produtos crus apresentaram maior freqüência de contaminação e contagem relativamente elevadas. A espécie Aeromonas hydrophila foi a mais freqüente (57,5%, seguida pelas espécies A. veroni (22,5%, A. sobria (17,5% e A. media (2,5%. Nenhuma amostra de água de consumo, clorada ou não clorada, mostrou-se positiva para Aeromonas ssp.

    PALAVRA-CHAVE: Aeromonas; produtos de origem animal; água de consumo.

  14. Prevalence of Aeromonas species and Escherichia coli in stool ...

    African Journals Online (AJOL)

    Background: Diarrhoea is one of the main causes of mortality and morbidity in childhood. Bacterial diarrhoea is a common disorder. Aeromonas species and Escherichia coli (E. coli) are some of the aetiological agents associated with diarrhoea in children. Objective: To determine the prevalence of Aeromonas species and ...

  15. Do young guinea pigs (Cavia porcellus) develop an attachment to inanimate objects?

    NARCIS (Netherlands)

    Janzen, MID; Timmermans, PJA; Kruijt, JP; Vossen, JMH

    1999-01-01

    Filial imprinting has been studied extensively in precocial birds. In these studies, inanimate objects were used as imprinting objects. Although attachment to the parents is common in mammals, experiments with inanimate objects are rare and mostly restricted to guinea pigs (Cavia porcellus). The

  16. Interlaboratorium vergelijking van het onderzoek naar Aeromonas spp. in drinkwater

    NARCIS (Netherlands)

    Havelaar AH; During M; Versteegh JFM

    1986-01-01

    Door middel van onderzoek van zes kunstmatig besmette gesimuleerde monsters drinkwater ( 4 Aeromonas spp., 1 Klebsiella oxytoca, 1 Pseudomonas aeruginosa) werd een vergelijking gemaakt van de resultaten van Aeromonas onderzoek in 14 laboratoria. De tellingen in de deelnemende laboratoria

  17. Efecto modulador del sulfuro de hidrógeno en el metabolismo basal en Cavia porcellus (cuy) normales

    OpenAIRE

    Gómez Herreros, César Gonzalo

    2016-01-01

    Evalúa el efecto modulador del H2S a 80 ppm sobre el metabolismo basal en Cavia porcellus (cuy) normales. Para ello mide el consumo de oxígeno y producción de dióxido de carbono del Cavia porcellus (cuy) normales inmediatamente antes y después de la exposición al sulfuro de hidrógeno. Para luego determinar los cambios histológicos a nivel de tejido pulmonar, cardiaco y renal, y los niveles de hemoglobina entre los grupos experimentales (control, experimental y gold estándar). Tesis

  18. Experimental induction of motile Aeromonas septicemia in channel catfish (Ictalurus punctatus by waterborne challenge with virulent Aeromonas hydrophila

    Directory of Open Access Journals (Sweden)

    Dunhua Zhang

    2016-05-01

    Full Text Available Motile Aeromonas septicemia (MAS, caused by virulent clonal isolates of Aeromonas hydrophila (vAh, is emerging as a major disease in catfish (Ictalurus punctatus aquaculture in the Southeastern United States. Predisposing conditions leading to vAh infection in catfish were however largely unknown. The objective of this study was to investigate factors that predispose catfish to vAh infection and establish a waterborne challenge model that mimics natural occurrence of MAS. Results of this study indicated that wounding on the fish body surface was one of the key factors that predisposed catfish to vAh infection via waterborne route. Relatively uniform wounds were created by clipping part of the fish adipose fin. Adipose fin clipped (Af-clipped fish behaved normally in terms of swimming and feeding and no mortality occurred in the control treatment (a mock challenge. When subjected to challenge in vAh-infected water, Af-clipped fish were highly susceptible, showing typical symptoms of MAS observed in the field. The mortality rate of Af-clipped fish was significantly associated with vAh concentration, challenge time and water temperature. About 90% mortality occurred within 48 h when Af-clipped fish were challenged for 1 h with vAh at the concentration of 2 × 107 colony forming units per mL of water (27 ± 1 °C. The waterborne challenge model was further tested using four field isolates including A. hydrophila and A. veronii. All vAh isolates caused about 90% mortality of Af-clipped fish and one isolate of Aeromonas veronii caused no mortality under the same challenge conditions. The waterborne challenge model described in this study would facilitate urgently-needed studies of MAS prevention (such as wound avoidance and healing and control (such as prophylactic vaccination; antibiotics treatment and probiotics screening. Keywords: Adipose fin, Channel catfish, Motile Aeromonas septicemia, Virulent Aeromonas hydrophila, Waterborne challenge

  19. Biological control of Aeromonas salmonicida subsp. salmonicida infection in rainbow trout (Oncorhynchus mykiss) using Aeromonas phage PAS-1.

    Science.gov (United States)

    Kim, J H; Choresca, C H; Shin, S P; Han, J E; Jun, J W; Park, S C

    2015-02-01

    The potential control efficacy of Aeromonas phage PAS-1 was evaluated against Aeromonas salmonicida subsp. salmonicida infection in rainbow trout (Oncorhynchus mykiss) model in this study. The phage was co-cultured with the virulent A. salmonicida subsp. salmonicida strain AS05 that possesses the type III secretion system (TTSS) ascV gene, and efficient bacteriolytic activity was observed against the bacteria. The administration of PAS-1 in rainbow trout demonstrated that the phage was cleared from the fish within 200 h post-administration, and a temporal neutralizing activity against the phage was detected in the sera of phage-administrated fish. The administration of PAS-1 (multiplicity of infection: 10 000) in A. salmonicida subsp. salmonicida infected rainbow trout model showed notable protective effects, with increased survival rates and mean times to death. These results demonstrated that Aeromonas phage PAS-1 could be considered as an alternative biological control agent against A. salmonicida subsp. salmonicida infections in rainbow trout culture. © 2013 Blackwell Verlag GmbH.

  20. Importancia biosanitaria de aeromonas: Taxonomia y Epidemiologia

    OpenAIRE

    Soler Falgàs, Lara

    2003-01-01

    El género Aeromonas está constituido por bacterias Gram-negativas aisladas frecuentemente en el agua. Adquieren relevancia por estar presentes en alimentos, y ser capaces de ocasionar cuadros diarreicos e infecciones extraintestinales en el hombre, habiéndose demostrado en la presente tesis, que pueden ser las causantes de hasta el 2% de las diarreas del viajero. La taxonomía de Aeromonas es compleja. El género consta de 15 especies difíciles de identificar con métodos bioquímicos, por lo cua...

  1. Novo meio seletivo-indicador para detecção de Aeromonas e Plesiomonas: ágar UNISC New selective indicator medium for detection of Aeromonas and Plesiomonas: UNISC agar

    Directory of Open Access Journals (Sweden)

    Marion Pereira da Rocha

    2008-08-01

    Full Text Available Avaliou-se um novo meio seletivo-indicador (ágar UNISC para o isolamento de enteropatógenos clássicos e Aeromonas e Plesiomonas shigelloides. A capacidade de fermentação da xilose é indicada pela coloração amarela (fermentadores ou azul (não fermentadores que, aliada à prova da oxidase, constitui-se em indicador para a detecção de Aeromonas spp e Plesiomonas shigelloides. A produtividade e seletividade, avaliadas pelos índice de contagem absoluta e índice de contagem relativa indicam-no como uma alternativa aos coprocultivos clássicos porque permite, num só meio, o isolamento de Escherichia coli, Shigella spp, Salmonella spp, bem como, Aeromonas spp e Plesiomonas shigelloides, favorecendo o diagnóstico laboratorial das gastroenterites.We evaluated a new selective indicator medium (UNISC Agar for isolation of classical enteropathogens, Aeromonas spp and Plesiomonas shigelloides. The xylose fermentation capacity is indicated by a yellow color (fermenting agents or blue (no fermenting agent. This, together with the oxidase test, establishes it as an indicator for detecting Aeromonas and Plesiomonas shigelloides. Its productivity and selectivity, as assessed using the absolute count index and relative count index, indicate it as an alternative to the classical feces culturing media. This is because, in a single medium, it enables isolation of Escherichia coli, Shigella spp and Salmonella spp, in addition to Aeromonas and Plesiomonas shigelloides, thereby favoring the laboratory diagnosis of gastroenteritis.

  2. J-GLOBAL MeSH Dictionary: Aeromonas salmonicida [MeCab user dictionary for science technology term[Archive

    Lifescience Database Archive (English)

    Full Text Available MeCab user dictionary for science technology term Aeromonas salmonicida 名詞 一般 * * * * Aeromonas salmon...icida ... MeSH D048409 200906081596351600 C LS07 UNKNOWN_2 Aeromonas salmonicida

  3. Le cobaye Cavia porcellus L., comme animal de boucherie au Cameroun

    Directory of Open Access Journals (Sweden)

    Ngou Ngoupayou, JD.

    1994-01-01

    Full Text Available Guinea Pig Cavia porcellus L. As A Meat Producing Animal In Cameroon. Guinea pig Cavia porcellus farming for meat production remains a marginalised activity in Cameroon in spite of the advantages this specie offers. With the view to promote its production, a national countrywide survey was carried out in order to evaluate the production systems and constraints. Traditional guinea pig farming appears to be a secondary household activity undertaken by small farmers basically women. The extensive production system which reveals no management practices, integrates very well in the agricultural systems (small livestock, food crops and natural forages production of the western highlands and southern forest zones of Cameroon. Guinea pig productivity remains low due to many constraints such as predation, uncontrolled breeding, inbreeding, poor feeding, negative selection and lack of veterinary care. Nevertheless, guinea pig farming plays an important role in the well being of low income village dwellers as food security, cash savings and socio-cultural values within the populations of South Cameroon. The promotion of its production requires an awareness of animal scientists, development authorities, as well as on station research if improved raising conditions.

  4. Aeromonas veronii septicemia in an immunocompetent patient

    Directory of Open Access Journals (Sweden)

    Paula McKenzie

    2013-09-01

    Full Text Available We present a 29-year-old healthy man who fell into an industrial auger, sustaining acrushed, open pelvic injury, multiple comminuted fractures of the right leg, and traumaticamputation of his left foot. Blood and wound cultures were positive for Aeromonasspp and vancomycin resistant Enterococcus. Treatment included cefepime, levofloxacin,daptomycin, and metronidazole. Aeromonas veronii is a Gram negative bacillus usuallyfound in fresh and brackish water in warm climates. It can cause severe skin andsoft tissue infections, typically after injured tissue is exposed to contaminated water.Aeromonas septicemia is uncommon and is usually associated with underlying diseases,such as malignancy, cirrhosis, diabetes, or immunosuppression. It rarely occurs in ahealthy host.

  5. Antibacterial Effect of Gallic Acid against Aeromonas hydrophila and Aeromonas sobria Through Damaging Membrane Integrity.

    Science.gov (United States)

    Lu, Jing; Wang, Zhenning; Ren, Mengrou; Huang, Guoren; Fang, Baochen; Bu, Xiujuan; Liu, Yanhui; Guan, Shuang

    In the study, we investigated the antibacterial activity and mechanism of gallic acid against Aeromonas hydrophila and Aeromonas sobria. Gallic acid showed strong antimicrobial activity against the two bacteria. Furthermore, the antibacterial mechanism of gallic acid (0, 3, 6, 12 mM) was performed by membrane integrity assay and scanning electron microscopy (SEM) assay. The results showed that gallic acid notably increased the released material absorption value at 260, 280 nm and electric conductivity in a dose-dependent manner. Moreover, the SEM assay showed that gallic acid induced severe shrink of bacterial intima and irregular morphology in a dose-dependent manner. The SDS-PAGE profiles further confirmed that gallic acid could damage bacterial cells. These results indicated gallic acid exhibited antibacterial effect by destroying membrane integrity of A. hydrophila and A. sobria. Hence, gallic acid has great potential as a new natural food preservative in food fresh-keeping and storage.

  6. Een bijdrage tot de kennis van de experimentele tuberculeuze super-infectie bij de cavia

    NARCIS (Netherlands)

    Goslinga, Jan

    1960-01-01

    Er werd een beschrijving gegeven van een in 1954 in het sanatorium "de KLOKKENBERG" te Breda verricht onderzoek, waarbij 37 caviae achtereenvolgens enkele malen met virulente, tegen bepaalde stoffen selectief resistent gekweekte tuberkelbacteriën, afgeleid van &n bepaalde, bij een van de patienten

  7. Aeromonas presence in drinking water from collective reservoirs and wells in peri-urban area in Brazil

    Directory of Open Access Journals (Sweden)

    Maria Tereza Pepe Razzolini

    2010-10-01

    Full Text Available Aeromonas genus is considered an emerging pathogen and its presence in drinking water supplies is a reason to public health concern. This study investigated the occurrence of Aeromonas in samples from collective reservoirs and wells used as drinking water sources in a peri-urban area. A total of 35 water samples were collected from collective reservoirs and 32 from wells bimonthly, from September 2007 to September 2008. Aeromonas spp determination was carried out using a Multiple-Tube Technique. Samples were inoculated into alkaline peptone water and the superficial film formed was transferred to blood agar plates amended with ampicillin. Typical Aeromonas colonies were submitted to a biochemical screening and then to biochemical tests for species differentiation. Aeromonas was detected in 13 (19% of the 69 samples examined (6 from collective reservoirs and 7 from wells. Concentrations of Aeromonas in collective reservoirs ranged from <0.3 to 1.2 x10²MPN/100mL and, in wells, from <0.3 to 2.4 x10²MPN/100mL. The most frequent specie in the collective reservoir samples was Aeromonas spp (68%, followed by A. encheleia (14% and A. allosaccharophila (8% and A. hydrophila (8%. Aeromonas spp (87% was the most frequent specie isolated from well samples, followed by A. allosacchariphila (8%, A. encheleia (2% and A. jandaei (5%. These data show the presence and diversity of Aeromonas genus in the samples analyzed and highlight that its presence in drinking water poses a significant public health concern.

  8. Aminoglycoside-resistant Aeromonas hydrophila as part of a polymicrobial infection following a traumatic fall into freshwater.

    Science.gov (United States)

    Shak, Joshua R; Whitaker, Jennifer A; Ribner, Bruce S; Burd, Eileen M

    2011-03-01

    Amikacin is a first-line treatment for Aeromonas infection due to high efficacy. There are few reports of aminoglycoside-resistant Aeromonas spp. We report a soft tissue infection containing multiple pathogens, including a strain of Aeromonas hydrophila resistant to amikacin, tobramycin, and multiple cephalosporins.

  9. Aminoglycoside-Resistant Aeromonas hydrophila as Part of a Polymicrobial Infection following a Traumatic Fall into Freshwater▿

    Science.gov (United States)

    Shak, Joshua R.; Whitaker, Jennifer A.; Ribner, Bruce S.; Burd, Eileen M.

    2011-01-01

    Amikacin is a first-line treatment for Aeromonas infection due to high efficacy. There are few reports of aminoglycoside-resistant Aeromonas spp. We report a soft tissue infection containing multiple pathogens, including a strain of Aeromonas hydrophila resistant to amikacin, tobramycin, and multiple cephalosporins. PMID:21209173

  10. Prevalence, species differentiation, haemolytic activity, and antibiotic susceptibility of aeromonads in untreated well water

    Directory of Open Access Journals (Sweden)

    Khalifa Sifaw Ghenghesh

    2001-02-01

    Full Text Available The use of untreated water for drinking and other activities have been associated with intestinal and extraintestinal infections in humans due to Aeromonas species. In the present study aeromonads were isolated from 48.7% of 1,000 water samples obtained from wells and other miscellaneous sources. Aeromonas species were detected in 45% of samples tested in spring, 34.5% in summer, 48% in autumn and 60% of samples tested in winter. Speciation of 382 strains resulted in 225 (59% being A. hydrophila, 103 (27% A. caviae, 42 (11% A. sobria and 11 (3% atypical aeromonads. Of 171 Aeromonas strains tested for their haemolytic activity, 53%, 49%, 40% and 37% were positive in this assay using human, horse, sheep and camel erythrocytes respectively. The results obtained indicate that potentially enteropathogenic Aeromonas species are commonly present in untreated drinking water obtained from wells in Libya (this may also apply to other neighbouring countries which may pose a health problem to users of such water supplies. In addition, ceftriaxone and ciprofloxacin are suitable drugs that can be used in the treatment of Aeromonas-associated infections, particularly in the immunocompromised, resulting from contact with untreated sources of water.

  11. Aeromonas hydrophila urinary tract infection in pregnancy- Case report and literature review

    OpenAIRE

    Ragunathan, Latha; Kavitha, Kannaiyan; Raveendran, Vinod; Dhandapani, Senthil Pragash; Jaget, Nirmala; Kannivelu, Jayanthi

    2012-01-01

    A case of a pregnant woman without previous or concomitant disease, who developed an Aeromonas hydrophila urinary tract infection (UTI) at 12 weeks gestation, is reported. A brief review of the literature on the association and incidence of Aeromonas spp in urinary infections and also in association with pregnancy is presented.

  12. Injury Thresholds for Topical Cream-Coated Skin of Hairless Guinea Pigs (Cavia Procellus) in Near Infrared Region

    National Research Council Canada - National Science Library

    Stolarski, David J; Zohner, Justin J; Imholte, Michelle L; Chavey, Lucas J; Pocock, Ginger M; Buchanan, Kelvin C; Jindra, Nichole M; Figueroa, Manuel A; Thomas, Robert J; Rockwell, Benjamin A

    2006-01-01

    .... Hairless guinea pigs (cavia porcellus) in vivo were used to evaluate how the minimum visible lesion threshold for single-pulse laser exposure is changed with a topical agent applied to the skin...

  13. Twórczość grupy Zero-61 na tle działań intermedialnych w sztuce polskiej po roku 1945

    OpenAIRE

    Lechowicz, Lech

    2017-01-01

    Praca stanowi cykl publikacji. Na rozprawę składają się teksty opublikowane oraz przygotowywane do publikacji dotyczące problematyki intermedialności w sztuce polskiej po roku 1945. Centralnym przykładem tego typu zjawisk jest analiza działalności grupy Zero-61 (1961-1969) przedstawiona w publikacji książkowej. Pozostałe teksty uzupełniają tło historyczne działalności grupy, bieżące konteksty w sztuce lat sześćdziesiątych oraz zjawiska występujące w intermedialnych praktykach w dekadac...

  14. Sensitivity of planktonic and biofilm-associated Aeromonas spp. to ionizing radiation

    International Nuclear Information System (INIS)

    Nagar, Vandan; Bandekar, J.R.

    2015-01-01

    Genus Aeromonas has emerged as an important human pathogen because it causes a variety of diseases including gastroenteritis and extra-intestinal infections. Aeromonas have the ability to adhere and form biofilms on food surfaces and food contact surfaces. Biofilm formation on foods and food contact surfaces is the major reason for contamination, cross contamination and post-processing contamination of the final food product leading to food spoilage, product rejection, economic losses and food-borne diseases. Biofilms have shown high resistance to heat, desiccation, acidic condition, high salt concentration, antibiotics and other food preservatives. Earlier studies in our laboratory have shown that ionizing radiation effectively inactivates Aeromonas in different food products. However, the relative efficacy of this process against biofilm associated cells versus free-living planktonic cells of Aeromonas is not well documented. Therefore, the dose of gamma radiation required to reduce the population by 90% (D10) was calculated for planktonic and biofilm-associated A. salmonicida Y567 and A. hydrophila A331 cells. Both A. hydrophila A331 and A. salmonicida Y567 expressed significant ability to attach and grow on glass surface following incubation at 30℃ in TSB. Ionizing radiation effectively reduced the populations of both planktonic and biofilm-associated cells for both the strains. Mean cell counts of survivors and surviving fraction of planktonic and biofilm-associated cells decreased with increased irradiation doses. The D10 values of planktonic cells and biofilm cells for A. salmonicida (Y567) were 232.65 Gy and 248.41 Gy, respectively; whereas, the D10 values of planktonic cells and biofilm cells for A. hydrophila (A331) were 249.2 Gy and 240.2 Gy respectively. No significant difference in the D10 values of planktonic and biofilm associated Aeromonas was observed. The influence of the cultured state of the organism, i.e., planktonic versus biofilm associated

  15. Molecular detection and antimicrobial resistance of Aeromonas from houseflies (Musca domestica in Iran

    Directory of Open Access Journals (Sweden)

    Davood Ommi

    2015-11-01

    Full Text Available Objective. This study aimed to report the molecular detection and antimicrobial resistance of Aeromonas among houseflies (Musca domestica in Shahrekord and Isfahan provinces of Iran. Materials and methods. Flies were caught from household kitchens, cattle farms, animal hospitals, human hospitals, slaughter house and poultry farms and put in collection separate sterile tubes. Isolation was accomplished by culture of flies in alkaline peptone water followed by identification with Aeromonas-specific Polymerase Chain Reaction (PCR. Results. Out of 600 houseflies 73 (12.2% were infected with Aeromonas spp. Significantly higher frequencies of Aeromonas were isolated in Shahrekord province (13.0%; 39/300 than in Isfahan province (11.3%; 34/300. The recovery frequencies of the organisms were significantly lower in kitchens as compared to those in cattle farms and hospital wards which were similar. Higher proportions of infected flies were obtained during summer whereas low proportions were obtained during winter. Conclusions. It is concluded that houseflies do harbor diarrheagenic pathogens, including Aeromonas especially during summer. The carried organisms are resistant to a number of antimicrobials at different levels. Thus, future plans aimed at stemming infections caused by these organisms should take flies into account. Control efforts of infections caused by this particular bacterium should therefore take into account Musca domestica.

  16. Antibiotic Susceptibility Profile of Aeromonas Species Isolated from Wastewater Treatment Plant

    Directory of Open Access Journals (Sweden)

    Isoken H. Igbinosa

    2012-01-01

    Full Text Available This study assessed the prevalence of antibiotic-resistant Aeromonas species isolated from Alice and Fort Beaufort wastewater treatment plant in the Eastern Cape Province of South Africa. Antibiotic susceptibility was determined using the disc diffusion method, and polymerase chain reaction (PCR assay was employed for the detection of antibiotics resistance genes. Variable susceptibilities were observed against ciprofloxacin, chloramphenicol, nalidixic acid, gentamicin, minocycline, among others. Aeromonas isolates from both locations were 100% resistant to penicillin, oxacillin, ampicillin, and vancomycin. Higher phenotypic resistance was observed in isolates from Fort Beaufort compared to isolates from Alice. Class A pse1 β-lactamase was detected in 20.8% of the isolates with a lower detection rate of 8.3% for blaTEM gene. Class 1 integron was present in 20.8% of Aeromonas isolates while class 2 integron and TetC gene were not detected in any isolate. The antibiotic resistance phenotypes observed in the isolates and the presence of β-lactamases genes detected in some isolates are of clinical and public health concern as this has consequences for antimicrobial chemotherapy of infections associated with Aeromonas species. This study further supports wastewater as potential reservoirs of antibiotic resistance determinants in the environment.

  17. Aeromonas hydrophila urinary tract infection in pregnancy- Case report and literature review

    Directory of Open Access Journals (Sweden)

    Latha Ragunathan

    2012-03-01

    Full Text Available A case of a pregnant woman without previous or concomitant disease, who developed an Aeromonas hydrophila urinarytract infection (UTI at 12 weeks gestation, is reported. A brief review of the literature on the association and incidenceof Aeromonas spp in urinary infections and also in association with pregnancy is presented. J Microbiol Infect Dis 2012;2(1: 26-28

  18. Aeromonas salmonicida bacteremia associated with chronic well water consumption in a patient with diabetes

    Directory of Open Access Journals (Sweden)

    Christine Ann Moore

    2017-01-01

    Full Text Available Aeromonas salmonicida is associated with superficial skin infections in fish. Its virulence factors allow colonization of water including surface water such as salt water, beaches, and fresh water wells. Moreover, it is possible for immunocompromised patients to develop invasive disease after chronic exposure to Aeromonas spp. through contaminated water. While there are reports of Aeromonas spp. bacteremia following water ingestion, there have been no reports of A. salmonicida bacteremia from water consumption. We report the first case of A. salmonicida bacteremia in a patient with diabetes due to chronic consumption of well water.

  19. Thin-film fixed-bed reactor (TFFBR for solar photocatalytic inactivation of aquaculture pathogen Aeromonas hydrophila

    Directory of Open Access Journals (Sweden)

    Khan Sadia J

    2012-01-01

    Full Text Available Abstract Background Outbreaks of infectious diseases by microbial pathogens can cause substantial losses of stock in aquaculture systems. There are several ways to eliminate these pathogens including the use of antibiotics, biocides and conventional disinfectants, but these leave undesirable chemical residues. Conversely, using sunlight for disinfection has the advantage of leaving no chemical residue and is particularly suited to countries with sunny climates. Titanium dioxide (TiO2 is a photocatalyst that increases the effectiveness of solar disinfection. In recent years, several different types of solar photocatalytic reactors coated with TiO2 have been developed for waste water and drinking water treatment. In this study a thin-film fixed-bed reactor (TFFBR, designed as a sloping flat plate reactor coated with P25 DEGUSSA TiO2, was used. Results The level of inactivation of the aquaculture pathogen Aeromonas hydrophila ATCC 35654 was determined after travelling across the TFFBR under various natural sunlight conditions (300-1200 W m-2, at 3 different flow rates (4.8, 8.4 and 16.8 L h-1. Bacterial numbers were determined by conventional plate counting using selective agar media, cultured (i under conventional aerobic conditions to detect healthy cells and (ii under conditions designed to neutralise reactive oxygen species (agar medium supplemented with the peroxide scavenger sodium pyruvate at 0.05% w/v, incubated under anaerobic conditions, to detect both healthy and sub-lethally injured (oxygen-sensitive cells. The results clearly demonstrate that high sunlight intensities (≥ 600 W m-2 and low flow rates (4.8 L h-1 provided optimum conditions for inactivation of A. hydrophila ATCC 3564, with greater overall inactivation and fewer sub-lethally injured cells than at low sunlight intensities or high flow rates. Low sunlight intensities resulted in reduced overall inactivation and greater sub-lethal injury at all flow rates. Conclusions This

  20. AEROMONAS SALMONICIDA INFECTION IN VACCINATED RAINBOW TROUT

    DEFF Research Database (Denmark)

    Chettri, Jiwan Kumar; Skov, Jakob; Mohammad, Rezkar Jaafar

    In vivo testing of any candidate vaccine is influenced by the choice of challenge method and the external environmental conditions. In the present study, a comparative challenge study was performed to evaluate the efficacy of different vaccines against the bacterial pathogen Aeromonas salmonicida...

  1. Evolutionary Roots and Diversification of the Genus Aeromonas.

    Science.gov (United States)

    Sanglas, Ariadna; Albarral, Vicenta; Farfán, Maribel; Lorén, J G; Fusté, M C

    2017-01-01

    Despite the importance of diversification rates in the study of prokaryote evolution, they have not been quantitatively assessed for the majority of microorganism taxa. The investigation of evolutionary patterns in prokaryotes constitutes a challenge due to a very scarce fossil record, limited morphological differentiation and frequently complex taxonomic relationships, which make even species recognition difficult. Although the speciation models and speciation rates in eukaryotes have traditionally been established by analyzing the fossil record data, this is frequently incomplete, and not always available. More recently, several methods based on molecular sequence data have been developed to estimate speciation and extinction rates from phylogenies reconstructed from contemporary taxa. In this work, we determined the divergence time and temporal diversification of the genus Aeromonas by applying these methods widely used with eukaryotic taxa. Our analysis involved 150 Aeromonas strains using the concatenated sequences of two housekeeping genes (approximately 2,000 bp). Dating and diversification model analyses were performed using two different approaches: obtaining the consensus sequence from the concatenated sequences corresponding to all the strains belonging to the same species, or generating the species tree from multiple alignments of each gene. We used BEAST to perform a Bayesian analysis to estimate both the phylogeny and the divergence times. A global molecular clock cannot be assumed for any gene. From the chronograms obtained, we carried out a diversification analysis using several approaches. The results suggest that the genus Aeromonas began to diverge approximately 250 millions of years (Ma) ago. All methods used to determine Aeromonas diversification gave similar results, suggesting that the speciation process in this bacterial genus followed a rate-constant (Yule) diversification model, although there is a small probability that a slight

  2. Evaluation of different conditions and culture media for the recovery of Aeromonas spp. from water and shellfish samples.

    Science.gov (United States)

    Latif-Eugenín, F; Beaz-Hidalgo, R; Figueras, M J

    2016-09-01

    To perform a comparative study for determining the optimum culture method (direct plating or enrichment) and medium (ampicillin dextrin agar (ADA), starch ampicillin agar (SAA), bile salts irgasan brilliant green modified (BIBG-m)) for recovering Aeromonas species from water and shellfish samples. By direct culture, Aeromonas was detected in 65% (13/20) of the water samples and in 54·5% (6/11) of the shellfish samples. However, when a pre-enrichment step was included, the number of positive water samples increased to 75% (15/20) and the ones of shellfish to 90·1% (10/11). The enriched culture significantly favoured (P culture medium for detecting Aeromonas from water was ADA. However, no differences were observed in the case of shellfish samples (P > 0·05). Isolation of Aeromonas media from water was favoured (P culture method and medium used influenced the recovery of some Aeromonas species from water and shellfish samples. This fact should be considered in future prevalence studies to avoid overestimating the above mentioned Aeromonas species. © 2016 The Society for Applied Microbiology.

  3. Aquatically acquired Aeromonas hydrophila wound infection A ...

    African Journals Online (AJOL)

    The occurrence of Aeromonas hydrophila wound infections in healthy hosts after water-associated injury is being reported more frequently. This paper reports our experience with 3 such cases and outlines the importance of recognising the association between a water-related injury and, this organism.

  4. Aeromonas spp. and microbial indicators in raw drinking water source Aeromonas sp. e indicadores microbiológicos em fontes de água não tratada

    Directory of Open Access Journals (Sweden)

    Marisa Di Bari

    2007-09-01

    Full Text Available Aeromonas species are autochtonous in the aquatic environment and some of them have been associated with health effects like wound infections, septicemia and diarrhoeal illness. In this study, the occurrence of Aeromonas spp. and microbial indicators in raw drinking water from wells, springs, fountains and mineral waters was evaluated. A total of 126 water samples was analyzed for Aeromonas spp. by the membrane filtration technique using ADA media and by P/A test. Typical colonies of Aeromonas spp. were submitted to biochemical tests for species differentiation. Toxin production was tested using Y-1 mouse adrenal cells. Coliforms and heterotrophic bacteria were enumerated by membrane filtration and pour plate techniques, respectively. P. aeruginosa, C. perfringens and fecal streptococci were determined by P/A method. Aeromonas spp. were isolated in 36.5% of the samples, whereas total and thermotolerant coliforms were detected in 51.2% and in 23.8% of the samples, respectively. C. perfringens, fecal streptococci and P. aeruginosa were present in 16.5%, 20.4% and 3.8% of the samples, respectively. The concentrations of heterotrophic bacteria were higher than 1,0x10³ CFU/mL in 52.5% of the samples. A. hydrophila was the most frequent species, followed by A. allosaccharophila,A. jandaei,A.sobria and HG2. A heat label toxin was detected in 13 from the 58 strains tested. These data show that the drinking water sources analyzed can represent a risk for human health. It is important to consider that wells and springs are used as drinking water supply in poor areas and rural regions, where undernourished people more susceptible to infections by these microorganisms predominate.Bactérias do gênero Aeromonas são naturais no ambiente aquático e algumas espécies podem causar infecções em humanos como feridas, septicemia e diarréia. Este trabalho objetivou avaliar a ocorrência de Aeromonas sp. em 126 amostras de água de poços, nascentes, fontes e

  5. A comparative analysis of the intestinal metagenomes present in guinea pigs (Cavia porcellus) and humans (Homo sapiens)

    DEFF Research Database (Denmark)

    Hildebrand, Falk; Ebersbach, Tine; Nielsen, Henrik Bjørn

    2012-01-01

    Background: Guinea pig (Cavia porcellus) is an important model for human intestinal research. We have characterized the faecal microbiota of 60 guinea pigs using Illumina shotgun metagenomics, and used this data to compile a gene catalogue of its prevalent microbiota. Subsequently, we compared th...

  6. Thin-film fixed-bed reactor for solar photocatalytic inactivation of Aeromonas hydrophila: influence of water quality

    Directory of Open Access Journals (Sweden)

    Khan Sadia J

    2012-11-01

    Full Text Available Abstract Background Controlling fish disease is one of the major concerns in contemporary aquaculture. The use of antibiotics or chemical disinfection cannot provide a healthy aquaculture system without residual effects. Water quality is also important in determining the success or failure of fish production. Several solar photocatalytic reactors have been used to treat drinking water or waste water without leaving chemical residues. This study has investigated the impact of several key aspects of water quality on the inactivation of the pathogenic bacterium Aeromonas hydrophila using a pilot-scale thin-film fixed-bed reactor (TFFBR system. Results The level of inactivation of Aeromonas hydrophila ATCC 35654 was determined using a TFFBR with a photocatalytic area of 0.47 m2 under the influence of various water quality variables (pH, conductivity, turbidity and colour under high solar irradiance conditions (980–1100 W m-2, at a flow rate of 4.8 L h-1 through the reactor. Bacterial enumeration were obtained through conventional plate count using trypticase soy agar media, cultured in conventional aerobic conditions to detect healthy cells and under ROS-neutralised conditions to detect both healthy and sub-lethally injured (oxygen-sensitive cells. The results showed that turbidity has a major influence on solar photocatalytic inactivation of A. hydrophila. Humic acids appear to decrease TiO2 effectiveness under full sunlight and reduce microbial inactivation. pH in the range 7–9 and salinity both have no major effect on the extent of photoinactivation or sub-lethal injury. Conclusions This study demonstrates the effectiveness of the TFFBR in the inactivation of Aeromonas hydrophila under the influence of several water quality variables at high solar irradiance, providing an opportunity for the application of solar photocatalysis in aquaculture systems, as long as turbidity remains low.

  7. Incidence of Aeromonas spp. infection in fish and chicken meat and its related public health hazards: A review

    Directory of Open Access Journals (Sweden)

    Praveen Kumar Praveen

    2016-01-01

    Full Text Available Aeromonas is recognized to cause a variety of diseases in man. In humans, they are associated with intestinal and extraintestinal infections. With the growing importance of Aeromonas as an emerging pathogen, it is important to combat this organism. It is indisputable that Aeromonas strains may produce many different putative virulence factors such as enterotoxins, hemolysins or cytotoxins, and antibiotic resistance against different antibiotics. The ability of these bacteria to grow competitively at 5°C may be indicative of their potential as a public health hazard. Comprehensive enteric disease surveillance strategies, prevention and education are essential for meeting the challenges in the years ahead. It is important for us to promote the value of enteric cultures when patients have a gastrointestinal illness or bloody diarrhea or when multiple cases of enteric disease occur after a common exposure. With the growing importance of Aeromonas as an emerging pathogen, it is important to combat this organism. It is indisputable that Aeromonas strains may produce many different putative virulence factors, such as enterotoxins, hemolysins or cytotoxins. It has been established that aerolysin is a virulence factor contributing to the pathogenesis of Aeromonas hydrophila infection. Fish and chicken play an important role in the transmission of this pathogen to humans. In the present study, the high prevalence of toxin-producing strains was found among the Aeromonas isolates. The ability of these bacteria to grow competitively at 5°C may be indicative of their potential as a public health hazard. The present review was constructed with a view to highlight the zoonotic importance of Aeromonas pathogen in fish and chicken meat.

  8. Incidence of Aeromonas spp. infection in fish and chicken meat and its related public health hazards: A review.

    Science.gov (United States)

    Praveen, Praveen Kumar; Debnath, Chanchal; Shekhar, Shashank; Dalai, Nirupama; Ganguly, Subha

    2016-01-01

    Aeromonas is recognized to cause a variety of diseases in man. In humans, they are associated with intestinal and extra-intestinal infections. With the growing importance of Aeromonas as an emerging pathogen, it is important to combat this organism. It is indisputable that Aeromonas strains may produce many different putative virulence factors such as enterotoxins, hemolysins or cytotoxins, and antibiotic resistance against different antibiotics. The ability of these bacteria to grow competitively at 5°C may be indicative of their potential as a public health hazard. Comprehensive enteric disease surveillance strategies, prevention and education are essential for meeting the challenges in the years ahead. It is important for us to promote the value of enteric cultures when patients have a gastrointestinal illness or bloody diarrhea or when multiple cases of enteric disease occur after a common exposure. With the growing importance of Aeromonas as an emerging pathogen, it is important to combat this organism. It is indisputable that Aeromonas strains may produce many different putative virulence factors, such as enterotoxins, hemolysins or cytotoxins. It has been established that aerolysin is a virulence factor contributing to the pathogenesis of Aeromonas hydrophila infection. Fish and chicken play an important role in the transmission of this pathogen to humans. In the present study, the high prevalence of toxin-producing strains was found among the Aeromonas isolates. The ability of these bacteria to grow competitively at 5°C may be indicative of their potential as a public health hazard. The present review was constructed with a view to highlight the zoonotic importance of Aeromonas pathogen in fish and chicken meat.

  9. Antimicrobial susceptibility pattern of Aeromonas hydrophila among ...

    African Journals Online (AJOL)

    A total of one hundred and twenty eight (128) stool samples were collected from patients attending Ahmadu Bello University Teaching Hospital Zaria and Aminu Kano Teaching Hospital Kano, and screened for the presence of Aeromonas hydrophila infection. Out of the one hundred and twenty eight samples analyzed 4 ...

  10. Gadolinium heteropoly complex K 17[Gd(P 2W 17O 61) 2] as a potential MRI contrast agent

    Science.gov (United States)

    Sun, Guoying; Feng, Jianghua; Wu, Huifeng; Pei, Fengkui; Fang, Ke; Lei, Hao

    2004-10-01

    Gadolinium heteropoly complex K17[Gd(P2W17O61)2] has been evaluated by in vitro and in vivo experiments as a potential contrast agent for magnetic resonance imaging (MRI). The thermal analysis and conductivity study indicate that this complex has good thermal stability and wide pH stability range. The T1 relaxivity is 7.59 mM-1 s-1 in aqueous solution and 7.97 mM-1 s-1 in 0.725 mmol l-1 bovine serum albumin (BSA) solution at 25 °C and 9.39 T, respectively. MR imaging of three male Sprague-Dawley rats showed remarkable enhancement in rat liver after intravenous injection, which persisted longer than with Gd-DTPA. The signal intensity increased by 57.1±16.9% during the whole imaging period at 0.082 mmol kg-1dose. Our preliminary in vitro and in vivo studies indicate that K17[Gd(P2W17O61)2] is a potential liver-specific MRI contrast agent.

  11. Detection of Aeromonas hydrophila Using Fiber Optic Microchannel Sensor

    Directory of Open Access Journals (Sweden)

    Samla Gauri

    2017-01-01

    Full Text Available This research focuses on the detection of Aeromonas hydrophila using fiber optic microchannel biosensor. Microchannel was fabricated by photolithography method. The fiber optic was chosen as signal transmitting medium and light absorption characteristic of different microorganisms was investigated for possible detection. Experimental results showed that Aeromonas hydrophila can be detected at the region of UV-Vis spectra between 352 nm and 354 nm which was comparable to measurement provided by UV spectrophotometer and also theoretical calculation by Beer-Lambert Absorption Law. The entire detection can be done in less than 10 minutes using a total volume of 3 μL only. This result promises good potential of this fiber optic microchannel sensor as a reliable, portable, and disposable sensor.

  12. Classification of a hypervirulent Aeromonas hydrophila pathotype responsible for epidemic outbreaks in warm-water fishes

    Science.gov (United States)

    Lineages of hypervirulent Aeromonas hydrophila (vAh) are the cause of persistent outbreaks of motile Aeromonas septicemia in warm-water fishes worldwide. Over the last decade, this virulent lineage of A. hydrophila has resulted in annual losses of millions of tons of farmed carp and catfish in the P...

  13. Characterization of atypical Aeromonas salmonicida by different methods

    DEFF Research Database (Denmark)

    Austin, B.; Austin, D.A.; Dalsgaard, Inger

    1998-01-01

    Fifty two isolates of atypical Aeromonas salmonicida, recovered from a wide range of hosts and geographical locations, were heterogeneous in terms of molecular and phenotypic characteristics, and represented taxa which could not be accommodated by the current classification of four subspecies...

  14. Antimicrobial resistance and plasmid profiles of Aeromonas ...

    African Journals Online (AJOL)

    The purpose of this study was to investigate the presence of Aeromonas hydrophila at commonly used water collection points on the River Njoro and to determine the in-vitro antimicrobial susceptibility and plasmid profiles of isolates. In total, 126 samples were collected and 36.5% of them were positive for A. hydrophila.

  15. Pathogenic potentials of Aeromonas species isolated from aquaculture and abattoir environments.

    Science.gov (United States)

    Igbinosa, Isoken H; Beshiru, Abeni; Odjadjare, Emmanuel E; Ateba, Collins N; Igbinosa, Etinosa O

    2017-06-01

    The present study elucidated the presence of antibiotics resistance, virulence genes and biofilm potentials among Aeromonas species isolated from abattoir and aquaculture environments in Benin City, Nigeria. A total of 144 wastewater samples were obtained from two independent aquaculture and abattoir environments between May and October 2016. Aeromonas species were isolated on Glutamate Starch Phenol Red (GSP) agar and confirmed using API 20NE kits. Antimicrobial susceptibility profile of the isolates was carried out using standard disc diffusion assay while biofilm potentials were detected by the microtitre plate method and PCR technique was used to detect antibiotics resistance and virulence gene markers. Overall, 32 and 26 Aeromonas species were isolated from the abattoir and aquaculture environments respectively. Isolates from both environments were completely resistant (100%) to penicillin G, ertapenem and tetracycline; whereas aquaculture isolates exhibited absolute sensitivity (100%) towards cefepime. All the virulence gene markers (aerA, hlyA, alt, ast, laf, ascF-G, fla, lip, stx1, and stx2) investigated in this study (except laf) were detected in isolates from both environments. The laf genes were only detected in isolates from abattoir environments. Antibiotics resistant genes including pse, bla TEM and class 1 integron were detected in isolates from both environments. Majority of the isolates (53/58 91.4%) from both environments; demonstrated capacity for biofilm potential. The detection of antibiotic resistance and virulence gene markers as well as biofilm forming ability in Aeromonas species isolated from aquaculture and abattoir environments raise serious public health concern worthy of further investigation. Copyright © 2017 Elsevier Ltd. All rights reserved.

  16. Polymerase chain reaction (PCR)-based typing analysis of atypical isolates of the fish pathogen Aeromonas salmonicida

    DEFF Research Database (Denmark)

    Høie, S.; Dalsgaard, Inger; Aase, I.L.

    1999-01-01

    . salmonicida subsp. salmonicida isolates tested, belonged to group 1. The PCR primer-sets separated A. salmonicida from other reference strains of Aeromonas species and related bacteria with the exception of Aeromonas hydrophila. The results indicated that PCR typing is a useful framework for characterization...

  17. Endoparasitos em cobaias (Cavia porcellus (Mammalia, Rodentia, Caviidae provenientes de biotérios de criação e experimentação do município do Rio de Janeiro, Brasil Endoparasites in guinea pigs (Cavia porcellus (Mammalia, Rodentia, Caviidae from breeding and experimentation animal housing of the municipality of Rio de Janeiro, Brazil

    Directory of Open Access Journals (Sweden)

    Luciana Casartelli Alves

    2007-10-01

    Full Text Available Foi realizado um levantamento sobre a prevalência e intensidade de infecção de endoparasitos em cobaias convencionais de linhagem Short Hair provenientes de biotérios de criação (A e experimentação (B do município do Rio de Janeiro, Brasil, avaliando-se a eficácia das medidas de prevenção entre eles. Para a realização do estudo, utilizou-se exame direto de mucosa e do conteúdo intestinal, a técnica de tricromo de WHEATLEY e exames coproparasitológicos pelas técnicas de Ritchie e Kinyoun. Os parasitos encontrados através da técnica de exame direto da mucosa e do conteúdo intestinal e de tricromo de WHEATLEY com as respectivas prevalências foram: Balantidium sp. (78%, Cyathodinium sp. (68%, Eimeria caviae (38%, Paraspidodera uncinata (34% e Giardia muris (24%. Nos exames de fezes realizados pelas técnicas de Ritchie e Kinyoun, foram encontrados os seguintes parasitos com as respectivas prevalências no biotério A: E. caviae (74%, Balantidium sp. (68%, Cyathodinium sp. (68% e Cryptosporidium sp. (5%. No biotério B, observou-se: E. caviae (58%, Balantidium sp. (42%, Cyathodinium sp. (25% e G. muris (8%. A alta prevalência de endoparasitos nos biotérios sugere a necessidade de se rever a eficácia das barreiras sanitárias adotadas.This paper discusses the prevalence and intensity of infection of endoparasites in conventionally maintained Short Hair guinea pigs colonies from a breeding (A and an experimental (B facilities in Rio de Janeiro, Brazil. It also evaluates the efficacy of the methods of prevention adopted by both facilities. The search of parasites was performed by direct examination of intestinal mucosa and its contents, WHEATLEY's trichrome method and coproparasitological examinations by Ritchie's and Kinyoun's techniques. The prevalences of endoparasites found throught direct examination of intestinal mucosa and its contents were: Balantidium sp. (78%, Cyathodinium sp. (68%, Eimeria caviae (38%, Paraspidodera

  18. Presence of Aeromonas spp in water from drinking-water- and wastewater-treatment plants in Mexico City.

    Science.gov (United States)

    Villarruel-López, Angélica; Fernández-Rendón, Elizabeth; Mota-de-la-Garza, Lydia; Ortigoza-Ferado, Jorge

    2005-01-01

    The frequency of Aeromonas spp in three wastewater-treatment plants (WWTPs) and two drinking-water plants (DWPs) in México City was determined. Samples were taken throughout a year by the Moore's swab technique. A total of 144 samples were obtained from WWTPs and 96 from DWPs of both incoming and outflowing water. Aeromonas spp was isolated in 31% of the samples, from both kinds of sources. The technique used for the isolation of the pathogen was suitable for samples with high associate microbiota content and for those with a scarce microbial content. The presence of mesophilic-aerobic, coliform, and fecal-coliform organisms was investigated to determine whether there was any correlation with the presence of Aeromonas spp. Most samples from WWTP, which did not comply with the Mexican standards, had the pathogen, and some of the samples from the outflow of the DWP, which were within the limits set by the Mexican standards, also had Aeromonas spp. Most samples containing Aeromonas spp. had concentrations below 0.1 ppm residual chlorine, and the strains were resistant to 0.3 ppm, which supports the recommendation to increase the residual chlorine concentration to 0.5 to 1.0 ppm, as recommended by the Mexican standards.

  19. Aeromonas Bacteraemia Causing Gas Gangrene in a Diabetic ...

    African Journals Online (AJOL)

    Early blood culture, culture of the aspirates from blebs, and subsequent culture of intraoperative specimens uniformly grew Aeromonas hydrophila. Urgent fasciotomy was carried out same day, and the patient was admitted into ICU for intensive monitoring and therapies. Second look procedures 48hours later showed turgid ...

  20. Evidence of Increased Antibiotic Resistance in Phylogenetically-Diverse Aeromonas Isolates from Semi-Intensive Fish Ponds Treated with Antibiotics.

    Science.gov (United States)

    Patil, Hemant J; Benet-Perelberg, Ayana; Naor, Alon; Smirnov, Margarita; Ofek, Tamir; Nasser, Ahmed; Minz, Dror; Cytryn, Eddie

    2016-01-01

    The genus Aeromonas is ubiquitous in aquatic environments encompassing a broad range of fish and human pathogens. Aeromonas strains are known for their enhanced capacity to acquire and exchange antibiotic resistance genes and therefore, are frequently targeted as indicator bacteria for monitoring antimicrobial resistance in aquatic environments. This study evaluated temporal trends in Aeromonas diversity and antibiotic resistance in two adjacent semi-intensive aquaculture facilities to ascertain the effects of antibiotic treatment on antimicrobial resistance. In the first facility, sulfadiazine-trimethoprim was added prophylactically to fingerling stocks and water column-associated Aeromonas were monitored periodically over an 11-month fish fattening cycle to assess temporal dynamics in taxonomy and antibiotic resistance. In the second facility, Aeromonas were isolated from fish skin ulcers sampled over a 3-year period and from pond water samples to assess associations between pathogenic strains to those in the water column. A total of 1200 Aeromonas isolates were initially screened for sulfadiazine resistance and further screened against five additional antimicrobials. In both facilities, strong correlations were observed between sulfadiazine resistance and trimethoprim and tetracycline resistances, whereas correlations between sulfadiazine resistance and ceftriaxone, gentamicin, and chloramphenicol resistances were low. Multidrug resistant strains as well as sul1, tetA , and intI1 gene-harboring strains were significantly higher in profiles sampled during the fish cycle than those isolated prior to stocking and these genes were extremely abundant in the pathogenic strains. Five phylogenetically distinct Aeromonas clusters were identified using partial rpoD gene sequence analysis. Interestingly, prior to fingerling stocking the diversity of water column strains was high, and representatives from all five clusters were identified, including an A. salmonicida

  1. Reciprocal immune benefit based on complementary production of antibiotics by the leech Hirudo verbana and its gut symbiont Aeromonas veronii.

    Science.gov (United States)

    Tasiemski, Aurélie; Massol, François; Cuvillier-Hot, Virginie; Boidin-Wichlacz, Céline; Roger, Emmanuel; Rodet, Franck; Fournier, Isabelle; Thomas, Frédéric; Salzet, Michel

    2015-12-04

    The medicinal leech has established a long-term mutualistic association with Aeromonas veronii, a versatile bacterium which can also display free-living waterborne and fish- or human-pathogenic lifestyles. Here, we investigated the role of antibiotics in the dynamics of interaction between the leech and its gut symbiont Aeromonas. By combining biochemical and molecular approaches, we isolated and identified for the first time the antimicrobial peptides (AMPs) produced by the leech digestive tract and by its symbiont Aeromonas. Immunohistochemistry data and PCR analyses evidenced that leech AMP genes are induced in the gut epithelial cells when Aeromonas load is low (starved animals), while repressed when Aeromonas abundance is the highest (post blood feeding). The asynchronous production of AMPs by both partners suggests that these antibiotic substances (i) provide them with reciprocal protection against invasive bacteria and (ii) contribute to the unusual simplicity of the gut microflora of the leech. This immune benefit substantially reinforces the evidence of an evolutionarily stable association between H. verbana and A. veronii. Altogether these data may provide insights into the processes making the association with an Aeromonas species in the digestive tract either deleterious or beneficial.

  2. Aeromonas hydrophila disturbs water and electrolyte transport in ...

    African Journals Online (AJOL)

    SERVER

    2008-02-19

    Feb 19, 2008 ... enterocytes with voluminous and spherical shape, disappearance of enterocyte brush border and lesions at ... (Paniagua et al., 1990) and causes different diseases. ... 22°C and the fish were fed on a standard diet composed of algae. ..... J (1998). Aeromonas hydrophila causes 'black diseases' in fairy.

  3. Population dynamics, antibiotics resistance and biofilm formation of Aeromonas and Vibrio species isolated from aquatic sources in Northern Malaysia.

    Science.gov (United States)

    Odeyemi, Olumide A; Ahmad, Asmat

    2017-02-01

    This study aimed to compare population dynamics, antibiotic resistance and biofilm formation of Aeromonas and Vibrio species from seawater and sediment collected from Northern Malaysia. Isolates with different colony morphology were characterized using both biochemical and molecular methods before testing for antibiotic resistance and biofilm formation. Results obtained from this study showed that in Kedah, the population of Aeromonas isolated from sediment was highest in Pantai Merdeka (8.22 log CFU/ml), Pulau Bunting recorded the highest population of Aeromonas from sediment (8.43 log CFU/g). It was observed that Vibrio species isolated from seawater and sediment were highest in Kuala Sanglang (9.21 log CFU/ml). In Kuala Perlis, the population of Aeromonas isolated from seawater was highest in Jeti (7.94 log CFU/ml). Highest population of Aeromonas from sediment was recorded in Kampong Tanah Baru (7.99 log CFU/g). It was observed that Vibrio species isolated from seawater was highest in Padang Benta (8.42 log CFU/g) while Jeti Kuala Perlis had highest population of Vibrio isolated from sediment. It was observed that location does not influence population of Aeromonas. The results of the independent t - test revealed that there was no significant relationship between location and population of Vibrio (df = 10, t = 1.144, p > 0.05). The occurrence of biofilm formation and prevalence of antibiotic resistant Aeromonas and Vibrio species in seawater and sediment pose danger to human and aquatic animals' health. Copyright © 2017 Elsevier Ltd. All rights reserved.

  4. CONTAMINATION RISK ASSESSMENT OF SOURCES OF WATER INTENDED FOR HUMAN CONSUMPTION WITH AEROMONAS SPP.

    Directory of Open Access Journals (Sweden)

    Luminita Minea

    2012-03-01

    Full Text Available mportance of Aeromonas spp as emerging pathogens in recent years has been a considerable increase, beingincluded by the World Health Organization (WHO and Environmental Protection Agency (EPA in the etiology ofwaterborne epidemics. We aimed to investigate the distribution of Aeromonas spp. in various aquatic ecosystems whichcan become potential sources of gastrointestinal infections. Simultaneously, the presence of this pathogen was evaluatedin relation to microbiological indicators set out in EU Directive 98/83/EC. Between March 2009 and May 2011 wereanalyzed by membrane filter technique untreated water samples, collected from surface sources (lakes, ponds andgroundwater (wells drilled, captured springs, wells and chlorinated water that coming from local distribution network,located in rural areas of Moldova (North-East Romania. The information was processed and interpreted statisticallyusing EpiInfo 3.5.1 software. The presence of Aeromonas spp. was detected in half of the 220 samples tested, especially,in surface waters (84% and captured springs (80.8% (χ 2=51.39; GL=4; p0.8, being influenced by exogenous humanimpact. The results of this study confirms that untreated water used in rural areas can affect public health andmicrobiological indicators have predictive value for the presence of Aeromonas spp only reporting to surface sources.

  5. Paraspidodera uncinata (Nematoda, Lauroiinae as parasite of Cavia magna and Cavia aperea (Rodentia, Caviidae in southern Brazil

    Directory of Open Access Journals (Sweden)

    Ana Gabriela da Silva Rocha

    2015-05-01

    Full Text Available Out of the 5 species of Guinea pig registered for Brazil, 4 (Cavia fulgida, C. porcellus, C. aperea, and C. magna have already been reported as hosts of Paraspidodera uncinata. The rodent species C. magna and C. aperea are small-sized mammals, with terrestrial habits, which occur from southern Brazil to eastern Uruguay. Guinea pig specimens donated for research were necropsied for the analysis of endoparasites, and the nematodes found were identified as P. uncinata. The microhabitats of this species were the small and large intestines in C. magna and the large intestine in C. aperea. The prevalence of P. uncinata in the hosts was 60% in C. magna (n = 5 and 14% in C. aperea (n = 7. The record of P. uncinata in different Guinea pig species allows inferring that the foraging mode is similar in the different locations where they occur in southern Brazil, because, perhaps, the infection of hosts has occurred through the ingestion of vegetables contaminated with P. uncinata eggs. This study contributes to knowledge on the helminth fauna of C. magna and C. aperea in southern Brazil.

  6. Simultaneous effects of environmental factors on motile Aeromonas dynamics in an urban effluent and in the natural seawater.

    Science.gov (United States)

    Maalej, Sami; Mahjoubi, Amira; Elazri, Chafai; Dukan, Sam

    2003-07-01

    Seasonal dynamics of motile Aeromonas in a treated urban effluent and in natural seawater along the Sfax coast (Mediterranean sea, Tunisia) were measured over a year concurrently with seven environmental factors, and compared with those of faecal coliforms. Counts for Aeromonas from a standard plate count method, ranged from 1.48 x 10(5)CFU.100 ml(-1) to 2.2 x 10(8)CFU.100 ml(-1) in the effluent and from 7.9 x 10(3)CFU.100 ml(-1) to undetectable level in the surface marine waters. Contrary to faecal coliforms, the Aeromonas dynamics exhibited a seasonal distribution in seawater which was inverse of the seasonal distribution in the sewage: From the end of November 1998 to April 1999 (cold period), Aeromonas counts increased in the treated effluent, while it decreased very rapidly in seawater. From May to October (warm period), Aeromonas abundance decreased in the effluent but showed an increasing fluctuating trend in the marine waters with a maximum in late summer/early autumn when the temperatures were around 22-23 degrees C. Multiple correlation and regression analyses suggest, by the coefficient of determination (R(2)), that 42% of variance in Aeromonas number changes in the treated effluent, may be explained by only turbidity, radiation and Aeromonas density in the previous sample, while 37% of variance in marine ecosystem were explained by radiance and conductivity. Furthermore, the t statistics and their p values and the coefficient of partial determination (r(2)) indicated that radiance contributed the most (r(2)=0.3184, t=-3.2, p=0.0041) to the dynamics of motile Aeromonas in seawater, when combined with conductivity. The models relevant for changes in faecal coliforms abundance incorporated turbidity, radiance in the effluent and conductivity, pH, radiance, turbidity in coastal marine environment. These models explain 66% and 73% of the observed cell number fluctuation, with turbidity (r(2)=0.529, t=5.08, p=0.0001) and conductivity (r(2)=0.5407, t=4.97, p=0

  7. Aeromonas hydrophila disturbs water and electrolyte transport in ...

    African Journals Online (AJOL)

    Fish diseases create a menace to aquaculture farms. They provoke disastrous economic losses and sanitary risks for the consumer. The present study aims to investigate the effect of the bacteria, Aeromonas hydrophila on water and electrolyte (Na+, K+, Cl-, HCO3 -) flux of Mugil cephalus (L, 1758) intestine. Anterior, middle ...

  8. Helminths of the guinea pig, Cavia porcellus (Linnaeus, in Brazil

    Directory of Open Access Journals (Sweden)

    Roberto Magalhães Pinto

    2002-07-01

    Full Text Available Worm burdens were evaluated and compared in two groups of the guinea pig, Cavia poreellus (Linnaeus, 1758: animals of the first group were conventionally maintained in an institutional animal house and those of the second group were openly kept in pet shops in Brazil. Animals from both sources were infected only with the nematode Paraspidodera uncinata (Rudolphi, 1819 Travassos, 1914 (10% of prevalence in guinea pigs from lhe institutional facility and 40% in those animals from the pet shop. Other helminth samples recovered from Brazilian guinea pigs during 52 years and that are deposited in the Helminthological Collection of the Oswaldo Cruz Institute (CHIOC were also analyzed. Paraspidodera uncinata and the cestode Monoecocestus parcitesticulatus Rêgo, 1960 were identified in these samples.

  9. Jejuno-jejunal intussusception in a guinea pig (Cavia porcellus

    Directory of Open Access Journals (Sweden)

    Tara J. Fetzer

    2017-09-01

    Full Text Available An approximately four-year-old male castrated guinea pig (Cavia porcellus was presented for painful defecation with a 24-hour history of hyporexia and intermittent episodes of rolling behavior. Upon presentation the patient was quiet, alert, and responsive, and mildly hypothermic. Abdominal palpation revealed an approximately 2-cm long oblong mass within the caudal abdomen. Abdominal radiographs revealed gastric dilation without volvulus and a peritoneal mass effect. The patient was euthanized following gastric reflux of brown malodorous fluid from his nares and oral cavity. A necropsy was performed and revealed a jejuno-jejunal intussusception causing mechanical gastrointestinal ileus, and gastric dilatation without volvulus. While non-obstructive gastrointestinal stasis is common and obstructive ileus is uncommon in guinea pigs, this report shows that intestinal intussusception is a differential in guinea pigs with ileus and gastric dilatation.

  10. The Effect of Some Physical and Chemical Parameters on Regrowth of Aeromonas Bacterium and Heterotrophic Bacteria in Isfahan Drinking Water System

    Directory of Open Access Journals (Sweden)

    Sina Dobaradaran

    2006-03-01

    Full Text Available Aeromonas is one the gram – negative , non spor – formating rod shaping , facultatively anaerobic and opportunistic bactria that can cause systematic infections, leision and diarrhoea in human. Fairly high bactrial population in distribution system is not only of concern because of affecting consumer health but also it makes it difficult to enumerate coliform bacterium indicator. So, the relationships between aeromonas and heterotrophic bacteria growth with pH, temperature, turbidity, free residual cholornie and DO were determined in this study. ADA- V media was used in presumptive stage to count aeromonas bacteria for the first time in Iran on the basis of 1605 EPA (2001 method and used oxidase tests, trehalose fermentation and indol test in confirmative stage. R2A media was used to count HPC bacteria and other factors measured on the basis of standards. The results showed that positive cases of aeromonas bacteria and HPC increase in higher temperature and turbidity and lower pH. In contrast, positive cases of aeromonas bacteria and HPC decrease while free residual cholorine and DO increase. In addition,no positive case of aeromonas was observed in more than 0.2 mg/L concentration of free residual cholorine.

  11. Evidence of increased antibiotic resistance in phylogenetically-diverse Aeromonas isolates from semi-intensive fish ponds treated with antibiotics

    Directory of Open Access Journals (Sweden)

    Hemant J Patil

    2016-11-01

    Full Text Available The genus Aeromonas is ubiquitous in aquatic environments encompassing a broad range of fish and human pathogens. Aeromonas strains are known for their enhanced capacity to acquire and exchange antibiotic resistance genes and therefore, are frequently targeted as indicator bacteria for monitoring antimicrobial resistance in aquatic environments. This study evaluated temporal trends in Aeromonas diversity and antibiotic resistance in two adjacent semi-intensive aquaculture facilities to ascertain effects of antibiotic treatment on antimicrobial resistance. In the first facility, sulfadiazine-trimethoprim was added prophylactically upon fingerling stocking and water column-associated Aeromonas were monitored periodically over an eleven-month fish-fattening cycle to assess temporal dynamics in taxonomy and antibiotic resistance. In the second facility, Aeromonas were isolated from fish skin ulcers sampled over a three-year period and from pond water samples to assess associations between pathogenic strains to those in the water column. A total of 1200 Aeromonas spp. were isolated, initially screened for sulfadiazine resistance and further screened against five additional antibiotics. In both facilities, strong correlations were observed between sulfadiazine resistance and trimethoprim and tetracycline resistances, whereas correlations between sulfadiazine resistance and ceftriaxone, gentamycin and chloramphenicol resistances were low. Abundance of multi-drug resistant strains as well as sul1, tetA and intI1 gene-harboring strains was significantly higher in profiles sampled during the fish cycle than those isolated prior to stocking and these genes were extremely abundant in the pathogenic strains. Five phylogenetically-distinct Aeromonas clusters were revealed using partial rpoD gene sequence analysis. Interestingly, prior to fingerling stocking the diversity of water column strains was high, and representatives from all five clusters were

  12. Insight into the mobilome of Aeromonas strains.

    Science.gov (United States)

    Piotrowska, Marta; Popowska, Magdalena

    2015-01-01

    The mobilome is a pool of genes located within mobile genetic elements (MGE), such as plasmids, IS elements, transposons, genomic/pathogenicity islands, and integron-associated gene cassettes. These genes are often referred to as "flexible" and may encode virulence factors, toxic compounds as well as resistance to antibiotics. The phenomenon of MGE transfer between bacteria, known as horizontal gene transfer (HGT), is well documented. The genes present on MGE are subject to continuous processes of evolution and environmental changes, largely induced or significantly accelerated by man. For bacteria, the only chance of survival in an environment contaminated with toxic chemicals, heavy metals and antibiotics is the acquisition of genes providing the ability to survive in such conditions. The process of acquiring and spreading antibiotic resistance genes (ARG) is of particular significance, as it is important for the health of humans and animals. Therefore, it is important to thoroughly study the mobilome of Aeromonas spp. that is widely distributed in various environments, causing many diseases in fishes and humans. This review discusses the recently published information on MGE prevalent in Aeromonas spp. with special emphasis on plasmids belonging to different incompatibility groups, i.e., IncA/C, IncU, IncQ, IncF, IncI, and ColE-type. The vast majority of plasmids carry a number of different transposons (Tn3, Tn21, Tn1213, Tn1721, Tn4401), the 1st, 2nd, or 3rd class of integrons, IS elements (e.g., IS26, ISPa12, ISPa13, ISKpn8, ISKpn6) and encode determinants such as antibiotic and mercury resistance genes, as well as virulence factors. Although the actual role of Aeromonas spp. as a human pathogen remains controversial, species of this genus may pose a serious risk to human health. This is due to the considerable potential of their mobilome, particularly in terms of antibiotic resistance and the possibility of the horizontal transfer of resistance genes.

  13. Insight into the mobilome of Aeromonas strains

    Directory of Open Access Journals (Sweden)

    Marta ePiotrowska

    2015-05-01

    Full Text Available The mobilome is a pool of genes located within mobile genetic elements (MGE, such as plasmids, IS elements, transposons, genomic/pathogenicity islands, and integron-associated gene cassettes. These genes are often referred to as flexible and may encode virulence factors, toxic compounds as well as resistance to antibiotics. The phenomenon of MGE transfer between bacteria, known as horizontal gene transfer (HGT, is well documented. The genes present on MGE are subject to continuous processes of evolution and environmental changes, largely induced or significantly accelerated by man. For bacteria, the only chance of survival in an environment contaminated with toxic chemicals, heavy metals and antibiotics is the acquisition of genes providing the ability to survive in such conditions. The process of acquiring and spreading antibiotic resistance genes (ARG is of particular significance, as it is important for the health of humans and animals. Therefore, it is important to thoroughly study the mobilome of Aeromonas spp. that is widely distributed in various environments, causing many diseases in fishes and humans. This review discusses the recently published information on MGE prevalent in Aeromonas spp. with special emphasis on plasmids belonging to different incompatibility groups, i.e., IncA/C, IncU, IncQ, IncF, IncI and ColE-type. The vast majority of plasmids carry a number of different transposons (Tn3, Tn21, Tn1213, Tn1721, Tn4401, the 1st, 2nd or 3rd class of integrons, IS elements (e.g. IS26, ISPa12, ISPa13, ISKpn8, ISKpn6 and encode determinants such as antibiotic and mercury resistance genes, as well as virulence factors. Although the actual role of Aeromonas spp. as a human pathogen remains controversial, species of this genus may pose a serious risk to human health. This is due to the considerable potential of their mobilome, particularly in terms of antibiotic resistance and the possibility of the horizontal transfer of resistance

  14. Aeromonas spp. in het Nederlandse drinkwater; een orienterend onderzoek

    NARCIS (Netherlands)

    Versteegh JFM; During M; Havelaar AH; Koot W

    1986-01-01

    In dit rapport worden uitvoering en resultaten van een orienterend onderzoek naar het voorkomen van Aeromonas spp. in het Nederlandse drinkwater in 1985 besproken. Het bleek dat in 71% van de onderzochte monsters (rein water "af pompstation" en water uit het distributienet) in 100 ml

  15. Ciprofloxacin-Resistant Aeromonas hydrophila Cellulitis following Leech Therapy

    Science.gov (United States)

    Giltner, Carmen L.; Bobenchik, April M.; Uslan, Daniel Z.; Deville, Jaime G.

    2013-01-01

    We report a case of surgical site infection with ciprofloxacin-resistant Aeromonas hydrophila following leech therapy. Antimicrobial and genetic analyses of leech and patient isolates demonstrated that the resistant isolates originated from the leech gut microbiota. These data suggest that ciprofloxacin monotherapy as a prophylaxis regimen prior to leech therapy may not be effective in preventing infection. PMID:23363826

  16. Trixacarus caviae Fain, Howell & Hyatt 1972 (Acari: Sarcoptidae) as a cause of mange in guinea-pigs and papular urticaria in man

    NARCIS (Netherlands)

    Dorrestein, G.M.; Bronswijk, J.E.M.H. van

    1979-01-01

    The clinical symptoms of infestation with Trixacarus caviae in guinea-pigs are described. In general large areas of thickened, denuded skin, with a heavy secondary bacterial infection, and sometimes neurological signs, are observed in mangy cases. Antiparasitic therapy was successful with one or

  17. Avaliação da qualidade microbiológica de águas minerais consumidas na região metropolitana de Recife, Estado de Pernambuco = Evaluation of the microbiological quality of mineral water consumed in the metropolitan region of Recife, Pernambuco State

    Directory of Open Access Journals (Sweden)

    Marcelo Iran Souza Coelho

    2010-01-01

    Full Text Available Águas minerais comercializadas em garrafões de 20 L na região metropolitana de Recife, Estado de Pernambuco foram analisadas microbiologicamente, no período de junho de 2002 a maio de 2003. As dez marcas escolhidas de água mineral foram avaliadas no tocante às bactérias heterotróficas, coliformes, Escherichia coli, Pseudomonas spp., Pseudomonas aeruginosa e Aeromonas spp. Os dados foram analisados estatisticamente por meio de Modelos Lineares Generalizados (GLM. As águas minerais apresentaram contaminação por E. coli, P. aeruginosa, A. hydrophila e A. caviae. Concluiu-se que, de todas as dez marcas analisadas, pelo menos uma amostra de cada marca apresentou-se imprópria para o consumo, por não atender aos parâmetros estabelecidos pela legislação em vigor em, no mínimo, duas análises; o Número Mais Provável (NMP de Pseudomonas spp. e de P. aeruginosa foi influenciado pela sazonalidade e a contagem de bactérias heterotróficas; o Número Mais Provável (NMP de coliformes totais e termotolerantes e a pesquisa de Aeromonas spp. não sofreram influência significativa da sazonalidade.Mineral water sold in 20 L bottles in the metropolitan area of Recife, Pernambuco State were microbiologically analyzed between June 2002 and May 2003. The ten selected brands of mineral water were evaluated with regard to heterotrophic bacteria, coliforms, Escherichia coli, Pseudomonas spp., Pseudomonas aeruginosa and Aeromonas spp. Data were statistically analyzed using Generalized Linear Models (GLM. Mineral waters showed contamination by the following: E. coli, P. aeruginosa, A. hydrophila and A. caviae. It was concluded that of all ten tested brands, at least one sample of each brand was improper for consumption, for not meeting the parameters established by legislation in at least two tests; the Most Probable Number (MPN for Pseudomonas spp. and P. aeruginosa was influenced by seasonality and the count of heterotrophic bacteria; the Most

  18. The occurrence of Aeromonas spp. in the bottled mineral water, well water and tap water from the municipal supplies

    Directory of Open Access Journals (Sweden)

    Denise de Oliveira Scoaris

    2008-10-01

    Full Text Available The aim of this work was to study the occurrence of Aeromonas sp in the bottled mineral water, well water and tap water from the municipal supplies. Positive samples were found for Aeromonas spp. 12.7% from the mineral water, 8.3% from the artesian water and 6.5% from the tap water. The recovery of Aeromonas spp. was significantly higher in the bottled mineral and artesian water than in the tap water from municipal supplies. The occurrence of the Aeromonas spp. did not correlate significantly with the contamination indicator bacteria (i.e. total coliforms in the artesian water samples. However, a significant correlation was found between Aeromonas spp. and total coliforms in the both mineral water and tap water samples. The presence or absence of a correlation between the indicator bacteria and Aeromonas could reflect the occasional appearance of the pathogen in the drinking water and the different rates of survival and recovery of these agents compared with those fecal indicators. The finding that 41.6, 14.8 and 9.0 % of the artesian water, bottled mineral water and tap water, respectively, sampled in the current study failed to meet the Brazilian standard for total coliforms in the drinking water should therefore be of concern.A porcentagem de amostras positivas para Aeromonas foi de 12.7% para água mineral, 8.3% para água de poço artesiano e 6.5% para água do sistema público de abastecimento. O isolamento de Aeromonas spp. foi significativamente maior em água mineral e água de poço artesiano do que em água do sistema público. A ocorrência de Aeromonas spp. não teve correlação significativa com os indicadores de contaminação tradicionalmente utilizados (coliformes totais em amostras de água de poço artesiano. No entanto, esta correlação foi positiva e significativa em água mineral e água do sistema público. A presença ou ausência de correlação entre bactérias indicadoras e a presença de Aeromonas pode refletir o

  19. Diversity and antibiotic resistance of Aeromonas spp. in drinking and waste water treatment plants.

    Science.gov (United States)

    Figueira, Vânia; Vaz-Moreira, Ivone; Silva, Márcia; Manaia, Célia M

    2011-11-01

    The taxonomic diversity and antibiotic resistance phenotypes of aeromonads were examined in samples from drinking and waste water treatment plants (surface, ground and disinfected water in a drinking water treatment plant, and raw and treated waste water) and tap water. Bacteria identification and intra-species variation were determined based on the analysis of the 16S rRNA, gyrB and cpn60 gene sequences. Resistance phenotypes were determined using the disc diffusion method. Aeromonas veronii prevailed in raw surface water, Aeromonas hydrophyla in ozonated water, and Aeromonas media and Aeromonas puntacta in waste water. No aeromonads were detected in ground water, after the chlorination tank or in tap water. Resistance to ceftazidime or meropenem was detected in isolates from the drinking water treatment plant and waste water isolates were intrinsically resistant to nalidixic acid. Most of the times, quinolone resistance was associated with the gyrA mutation in serine 83. The gene qnrS, but not the genes qnrA, B, C, D or qepA, was detected in both surface and waste water isolates. The gene aac(6')-ib-cr was detected in different waste water strains isolated in the presence of ciprofloxacin. Both quinolone resistance genes were detected only in the species A. media. This is the first study tracking antimicrobial resistance in aeromonads in drinking, tap and waste water and the importance of these bacteria as vectors of resistance in aquatic environments is discussed. Copyright © 2011 Elsevier Ltd. All rights reserved.

  20. Aeromonas veronii septicemia in an immunocompetent patient

    OpenAIRE

    Paula McKenzie; David Sotello; Yared Hailemariam; Vipul Desai; Brian Temple

    2013-01-01

    We present a 29-year-old healthy man who fell into an industrial auger, sustaining acrushed, open pelvic injury, multiple comminuted fractures of the right leg, and traumaticamputation of his left foot. Blood and wound cultures were positive for Aeromonasspp and vancomycin resistant Enterococcus. Treatment included cefepime, levofloxacin,daptomycin, and metronidazole. Aeromonas veronii is a Gram negative bacillus usuallyfound in fresh and brackish water in warm climates. It can cause severe s...

  1. In vitro comparisons of the inhibitory activity of florfenicol copper sulfate and potassium permanganate towards Aeromonas hydrophila and Flavobacterium columnare

    Science.gov (United States)

    Aeromonas hydrophila and Flavobacterium columnare, the etiological agents of motile aeromonas septicemia (MAS) and columnaris disease, respectively, have been recently causing crippling moralities to the sunshine bass, Morone chrysops female X Morone saxatilis male (Percichthyidae), industry in the ...

  2. Immunological evaluation of Aeromonas infection in albino rats | El ...

    African Journals Online (AJOL)

    Aeromonas hydrophila is the most common bacterial species causing an acute self limiting diarrheal illness in mammals. Albino rats were categorized into treated and control groups. Treated groups were injected daily intraperitoneally with 0.2ml of bacterial suspension containing 6x106 cells/ml of 0.9% NaCl, while the ...

  3. Unusual microorganisms and antimicrobial resistances in a group of Syrian migrants: Sentinel surveillance data from an asylum seekers centre in Italy.

    Science.gov (United States)

    Angeletti, Silvia; Ceccarelli, Giancarlo; Vita, Serena; Dicuonzo, Giordano; Lopalco, Maurizio; Dedej, Etleva; Blasi, Aletheia; Antonelli, Francesca; Conti, Alessia; De Cesaris, Marina; Farchi, Francesca; Lo Presti, Alessandra; Ciccozzi, Massimo

    2016-01-01

    Three years of civil war in Syria have caused death and increase of communicable diseases. The suffering population has been forced to migrate creating a fertile condition for epidemic spread of infection within the refugee camps. Forty-eight Syrian migrants, upon their arrival in Italy, were accommodated at the asylum seekers centre of Castelnuovo di Porto. They received a physical examination and were subjected to microbiological surveillance by blood, rectal, pharyngeal and nasal swabs collection and delivering to the Clinical Pathology and Microbiology Laboratory of the University Campus Bio-Medico of Rome. All refugees resulted negative for HBV, HCV and HIV infections. In swabs a large number of unusual gram-negative bacteria species were isolated, such as Pseudomonas putida, Pseudomonas monteilii, Pseudomonas fulva, Pseudomonas moselii, Aeromonas veronii, Aeromonas caviae, Aeromonas hydrophila, Acinteobacter guilloviae, Acinteobacter lowffii; Acinetobacter johnsonii; Acinteobacter tjernbergae; Pantoea agglomerans; Pantoea calida. Among isolates, strains resistant to carbapenems, ESBL producers and methicillin resistant were found. The microbiological surveillance performed represents a useful action to understand refugees health status and to trace unusual microorganisms movement even carriers of antimicrobial resistance during migrants traveling. Copyright © 2016 Elsevier Ltd. All rights reserved.

  4. Phytochemical analysis of Binahong (Anredera Cordifolia) leaves extract to inhibit In Vitro growth of Aeromonas Hydrophila

    Science.gov (United States)

    Basyuni, Mohammad; Ginting, Prita Yulianti Anasta Br; Lesmana, Indra

    2017-11-01

    Binahong (Anredera cordifolia) is one of the medicinal plants commonly used to treat the disease of living organisms. The secondary metabolite of A. cordifolia leaves has been shown antibacterial activity. This study aimed to investigate the secondary metabolite of A. cordifolia leaves showing antibacterial and analysis the effectiveness of antibacterial to inhibit the growth of bacteria Aeromonas hydrophila. A paper disc soaked in a solution of A. cordifolia leaves extract was used to test in vitro at a concentration of 0% (w/v), 0.2%, 0.4%, 0.6%, 0.8%, and positive control of antibiotic (oxytetracycline), respectively. The extracts then placed on a tryptone soy agar (TSA) medium containing bacteria A. hydrophila and incubated at 37 °C for 24 hours. In vitro test showed that A. cordifolia leaves extract inhibited the growth of bacteria A. hydrophila with an inhibition area around the paper disc. The inhibition growth of A. hydrophila increased with the increasing of extract concentration. Bacterial growth was inhibited in the diameter zone of A. hydrophila under different levels of the extracts were 0 mm (0 % negative control), 8.4 mm (0.2 %), 9.4 mm (0.4 %), 10.5 mm (0.6 %), 11.9 mm (0.8 %), 27.5 mm (positive control), respectively. Phytochemical screening of A. cordifolia leaves extract indicated that the extracts contained flavonoid, phenol, saponin, alkaloid, triterpenoid, and β-sitosterol. Our in vitro study demonstrated the inhibition growth of A. hydrophila that caused the disease of motile Aeromonas septicemia (MAS).

  5. Potential of Chromolaena odorata Leaf as A Cure of Aeromonas hydrophila on Giant Gouramy (Osphronemus gouramy

    Directory of Open Access Journals (Sweden)

    Y. Hadiroseyani

    2007-07-01

    Full Text Available This study was conducted to examine the potency of Chromolaena odorata leaf extract as a medicine for skin eruption disease caused by  Aeromonas hydrophila in giant gouramy Osphronemus gouramy.  Leaf extract of Chromolaena odorata for in vitro test was 0 (as control, 13000, 15000, 17000, 19000 and 21000 ppm, poured onto TSA medium containing bacteria 103 cfu/ml, and then is incubated for 24 hours. In vivo test was performed by injecting bacteria 0.1 ml of 109 cfu/ml intramuscularly into giant gouramy (14 g weight, and then  fish were maintained in the water containing 15000 ppm of Chromolaena odorata leaf extract. In vitro study showed that prevention area of leaf extract against Aeromonas hydrophila was increase by increasing the concentration of leaf extract used, reached 9,33 mm.  Prevention zone of leaf extract by difusion tends to constant, reached 7,6 mm. By in vivo test, survival rate of giant gouramy infected by Aeromonas hydrophila was no significantly different between dosages of leaf extract.  All treated fish, excluded control died after 24 hours infection. Keywords: Aeromonas hydrophila, Osphronemus gouramy, Chromolaena odorata   ABSTRAK Penelitian ini dilakukan untuk mengetahui potensi daun kirinyuh Chromolaena odorata sebagai obat untuk penyakit cacar yang diakibatkan oleh Aeromonas hydrophila pada ikan gurame Osphronemus gouramy. Konsentrasi ekstrak daun Chromolaena odorata untuk uji in vitro adalah 13000, 15000, 17000, 19000 dan 21000 serta 0 ppm sebagai kontrol, yang diletakkan di atas media TSA yang telah mengandung biakan bakteri 103 cfu/ml dan diinkubasi selama 24 jam. Uji in vivo dilakukan dengan menginjeksikan bakteri  sebanyak 0,1 ml (109 cfu/ml secara intramuskular ke ikan gurame (berat 14 g dan kemudian ikan dipelihara dalam air yang mengandung ekstrak daun kirinyuh 15000 ppm. Hasil uji in virto menunjukkan bahwa semakin tinggi konsentrasi ekstrak daun kirinyuh basah semakin efektif dalam menghambat perkembangan

  6. A rapid MALDI-TOF MS identification database at genospecies level for clinical and environmental Aeromonas strains.

    Directory of Open Access Journals (Sweden)

    Cinzia Benagli

    Full Text Available The genus Aeromonas has undergone a number of taxonomic and nomenclature revisions over the past 20 years, and new (subspecies and biogroups are continuously described. Standard identification methods such as biochemical characterization have deficiencies and do not allow clarification of the taxonomic position. This report describes the development of a matrix-assisted laser desorption/ionisation-time of flight mass spectrometry (MALDI-TOF MS identification database for a rapid identification of clinical and environmental Aeromonas isolates.

  7. Antibacterial efficacies of some plant extracts against Aeromonas and Pseudomonas diseases of farmed catfish (Heterobranchus longifilis

    Directory of Open Access Journals (Sweden)

    Albert P. Ekanem

    2011-11-01

    Full Text Available Aeromonas and Pseudomonas diseases are responsible for mortalities of some farmed catfish in Nigeria. The objective of the study is to investigate the efficacies of extracts of some plants against Aeromonas and Pseudomonas diseases of Heterobranchus longifilis. Ethanol extracts of Phyllanthus amarus, Allium sativum, Artemisia annua, Citrus limon, Moringa oleifera, Allium cepa and Azadirachta indica were tested against Aeromonas hydrophila and Pseudomonas flourescens of H. longifilis by disc diffusion assay. Extracts of P. amarus, A. sativum, A. annua and C. limon were significantly (P<0.05 more sensitive to A. hydrophila and P. flourescens than M. oleifera, A. cepa and A. indica which were effective against P. flourescens. Minimum inhibitory concentrations (MIC of the extracts were 25mg/ml for P. amarus and A. annua; 25 and 100mg/ml for C. lemon and A. cepa respectively and 50mg/ml for A. indica.  Alkaloid was demonstrated in all plants except A. annua by qualitative methods. Moderate amount (++ of cardiac glycosides was demonstrated in A. sativum, M. oleifera and P. amarus. Saponin (+++ was present in M. oleifera and A. indica while, tannin (++ was present in M. oleifera, P. amarus and A. indica respectively. Phlobatanins and Anthraquinones (++ were present in P. amarus and M. oleifera respectively.  Extracts of aforementioned plants have potentials as therapy against Aeromonas hydrophila and Pseudomonas flourescens of farmed catfish.

  8. Characterization of atypical Aeromonas salmonicida isolates by ribotyping and plasmid profiling

    DEFF Research Database (Denmark)

    Pedersen, Karl; Dalsgaard, Inger; Larsen, J.L.

    1996-01-01

    A total of 38 strains of atypical Aeromonas salmonicida, three oxidase-negative but otherwise typical Aer. salmonicida, three typical Aer. salmonicida, and two reference strains, isolated from several countries and fish species were examined with respect to rRNA gene restriction patterns (ribotypes...

  9. Aspects of constitutive and acquired antibioresistance in Aeromonas hydrophila strains isolated from water sources.

    Science.gov (United States)

    Balotescu, Carmen; Israil, Anca; Radu, Roxana; Alexandru, Ionela; Dobre, Georgeta

    2003-01-01

    Over the last three decades, the literature pointed out the implications of Aeromonas species in human pathology. These species were described as being involved in intestinal (several outbreaks of acute gastroenteritis of choleric/dysenteric form or chronic diarrhoea, ulcerative colitis, etc.) in normal adults or children, as well as in extraintestinal infections in immunocompromised hosts. This last aspect included a large range of cutaneous injuries (micronecrosis, abscesses, bums, cellulites, furunculosis), joint, bones, respiratory, urinary tract, ocular infections up to meningitis, endocarditis, peritonitis, hepatobilliary disease, endotoxic shock and septicemia (as consequence of leech microvascular surgery). During the last decade, the literature reported a high mortality in Aeromonas infections determined by certain phenospecies (A. hydrophila and A. veronii) especially in extraintestinal infections in immunocompromised patients. In microbiologists' opinion this high rate of mortality was probably due to poor knowledge concerning the aspects of antibioresistance in Aeromonas strains, to empiric treatments with antibiotics to which these bacteria exhibiting constitutive resistance lead to insuccessful results, and at last to the increasing trend of aeromonads resistance to certain antibiotics after 1996. The literature mentioned also that for a great number of Beta-lactamase producing Aeromonas strains, the use of microdilution method (by comparison to disk diffusion in agar medium) giving false results made more difficult the true knowledge of Aeromonas antibioresistance patterns. At the same time, in 2002, the literature mentioned 4 ecological compartments considered as "reservoirs for dissemination and transfer of microbial antibioresistance i.e. humans, animals, plants and natural soil and water. In the last time, more and more data of the literature revealed that some bacteria with role of reservoir of antibioresistance in the natural environment, even

  10. Draft genome sequences of three Aeromonas hybrophila isolates from catfish and tilapia

    Science.gov (United States)

    Aeromonas hydrophila is a Gram-negative bacteria that is particularly adapted to freshwater environments and can cause severe infections in fish and humans. Here we report the draft genomes of three A. hydrophila catfish and tilapia isolates....

  11. Necrotizing Fasciitis Secondary to Aeromonas Infection Presenting with Septic Shock

    Directory of Open Access Journals (Sweden)

    Nikhil Bhatia

    2017-01-01

    Full Text Available This report describes a case of necrotizing fasciitis presenting with septic shock due to an Aeromonas infection. The patient cut his foot while mowing the lawn and then spent time in a pool with black mold. He began feeling ill and developed swelling and a quarter-sized black area on his right lower extremity. Despite being hemodynamically unstable with systolic blood pressure in the low 70s, the patient was transferred to our facility from outside hospital 100 miles away. Upon arriving to facility, the patient appeared to be septic and the infected area of skin had grown. Irrigation and debridement were performed and appropriate antibiotic therapy was given; however, the patient subsequently died on hospital day 8. On review of the literature, cases of necrotizing fasciitis due to Aeromonas infection have been treated successfully with the aforementioned therapy; however, there is high mortality associated with these infections, many times related to a delayed diagnosis. Our patient also had multiple poor prognostic factors including hepatic dysfunction and immunosuppression.

  12. Antibiogram, Adhesive Characteristics, and Incidence of Class 1 Integron in Aeromonas Species Isolated from Two South African Rivers

    Directory of Open Access Journals (Sweden)

    Isoken H. Igbinosa

    2013-01-01

    Full Text Available Aeromonas species are well distributed in freshwater environments, and their natural susceptibility to antimicrobials renders them interesting candidates for the survey of antimicrobial resistance in freshwater milieu. Water samples were collected from Kat and Tyume rivers in the Eastern Cape province of South Africa, and a total of 45 isolates identified as Aeromonas species were recovered from the two rivers. All Aeromonas isolates were resistant to oxacillin, penicillin, clindamycin, cephalothin, vancomycin, and rifamycin, while appreciable susceptibilities (89.3 : 94.1%, 82.1 : 94.1%, 85.7 : 88.2%, and 92.9 : 88.2% were observed against ciprofloxacin, chloramphenicol, nitrofurantoin, and gentamicin from Kat and Tyume rivers, respectively. Multiple antibiotic resistance (MAR indices ranged from 0.016 to 0.044 for the two rivers. Class 1 integron was detected in about 20% of the isolates, and all the isolates except one showed ability to produce biofilm in vitro as weak producers (53.33%, moderate producers (15.56%, and strong producers (28.9%. This investigation provides a baseline data on antibiotic resistance as well as the adhesive characteristics of Aeromonas isolates from Tyume and Kat rivers in the Eastern Cape province of South Africa.

  13. $W^{+}W^{-}$ Production Cross Section and W Branching Fractions in $e^{+}e^{-}$ Collisions at 189 GeV

    CERN Document Server

    Abbiendi, G.; Ainsley, C.; Akesson, P.F.; Alexander, G.; Allison, John; Anderson, K.J.; Arcelli, S.; Asai, S.; Ashby, S.F.; Axen, D.; Azuelos, G.; Bailey, I.; Ball, A.H.; Barberio, E.; Barlow, Roger J.; Baumann, S.; Behnke, T.; Bell, Kenneth Watson; Bella, G.; Bellerive, A.; Benelli, G.; Bentvelsen, S.; Bethke, S.; Biebel, O.; Bloodworth, I.J.; Boeriu, O.; Bock, P.; Bohme, J.; Bonacorsi, D.; Boutemeur, M.; Braibant, S.; Bright-Thomas, P.; Brigliadori, L.; Brown, Robert M.; Burckhart, H.J.; Cammin, J.; Capiluppi, P.; Carnegie, R.K.; Carter, A.A.; Carter, J.R.; Chang, C.Y.; Charlton, David G.; Clarke, P.E.L.; Clay, E.; Cohen, I.; Cooke, O.C.; Couchman, J.; Couyoumtzelis, C.; Coxe, R.L.; Csilling, A.; Cuffiani, M.; Dado, S.; Dallavalle, G.Marco; Dallison, S.; de Roeck, A.; de Wolf, E.; Dervan, P.; Desch, K.; Dienes, B.; Dixit, M.S.; Donkers, M.; Dubbert, J.; Duchovni, E.; Duckeck, G.; Duerdoth, I.P.; Estabrooks, P.G.; Etzion, E.; Fabbri, F.; Fanti, M.; Feld, L.; Ferrari, P.; Fiedler, F.; Fleck, I.; Ford, M.; Frey, A.; Furtjes, A.; Futyan, D.I.; Gagnon, P.; Gary, J.W.; Gaycken, G.; Geich-Gimbel, C.; Giacomelli, G.; Giacomelli, P.; Glenzinski, D.; Goldberg, J.; Grandi, C.; Graham, K.; Gross, E.; Grunhaus, J.; Gruwe, M.; Gunther, P.O.; Hajdu, C.; Hanson, G.G.; Hansroul, M.; Hapke, M.; Harder, K.; Harel, A.; Harin-Dirac, M.; Hauke, A.; Hauschild, M.; Hawkes, C.M.; Hawkings, R.; Hemingway, R.J.; Hensel, C.; Herten, G.; Heuer, R.D.; Hill, J.C.; Hocker, James Andrew; Hoffman, Kara Dion; Homer, R.J.; Honma, A.K.; Horvath, D.; Hossain, K.R.; Howard, R.; Huntemeyer, P.; Igo-Kemenes, P.; Ishii, K.; Jacob, F.R.; Jawahery, A.; Jeremie, H.; Jones, C.R.; Jovanovic, P.; Junk, T.R.; Kanaya, N.; Kanzaki, J.; Karapetian, G.; Karlen, D.; Kartvelishvili, V.; Kawagoe, K.; Kawamoto, T.; Keeler, R.K.; Kellogg, R.G.; Kennedy, B.W.; Kim, D.H.; Klein, K.; Klier, A.; Kluth, S.; Kobayashi, T.; Kobel, M.; Kokott, T.P.; Komamiya, S.; Kowalewski, Robert V.; Kress, T.; Krieger, P.; von Krogh, J.; Kuhl, T.; Kupper, M.; Kyberd, P.; Lafferty, G.D.; Landsman, H.; Lanske, D.; Lawson, I.; Layter, J.G.; Leins, A.; Lellouch, D.; Letts, J.; Levinson, L.; Liebisch, R.; Lillich, J.; List, B.; Littlewood, C.; Lloyd, A.W.; Lloyd, S.L.; Loebinger, F.K.; Long, G.D.; Losty, M.J.; Lu, J.; Ludwig, J.; Macchiolo, A.; Macpherson, A.; Mader, W.; Marcellini, S.; Marchant, T.E.; Martin, A.J.; Martin, J.P.; Martinez, G.; Mashimo, T.; Mattig, Peter; McDonald, W.John; McKenna, J.; McMahon, T.J.; McPherson, R.A.; Meijers, F.; Mendez-Lorenzo, P.; Menges, W.; Merritt, F.S.; Mes, H.; Michelini, A.; Mihara, S.; Mikenberg, G.; Miller, D.J.; Mohr, W.; Montanari, A.; Mori, T.; Nagai, K.; Nakamura, I.; Neal, H.A.; Nisius, R.; O'Neale, S.W.; Oakham, F.G.; Odorici, F.; Ogren, H.O.; Oh, A.; Okpara, A.; Oreglia, M.J.; Orito, S.; Pasztor, G.; Pater, J.R.; Patrick, G.N.; Patt, J.; Pfeifenschneider, P.; Pilcher, J.E.; Pinfold, J.; Plane, David E.; Poli, B.; Polok, J.; Pooth, O.; Przybycien, M.; Quadt, A.; Rembser, C.; Renkel, P.; Rick, H.; Rodning, N.; Roney, J.M.; Rosati, S.; Roscoe, K.; Rossi, A.M.; Rozen, Y.; Runge, K.; Runolfsson, O.; Rust, D.R.; Sachs, K.; Saeki, T.; Sahr, O.; Sarkisyan, E.K.G.; Sbarra, C.; Schaile, A.D.; Schaile, O.; Scharff-Hansen, P.; Schroder, Matthias; Schumacher, M.; Schwick, C.; Scott, W.G.; Seuster, R.; Shears, T.G.; Shen, B.C.; Shepherd-Themistocleous, C.H.; Sherwood, P.; Siroli, G.P.; Skuja, A.; Smith, A.M.; Snow, G.A.; Sobie, R.; Soldner-Rembold, S.; Spagnolo, S.; Sproston, M.; Stahl, A.; Stephens, K.; Stoll, K.; Strom, David M.; Strohmer, R.; Stumpf, L.; Surrow, B.; Talbot, S.D.; Tarem, S.; Taylor, R.J.; Teuscher, R.; Thiergen, M.; Thomas, J.; Thomson, M.A.; Torrence, E.; Towers, S.; Toya, D.; Trefzger, T.; Trigger, I.; Trocsanyi, Z.; Tsur, E.; Turner-Watson, M.F.; Ueda, I.; Vachon, B.; Vannerem, P.; Verzocchi, M.; Voss, H.; Vossebeld, J.; Waller, D.; Ward, C.P.; Ward, D.R.; Watkins, P.M.; Watson, A.T.; Watson, N.K.; Wells, P.S.; Wengler, T.; Wermes, N.; Wetterling, D.; White, J.S.; Wilson, G.W.; Wilson, J.A.; Wyatt, T.R.; Yamashita, S.; Zacek, V.; Zer-Zion, D.

    2000-01-01

    From a data sample of 183 pb^-1 recorded at a center-of-mass energy of roots = 189 GeV with the OPAL detector at LEP, 3068 W-pair candidate events are selected. Assuming Standard Model W boson decay branching fractions, the W-pair production cross section is measured to be sigmaWW = 16.30 +- 0.34(stat.) +- 0.18(syst.) pb. When combined with previous OPAL measurements, the W boson branching fraction to hadrons is determined to be 68.32 +- 0.61(stat.) +- 0.28(syst.) % assuming lepton universality. These results are consistent with Standard Model expectations.

  14. An investigation of the bactericidal activity of selected essential oils to Aeromonas spp.

    Directory of Open Access Journals (Sweden)

    Clifford E. Starliper

    2015-01-01

    Full Text Available Diseases of fishes caused by Aeromonas spp. are common, have broad host ranges and may cause high mortality. Treatments of captive-reared populations using antimicrobials are limited with concerns for bacterial resistance development and environmental dissemination. This study was done to determine whether selected plant-derived essential oils were bactericidal to Aeromonas spp. Initially, twelve essential oils were evaluated using a disk diffusion assay to an isolate of A. salmonicida subsp. salmonicida, cause of fish furunculosis. The greatest zones of inhibition were obtained with oils of cinnamon Cinnamomum cassia, oregano Origanum vulgare, lemongrass Cymbopogon citratus and thyme Thymus vulgaris. Minimum bactericidal concentrations (MBC’s were determined for these four oils, Allimed® (garlic extract, Allium sativum and colloidal silver to sixty-nine isolates representing nine Aeromonas spp. The lowest mean MBCs (0.02–0.04% were obtained with three different sources of cinnamon oil. MBCs for three sources of oregano and lemongrass oils ranged from 0.14% to 0.30% and 0.10% to 0.65%, respectively, and for two thyme oils were 2.11% and 2.22%. The highest concentration (5% of Allimed® tested resulted in MBCs to twelve isolates. A concentration of silver greater than 15 mg/L would be required to determine MBCs for all but one isolate.

  15. [Role of Aeromonas in the monitoring of a hydroecosystem in the Volga-Caspian area].

    Science.gov (United States)

    Obukhova, O V; Lartseva, L V; Lisitskaia, I A

    2011-01-01

    The paper gives data obtained over many years on the quantity of bacteria of the genus Aeromonas in the hydroecosystems of the delta of the Volga and Caspian Sea and in commercial fishes (sturgeon (Acipenseridae), pike perch (Stizostedion), carp (Cyprinus carpio), silurus (Silurus glanis), etc.). It provides a detailed analysis of their seasonal trends and spatial distribution, markers of their pathogenicity, and antibiotic resistance. The findings suggest that Aeromonas is a causative agent of sapronoses and meets the criteria for natural focal infections. They show a wide range of tolerance to the abiotic factors of hydroecosystems, as well as mixotrophy and autrophic nutrition in the environment and they are of great sanitary and hygienic importance.

  16. Spirulina chitosan gel induction on healing process of Cavia cobaya post extraction socket

    Directory of Open Access Journals (Sweden)

    Rostiny Rostiny

    2014-03-01

    Full Text Available Background: Prominent residual ridge is necessary to gain retention and stabilility for succesful prosthodontic treatment such as removable, fixed or implant. Spirulina is a natural substance that can help tissue healing and chitosan also a natural substance that reported to have the ability to help bone remodelling. The combination gel of spirulina and chitosan could be considered as an alternative material to maintain residual ridge height after tooth extraction. Purpose: The aim of study was to examine the effect of combination gel of Spirulina and chitosan on healing process of Cavia cobaya post tooth extraction socket by counting the amount of osteoclast, osteoblast and colagen as an indicator. Methods: Twenty eight cavia cobaya were divided into 4 groups. Insisive mandible extraction was done and the sockets were filled with 3% CMCNa for control groups, 3% spirulina chitosan 200 mg for group 1, 6% spirulina chitosan 200 mg for group 2, 12% spirulina chitosan 200 mg for group 3. After 30 days, histopathology examination was done by using microscope to count the amount of osteoclast, osteoblast and collagen. Results: Data was analyzed by using Anova and Tukey HSD. For osteoclast, there was no significant different between every groups, while for osteoblast and collagen there was significant different between groups. The results showed that induction of combination gel spirulina chitosan was able to accumulate collagen fiber and resulting faster wound healing. Conclusion: Combination 12% gel spirulina chitosan 200 mg could be used as an alternative material for better bone remodeling after tooth extraction.Latar belakang: Residual ridge yang prominen sangat dibutuhkan untuk mendapatkan retensi dan stabilitas untuk menunjang keberhasilan perawatan di bidang prostodonsia seperti pada kasus removable, fixed atau implant. Tindakan pencabutan gigi dapat merusak jaringan periodontal, sementum dan tulang alveolar yang mengakibatkan resorbsi ridge

  17. Isolation of Electrogenic Microorganisms with Potential to Reduce Hexavalent Chromium

    Directory of Open Access Journals (Sweden)

    Alexander Mora Collazos

    2017-01-01

    Full Text Available Isolation of cultivable microorganisms was made from the biofilm formed on the anode of a microbial fuel cell put into operation for 30 days; isolated microorganisms were evaluated for their ability to produce energy and reduce the hexavalent chromium Cr (VI. Five microorganisms were isolated, which were characterized by analysis of 16S rRNA gene, placing them in four bacterial genera: Exiguobacterium (CrMFC1, Acinetobacter (CrMFC2, Aeromonas (CrMFC3 and CrMFC5 and Serratia (CrMFC4. All isolates showed electrogenic activity and ability to reduce hexavalent chromium; the Acinetobacter CrMFC1 strain showed the best electrochemical performance registering a maximum power density of 18.61 mW/m2; the other strains showed values of maximum power density between 4.6 mW/m2and 7.1 mW/m2. Strains Aeromonas CrMFC5 and Exiguobacterium CrMFC1 showed the best rates of chromium reduction being able to reduce 100 % of the Cr (VI in less than 24 hours, the Aeromonas CrMFC5 strain was the most efficient, reducing 100 % of Cr (VI in 10 hours; the other strains reduced 100% of the contaminant after 28 to 30 hours. The microorganisms isolated in this study are hardly known for their electrogenic capacity and for reducing Cr (VI; however, show promise for their use in combined systems involving energy production system coupled to bioremediation of chromium contaminated water.

  18. Recovery of atypical Aeromonas salmonicida from ulcerated fish from the Baltic Sea

    DEFF Research Database (Denmark)

    Wiklund, T.; Tabolina, I; Bezgachina, T.V.

    1999-01-01

    Ulcerated fish of six different species were collected during the BMB/ICES Sea-going Workshop "Fish Diseases and Parasites in the Baltic Sea", 25 November to 8 December 1994, and examined for bacteriological infections. Atypical Aeromonas salmonicida strains were isolated from the majority...

  19. ORF Alignment: NC_003361 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available on ... tolerance protein [Chlamydophila caviae GPIC] ... Length = 102 ... Query: 2 ... TPVIIFTQLPSQEEADCISH...ALVTQKLAACVHVFPKGNSTYMWEGKLYISEEYHMHIKTI 61 ... TPVIIFTQLPSQEEADCISH...ALVTQKLAACVHVFPKGNSTYMWEGKLYISEEYHMHIKTI Sbjct: 1 ... TPVIIFTQLPSQEEADCISHALVTQKLAACVHVFPKGNSTYMWEGKLYISEEYHMHIKTI 60 ...

  20. Characterization and mechanism of anti-Aeromonas salmonicida activity of a marine probiotic strain, Bacillus velezensis V4.

    Science.gov (United States)

    Gao, Xi-Yan; Liu, Ying; Miao, Li-Li; Li, Er-Wei; Sun, Guo-Xiang; Liu, Ying; Liu, Zhi-Pei

    2017-05-01

    The bacterium Aeromonas salmonicida is the causative agent of furunculosis, a systemic, ubiquitous disease of fish in the salmon family, characterized by high mortality and morbidity. Probiotics are a promising approach for prevention of furunculosis in aquaculture. A bacterial strain with anti-A. salmonicida properties, Bacillus velezensis V4, was isolated and the mechanisms underlying these properties were investigated. Anti-A. salmonicida compounds present in cell-free supernatant of V4 were purified and structurally identified as members of the iturin, macrolactin, and difficidin groups. The compounds contributed jointly to inhibition of A. salmonicida, and the diversity of the compounds was related to the versatility of their mode of action. Addition of the compounds to A. salmonicida cell suspensions reduced cell density. Analyses by confocal microscopy and scanning electron microscopy revealed cell membrane disruption, deletion of cellular content, and cell lysis of A. salmonicida. The V4 genome was sequenced, and gene clusters involved in synthesis of anti-Aeromonas compounds were detected and identified. A possible probiotic effect on growth performance of Oncorhynchus mykiss (rainbow trout) was investigated by addition of 0, 1, and 3 % (v/w) V4. Relative to control, mortality was reduced 27.25 % in the 1 % addition group and 81.86 % in the 3 % addition group. Feed coefficient ratio was reduced 19.49 % and weight gain ratio was increased 71.22 % in the 1 % addition group. Our findings demonstrate that V4 is an effective probiotic strain in O. mykiss and has clear potential for both control of furunculosis and growth promotion of aquaculture animals.

  1. Population dynamics and antimicrobial susceptibility of Aeromonas spp. along a salinity gradient in an urban estuary in Northeastern Brazil.

    Science.gov (United States)

    Silva, Camila Magalhães; Evangelista-Barreto, Norma Suely; Vieira, Regine Helena Silva Dos Fernandes; Mendonça, Kamila Vieira; Sousa, Oscarina Viana de

    2014-12-15

    The main objective of this study was to quantify population and identify culturable species of Aeromonas in sediment and surface water collected along a salinity gradient in an urban estuary in Northeastern Brazil. Thirty sediment samples and 30 water samples were collected from 3 sampling locations (A, B and C) between October 2007 and April 2008. The Aeromonas count was 10-7050CFU/mL (A), 25-38,500CFU/mL (B) andwater samples, and ∼100-37,500CFU/g (A), 1200-43,500CFU/g (B) andantibiotics tested. Resistance to erythromycin was mostly plasmidial. In conclusion, due to pollution, the Cocó River is contaminated by pathogenic strains of Aeromonas spp. with a high incidence of antibacterial resistance, posing a serious risk to human health. Copyright © 2014 Elsevier Ltd. All rights reserved.

  2. Transmissão do Trypanosoma cruzi em três gerações de Cavia porcellus sem a participação de triatomíneos

    Directory of Open Access Journals (Sweden)

    Ítalo A. Sherlock

    1976-02-01

    Full Text Available Foi verificada a transmissão sucessiva do T. cruzi em três gerações da cobaia Cavia porcellus sem a participação de triatomíneos. Embora não fosse determinado qual das vias, se placentária, leite, excreções ou contágio direto pelo qual o protozoário foi transmitido para os descendentes, chama-se atenção para a importância da manutenção de reservatórios da Doença de Chagas, mesmo na ausência de vetores invertebrados.The sucessive transmission of Trypanosoma cruzi among three generations of the guinea pig Cavia porcellus without the participation of triatomine bugs is verified. Although the mode of transmission, such as congenital, infected milk or other excretion or direct contagion was not defined, this maybe of importance in natural maintenance of reservoirs of T. cruzi without the invertebrate vectors.

  3. Draft Genome Sequence of Fish Pathogen Aeromonas bestiarum GA97-22.

    Science.gov (United States)

    Kumru, Salih; Tekedar, Hasan C; Griffin, Matt J; Waldbieser, Geoffrey C; Liles, Mark R; Sonstegard, Tad; Schroeder, Steven G; Lawrence, Mark L; Karsi, Attila

    2018-06-14

    Aeromonas bestiarum is a Gram-negative mesophilic motile bacterium causing acute hemorrhagic septicemia or chronic skin ulcers in fish. Here, we report the draft genome sequence of A. bestiarum strain GA97-22, which was isolated from rainbow trout in 1997. This genome sequence will improve our understanding of the complex taxonomy of motile aeromonads.

  4. Resistensi Bakteri Aeromonas sp. Isolat Ikan Piranha (Pygosentrus nattereri Bali Safari And Marine Park terhadap Antibiotik

    Directory of Open Access Journals (Sweden)

    Ni Made Herawati

    2013-11-01

    Full Text Available Normal 0 false false false EN-US X-NONE X-NONE Piranha (Pygosentrus nattereri is a fish that has been conserved at Conservation Center of Bali Safari and Marine Park. In May 2012 there was a case that twelve Piranhas suffered from illness and two of them died without any specific clinical signs. The dead Piranhas were necropsied and the tissues or parts of organs were collected for microbial examination interests. Spesies specific bacterial examination was also included using Microgen GNA TM + B-ID system test The bacterial examination found that the fishes were infected by Aeromonas hydropila and Aeromonas veronii. Further examination about antibiotic resistance tests showed that those Aeromonas spp were resistant to chloramphenicol and a combination of trimethoprim and sulphamethoxazole. It can be suggested that, next, the usage of other antibiotics is strongly recommended for the case of Piranha infected by Aeromonas spp at Bali Safari and Marine Park. /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin:0in; mso-para-margin-bottom:.0001pt; text-align:justify; line-height:150%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin;}

  5. A new karyotype for the genus Cavia from a southern island of Brazil (Rodentia - Caviidae

    Directory of Open Access Journals (Sweden)

    A. Gava

    1998-03-01

    Full Text Available Intraspecific karyotype variation in mammal species is very common and often caused by centromeric fusion of acrocentric chromosomes. We describe here a new karyotype 2n = 62 (FN = 112 for the genus Cavia from the Moleques do Sul Islands, of the southern coast of Brazil. We analyzed two male and four female karyotypes that had twenty-four biarmed pairs and six pairs of acrocentric chromosomes. The sexual pair consisted of a metacentric X-chromosome and a large acrocentric Y. C-bands were found in the centromeric and pericentromeric regions of almost all chromosomes, except for some small biarmed and acrocentric ones. Nucleolus organizer regions appeared in two biarmed chromosomes, and G-banding patterns were also seen.RESUMO A variação cariotípica nas espécies de mamíferos é bastante comum e geralmente causada pela fusão de cromossomos acrocêntricos. Foi descrito neste trabalho um novo cariótipo, com 2n = 62 e FN = 112, para o gênero Cavia proveniente das ilhas Moleques do Sul, da costa sul do Brasil. Foram analisados os cariótipos de dois machos e quatro fêmeas que possuiam 24 pares de cromossomos com dois braços e seis pares de acrocêntricos. O par sexual era constituído por um cromossomo X metacêntrico grande e um Y acrocêntrico. As bandas C estavam localizadas nas regiões centroméricas e pericentroméricas da maioria dos cromossomos, com exceção de alguns acrocêntricos e os cromossomos de dois braços menores. As regiões organizadoras de nucléolo ocorreram em dois cromossomos com dois braços e o padrão de bandamento G foi também apresentado.

  6. Estereología Comparativa entre el Bazo del Cuye (Cavia porcellus) y la Rata (Rattus novergicus, Sprague Dawley)

    OpenAIRE

    Furrianca, María Cristina; Vásquez, Bélgica; del Sol, Mariano

    2008-01-01

    El bazo es el órgano linfático periférico más grande del organismo y conocer sus aspectos morfológicos cuantitativos es importante para determinar posibles patologías. El objetivo del estudio fue determinar en dos especies: cuye (Cavia porcellus) y rata (Rattus novergicus Sprague Dawley), las características estereológicas del bazo, para obtener patrones de normalidad cuantitativos, los que servirán de base para futuros estudios morfofuncionales. Se utilizaron 5 bazos de cada especie, clínica...

  7. JST Thesaurus Headwords and Synonyms: Aeromonas salmonicida [MeCab user dictionary for science technology term[Archive

    Lifescience Database Archive (English)

    Full Text Available MeCab user dictionary for science technology term Aeromonas salmonicida 名詞 一般 * * *... * Aeromonas salmonicida Aeromonas salmonicida エイイーアールオーエムオーエヌエイエス エスエイエルエムオーエヌアイシーアイディーエイ Thesaurus2015 200906081596351600 C LS07 UNKNOWN_2 Aeromonas salmonicida

  8. Prolactin family of the guinea pig, Cavia porcellus.

    Science.gov (United States)

    Alam, S M Khorshed; Konno, Toshihiro; Rumi, M A Karim; Dong, Yafeng; Weiner, Carl P; Soares, Michael J

    2010-08-01

    Prolactin (PRL) is a multifunctional hormone with prominent roles in regulating growth and reproduction. The guinea pig (Cavia porcellus) has been extensively used in endocrine and reproduction research. Thus far, the PRL cDNA and protein have not been isolated from the guinea pig. In the present study, we used information derived from the public guinea pig genome database as a tool for identifying guinea pig PRL and PRL-related proteins. Guinea pig PRL exhibits prominent nucleotide and amino acid sequence differences when compared with PRLs of other eutherian mammals. In contrast, guinea pig GH is highly conserved. Expression of PRL and GH in the guinea pig is prominent in the anterior pituitary, similar to known expression patterns of PRL and GH for other species. Two additional guinea pig cDNAs were identified and termed PRL-related proteins (PRLRP1, PRLRP2). They exhibited a more distant relationship to PRL and their expression was restricted to the placenta. Recombinant guinea pig PRL protein was generated and shown to be biologically active in the PRL-responsive Nb2 lymphoma cell bioassay. In contrast, recombinant guinea pig PRLRP1 protein did not exhibit PRL-like bioactivity. In summary, we have developed a new set of research tools for investigating the biology of the PRL family in an important animal model, the guinea pig.

  9. Presence of Vibrios and Aeromonas strains and total psychrotrophs in hexagonal spotted grouper and Spanish Mackerel Fish

    International Nuclear Information System (INIS)

    Al-Dagal, M.

    2002-01-01

    This work was conducted on different parts of hexagonal-spotted grouper and Spanish mackerel fish from 10 major fishery shops in Riyadh city to assess the presence of vibrios and aeromonas using the API20E and Biolog system. Also, pH and total psychotrophs were assessed as two indexes of quality. Similar data were obtained from both identification systems except for Aeromonas media-like and Vibrio anguillarum which are not included in the API20E database. Aeromonas hydrophila, A. media-like, V. alginolyticus, V.anguillarum, V. damsel and V. fluvialis were recovered from fish samples A. medial-like and V. damsel most predominant. Unexpectedly, V. cholera and V. parahemolyticus were not recovered. The numbers of skin samples of grouper having more than 7 log CFU/gm were much higher than that of mackerel skin samples. Similar psychrotrophic counts were noticed in gut samples of the two fish types, indicating similarly in growth habitat. Most of the grouper fish samples had a pH in the range of >6.40-7.02, whereas 95% of mackerel samples had a pH at 6.40 or below. (author)

  10. Occurrence and Variety of β-Lactamase Genes among Aeromonas spp. Isolated from Urban Wastewater Treatment Plant

    Directory of Open Access Journals (Sweden)

    Marta Piotrowska

    2017-05-01

    Full Text Available Members of the genus Aeromonas that commonly occur in various aquatic ecosystems are taken into account as vectors spreading antibiotic resistance genes (ARGs in the environment. In our study strains of Aeromonas spp. (n = 104 not susceptible to ampicillin were isolated from municipal sewage of different levels of purification – raw sewage, activated sludge and treated wastewater. The crucial step of the study was the identification of β-lactamase resistance genes. The identified genes encode β-lactamases from 14 families – blaTEM, blaOXA, blaSHV, blaCTX-M, blaMOX, blaACC, blaFOX, blaGES, blaPER, blaV EB, blaKPC, cphA, imiH, and cepH. There were no significant differences in number of identified ARGs between isolation points. BlaOXA, blaFOX variants and, characteristic for Aeromonas genus, metallo-β-lactamase cphA-related genes were the most commonly identified types of β-lactam resistance determinants. Moreover, we found four extended-spectrum β-lactamases (blaSHV -11, blaCTX-M-27, blaCTX-M-98, and blaPER-4 – and seven AmpC (blaACC, blaFOX-2-like, blaFOX-3, blaFOX-4-like, blaFOX-9, blaFOX-10-like, and blaFOX-13-like types and variants of genes that had never been found among Aeromonas spp. before. Five of the β-lactamases families (blaTEM, blaOXA, blaFOX, blaV EB, and cphA were identified in all three isolation sites, which supports the hypothesis that wastewater treatment plants (WWTPs are hot spots of ARGs dissemination. The obtained ARGs sequences share high identity with previously described β-lactamases, but new variants of those genes have to be considered as well. Characterization of antibiotic susceptibility was performed using disk the diffusion method with 12 different antibiotics according to CLSI guidelines. Over 60% of the strains are unsusceptible to cefepime and chloramphenicol and the majority of the strains have a multidrug resistance phenotype (68%. Finally, analysis of plasmid profiles among the resistant strains

  11. Role of pH in oxidase variability of Aeromonas hydrophila.

    OpenAIRE

    Hunt, L K; Overman, T L; Otero, R B

    1981-01-01

    Some strains of Aeromonas hydrophila may be oxidase negative or only weakly oxidase positive by the Kovacs method taken from the surface of a differential medium, such as MacConkey agar. Six strains of A. hydrophila, two oxidase variable, one oxidase constant, and three weakly oxidase positive on MacConkey agar, were studied to determine the cause of oxidase variability. The bacteriostatic dyes in MacConkey agar were considered possible inhibitors of the oxidase reaction. The concentration of...

  12. Social preferences of developing guinea pigs (Cavia porcellus) from the preweaning to the periadolescent periods.

    Science.gov (United States)

    Hennessy, Michael B; Young, Travis L; O'Leary, Shonagh K; Maken, Deborah S

    2003-12-01

    Preference tests in a novel environment (Experiment 1) and unobtrusive observations in a specialized living environment (Experiment 2) examined the attractiveness of various classes of conspecifics for maturing guinea pigs (Cavia porcellus). It was found that (a). the young continued to remain near the mother well beyond weaning; (b). there was increased time spent with unrelated adult females, but not males, after weaning; (c). male and female offspring behaved similarly; and (d). littermates spent considerable time with each other. These results provide no evidence that guinea pigs approaching sexual maturity begin to associate preferentially with novel animals or potential breeding partners. Choices were largely predictable from earlier findings of the ability of various classes of conspecifics to reduce hypothalamic-pituitary-adrenal activity of the young.

  13. Resistance of Salmonds Against Aeromonas Salmonicida

    DEFF Research Database (Denmark)

    Holten-Andersen, Lars; Dalsgaard, Inger; Buchmann, Kurt

    2011-01-01

    Furunculosis, caused by Aeromonas salmonicida, continues to be a health problem for the growing salmonid aquaculture. Despite effective vaccination programs regular outbreaks occur at Danish trout farms calling for repeated antibiotic treatment. We hypothesized that a difference in natural...... over a 30-day period post challenge and the results were summarized in mortality curves. A. salmonicida was recovered from mortalities during the entire test period. At day 30 the survival was 6.2 % and 34.0 % for rainbow trout and Baltic salmon, respectively. Significant differences in susceptibility...... to A. salmonicida were demonstrated between the two salmonids and hazard ratio estimation between rainbow trout and Baltic salmon showed a 3.36 higher risk of dying from the infection in the former. The finding that Baltic salmon carries a high level of natural resistance to furunculosis might raise...

  14. Multifocal Aeromonas Osteomyelitis in a Child with Leukemia

    Directory of Open Access Journals (Sweden)

    Dimitrios Doganis

    2016-01-01

    Full Text Available Aeromonas hydrophila is a Gram negative organism causing both intestinal and extraintestinal disease. The case of a 14-year-old girl with underlying immunodeficiency and leukemia who developed systemic A. hydrophila infection is described in this report. While in deep bone marrow aplasia she developed fever, severe pain in the lower extremities, and swelling of the left femur. Blood culture showed Escherichia coli and A. hydrophila whereas pus culture from the soft tissue swelling showed the presence of A. hydrophila. Imaging studies showed diffuse osteolytic lesions. Patient received 5 months of intravenous and oral antibiotics and she improved clinically whereas the radiology findings persisted.

  15. Reação em cadeia da polimerase para detecção de Clostridium chauvoei em tecidos de Cavia porcellus PCR detection of Clostridium chauvoei in tissues of Cavia porcellus

    Directory of Open Access Journals (Sweden)

    Ronnie Antunes de Assis

    2005-12-01

    Full Text Available O objetivo deste trabalho foi padronizar uma técnica de reação em cadeia da polimerase (PCR, para detecção de Clostridium chauvoei, em tecidos fixados em formol e incluídos em parafina de cobaias (Cavia porcellus experimentalmente infectadas com esse microrganismo. Os animais foram sacrificados, e amostras do músculo da área de inoculação (MAI, fígado, miocárdio e baço foram disponibilizadas para a técnica de PCR. O clostrídio foi detectado em todas as secções do MAI, fígado e miocárdio, mas não foi observado em secções do baço. Reações cruzadas não foram observadas a partir de secções do MAI dos animais com inoculação de outras espécies de clostrídios, bem como nenhuma amplificação foi observada a partir de secções do MAI dos animais controle. Esses resultados mostram que a técnica de PCR desenvolvida neste estudo, pode ser usada para detecção de Clostridium chauvoei em tecidos fixados em formol e incluídos em parafina.The objective of this work was the standardization of a polymerase chain reaction (PCR for detection of Clostridium chauvoei in formalin-fixed, paraffin-embedded tissues of guinea-pigs (Cavia porcellus infected experimentally with this microorganism. The animals were sacrificed, and samples of muscle from inoculation area (MIA, liver, myocardium and spleen were available for PCR technique. Clostridium chauvoei was detected in all sections of the MIA, liver and myocardium, and no product was observed in sections of the spleen. Cross-reactions were not observed in sections of MIA of the animals inoculated with other clostridia, as well as no amplification was observed in sections of MIA of control animals. These results show that the PCR technique developed in this study may be useful for detection of C. chauvoei in formalin-fixed, paraffin-embedded tissues.

  16. Detection and quantification of Aeromonas salmonicida in fish tissue by real-time PCR

    DEFF Research Database (Denmark)

    Bartkova, Simona; Kokotovic, Branco; Skall, H. F.

    2017-01-01

    Furunculosis, a septicaemic infection caused by the bacterium Aeromonas salmonicida subsp. salmonicida, currently causes problems in Danish seawater rainbow trout production. Detection has mainly been achieved by bacterial culture, but more rapid and sensitive methods are needed. A previously...

  17. The influence of p H during growth of bacteria in toluene

    International Nuclear Information System (INIS)

    Nahar, N.; Quilty, B.; Alauddin, M.

    2000-01-01

    Five toluene tolerant species were isolated from the activated sludge of a wastewater treatment plant (Dublin). The isolate were investigated for influence of pH on the growth in toluene. Four of the bacteria have been identified as Pseudomonas putida and one as an Aeromonas caviae. When these bacteria were grown with toluene as the sole source of carbon and energy, the pH of the culture medium became acidic and dropped. 0.5 M sodium phosphate buffer was selected to investigate the optimum pH for growth in the presence of 500 mu l of toluene. In general, the growth was optimum between pH 5.8 and 7.4. (author)

  18. Plesiomonasshigelloides and Aeromonadaceae family pathogens isolated from marine mammals of Southern and Southeastern Brazilian coast Plesiomonasshigelloides e patógenos da família Aeromonadaceae isolados de mamíferos marinhos da costa sul e sudeste do Brasil

    Directory of Open Access Journals (Sweden)

    Christiane S. Pereira

    2008-12-01

    Full Text Available The aquatic environment is the habitat of many microorganisms, including Plesiomonasshigelloides and Aeromonas species which are pathogenic to human and animals. In the present investigation, we evaluated the occurrence of these pathogens from marine mammals beached or accidentally captured by fishing net in southeastern (RJ and southern (RS coastal Brazilian regions. A total of 198 swabs from 27 specimens of marine mammals, including 11 different species, were collected by DEENSP and GEMARS-CECLIMAR/UFRGS Institutes and sent to LRNCEB/IOC/FIOCRUZ. The samples were enriched in Alkaline Peptone Water (APW added with 1% of sodium chloride (NaCl, APW plus 3% NaCl and incubated at 37ºC for 18-24 hours. Following, samples were streaked onto Pseudomonas-Aeromonas Selective Agar Base (GSP Agar and suspected colonies were biochemically characterized. The results revealed 114 strains, including ten Aeromonas species and P.shigelloides. The main pathogens isolated were A.veronii biogroup veronii (19.3%, A. caviae (12.3%, A. hydrophila (9.6% and P.shigelloides (7%. The pathogens were isolated in both coastal and offshore marine mammals. These data point the importance of epidemiological surveillance and microbiological monitoring and reinforce the need to implement environmental protection programs, especially related to endangered cetacean species.O ambiente aquático é o habitat de vários microrganismos, incluindo Plesiomonasshigelloides e espécies de Aeromonas, os quais são patogênicos para o homem e os animais. Na presente investigação, foi avaliada a ocorrência destes patógenos a partir de swabs coletados de mamíferos marinhos encalhados ou capturados acidentalmente em redes de pesca nas regiões costeiras do sudeste (RJ e sul (RS do Brasil. O total de 198 swabs de 27 espécimes de mamíferos marinhos, incluindo 11 espécies distintas, foi coletado por profissionais dos institutos DEENSP, GEMARS-CECLIMAR/UFRGS e enviado ao LRNCEB

  19. Antibiotic resistance profiling and phenotyping of Aeromonas species isolated from aquatic sources

    Directory of Open Access Journals (Sweden)

    Olumide A. Odeyemi

    2017-01-01

    Full Text Available This study aimed to investigate antibiotics resistance pattern and phenotyping of Aeromonas species isolated from different aquatic sources in Melaka, Malaysia. A total of 53 Aeromonas species were isolated from the following sources: sediment (n = 13, bivalve (n = 10, sea cucumber (n = 16 and sea water (n = 14 and resistance to 12 antibiotics – Tetracycline (30 μg, Kanamycin (30 μg, Oxytetracycline (30 μg, Ampicillin (10 μg, Streptomycin (10 μg, Gentamicin (10 μg, Sulphamethoxazole (25 μg, Nalixidic acid (30 μg, Trimethoprim (1.25 μg, Novobiocin (5 μg, Penicilin (10 μg and Chloramphenicol (10 μg was tested. The results obtained from this study reveal multi drug resistance pattern among the isolates. All the isolates were completely resistant to Ampicillin, Novobiocin, Sulphamethoxazole and Trimethoprim, respectively but susceptible to Tetracycline (100%, Kanamycin (5.7%, Gentamicin (5.7% and Oxytetracycline (24.5%. Antibiotics phenotyping of the bacteria revealed 21 different phenotypes among the isolates.

  20. El pH de la carne de cobayo (Cavia porcellus procedente del manejo deficiente del bienestar animal durante el sacrificio en la sierra central del Perú.

    Directory of Open Access Journals (Sweden)

    LUCAS JR

    2017-09-01

    Full Text Available En la región andina del Perú es común observar el sacrificio de los cobayos sin aturdimiento ni descanso ante mortem. El objetivo del presente estudio fue evaluar el pH de la carne de cobayo (Cavia porcellus resultante de este manejo. Se evaluó el pH de 60 canales a las 0, 1, 6, 12, y 24 h posteriores al sacrificio sin descanso ante mortem ni aturdimiento. El pH fue de 6.79 ± 0.3, 6.74 ± 0.34, 6.59 ± 0.28, 6.45 ± 0.35 y 5.96 ± 0.11, a la 0, 1, 6, 12 y 24 horas post sacrificio respectivamente. La ecuación que representa la evolución del pH fue Y=6.7765-0.0231X-0.0005X2 (R2=0.996. SUMMARY. The pH of guinea pig (Cavia porcellus meat from the welfare-deficient slaughtering in the Peruvian central Andes. In Andean region of Peru is common to slaughter Guinea pig without lairage and stunning. The aim of this study was to evaluate the pH of meat of Guinea pig (Cavia porcellus from the unsuitable welfare practices during slaughtering in the Peruvian central Andes. The pH of 60 guinea pig carcasses were analyzed at 0, 1, 6, 12 and 24 hours after the end of the slaughter process. The pH was 6.79 ± 0.3, 6.74 ± 0.34, 6.59 ± 0.28, 6.45 ± 0.35 and 5.96 ± 0.11 for 0, 1, 6, 12 y 24 h post slaughtering. The equation that graphs pH evolution was Y=6.7765-0.0231X-0.0005X2 (R2=0.996.

  1. Aeromonas hydrophila as cause of hemorrhagic septicemia in a ground-hornbill (Bucorvus abyssinicus).

    Science.gov (United States)

    Ocholi, R A; Kalejaiye, J O

    1990-01-01

    An acute hemorrhagic septicemia in a captive ground-hornbill (Bucorvus abyssinicus) is reported. Aeromonas hydrophila was isolated from lungs, liver, kidney, and intestines. Postmortem lesions were characterized by hemorrhages in the internal organs. Microscopically, necrotic lesions were found in the liver, lungs, and kidney. Factors that might have contributed to the clinical disease condition are discussed.

  2. THE PREVALENCE OF Salmonella sp., Listeria sp. AND Aeromonas spp. IN CATFISH (CLARIAS (Clarias gariepinus AND TILAPIA (Tilapia mossambica BY PELLETING METHOD

    Directory of Open Access Journals (Sweden)

    Titik Budiati

    2013-06-01

    Full Text Available The aim of this study was to modify the isolation methods of Aeromonas sp., Salmonella spp., and Listeria sp. in catfish (Clarias gariepinus and tilapia (Tilapia mossambica obtained from wet markets and ponds in Malaysia by pelleting the sample. A total of 108 samples (32 catfish intestines, 32 tilapia intestines, and 44 water samples were obtained from nine wet markets and eight ponds. The modified method was employed by pelleting the samples and followed by either implementing pre-enrichment or without pre-enrichment on the isolation of Salmonella and Listeria spp. The modified method (by pelleting the sample in combination with pre-enrichment was the most efficient for Salmonella and Listeria isolation. The sensitivity of the modified Salmonella isolation method was 0.53 and 0.73 for fish and water samples, respectively. The sensitivity of the modified Listeria method was 1 and 0.92 for fish and water samples, respectively. However, the sensitivity of the method by pelleting the sample was similar to those of non-pelleting the sample on Aeromonas isolation. Five species of Aeromonas spp., seven serovars of Salmonella sp., and four species of Listeria sp. were observed in catfish, tilapia and water samples. Overall, by pelleting the sample offered the beneficial to isolate Aeromonas spp., Salmonella sp. and Listeria spp. in catfish, tilapia and water.

  3. Diarrea del viajero asociada a Aeromonas hydrophila Traveller's diarrohea caused by Aeromonas hydrophila

    Directory of Open Access Journals (Sweden)

    M. L. Pita Toledo

    2001-06-01

    Full Text Available Aeromonas hydrophila es una bacteria que se encuentra frecuentemente en aguas dulces y salobres. Desde hace varios años se conoce que determinadas cepas de la especie pueden causar enfermedad en pescados y en anfibios, existiendo cierta controversia sobre su patogeneicidad en humanos. No obstante, puede dar lugar a infección en personas, que la adquieren bien a través de heridas abiertas o bien por ingestión de alimentos o agua contaminados. Sin embargo, en prácticamente la totalidad de las publicaciones se hace referencia a casos aislados más que a brotes producidos por esta bacteria. Generalmente la infección por A. hydrophila da lugar a gastroenteritis en personas sanas, pudiendo generar una septicemia en individuos inmunodeprimidos.En 1998 se produjo una alarma en el sector hotelero por un incremento considerable de los casos de gastroenteritis entre los turistas que acudían durante sus vacaciones a determinadas zonas costeras de la isla de Tenerife.Tras tener conocimiento de la situación, la Dirección General de Salud Pública inició una investigación epidemiológica con el objetivo de conocer la magnitud real del problema detectado e identificar los factores asociados a la misma, para poner en marcha las medidas correctoras y de control necesarias. El análisis inicial permitió determinar que se trataba de un proceso de gran magnitud en su extensión aunque de carácter leve, que afectaba únicamente a los turistas en una zona costera en concreto, compatible por lo tanto con la diarrea del viajero, planteándose un origen probablemente hídrico.Aeromonas hydrophila is a bacteria frequently found in fresh water and saline water. Certain strains of the species have been known to cause disease in fish and amphibians for several years, although some controversy exists about its ability to cause illness in humans. Nevertheless, either through open wounds or contaminated food or water, it can give rise to infection. However, almost

  4. Breeding of guinea-pig (Cavia porcellus, L. 1758) for meat production in Butembo, Democratic Republic of Congo : Literature review and breeding scheme

    OpenAIRE

    Sikiminywa, K.-L.; Godeau, Jean-Marie; Nyongombe, U.-F.; Hornick, Jean-Luc

    2013-01-01

    Providing animal proteins to humans requires choosing the animal species to be raised when access to land is limited. Butembo, is a refuge city of conflicts area in the east of Democratic Republic of Congo, where guinea-pig (Cavia porcellus) is considered as food. Therefore the breeding of this animal is an option to make more meat available. Genetic selection of guinea pigs and popularization of improved farming techniques can contribute to solve problems of food security in the region. The ...

  5. Microplastics as a vector for the transport of the bacterial fish pathogen species Aeromonas salmonicida.

    Science.gov (United States)

    Viršek, Manca Kovač; Lovšin, Marija Nika; Koren, Špela; Kržan, Andrej; Peterlin, Monika

    2017-12-15

    Microplastics is widespread in the marine environment where it can cause numerous negative effects. It can provide space for the growth of organisms and serves as a vector for the long distance transfer of marine microorganisms. In this study, we examined the sea surface concentrations of microplastics in the North Adriatic and characterized bacterial communities living on the microplastics. DNA from microplastics particles was isolated by three different methods, followed by PCR amplification of 16S rDNA, clone libraries preparation and phylogenetic analysis. 28 bacterial species were identified on the microplastics particles including Aeromonas spp. and hydrocarbon-degrading bacterial species. Based on the 16S rDNA sequences the pathogenic fish bacteria Aeromonas salmonicida was identified for the first time on microplastics. Because A. salmonicida is responsible for illnesses in fish, it is crucial to get answers if and how microplastics pollution is responsible for spreading of diseases. Copyright © 2017 Elsevier Ltd. All rights reserved.

  6. A foodborne outbreak of Aeromonas hydrophila in a college, Xingyi City, Guizhou, China, 2012.

    Science.gov (United States)

    Zhang, Qian; Shi, Guo-Qing; Tang, Guang-Peng; Zou, Zhi-Tin; Yao, Guang-Hai; Zeng, Guang

    2012-10-01

    On 12 May 2012, over 200 college students with acute diarrhoea were reported to the Guizhou Center for Disease Control and Prevention. We conducted an investigation to identify the agent and mode of transmission and to recommend control measures. A suspected case was a person at the college with onset of ≥ two of the following symptoms: diarrhoea (more than three loose stools in 24 hours), abdominal pain, vomiting or fever (> 37.5C) between 6 and 15 May 2012. A confirmed case also had a positive Aeromonas hydrophila culture from a stool sample. A retrospective-cohort study of 902 students compared attack rates (AR) by dining place, meals and food history. We reviewed the implicated premise, its processes and preparation of implicated food. We identified 349 suspected cases (AR = 14%) and isolated Aeromonas hydrophila from three stools of 15 cases. Students who ate in cafeteria A were more likely to be ill compared to those eating in other places (relative risk [RR]: 3.1, 95% confidence interval [CI]: 2.0-4.8). The cohort study implicated cold cucumber (RR: 2.6, 95% CI: 2.0-3.3) and houttuynia dishes (RR: 1.8, 95% CI: 1.4-2.3). Environmental investigation showed that vegetables were washed in polluted water from a tank close to the sewage ditch, then left at 30 °C for two hours before serving. The Escherichia coli count of the tank was well above the standard for drinking-water. This outbreak of Aeromonas hydrophila was most probably caused by salad ingredients washed in contaminated tank water. We recommended enhancing training of foodhandlers, ensuring tanks and sewerage systems comply with appropriate standards and adequate monitoring of drinking-water sources.

  7. A foodborne outbreak of Aeromonas hydrophila in a college, Xingyi City, Guizhou, China, 2012

    Directory of Open Access Journals (Sweden)

    Guang Zeng

    2012-12-01

    Full Text Available Background: On 12 May 2012, over 200 college students with acute diarrhoea were reported to the Guizhou Center for Disease Control and Prevention. We conducted an investigation to identify the agent and mode of transmission and to recommend control measures.Methods: A suspected case was a person at the college with onset of more than two of the following symptoms: diarrhoea (more than three loose stools in 24 hours, abdominal pain, vomiting or fever (> 37.5C between 6 and 15 May 2012. A confirmed case also had a positive Aeromonas hydrophila culture from a stool sample. A retrospective-cohort study of 902 students compared attack rates (AR by dining place, meals and food history. We reviewed the implicated premise, its processes and preparation of implicated food.Results: We identified 349 suspected cases (AR = 14% and isolated Aeromonas hydrophila from three stools of 15 cases. Students who ate in cafeteria A were more likely to be ill compared to those eating in other places (relative risk [RR]: 3.1, 95% confidence interval [CI]: 2.0–4.8. The cohort study implicated cold cucumber (RR: 2.6, 95% CI: 2.0–3.3 and houttuynia dishes (RR: 1.8, 95% CI: 1.4–2.3. Environmental investigation showed that vegetables were washed in polluted water from a tank close to the sewage ditch, then left at 30°C for two hours before serving. The Escherichia coli count of the tank was well above the standard for drinking water.Conclusion: This outbreak of Aeromonas hydrophila was most probably caused by salad ingredients washed in contaminated tank water. We recommended enhancing training of foodhandlers, ensuring tanks and sewerage systems comply with appropriate standards and adequate monitoring of drinking water sources.

  8. Identification of chitinolytic bacteria isolated from shrimp pond sediment and characterization of their chitinase encoding gene

    Science.gov (United States)

    Triwijayani, A. U.; Puspita, I. D.; Murwantoko; Ustadi

    2018-03-01

    Chitinolytic bacteria are a group of bacteria owning enzymes that able to hydrolyze chitin. Previously, we isolated chitinolytic bacteria from shrimp pond sediment in Bantul, Yogyakarta, and obtained five isolates showing high chitinolytic index named as isolate PT1, PT2, PT5, PT6 and PB2. The aims of this study were to identify chitinolytic bacteria isolated from shrimp pond sediment and to characterize the chitinase encoding gene from each isolate. The molecular technique was performed by amplification of 16S rDNA, amplification of chitinase encoding gene and sequence analysis. Two chitinolytic bacteria of PT1 and PT2 were similar to Aeromonas bivalvium strain D15, PT5 to Pseudomonas stutzeri strain BD-2.2.1, PT6 to Serratia marcescens strain FZSF02 and PB2 to Streptomyces misionensis strain OsiRt-1. The comparison of chitinase encoding gene between three isolates with those in Gen Bank shows that PT1 had similar sequences with the chi1 gene in Aeromonas sp. 17m, PT2 with chi1 gene in A. caviae (CB101) and PT6 with chiB gene in S. Marcescens (BJL200).

  9. Lactobacillus caviae sp. nov., an obligately heterofermentative bacterium isolated from the oral cavity of a guinea pig (Cavia aperea f. porcellus).

    Science.gov (United States)

    Killer, Jiri; Pechar, Radko; Švec, Pavel; Salmonová, Hana; Švejstil, Roman; Geigerová, Martina; Rada, Vojtěch; Vlková, Eva; Mekadim, Chahrazed

    2017-08-01

    A Gram-stain-positive, facultatively anaerobic, and catalase- and oxidase-negative bacterial strain designated MOZM2T, having 98.4 % 16S rRNA gene sequence identity with Lactobacillus reuteri DSM 20016T, was isolated from a swab of the oral cavity of a home-bred guinea pig. Comparative analyses based on the hsp60, pheS and tuf genes confirmed L. reuteri as its closest relative species, with calculated sequence similarities of 92.8, 88.8 and 96.9 %, respectively. DNA-DNA hybridisation revealed a 42 % degree of genetic similarity between the novel strain and L. reuteri DSM 20016T. Strain MOZM2T degrades carbohydrates via the 6-phosphogluconate/phosphoketolase pathway, evidenced by its production of gas from glucose and the end products of hexose catabolism. Comparative analysis of the cellular fatty acid profiles determined significant differences between MOZM2T and L. reuteri DSM 20016T in their proportions of C8 : 0, C14 : 1, C17 : 0, C18 : 2ω6t and C20 : 0 fatty acids. Results of genotypic analyses also demonstrated differences between these two strains. They also differed in DNA G+C content, and some biochemical and physiological characteristics. We therefore believe that the examined bacterial isolate should be considered as a new taxon within the group of obligately heterofermentative lactobacilli. The species name Lactobacillus caviae sp. nov. is proposed, of which the type strain is MOZM2T (=CCM 8609T=DSM 100239T=LMG 28780T).

  10. The effect of combined Moringa oleifera and demineralized freeze-dried bovine bone xenograft on the amount of osteoblast and osteoclast in the healing of tooth extraction socket of Cavia cobaya

    Directory of Open Access Journals (Sweden)

    Rostiny Rostiny

    2016-12-01

    Full Text Available Background: Alveolar bone has an important role in providing support to teeth and dentures. Loss of support caused by alveolar resorption will cause functional and aesthetic problems. Preservation socket using bone graft is one way to maintain the dimensions of the alveolar bone. Moringa oleifera leaf can increase the activity of bone graft in the formation of new bone. Purpose: This study was aimed to evaluate the effect of combined Moringa oleivera leaf extract and demineralized freeze-dried bovine bone xenograft (DFDBBX towards the formation of osteoblasts and osteoclasts in the tooth extraction sockets of cavia cobaya. Method: This study used 28 cavia cobayas divided into four groups. The combination of Moringa oleifera leaf extract and DFDBBX was inducted into the sockets of lower incisor tooth with certain dose in each group, ointment 1 containing PEG (a mixture of PEG 400 and PEG 4000 for control group, ointment 2 containing Moringa oleifera leaf extract and DFDBBX and PEG (at active subtance consentration of 0.5% for group 1, ointment 3 containing Moringa oleifera leaf extract and DFDBBX and PEG (at active substance concentration of 1% for group 2, and Ointment 4 containing Moringa oleifera leaf extract and DFDBBX and PEG (at active substance consentration of 2% for group 3. paraffin block preparations were made for histopathology examination using hematoxylin eosin staining. Result: The results showed that there were significant differences of the number of osteoblasts and osteoclasts in each treatment group (p <0.05. Conclusion: It can be concluded that the combination of Moringa oleifera leaf extract and DFDBBX at 2% cocentration can increase the number of osteoblasts and decrease osteoclasts in the healing of tooth extraction sockets of cavia cobaya.

  11. Necrotizing Fasciitis Caused by Inconspicuous Infection of Aeromonas hydrophila in an Immunocompromised Host

    Directory of Open Access Journals (Sweden)

    Kuo-Chun Liao

    2010-09-01

    Full Text Available We present a case of serious necrotizing fasciitis due to Aeromonas hydrophila without a suggestive history of routes of pathogen invasion in a 60-year-old male. Despite prompt broad-spectrum antibiotic and extensive surgical therapies, the patient died within 72 hours following initial presentation. Our experience suggests clinicians be highly alert to the disease when an immunocompromised patient featured fulminant soft-tissue infection in the endemic area.

  12. The genome of Aeromonas salmonicida subsp. salmonicida A449: insights into the evolution of a fish pathogen

    Directory of Open Access Journals (Sweden)

    Murphy Colleen

    2008-09-01

    Full Text Available Abstract Background Aeromonas salmonicida subsp. salmonicida is a Gram-negative bacterium that is the causative agent of furunculosis, a bacterial septicaemia of salmonid fish. While other species of Aeromonas are opportunistic pathogens or are found in commensal or symbiotic relationships with animal hosts, A. salmonicida subsp. salmonicida causes disease in healthy fish. The genome sequence of A. salmonicida was determined to provide a better understanding of the virulence factors used by this pathogen to infect fish. Results The nucleotide sequences of the A. salmonicida subsp. salmonicida A449 chromosome and two large plasmids are characterized. The chromosome is 4,702,402 bp and encodes 4388 genes, while the two large plasmids are 166,749 and 155,098 bp with 178 and 164 genes, respectively. Notable features are a large inversion in the chromosome and, in one of the large plasmids, the presence of a Tn21 composite transposon containing mercury resistance genes and an In2 integron encoding genes for resistance to streptomycin/spectinomycin, quaternary ammonia compounds, sulphonamides and chloramphenicol. A large number of genes encoding potential virulence factors were identified; however, many appear to be pseudogenes since they contain insertion sequences, frameshifts or in-frame stop codons. A total of 170 pseudogenes and 88 insertion sequences (of ten different types are found in the A. salmonicida genome. Comparison with the A. hydrophila ATCC 7966T genome reveals multiple large inversions in the chromosome as well as an approximately 9% difference in gene content indicating instances of single gene or operon loss or gain. A limited number of the pseudogenes found in A. salmonicida A449 were investigated in other Aeromonas strains and species. While nearly all the pseudogenes tested are present in A. salmonicida subsp. salmonicida strains, only about 25% were found in other A. salmonicida subspecies and none were detected in other

  13. Total protein electrophoresis and RAPD fingerprinting analysis for the identification of Aeromonas at the species level Análise eletroforética de proteínas totais e marcadores de RAPD na identificação de Aeromonas ao nível de espécie

    Directory of Open Access Journals (Sweden)

    Ana Paula Longaray Delamare

    2002-12-01

    Full Text Available Fifteen well-defined strains of Aeromonas of thirteen species were analyzed by SDS protein electrophoretic analysis (SDS-PAGE and random amplified polymorphic DNA analysis (RAPD. The comparison between the patterns obtained by both methods allowed differentiating all the strains. Clusters formed by the unweighted pair group method with arithmetic averages applied to protein data correlates with the genetic and biochemical information about the species. The results show that protein fingerprinting has the potential to differentiate Aeromonas species, but the low qualitative variation indicates that this technique is not efficient for the characterization of strains within a species. Conversely, RAPD fingerprinting allows the identification of strains but the high variability limits its potential as an aiding method for species identification.Quinze linhagens de Aeromonas pertencentes a treze espécies foram avaliadas através de eletroforese de proteínas totais (SDS-PAGE e segmentos de DNA amplificados ao acaso (RAPD. A comparação entre os padrões obtidos por ambos métodos permitiu diferenciar todas as linhagens. Agrupamentos formados com base nos dados protéicos mostraram relação com informações bioquímicas e genéticas a respeito das espécies. Os resultados mostraram que análises protéicas têm potencial para diferenciar espécies de Aeromonas, mas a baixa variação qualitativa indica que esta técnica não é eficiente para a caracterização entre linhagens dentro de espécies. Ao contrário, marcadores de RAPD permitem identificar linhagens, mas a alta variabilidade limita seu potencial como método auxiliar na identificação de espécies.

  14. Teste intradérmico com proteínas recombinantes de Mycobacterium bovis como antígenos em Cavia porcellus

    Directory of Open Access Journals (Sweden)

    Elaine S.P. Melo

    2014-10-01

    Full Text Available O teste intradérmico para o diagnóstico da tuberculose bovina utiliza derivados proteicos purificados (PPD de Mycobacterium bovis que são capazes de induzir reações de hipersensibilidade em animais infectados. No entanto, apresenta baixa especificidade devido à ocorrência de reações cruzadas com outras micobactérias. Neste sentido, o objetivo desse trabalho foi produzir proteínas recombinantes (ESAT-6, PE13, PE5 e ESX-1 de Mycobacterium bovis e avaliá-las como antígenos em teste intradérmico utilizando Cavia porcellus como modelo, e verificar se as condições empregadas na purificação (nativa ou desnaturante interferem no desempenho antigênico dessas proteínas. As proteínas foram testadas em Cavia porcellus previamente sensibilizados com cepa M. bovis AN5 inativada, individualmente (160 µg ou combinadas na forma de um coquetel (40 µg cada. O coquetel de proteínas induziu reações de hipersensibilidade nos animais sensibilizados significativamente superiores (p=0,002 as observadas nos animais não sensibilizados, possibilitando diferenciação. No entanto, as proteínas isoladamente não foram capazes de promover essa diferenciação. As condições de solubilização e purificação influenciaram o desempenho antigênico da proteína ESAT-6, pois, quando produzida em condição desnaturante desencadeou reações inespecíficas nos animais não sensibilizados, enquanto que aquela produzida em condições nativas e aplicada em concentrações de 6, 12, 24 e 48µg induziu reações significativas apenas nos animais sensibilizados, confirmando o seu potencial como antígeno.

  15. Comparative evaluation of infection methods and environmental factors on challenge success: Aeromonas salmonicida infection in vaccinated rainbow trout

    DEFF Research Database (Denmark)

    Chettri, Jiwan Kumar; Skov, Jakob; Jaafar, Rzgar M.

    2015-01-01

    When testing vaccine-induced protection an effective and reliable challenge method is a basic requirement and we here present a comparative study on different challenge methods used for infection of rainbow trout Oncorhynchus mykiss with Aeromonas salmonicida, a bacterial pathogen eliciting...

  16. Ractopamina y nivel de proteína de la dieta, respuesta productiva y características de la carcasa de cuyes (Cavia porcellus)

    OpenAIRE

    García Leandro, Madeline Victoria

    2017-01-01

    Universidad Nacional Agraria La Molina. Escuela de Posgrado. Maestría en Nutrición El objetivo del presente trabajo fue determinar el efecto del Clorhidrato de Ractopamina (RAC) y el nivel de proteína de la dieta sobre la respuesta productiva y características de la carcasa de cuyes (Cavia porcellus). Se emplearon 96 cuyes machos de 49 días de edad que se distribuyeron en 24 pozas. Cada poza fue una unidad experimental con cuatro cuyes. Se les administró seis dietas con dos niveles de RAC ...

  17. Draft genome sequence of Pseudomonas mosselii Gil3, isolated from catfish and antagonistic against hypervirulent Aeromonas hydrophila

    Science.gov (United States)

    Pseudomonas mosselii Gil3 was isolated from a catfish that survived from lethal challenge with hypervirulent Aeromonas hydrophila (vAh). When assayed in vitro, the bacterium showed antagonism against vAh. Sequence analysis revealed that the genome of P. mosselii Gil3 encodes numerous aromatic metabo...

  18. Molecular Phylogenetics and Temporal Diversification in the Genus Aeromonas Based on the Sequences of Five Housekeeping Genes

    Science.gov (United States)

    Lorén, J. Gaspar; Farfán, Maribel; Fusté, M. Carmen

    2014-01-01

    Several approaches have been developed to estimate both the relative and absolute rates of speciation and extinction within clades based on molecular phylogenetic reconstructions of evolutionary relationships, according to an underlying model of diversification. However, the macroevolutionary models established for eukaryotes have scarcely been used with prokaryotes. We have investigated the rate and pattern of cladogenesis in the genus Aeromonas (γ-Proteobacteria, Proteobacteria, Bacteria) using the sequences of five housekeeping genes and an uncorrelated relaxed-clock approach. To our knowledge, until now this analysis has never been applied to all the species described in a bacterial genus and thus opens up the possibility of establishing models of speciation from sequence data commonly used in phylogenetic studies of prokaryotes. Our results suggest that the genus Aeromonas began to diverge between 248 and 266 million years ago, exhibiting a constant divergence rate through the Phanerozoic, which could be described as a pure birth process. PMID:24586399

  19. Effet de Panicum maximum sur la productivité des femelles primipares durant le cycle de reproduction chez le cobaye (Cavia porcellus L.

    Directory of Open Access Journals (Sweden)

    Danho, M.

    2012-01-01

    Full Text Available Effect of Panicum maximum on Productivity of Primiparous Females during Reproduction Cycle in Guinea Pigs (Cavia porcellus L.. In Ivory Coast, Guinea pigs reared for meat (Cavia porcellus L. are mainly fed with Panicum maximum. To assess the effect of the latter during pregnancy and lactation (RC of these animals, primiparous dams were fed ad libitum, Panicum maximum alone during the RC (MOD1 or associated with pellets for rabbits during lactation (MOD2, or associated with pellets for rabbits during the last part of the pregnancy period and the lactation (MOD3, or associated with pellets for rabbits during the entire RC (MOD4. The number of corpora lutea per female was 1.3 ± 0.5 and 2.0 ± 0.0 respectively for MOD1 and MOD4. No pre-embryonic mortality was recorded. The mean weight of the young guinea pigs of MOD1 (54.7 ± 10. g was only 55% of that of MOD4 (98.6 ± 13.6 g. At weaning, the average weight gain of young guinea pigs of MOD1 (40.5 ± 22.2 g represented a third of those obtained with other diets that did not significantly differ. At the end of RC, the weight gain of dams was 17 ± 13.3% for MOD1 compared to 50% for MOD2, MOD3 and MOD4. Feeding Panicum maximum alone induces chronic malnutrition which in turn is responsible of the low ovulation rate and reduced growth in guinea pig breeding.

  20. Isolation and Identification of Aeromonas hydrophila and Saprolegnia sp. on Catfish (Clarias gariepinus) in Floating cages in Bozem Moro Krembangan Surabaya

    Science.gov (United States)

    Kusdarwati, Rahayu; Kismiyati; Sudarno; Kurniawan, Hendi; Teguh Prayogi, Yudha

    2017-02-01

    Catfish (Clarias gariepinus) is one of the familiar freshwater fish cultured in Indonesia farmer. One of the reason is the high mortality of the catfish infected by Aeromonas hydrophila and Saprolegnia sp. Motile Aeromonas septicemia (MAS) is a common bacterial disease, caused by Aeromonas hydrophila, which affects freshwater fish. In Southeast Asia, the outbreak of this disease was firstly reported from West Java in 1980, when a total of 82.5 tons a month of catfish were lost, while in Central Java in 1984, the total loss was 1.6 tons. Saprolegniosis can cause economic loss due to high mortality from its case reaching 10% to 50%. This research aimed to identify and determine the percentage of A. hydrophila and Saprolegnia sp. the catfish farmed in bozem Moro Krembangan, Surabaya, East Java. Meanwhile, a supporting parameter in this research is the value of water quality parameter including pH, temperature, ammonia and dissolved oxygen that were measured during sampling. The results showed that of the 20 samples taken from the two cages, 19 fish were positively infected by A. drophila. percentage of infections of A. hydrophila that infect umbo catfish in Moro Krembangan, was 95%, while the percentage Saprolegnia sp. was 90%.

  1. Molecular characterization and susceptibility to antimicrobial drugs of isolated bacterials from shrimps (“Litopenaeus vannamei” Caracterização molecular e susceptibilidade aos antimicrobianos de isolados bacterianos de camarões

    Directory of Open Access Journals (Sweden)

    Ricardo Castelo Branco Albinati

    2010-06-01

    Full Text Available The objective was to isolate bacteria from gut of shrimps from Litopenaeus vannamei, by biochemical characterization and molecular identification, inhibition activity in vitro of Bacillus cereus and sensitivity pattern determination. The bacterial species isolated were: Aeromonas caviae (n = 7, Alcaligenes denitrificans (n = 1, Bacillus cereus (n = 1 and Enterobacter spp. (n = 3. Bacillus cereus isolated in this study did not have inhibitory activity to other shrimps isolated bacteria evaluated. In the susceptibility to antimicrobial drug test, it were observed 68,7% to erythromycin, 50% to tetracycline, 81,2% to trimethoprim:sulfamethoxazole, neomycin and estreptomycin, 12,5% to lincomycin and ampicillin, 87,5% to enrofloxacin and nitrofurantoin, 93,7% to ceftriaxone, 100% to norfloxacin and nalidix acid. The characterization molecular is important on identifying the microrganisms studied. The nalidixic acid and norfloxacin are antimicrobial drugs with high sensitivity for bacteria isolated from shrimps.Objetivou-se isolar bactérias provenientes do trato intestinal de camarões da espécie Litopenaeus vannamei, por meio da caracterização bioquímica e molecular, atividade de inibição in vitro do Bacillus cereus e perfil de sensibilidade aos antimicrobianos. As espécies bacterianas identificadas foram Aeromonas caviae (n = 7, Alcaligenes denitrificans (n = 1, Bacillus cereus (n = 1 e Enterobacter spp. (n = 3. Bacillus cereus obtido neste estudo não apresentou atividade de inibição frente às demais bactérias isoladas de camarões. Quanto ao perfil de sensibilidade aos antimicrobianos, foram observados 68,7% de eritromicina, 50% de tetraciclina, 81,2% de sulfametoxazol/trimetoprina, neomicina e estreptomicina, 12,5% de lincomicina e ampicilina, 87,5% de enrofloxacina e nitrofurantoína, 93,7% de ceftriaxona, 100% de norfloxacina e ácido nalidíxico. A caracterização molecular é útil para identificação dos microrganismos estudados

  2. Characterization of fetal growth by repeated ultrasound measurements in the wild guinea pig (Cavia aperea).

    Science.gov (United States)

    Schumann, K; Guenther, A; Göritz, F; Jewgenow, K

    2014-08-01

    Fetal growth during pregnancy has previously been studied in the domesticated guinea pig (Cavia aperea f. porcellus) after dissecting pregnant females, but there are no studies describing the fetal growth in their wild progenitor, the wild guinea pig (C aperea). In this study, 50 pregnancies of wild guinea pig sows were investigated using modern ultrasound technique. The two most common fetal growth parameters (biparietal diameter [BPD] and crown-rump-length [CRL]) and uterine position were measured. Data revealed similar fetal growth patterns in the wild guinea pig and domesticated guinea pig in the investigated gestation period, although they differ in reproductive milestones such as gestation length (average duration of pregnancy 68 days), average birth weight, and litter mass. In this study, pregnancy lasted on average 60.2 days with a variance of less than a day (0.96 days). The measured fetal growth parameters are strongly correlated with each (R = 0.91; P guinea pig. Copyright © 2014 Elsevier Inc. All rights reserved.

  3. Susceptibilities to carbapenems and presence of cphA gene on food-borne Aeromonas

    Directory of Open Access Journals (Sweden)

    Bibiana María Martín Talavera

    2006-07-01

    Full Text Available The purpose of this study was to determine the susceptibilities of food-borne Aeromonas to carbapenems, as well as to investigate the presence of a metallo carbapenemase-encoding gene, named cphA. Minimum Inhibitory Concentration (MIC was determined following NCCLS standards. All the tested microorganisms were susceptible to imipenem, meropenem and biapenem. However, a strong inoculum size effect on carbapenem MICs was observed for most of the strains. Six strains, out of seven, showed the presence of metallo--beta-lactamases but cphA gene was detected in only two strains of A. veronii bv. sobria.O objetivo deste estudo foi determinar a suscetibilidade de aeromonas de origem alimentar a carbapenems bem como investigar a presença de um gene codificante de metalocarbapenemase, denominado "cph A". A suscetibilidade in vitro foi determinada pelo metodo de diluição em agar. Todas as cepas foram suscetíveis a Imipenem, Meropenem e Biapenem. Porém foi observado um forte efeito de tamanho do inóculo sobre as CIM das carbapenems na maioria das cepas. A detecção de metalo-beta-lactamase foi realizada pelo metodo lodometrico. Seis cepas das sete testadas demostraron a presença da enzima. A presença do gene cphA foi determinada por PCR e foi detectada em duas cepas de A veronii bv. sobria.

  4. Inventarisatie van Aeromonas spp. in het drinkwater van 21 pompstations in de periode september 1985-december 1986 (deel I)

    NARCIS (Netherlands)

    Versteegh JFM; During M; Havelaar AH

    1987-01-01

    In de periode september 1985-december 1986 is in samenwerking met een aantal drinkwaterbedrijven een inventariserend onderzoek uitgevoerd naar het voorkomen van Aeromonas-bacterien in verschillende typen drinkwater geproduceerd op 21 drinkwaterpompstations. Nadat in de loop van het onderzoek

  5. Inventarisatie van Aeromonas spp. in het drinkwater van 21 pompstations in de periode september 1985-december 1986 (deel II)

    NARCIS (Netherlands)

    Versteegh JFM; During M; Havelaar AH

    1987-01-01

    In de periode september 1985-december 1986 is in samenwerking met een aantal drinkwaterbedrijven een inventariserend onderzoek uitgevoerd naar het voorkomen van Aeromonas-bacterien in verschillende typen drinkwater geproduceerd op 21 drinkwaterpompstations. Nadat in de loop van het onderzoek

  6. Antibiotic and heavy metal resistance of Aeromonas hydrophila and Edwardsiella tarda isolated from red hybrid tilapia (Oreochromis spp. coinfected with motile aeromonas septicemia and edwardsiellosis

    Directory of Open Access Journals (Sweden)

    S. W. Lee

    2017-07-01

    Full Text Available Aim: The aim of this study is to identify antibiogram and heavy metal resistance pattern of Aeromonas hydrophila and Edwardsiella tarda isolated from red hybrid tilapia (Oreochromis spp. coinfected with motile aeromonas septicemia and edwardsiellosis in four commercial fish farms. Materials and Methods: A. hydrophila and E. tarda were isolated using glutamate starch phenol red and xylose lysine deoxycholate (Merck, Germany as a selective medium, respectively. All the suspected bacterial colonies were identified using conventional biochemical tests and commercial identification kit (BBL Crystal, USA. Susceptibility testing of present bacterial isolates to 16 types of antibiotics (nalidixic acid, oxolinic acid, compound sulfonamides, doxycycline, tetracycline, novobiocin, chloramphenicol, kanamycin, sulfamethoxazole, flumequine, erythromycin, ampicillin, spiramycin, oxytetracycline, amoxicillin, and fosfomycin and four types of heavy metals (mercury, chromium, copper, and zinc were carried out using disk diffusion and two-fold agar dilution method, respectively. Results: Three hundred isolates of A. hydrophila and E. tarda were successfully identified by biochemical tests. Antibiotic susceptibility testing results showed that 42.2% of the bacterial isolates were sensitive to compound sulfonamides, sulfamethoxazole, flumequine, oxytetracycline, doxycycline, and oxolinic acid. On the other hand, 41.6% of these isolates were resistant to novobiocin, ampicillin, spiramycin, and chloramphenicol, which resulted for multiple antibiotic resistance index values 0.416. Among tested heavy metals, bacterial isolates exhibited resistant pattern of Zn2+ > Cr6+ > Cu2+ > Hg2+. Conclusion: Results from this study indicated that A. hydrophila and E. tarda isolated from coinfected farmed red hybrid tilapia were multi-resistant to antibiotics and heavy metals. These resistant profiles could be useful information to fish farmers to avoid unnecessary use of

  7. Congenital malformations caused by Stryphnodendron fissuratum (Leg. Mimosoideae) in guinea pigs (Cavia porcellus).

    Science.gov (United States)

    Macedo, Josenaldo S; Rocha, Brena P; Colodel, Edson M; Freitas, Sílvio H; Dória, Renata G S; Riet-Correa, Franklin; Evêncio-Neto, Joaquim; Mendonça, Fábio S

    2015-11-01

    The aim of this study was to evaluate the toxicity of Stryphnodendron fissuratum pods in guinea pigs (Cavia porcellus) and test the hypothesis that this plant has teratogenic effects. Thus, sixteen guinea pigs were randomly divided into four groups of four animals each. Groups 10, 20 and 40 consisted of guinea pigs that received commercial food that contained crushed pods of S. fissuratum at concentrations of 10, 20 and 40 g/kg, respectively, during the period of organogenesis. Control group consisted of guinea pigs under the same management conditions that did not receive crushed pods of S. fissuratum in their food. In all experimental groups, the main clinical signs of poisoning consisted of anorexia, prostration, absence of vocalizations, alopecia, diarrhea, and abortions within the adult guinea pigs. Those that did not abort gave birth to weak, malnourished pups, some of which had fetal malformations. The main teratogenic changes consisted of eventration, arthrogryposis, amelia of the forelimbs, anophthalmia, microphthalmia, anotia and agnathia. The reductions in the number of offspring and the malformations observed in the experimental groups suggest that S. fissuratum affects fetal development and is teratogenic. Copyright © 2015 Elsevier Ltd. All rights reserved.

  8. OBLICZENIE PRZEPŁYWÓW MAKSYMALNYCH I ICH REDUKCJI W ZLEWNI ZURBANIZOWANEJ

    Directory of Open Access Journals (Sweden)

    Mariusz BARSZCZ

    2016-03-01

    Full Text Available W pracy przedstawiono wyniki zastosowania modelu SWMM do obliczenia przepływów o prawdopodobieństwach 50, 10, 2 i 1% w 8. przekrojach Potoku Służewieckiego na odcinku od km 0+000 do 6+576 oraz w 2. przekrojach Rowu Wolica. Zlewnia Potoku Służewieckiego jest zlokalizowana w południowej części Warszawy. Największe zagrożenie powodziowe występuje na odcinku Potoku Służewieckiego od km 0+000 do 3+875. Przepustowość koryta Potoku na tym odcinku kształtuje się na poziomie przepływu maksymalnego o prawdopodobieństwie 50%. Największe wartości przepływów w Potoku Służewieckim prognozowano w przekroju obliczeniowym numer V (km 4+267: Q50% = 13,863, Q10% = 23,019, Q2% = 28,825 i Q1% = 30,500 m3·s-1. Jedną z przyczyn występowania zagrożenia powodziowego w dolnym biegu Potoku Służewieckiego jest dopływ dużej ilości wód opadowych Rowem Wolica. Wartości przepływów w górnym odcinku Rowu Wolica (w przekroju VI zawierały się w granicach od 8,005 do 12,402 m3·s-1, w zależności od prawdopodobieństwa wystąpienia opadu obliczeniowego. W celu określenia możliwości redukcji przepływów w Rowie Wolica, przeprowadzono obliczenia w których uwzględniono zastosowanie kryzy na odcinku ujściowym kolektora do kanału otwartego. Zastosowanie kryzy w kolektorze pozwoli zredukować przepływy o prawdopodobieństwach 50, 10 i 2% odpowiednio o 61,0; 46,0 i 36,6%. Zastosowanie kryzy o stałej średnicy ϕ1,08 m, ustalonej dla przepływu o prawdopodobieństwie 2%, spowoduje znacznie mniejszą redukcję przepływów maksymalnych o prawdopodobieństwach 50 i 10%.

  9. Measurement of the $W^{+}W^{-} \\gamma$ Cross-section and First direct Limits on Anomalous Electroweak Quartic Gauge Couplings

    CERN Document Server

    Abbiendi, G.; Akesson, P.F.; Alexander, G.; Allison, John; Anderson, K.J.; Arcelli, S.; Asai, S.; Ashby, S.F.; Axen, D.; Azuelos, G.; Bailey, I.; Ball, A.H.; Barberio, E.; Barlow, Roger J.; Batley, J.R.; Baumann, S.; Behnke, T.; Bell, Kenneth Watson; Bella, G.; Bellerive, A.; Bentvelsen, S.; Bethke, S.; Betts, S.; Biebel, O.; Biguzzi, A.; Bloodworth, I.J.; Bock, P.; Bohme, J.; Boeriu, O.; Bonacorsi, D.; Boutemeur, M.; Braibant, S.; Bright-Thomas, P.; Brigliadori, L.; Brown, Robert M.; Burckhart, H.J.; Capiluppi, P.; Carnegie, R.K.; Carter, A.A.; Carter, J.R.; Chang, C.Y.; Charlton, David G.; Chrisman, D.; Ciocca, C.; Clarke, P.E.L.; Clay, E.; Cohen, I.; Conboy, J.E.; Cooke, O.C.; Couchman, J.; Couyoumtzelis, C.; Coxe, R.L.; Cuffiani, M.; Dado, S.; Dallavalle, G.Marco; Dallison, S.; Davis, R.; de Roeck, A.; Dervan, P.; Desch, K.; Dienes, B.; Dixit, M.S.; Donkers, M.; Dubbert, J.; Duchovni, E.; Duckeck, G.; Duerdoth, I.P.; Estabrooks, P.G.; Etzion, E.; Fabbri, F.; Fanfani, A.; Fanti, M.; Faust, A.A.; Feld, L.; Ferrari, P.; Fiedler, F.; Fierro, M.; Fleck, I.; Frey, A.; Furtjes, A.; Futyan, D.I.; Gagnon, P.; Gary, J.W.; Gaycken, G.; Geich-Gimbel, C.; Giacomelli, G.; Giacomelli, P.; Gingrich, D.M.; Glenzinski, D.; Goldberg, J.; Gorn, W.; Grandi, C.; Graham, K.; Gross, E.; Grunhaus, J.; Gruwe, M.; Hajdu, C.; Hanson, G.G.; Hansroul, M.; Hapke, M.; Harder, K.; Harel, A.; Hargrove, C.K.; Harin-Dirac, M.; Hauschild, M.; Hawkes, C.M.; Hawkings, R.; Hemingway, R.J.; Herten, G.; Heuer, R.D.; Hildreth, M.D.; Hill, J.C.; Hobson, P.R.; Hocker, James Andrew; Hoffman, Kara Dion; Homer, R.J.; Honma, A.K.; Horvath, D.; Hossain, K.R.; Howard, R.; Huntemeyer, P.; Igo-Kemenes, P.; Imrie, D.C.; Ishii, K.; Jacob, F.R.; Jawahery, A.; Jeremie, H.; Jimack, M.; Jones, C.R.; Jovanovic, P.; Junk, T.R.; Kanaya, N.; Kanzaki, J.; Karapetian, G.; Karlen, D.; Kartvelishvili, V.; Kawagoe, K.; Kawamoto, T.; Kayal, P.I.; Keeler, R.K.; Kellogg, R.G.; Kennedy, B.W.; Kim, D.H.; Klier, A.; Kobayashi, T.; Kobel, M.; Kokott, T.P.; Kolrep, M.; Komamiya, S.; Kowalewski, Robert V.; Kress, T.; Krieger, P.; von Krogh, J.; Kuhl, T.; Kupper, M.; Kyberd, P.; Lafferty, G.D.; Landsman, H.; Lanske, D.; Lauber, J.; Lawson, I.; Layter, J.G.; Lellouch, D.; Letts, J.; Levinson, L.; Liebisch, R.; Lillich, J.; List, B.; Littlewood, C.; Lloyd, A.W.; Lloyd, S.L.; Loebinger, F.K.; Long, G.D.; Losty, M.J.; Lu, J.; Ludwig, J.; Macchiolo, A.; Macpherson, A.; Mader, W.; Mannelli, M.; Marcellini, S.; Marchant, T.E.; Martin, A.J.; Martin, J.P.; Martinez, G.; Mashimo, T.; Mattig, Peter; McDonald, W.John; McKenna, J.; Mckigney, E.A.; McMahon, T.J.; McPherson, R.A.; Meijers, F.; Mendez-Lorenzo, P.; Merritt, F.S.; Mes, H.; Meyer, I.; Michelini, A.; Mihara, S.; Mikenberg, G.; Miller, D.J.; Mohr, W.; Montanari, A.; Mori, T.; Nagai, K.; Nakamura, I.; Neal, H.A.; Nisius, R.; O'Neale, S.W.; Oakham, F.G.; Odorici, F.; Ogren, H.O.; Okpara, A.; Oreglia, M.J.; Orito, S.; Pasztor, G.; Pater, J.R.; Patrick, G.N.; Patt, J.; Perez-Ochoa, R.; Petzold, S.; Pfeifenschneider, P.; Pilcher, J.E.; Pinfold, J.; Plane, David E.; Poli, B.; Polok, J.; Przybycien, M.; Quadt, A.; Rembser, C.; Rick, H.; Robins, S.A.; Rodning, N.; Roney, J.M.; Rosati, S.; Roscoe, K.; Rossi, A.M.; Rozen, Y.; Runge, K.; Runolfsson, O.; Rust, D.R.; Sachs, K.; Saeki, T.; Sahr, O.; Sang, W.M.; Sarkisian, E.K.G.; Sbarra, C.; Schaile, A.D.; Schaile, O.; Scharff-Hansen, P.; Schieck, J.; Schmitt, S.; Schoning, A.; Schroder, Matthias; Schumacher, M.; Schwick, C.; Scott, W.G.; Seuster, R.; Shears, T.G.; Shen, B.C.; Shepherd-Themistocleous, C.H.; Sherwood, P.; Siroli, G.P.; Skuja, A.; Smith, A.M.; Snow, G.A.; Sobie, R.; Soldner-Rembold, S.; Spagnolo, S.; Sproston, M.; Stahl, A.; Stephens, K.; Stoll, K.; Strom, David M.; Strohmer, R.; Surrow, B.; Talbot, S.D.; Taras, P.; Tarem, S.; Teuscher, R.; Thiergen, M.; Thomas, J.; Thomson, M.A.; Torrence, E.; Towers, S.; Trefzger, T.; Trigger, I.; Trocsanyi, Z.; Tsur, E.; Turner-Watson, M.F.; Ueda, I.; Van Kooten, Rick J.; Vannerem, P.; Verzocchi, M.; Voss, H.; Wackerle, F.; Waller, D.; Ward, C.P.; Ward, D.R.; Watkins, P.M.; Watson, A.T.; Watson, N.K.; Wells, P.S.; Wengler, T.; Wermes, N.; Wetterling, D.; White, J.S.; Wilson, G.W.; Wilson, J.A.; Wyatt, T.R.; Yamashita, S.; Zacek, V.; Zer-Zion, D.

    1999-01-01

    A study of W+W- events accompanied by hard photon radiation produced in e+e- collisions at LEP is presented. Events consistent with two on-shell W-bosons and an isolated photon are selected from 183pb^-1 of data recorded at root{s}=189GeV. From these data, 17 W+W-gamma candidates are selected with photon energy greater than 10GeV, consistent with the Standard Model expectation. These events are used to measure the e+e- to W+W-gamma cross-section within a set of geometric and kinematic cuts; sigma{W+W-gamma} = 136+-37+-8 fb, where the first error is statistical and the second systematic. The photon energy spectrum is used to set the first direct, albeit weak, limits on possible anomalous contributions to the {W+ W- gamma gamma} and {W+ W- gamma Z0} vertices: -0.070GeV^{-2} < a_0/Lambda^2 < 0.070GeV^{-2}, -0.13GeV^{-2} < a_c/Lambda^2 < 0.19GeV^{-2}, -0.61GeV^{-2} < a_n/Lambda^2 < 0.57GeV^{-2}, where Lambda represents the energy scale for new physics.

  10. Quorum sensing signals are produced by Aeromonas salmonicida and quorum sensing inhibitors can reduce production of a potential virulence factor

    DEFF Research Database (Denmark)

    Rasch, Maria; Kastbjerg, Vicky Gaedt; Bruhn, Jesper Bartholin

    2007-01-01

    Many pathogens control production of virulence factors by self-produced signals in a process called quorum sensing (QS). We demonstrate that acyl homoserine lactone (AHL) signals, which enable bacteria to express certain phenotypes in relation to cell density, are produced by a wide spectrum...... of Aeromonas salmonicida strains. All 31 typical strains were AHL producers as were 21 of 26 atypical strains, but on a strain population basis, production of virulence factors such as protease, lipase, A-layer or pigment did not correlate with the production and accumulation of AHLs in the growth medium...... of Aeromonas salmonicida. The most efficient compound N-(heptylsulfanylacetyl)-L-homoserine lactone (HepS-AHL), reduced protease production by a factor of 10. Five extracellular proteases were detected on gelatin-containing sodium dodecyl sulphate polyacrylamide gel electrophoresis (SDS-PAGE) gels and 3...

  11. Positive correlation between Aeromonas salmonicida vaccine antigen concentration and protection in vaccinated rainbow trout Oncorhynchus mykiss evaluated by a tail fin infection model

    DEFF Research Database (Denmark)

    Marana, M. H.; Skov, J.; Chettri, Jiwan Kumar

    2017-01-01

    Rainbow trout, Oncorhynchus mykiss (Walbaum), are able to raise a protective immune response against Aeromonas salmonicida subsp. salmonicida (AS) following injection vaccination with commercial vaccines containing formalin-killed bacteria, but the protection is often suboptimal under Danish...... mariculture conditions. We elucidated whether protection can be improved by increasing the concentration of antigen (formalin-killed bacteria) in the vaccine. Rainbow trout juveniles were vaccinated by intraperitoneal (i.p.) injection with a bacterin of Aeromonas salmonicida subsp. salmonicida strain 090710...... bacteria. The infection method proved to be efficient and could differentiate efficacies of different vaccines. It was shown that protection and antibody production in exposed fish were positively correlated to the AS antigen concentration in the vaccine....

  12. Combination of Aloe vera and xenograft induction on decreasing of NF-kb of tooth extraction socket preservation in Cavia cobaya

    Directory of Open Access Journals (Sweden)

    Utari Kresnoadi

    2014-03-01

    Full Text Available Background: Tooth extraction can naturally cause inflammation triggering osteoclast proliferation and alveolar bone resorption. Preservation of the tooth extraction sockets is needed for patients in order to reduce alveolar bone resorption risks. Aloe vera is known to have anthraquinones components, namely Aloin, Aloe emedin, and barbaloin, considered as anti-inflammation. Therefore, to overcome the inflammation, the role of NF-kb is very significant to decrease nuclear factor kappa b (NF-kb. As a result, inflammation risks will be decreased. Purpose: The study was aimed to determine the induction effect of combination of Aloe vera and XCB into tooth extraction sockets to reduce inflammation by reducing NF-kb expression, osteoclasts and osteoblasts. Methods: Forty-eight Cavia cobaya were divided into eight groups, each group consisted of six animals. The mandibular incisors of those Cavia cobaya were extracted and induced with either PEG, XCB, Aloe vera, or the combination of Aloe vera + XCB. Those animals were sacrificed on day 7 and day 30 after the extraction. Then immunohistochemical and histopathology examinations were conducted to observe NF-kb expression, osteoblasts and osteoclasts. Results: It was known that in group induced with the combination of Aloe vera and xenograft concelous bovine, the growth of osteoblasts was high, while NF-kb expression and osteoclasts reduced. Conclusion: It can be concluded that the induction of the combination of Aloe vera and XCB into the tooth extraction sockets can reduce NF-kb expression and osteoclast, as a result, alveolar bone resorption risks decrease, and osteoblast increase.Latar belakang: Trauma mekanis akibat pencabutan gigi asli menyebabkan keradangan. Keradangan memicu proliferasi osteoklas sehingga menyebabkan resorpsi tulang alveolararis. Pada pembuatan gigi tiruan, resorpsi tulang alveolar yang terjadi, sangat tidak diinginkan, sebab resorpsi tulang alveolar mengurangi keberhasilan

  13. A DNA biosensor for molecular diagnosis of Aeromonas hydrophila using zinc sulfide nanospheres

    Directory of Open Access Journals (Sweden)

    M. Negahdary

    2017-07-01

    Full Text Available Today, identification of pathogenic bacteria using modern and accurate methods is inevitable. Integration in electrochemical measurements with nanotechnology has led to the design of efficient and sensitive DNA biosensors against bacterial agents. Here, efforts were made to detect Aeromonas hydrophila using aptamers as probes and zinc sulfide (ZnS nanospheres as signal enhancers and electron transfer facilitators. After modification of the working electrode area (in a screen-printed electrode with ZnS nanospheres through electrodeposition, the coated surface of a modified electrode with ZnS nanospheres was investigated through scanning electron microscopy (SEM. The size of synthesized ZnS nanospheres was estimated at about 20–50 nm and their shape was in the form of porous plates in microscopic observations. All electrochemical measurements were performed using cyclic voltammetry (CV, electrochemical impedance spectroscopy (EIS, and constant potential amperometry (CPA techniques. The designed DNA biosensor was able to detect deoxyribonucleic acid (DNA of Aeromonas hydrophila in the range 1.0  ×  10−4 to 1.0  ×  10−9 mol L−1; the limit of detection (LOD in this study was 1  ×  10−13 mol L−1. This DNA biosensor showed satisfactory thermal and pH stability. Reproducibility for this DNA biosensor was measured and the relative standard deviation (RSD of the performance of this DNA biosensor was calculated as 5 % during 42 days.

  14. sugE: A gene involved in tributyltin (TBT) resistance of Aeromonas molluscorum Av27.

    Science.gov (United States)

    Cruz, Andreia; Micaelo, Nuno; Félix, Vitor; Song, Jun-Young; Kitamura, Shin-Ichi; Suzuki, Satoru; Mendo, Sónia

    2013-01-01

    The mechanism of bacterial resistance to tributyltin (TBT) is still unclear. The results herein presented contribute to clarify that mechanism in the TBT-resistant bacterium Aeromonas molluscorum Av27. We have identified and cloned a new gene that is involved in TBT resistance in this strain. The gene is highly homologous (84%) to the Aeromonas hydrophila-sugE gene belonging to the small multidrug resistance gene family (SMR), which includes genes involved in the transport of lipophilic drugs. In Av27, expression of the Av27-sugE was observed at the early logarithmic growth phase in the presence of a high TBT concentration (500 μM), thus suggesting the contribution of this gene for TBT resistance. E. coli cells transformed with Av27-sugE become resistant to ethidium bromide (EtBr), chloramphenicol (CP) and tetracycline (TE), besides TBT. According to the Moriguchi logP (miLogP) values, EtBr, CP and TE have similar properties and are substrates for the sugE-efflux system. Despite the different miLogP of TBT, E. coli cells transformed with Av27-sugE become resistant to this compound. So it seems that TBT is also a substrate for the SugE protein. The modelling studies performed also support this hypothesis. The data herein presented clearly indicate that sugE is involved in TBT resistance of this bacterium.

  15. Antibiotic resistence of Aeromonas hydrophila isolated from Piaractus mesopotamicus (Holmberg, 1887) and Oreochromis niloticus (Linnaeus, 1758)

    OpenAIRE

    Belém-Costa,Andréa; Cyrino,José Eurico Possebon

    2006-01-01

    One of the most important problems involving treatments with antibiotics against Aeromonas hydrophila isolated from fishes is that antibiotic resistance develops readily. The antimicrobial activity of chemotherapeutants in isolates from pacu Piaractus mesopotamicus (Holmberg, 1887) and tilapia Oreochromis niloticus (Linnaeus, 1758) was tested by the Kirby-Bauer disk method, over Mueller-Hinton surface agar previously inoculated with 100 µL of bacterial suspensions. After regular incubation, i...

  16. Temperature Preference in IAF Hairless and Hartley Guinea Pigs (Cavia porcellus).

    Science.gov (United States)

    Kleven, Gale A; Joshi, Prianca

    2016-03-01

    The Hairless strain of guinea pigs (Cavia porcellus) is the result of a spontaneous recessive mutation first identified at the Institute Armand Frappier (IAF) in 1978. Despite the longstanding availability of this strain, little is known about its thermoregulatory behavior. The aim of this study was to determine temperature preference in Hartley and Hairless guinea pigs by observing each strain in a ring-shaped apparatus containing a nonlinear temperature gradient. Temperatures were maintained by separately controlled heating mats lining the apparatus. Set point temperatures ranged from 24 to 38 °C. Guinea pigs (Hartley female, Hairless female, and Hairless male guinea pigs; n = 8 each group) were placed either singly or in pairs at 1 of the 8 randomized starting points within the apparatus. Subjects were observed for 30 min and coded for location within the temperature gradient by both frequency and duration. When placed singly in the apparatus, all 3 groups spent more time in the 30 °C zones. However, when placed as pairs with a cagemate, Hartley female guinea pigs spent more time in the cooler range of temperatures from 24 to 30 °C, whereas Hairless guinea pigs preferred a range of 30 to 38 °C. These results confirm a temperature preference of 30 ± 2 °C for both Hartley and Hairless guinea pigs when singly housed. However, data from the paired housing condition suggest that context plays an important role in thermoregulatory behavior.

  17. Prevalence and diversity of Aeromonas and Vibrio spp. in coastal waters of Southern Italy

    DEFF Research Database (Denmark)

    Dumontet, S.; Krovacek, K.; Svenson, S.B.

    2000-01-01

    % of samples were positive for Vibrio spp. It was interesting to note that 38% of the positive stations for both Aeromonas and Vibrio spp. showed a fecal coliform contamination of water at ... coliforms) do not always satisfactorily reflect the hygienic quality of water. The presence of Vibrionaceae on copepods was also investigated. Copepods were sampled at a station located inside the harbour of the city of Naples and were found contaminated by V. cholerae non-Ol, V. alginolyticus, V. fluvialis...

  18. DIFFERENTIATION OF AEROMONAS ISOLATES OBTAINED FROM DRINKING WATER DISTRIBUTION SYSTEM USING MATRIX-ASSISTED LASER DESCRIPTION/IONIZATION-MASS SPECTROMETRY (MALDI-MS)

    Science.gov (United States)

    The genus Aeromonas is one of several medically significant genera that have gained prominence due to their evolving taxonomy and controversial role in human diseases. In this study, matrix-assisted laser desorption/ionization-mass spectrometry (MALDI-MS) was used to analyze the...

  19. $W^{+}W^{-}$ production and triple gauge boson couplings at LEP energies up to 183 GeV

    CERN Document Server

    Abbiendi, G.; Alexander, G.; Allison, John; Altekamp, N.; Anderson, K.J.; Anderson, S.; Arcelli, S.; Asai, S.; Ashby, S.F.; Axen, D.; Azuelos, G.; Ball, A.H.; Barberio, E.; Barlow, Roger J.; Bartoldus, R.; Batley, J.R.; Baumann, S.; Bechtluft, J.; Behnke, T.; Bell, Kenneth Watson; Bella, G.; Bellerive, A.; Bentvelsen, S.; Bethke, S.; Betts, S.; Biebel, O.; Biguzzi, A.; Bird, S.D.; Blobel, V.; Bloodworth, I.J.; Bock, P.; Bohme, J.; Bonacorsi, D.; Boutemeur, M.; Braibant, S.; Bright-Thomas, P.; Brigliadori, L.; Brown, Robert M.; Burckhart, H.J.; Capiluppi, P.; Carnegie, R.K.; Carter, A.A.; Carter, J.R.; Chang, C.Y.; Charlton, David G.; Chrisman, D.; Ciocca, C.; Clarke, P.E.L.; Clay, E.; Cohen, I.; Conboy, J.E.; Cooke, O.C.; Couyoumtzelis, C.; Coxe, R.L.; Cuffiani, M.; Dado, S.; Dallavalle, G.Marco; Davis, R.; De Jong, S.; De Roeck, A.; Dervan, P.; Desch, K.; Dienes, B.; Dixit, M.S.; Dubbert, J.; Duchovni, E.; Duckeck, G.; Duerdoth, I.P.; Eatough, D.; Estabrooks, P.G.; Etzion, E.; Fabbri, F.; Fanti, M.; Faust, A.A.; Fiedler, F.; Fierro, M.; Fleck, I.; Folman, R.; Furtjes, A.; Futyan, D.I.; Gagnon, P.; Gary, J.W.; Gascon, J.; Gascon-Shotkin, S.M.; Gaycken, G.; Geich-Gimbel, C.; Giacomelli, G.; Giacomelli, P.; Gibson, V.; Gibson, W.R.; Gingrich, D.M.; Glenzinski, D.; Goldberg, J.; Gorn, W.; Grandi, C.; Graham, K.; Gross, E.; Grunhaus, J.; Gruwe, M.; Hanson, G.G.; Hansroul, M.; Hapke, M.; Harder, K.; Harel, A.; Hargrove, C.K.; Hartmann, C.; Hauschild, M.; Hawkes, C.M.; Hawkings, R.; Hemingway, R.J.; Herndon, M.; Herten, G.; Heuer, R.D.; Hildreth, M.D.; Hill, J.C.; Hobson, P.R.; Hoch, M.; Hocker, James Andrew; Hoffman, Kara Dion; Homer, R.J.; Honma, A.K.; Horvath, D.; Hossain, K.R.; Howard, R.; Huntemeyer, P.; Igo-Kemenes, P.; Imrie, D.C.; Ishii, K.; Jacob, F.R.; Jawahery, A.; Jeremie, H.; Jimack, M.; Jones, C.R.; Jovanovic, P.; Junk, T.R.; Karlen, D.; Kartvelishvili, V.; Kawagoe, K.; Kawamoto, T.; Kayal, P.I.; Keeler, R.K.; Kellogg, R.G.; Kennedy, B.W.; Kim, D.H.; Klier, A.; Kluth, S.; Kobayashi, T.; Kobel, M.; Koetke, D.S.; Kokott, T.P.; Kolrep, M.; Komamiya, S.; Kowalewski, Robert V.; Kress, T.; Krieger, P.; von Krogh, J.; Kuhl, T.; Kyberd, P.; Lafferty, G.D.; Landsman, H.; Lanske, D.; Lauber, J.; Lautenschlager, S.R.; Lawson, I.; Layter, J.G.; Lazic, D.; Lee, A.M.; Lellouch, D.; Letts, J.; Levinson, L.; Liebisch, R.; List, B.; Littlewood, C.; Lloyd, A.W.; Lloyd, S.L.; Loebinger, F.K.; Long, G.D.; Losty, M.J.; Ludwig, J.; Lui, D.; Macchiolo, A.; Macpherson, A.; Mader, W.; Mannelli, M.; Marcellini, S.; Markopoulos, C.; Martin, A.J.; Martin, J.P.; Martinez, G.; Mashimo, T.; Mattig, Peter; McDonald, W.John; McKenna, J.; Mckigney, E.A.; McMahon, T.J.; McPherson, R.A.; Meijers, F.; Menke, S.; Merritt, F.S.; Mes, H.; Meyer, J.; Michelini, A.; Mihara, S.; Mikenberg, G.; Miller, D.J.; Mir, R.; Mohr, W.; Montanari, A.; Mori, T.; Nagai, K.; Nakamura, I.; Neal, H.A.; Nellen, B.; Nisius, R.; O'Neale, S.W.; Oakham, F.G.; Odorici, F.; Ogren, H.O.; Oreglia, M.J.; Orito, S.; Palinkas, J.; Pasztor, G.; Pater, J.R.; Patrick, G.N.; Patt, J.; Perez-Ochoa, R.; Petzold, S.; Pfeifenschneider, P.; Pilcher, J.E.; Pinfold, J.; Plane, David E.; Poffenberger, P.; Polok, J.; Przybycien, M.; Rembser, C.; Rick, H.; Robertson, S.; Robins, S.A.; Rodning, N.; Roney, J.M.; Roscoe, K.; Rossi, A.M.; Rozen, Y.; Runge, K.; Runolfsson, O.; Rust, D.R.; Sachs, K.; Saeki, T.; Sahr, O.; Sang, W.M.; Sarkisian, E.K.G.; Sbarra, C.; Schaile, A.D.; Schaile, O.; Scharf, F.; Scharff-Hansen, P.; Schieck, J.; Schmitt, B.; Schmitt, S.; Schoning, A.; Schroder, Matthias; Schumacher, M.; Schwick, C.; Scott, W.G.; Seuster, R.; Shears, T.G.; Shen, B.C.; Shepherd-Themistocleous, C.H.; Sherwood, P.; Siroli, G.P.; Sittler, A.; Skuja, A.; Smith, A.M.; Snow, G.A.; Sobie, R.; Soldner-Rembold, S.; Spagnolo, S.; Sproston, M.; Stahl, A.; Stephens, K.; Steuerer, J.; Stoll, K.; Strom, David M.; Strohmer, R.; Surrow, B.; Talbot, S.D.; Tanaka, S.; Taras, P.; Tarem, S.; Teuscher, R.; Thiergen, M.; Thomas, J.; Thomson, M.A.; von Torne, E.; Torrence, E.; Towers, S.; Trigger, I.; Trocsanyi, Z.; Tsur, E.; Turcot, A.S.; Turner-Watson, M.F.; Ueda, I.; Vachon, B.; Van Kooten, Rick J.; Vannerem, P.; Verzocchi, M.; Voss, H.; Wackerle, F.; Wagner, A.; Ward, C.P.; Ward, D.R.; Watkins, P.M.; Watson, A.T.; Watson, N.K.; Wells, P.S.; Wermes, N.; White, J.S.; Wilson, G.W.; Wilson, J.A.; Wyatt, T.R.; Yamashita, S.; Yekutieli, G.; Zacek, V.; Zer-Zion, D.

    1999-01-01

    A study of W-pair production in e+e- annihilations at Lep2 is presented, based on 877 W+W- candidates corresponding to an integrated luminosity of 57 pb-1 at sqrt(s) = 183 GeV. Assuming that the angular distributions of the W-pair production and decay, as well as their branching fractions, are described by the Standard Model, the W-pair production cross-section is measured to be 15.43 +- 0.61 (stat.) +- 0.26 (syst.) pb. Assuming lepton universality and combining with our results from lower centre-of-mass energies, the W branching fraction to hadrons is determined to be 67.9 +- 1.2 (stat.) +- 0.5 (syst.)%. The number of W-pair candidates and the angular distributions for each final state (qqlnu,qqqq,lnulnu) are used to determine the triple gauge boson couplings. After combining these values with our results from lower centre-of-mass energies we obtain D(kappa_g)=0.11+0.52-0.37, D(g^z_1)=0.01+0.13-0.12 and lambda=-0.10+0.13-0.12, where the errors include both statistical and systematic uncertainties and each co...

  20. POTENSI TUMBUHAN BANGKAL (Nauclea Orientalis UNTUK PENGENDALIAN BAKTERI Aeromonas Hydrophila (POTENTIAL PLANT BANGKAL (Nauclea orientalis FOR CONTROL Aeromonas Hydrophila

    Directory of Open Access Journals (Sweden)

    Siti Aisiah

    2017-02-01

    Full Text Available Tujuan penelitian ini adalah didapatkan metode pengendalian penyakit yang disebabkan oleh bakteri Aeromonas hydrophila pada budi daya ikan yang ramah lingkungan. Dalam penelitian ini dilakukan uji sensitivitas terhadap bakteri A. hydrophila, uji minimal konsentrasi menghambat  bakteri A. hydrophila (uji MIC dan uji toksisitas terhadap ikan nila. Rancangan  yang digunakan untuk  uji toksisitas  adalah rancangan acak lengkap (RAL, dengan 4 perlakuan yaitu A  = Ikan disuntik dengan ekstrak bangkal konsentrasi 20%, B  = Ikan disuntik dengan ekstrak bangkal konsentrasi 40%,  C  = Ikan disuntik dengan ekstrak bangkal konsentrasi 80%, dan D  = Kontrol (ikan tidak disuntik, diulang sebanyak 3 kali. Perlakuan ini didapat dari hasil uji sensitivitas antibakteri bangkal yang mempunyai daya hambat dan daya bunuh paling besar terhadap bakteri A. hydrophila yaitu ekstrak daun bangkal dengan pelarut akuades. Pengujian MIC menunjukkan bahwa ekstrak bangkal-akuades memiliki daya hambat minimal  20 % terhadap aktivitas bakteri A. hydrophila. Hasil uji toksisitas yang dilakukan terhadap ikan nila dengan konsentrasi 20%, 40% dan 80%  mortalitas ikan nila dibawah 50 %. Pengamatan hematologis yaitu eretrosit, leokosit, plasma darah, hematokrit dan leokokrit pada masing-masing perlakuan sebagian besar masih berada dalam kisaran yang normal. Parameter kualitas air yaitu, kadar oksigen terlarut,  pH, amoniak, CO2 dan suhu masih dapat mendukung kehidupan normal ikan nila. The purpose of this study was obtained method of controlling diseases caused by Aeromonas hydrophila in fish farming is environmentally friendly. In this study the sensitivity of the test  A. hydrophila, a minimum test konsentari inhibiting A. hydrophila (MIC test and toxicity test on  tilapia. The design used for toxicity tests is completely randomized design with 4 treatments it A = Fish injected with extracts bangkal concentration of 20 %,  B = Fish injected with extracts bangkal

  1. Vibrio cholerae No O1 en muestras de aguas no cloradas consumidas por pobladores de las localidades de Santa y Coishco (Ancash, 2003 - 2004

    Directory of Open Access Journals (Sweden)

    Ana García P

    2006-07-01

    Full Text Available Objetivo: Identificar la presencia de Vibrio cholerae en muestras de agua no cloradas para consumo humano en las localidades de Santa y Coishco. Materiales y métodos: Entre julio de 2003 a junio de 2004 se tomaron muestras de agua, en forma semanal, provenientes de siete pozos con bomba manuable y de seis pozos con reservorio. A cada muestra de agua se le midió in situ el cloro residual mediante un comparador de cloro Hatch, método colorimétrico, usando para ello las pastillas DPD 1. En las muestras con cloro <0,05mg/L se realizó el cultivo según los manuales de procedimientos del Instituto Nacional de Salud (INS, Lima. Las cepas aisladas se enviaron al INS para confirmación diagnóstica y pruebas serológicas. Resultados: Se incluyeron 308 muestras de agua para consumo humano en ambos distritos (201 de pozos con bomba manuable y 107 con reservorio. Se realizó el aislamiento en 70(22,7% muestras: Aeromonas caviae 34(11,0%, Aeromonas hidrophyla 17(5,5% y Vibrio cholerae No O1 19(6,2%, no se encontró V. cholerae del serotipo O139. El Vibrio cholerae No O1 se aisló en 11(5,5% muestras de pozos con bomba manuable y en 8(7,4% pozos con reservorio, respectivamente. Conclusión: El agua de consumo humano proveniente de pozos tubulares representa un reservorio potencial para bacterias como Aeromonas y Vibrio cholerae, resaltando la necesidad de realizar la desinfección correspondiente de ésta antes de su consumo.

  2. Evaluating virulence of waterborne and clinical Aeromonas isolates using gene expression and mortality in neonatal mice followed by assessing cell culture’s ability to predict virulence based on transcriptional response

    Energy Technology Data Exchange (ETDEWEB)

    Hayes, S L; Rodgers, M R; Lye, D J; Stelma, G N; McKinstry, Craig A.; Malard, Joel M.; Vesper, Sephen J.

    2007-10-01

    Aims: To assess the virulence of Aeromonas spp. using two models, a neonatal mouse assay and a mouse intestinal cell culture. Methods and Results: After artificial infection with a variety of Aeromonas spp., mRNA extracts from the two models were processed and hydridized to murine microarrays to determine host gene response. Definition of virulence was determined based on host mRNA production in murine neonatal intestinal tissue and mortality of infected animals. Infections of mouse intestinal cell cultures were then performed to determine whether this simpler model system’s mRNA responses correlated to neonatal results and therefore be predictive of virulence of Aeromonas spp. Virulent aeromonads up-regulated transcripts in both models including multiple host defense gene products (chemokines, regulation of transcription and apoptosis and cell signalling). Avirulent species exhibited little or no host response in neonates. Mortality results correlated well with both bacterial dose and average fold change of up-regulated transcripts in the neonatal mice. Conclusions: Cell culture results were less discriminating but showed promise as potentially being able to be predictive of virulence. Jun oncogene up-regulation in murine cell culture is potentially predictive of Aeromonas virulence. Significance and Impact of the Study: Having the ability to determine virulence of waterborne pathogens quickly would potentially assist public health officials to rapidly assess exposure risks.

  3. Concentração inibitória mínima de oxitetraciclina para isolados de Aeromonas Hydrophila obtidos de diferentes fontes Minimal inhibitory concentration to oxitetracycline in Aeromonas Hydrophila strains isolated from different sources

    Directory of Open Access Journals (Sweden)

    Delton José Pereira Júnior

    2006-12-01

    Full Text Available Objetivou-se com este trabalho determinar a concentração inibitória mínima (MIC de oxitetraciclina para isolados de Aeromonas hydrophila obtidos de pescado, água de cultivo de peixes e casos de septicemia hemorrágica em peixes. Foi determinado MIC de 100 isolados de A. hydrophila, oriundos de 12 pisciculturas localizadas nos Estados de Minas Gerais, Rio de Janeiro e Rio Grande do Sul, utilizando a técnica de macrodiluição em caldo. Os resultados demonstraram que 14 isolados apresentaram MIC>100 µg/mL (resistentes e 86 apresentaram MICThe aim of this paper was to determine the minimal inhibitory concentration (MIC to oxitetracycline in Aeromonas hydrophila strains isolated from marketed fish, pond water of piscicultures and fish suffering hemorrhagic septicemia. These strains were obtained from 12 different piscicultures from Minas Gerais, Rio de Janeiro e Rio Grande do Sul states. It was determined the MIC to 100 strains, using the broth macrodilution method, and the results showed that 86 strains shown value of MIC100µg/mL (classified as resistant. No differences were observed among strains isolated from marketed fish, pond water and disease outbreaks. I was concluded that the variation detected may represent a risk of selection of resistant bacterial strains in aquatic environments under use of oxitetracycline.

  4. Decolorisation of Congo Red by Aeromonas hydrophila Under Microaerophilic Conditions

    International Nuclear Information System (INIS)

    El Gizawy, S.; Refae, R.A.; Abd El Kareem, H.; Gomaa, O.M.; Hamed, H.

    2009-01-01

    Among 22 local bacterial isolates, Aeromonas hydrophila isolated from Bolti fish showed a remarkable ability to decolorize congo red under microaerophilic conditions (98.8% in 48 hrs) without prior adaptation. The bacterium had the ability to grow and decolorized high concentrations of congo red which varied from 50 to 1000 mg/l , the decolorisation was irrelevant to bacterial growth. The strain was capable of decolorizing congo red under a wide range of temperatures (20-40 degree C), ph (3-8), NaCl (0-200 mg/l) and also had the ability to decolorized mono, di and poly azo dyes. This bacterium is notable in its ability to decolorized the diazo congo red under extreme conditions of temperature, ph, salinity and high dye concentrations which makes it suitable for decolorisation under extreme industrial conditions

  5. Expression, purification, crystallization and preliminary X-ray analysis of Aeromonas hydrophilia metallo-[beta]-lactamase

    Energy Technology Data Exchange (ETDEWEB)

    Sharma, N.; Toney, J.H.; Fitzgerald, P.M.D. (Merck)

    2010-07-20

    The CphA metallo-{beta}-lactamase from Aeromonas hydrophilia has been expressed, purified and crystallized by the hanging-drop vapor-diffusion method using ammonium sulfate as the precipitant. The crystals exhibit orthorhombic symmetry (P2{sub 1}2{sub 1}2), with unit-cell parameters a = 40.75, b = 42.05, c = 128.88 {angstrom}. There is one monomer in the asymmetric unit and the solvent content is estimated to be 44% by volume. A data set extending to 1.8 {angstrom} has been measured.

  6. Genome Sequence of the Melanin-Producing Extremophile Aeromonas salmonicida subsp. pectinolytica Strain 34melT

    OpenAIRE

    Pavan, María Elisa; Pavan, Esteban E.; López, Nancy Irene; Levin, Laura Noemí; Pettinari, María Julia

    2017-01-01

    The genome of Aeromonas salmonicida subsp. pectinolytica strain 34melT, isolated from a heavily polluted river, contains several genomic islands and putative virulence genes. The identification of genes involved in resistance to different kinds of stress sheds light on the mechanisms used by this strain to thrive in an extreme environment. Fil: Pavan, María Elisa. Universidad de Buenos Aires. Facultad de Ciencias Exactas y Naturales. Departamento de Química Biológica; Argentina Fil: Pav...

  7. Bacteremia due to Aeromonas hydrophila in Acute Lymphoblastic Leukemia

    International Nuclear Information System (INIS)

    Fatima, A.; Afridi, F.I.; Farooqi, B.J.; Qureshi, A.; Hussain, A.

    2013-01-01

    Aeromonas hydrophila (A. hydrophila) is a low virulent organism but may cause devastating fatal infections in immunocompromised host especially in liver cirrhosis. It is rarely reported to cause septicemia in a patient with Acute Lymphoblastic Leukemia (ALL). The mortality rate of septicemia due to A. hydrophila is 29% to 73%. We report a case of 59-year-old female patient who was a known case of ALL, presented with the complaints of fever, lethargy and generalized weakness for one month. After taking blood samples for investigations, empirical antimicrobial therapy was started. She did not improve after 48 hours of therapy. Meanwhile blood culture revealed pure growth of A. hydrophila. After sensitivity report was available, ciprofloxacin was started. Patient became afebrile after 48 hours of treatment with ciprofloxacin. It is very vital to correctly identified and treat bacteremia due to A. hydrophila especially in the underlying leukemic patient. (author)

  8. PEMBERIAN PROBIOTIK LACTOBACILLUS BREVIS DAN PREBIOTIK OLIGOSAKARIDA PADA BENIH PATIN SIAM (Pangasionodon hypophthalmus YANG DIINFEKSI Aeromonas hydrophila

    Directory of Open Access Journals (Sweden)

    Yuke Eliyani

    2013-08-01

    Lactobacillus brevis, prebiotik oligosakarida dan sinbiotiknya terhadap jumlah bakteri Lactobacillus sp. dan total bakteri dalam usus, total eritrosit, total leukosit, diferensial leukosit, aktivitas fagositik, sintasan, tingkat pertumbuhan, serta FCR benih ikan patin siam yang diinfeksi Aeromonas hydrophila. Hasil uji karakteristik menunjukkan bahwa jenis probiotik dan patogen adalah Lactobacillus sp. dan Aeromonas hydrophila. Pada uji in vivo digunakan lima perlakuan yang terdiri atas K(+, K(-, probiotik (pro, prebiotik (pre serta sinbiotik (sin. Bakteri Lactobacillus sp. ditemukan di usus pada perlakuan probiotik dan sinbiotik dengan kisaran jumlah sekitar 101 sampai 106 (CFU/g. Total eritrosit, total leukosit, aktivitas fagositik berbeda nyata (P<0,05 dengan kontrol pada beberapa waktu pengamatan. Tingkat sintasan terendah diperoleh pada perlakuan K(+ sebesar 43,33±11,55; sedangkan empat perlakuan lainnya memperoleh nilai 100%. Tingkat pertumbuhan harian berbeda nyata antar perlakuan, nilai terbaik dicapai pada perlakuan pemberian sinbiotik sebesar 3,370±0,14. Nilai FCR perlakuan probiotik, prebiotik dan sinbiotik menunjukkan beda nyata dengan kontrol. Perlakuan sin, pre, pro memberikan nilai yang lebih baik pada total eritrosit, total leukosit, aktivitas fagositik, sintasan, pertumbuhan, dan FCR dibandingkan kontrol.

  9. Development of highly sensitive electrochemical genosensor based on multiwalled carbon nanotubes-chitosan-bismuth and lead sulfide nanoparticles for the detection of pathogenic Aeromonas.

    Science.gov (United States)

    Fernandes, António Maximiano; Abdalhai, Mandour H; Ji, Jian; Xi, Bing-Wen; Xie, Jun; Sun, Jiadi; Noeline, Rasoamandrary; Lee, Byong H; Sun, Xiulan

    2015-01-15

    In this paper, we reported the construction of new high sensitive electrochemical genosensor based on multiwalled carbon nanotubes-chitosan-bismuth complex (MWCNT-Chi-Bi) and lead sulfide nanoparticles for the detection of pathogenic Aeromonas. Lead sulfide nanoparticles capped with 5'-(NH2) oligonucleotides thought amide bond was used as signalizing probe DNA (sz-DNA) and thiol-modified oligonucleotides sequence was used as fixing probe DNA (fDNA). The two probes hybridize with target Aeromonas DNA (tDNA) sequence (fDNA-tDNA-szDNA). The signal of hybridization is detected by differential pulse voltammetry (DPV) after electrodeposition of released lead nanoparticles (PbS) from sz-DNA on the surface of glass carbon electrode decorated with MWCNT-Chi-Bi, which improves the deposition and traducing electrical signal. The optimization of incubation time, hybridization temperature, deposition potential, deposition time and the specificity of the probes were investigated. Our results showed the highest sensibility to detect the target gene when compared with related biosensors and polymerase chain reaction (PCR). The detection limit for this biosensor was 1.0×10(-14) M. We could detect lower than 10(2) CFU mL(-1) of Aeromonas in spiked tap water. This method is rapid and sensitive for the detection of pathogenic bacteria and would become a potential application in biomedical diagnosis, food safety and environmental monitoring. Copyright © 2014 Elsevier B.V. All rights reserved.

  10. Transmissão do Trypanosoma cruzi em três gerações de Cavia porcellus sem a participação de triatomíneos

    Directory of Open Access Journals (Sweden)

    Ítalo A. Sherlock

    1976-02-01

    Full Text Available Foi verificada a transmissão sucessiva do T. cruzi em três gerações da cobaia Cavia porcellus sem a participação de triatomíneos. Embora não fosse determinado qual das vias, se placentária, leite, excreções ou contágio direto pelo qual o protozoário foi transmitido para os descendentes, chama-se atenção para a importância da manutenção de reservatórios da Doença de Chagas, mesmo na ausência de vetores invertebrados.

  11. Vaccination in Nile tilapia broodstock with whole cell vaccine and disease resistance in its fry against Aeromonas hydrophila

    Directory of Open Access Journals (Sweden)

    Sukenda Sukenda

    2017-07-01

    Full Text Available ABSTRACT The aim of this study was to analyze the effectivity of vaccination in Nile tilapia broodstock with whole cell vaccine and disease resistance in fry tilapia against Aeromonas hydrophila. Tilapia Nirwana strain that used for this had average body weight of 185±13.23 g and were maintained in ponds sizing of (2.5×2.5×1 m3. Vaccinations that has been done through intraperitoneal injection using dose of 0.1 mL/fish, meanwhile the fish for control was injected by phosphate buffered saline (PBS. This study used complete randomized design with two treatments and three replications. Antibody level was measured by using indirect enzyme-linked immunosorbent assay (ELISA method in the broodstock, egg, and fry.  Challenge test in fry tilapia performed at the age of 5, 10, and 15 days. The results showed that vaccination in tilapia broodstock delivered a significant antibody level in broodstock, eggs, and fry (P<0.05 compared to the control. Relative percent survival of offspring at 5, 10, and 15 days were 78.26%, 70.59%, and 65.52%, respectively.  As a conclusion, vaccination in tilapia broodstock was effective to improve specific and non-specific immunity, and protect fry tilapia from A. hydrophila infection through maternal immunity. Keywords: vaccination, antibody, maternal immunity, tilapia, Aeromonas hydrophila  ABSTRAK Penelitian ini bertujuan untuk menganalisis efikasi vaksinasi pada induk nila dengan vaksin sel utuh dan ketahanan benih yang dihasilkan terhadap Aeromonas hydrophila. Ikan nila stain Nirwana yang digunakan dalam penelitian memiliki bobot rata-rata 185±13,23 g dan ikan dipelihara dalam kolam (2,5×2,5×1 m3. vaksinasi dilakukan melalui penyuntikan intraperitoneal dengan dosis 0,1 mL/ikan, sementara itu ikan kontrol disuntik dengan phosphate buffered saline (PBS. Penelitian ini menggunakan rancangan acak lengkap dengan dua perlakuan dan tiga ulangan. Tingkat antibodi diukur dengan menggunakan metode indirect enzyme

  12. PEMBERIAN TOTAL FENOL TERIPANG PASIR (Holothuria scabra UNTUK MENINGKATKAN LEUKOSIT DAN DIFERENSIAL LEUKOSIT IKAN MAS (Cyprinus carpio YANG DIINFEKSI BAKTERI Aeromonas Hydrophila

    Directory of Open Access Journals (Sweden)

    Achmad Suhermanto

    2011-10-01

    Full Text Available Freshwater fishery commodities are most likely to be increased production of carp (Cyprinus carpio. Intensification of cultivation which raises new problems with fish disease outbreaks caused by Aeromonas hydrophila. Providing of immunostimulatory bioactive compounds of sea cucumbers (Holothuria scabra can enhance non-specific immune responses in the goldfish as a mechanism of defense against disease. The purpose of this study is to determine the role and optimal dose of total phenols sea cucumber in enhancing non-specific immune response seen from the hematology parameters Extraction of bioactive components from sea cucumber prepared by using methanol and fractionated with ethyl acetate solvent (v/v. Identification of total phenols in ethyl acetate fraction performed using UV-Vis spectrophotometer and infrared. Total phenol produced was tested on carp with intraperitonial injection, the concentration of 0.09, 0.18 and 0.27 mg phenol/kg fish. Challenge test was done by using the Aeromonas hydrophila (107 cells/ml through the immersion method. The observations included hematological parameters and total plasma proteins.The observations of hematological parameters that Leukocytes, Neutrophils pre-and post-infection were significantly increased. Lymphocyte pre infection was increased significantly and post-bacterial infection was decreased significantly. Eosinophils, Monocytes pre-and post-bacterial infection were not differ significantly between treatment. The use of phenolic compounds at 0.09 mg / kg can be increase of non-specific immune response in carp (Cyprinus carpio. Key Words : Total phenol, Aeromonas hydrophila, Cyprinus carpio, nonspecific immune response 

  13. 40 CFR 61.61 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) NATIONAL EMISSION STANDARDS FOR HAZARDOUS AIR POLLUTANTS National Emission Standard for Vinyl Chloride § 61.61... collected. (o) Ethylene dichloride purification includes any part of the process of ethylene dichloride...

  14. Prevalence of listeria, Aeromonas, and Vibrio species in fish used for human consumption in Turkey.

    Science.gov (United States)

    Yücel, Nihal; Balci, Senay

    2010-02-01

    A total of 78 raw retail fish samples from 30 freshwater and 48 marine fish were examined for the presence of Listeria, Aeromonas, and Vibrio species. The overall incidence of Listeria spp. was 30% in freshwater samples and 10.4% in marine fish samples. Listeria monocytogenes (44.5%) was the most commonly isolated species in freshwater fish, and Listeria murrayi (83.5%) was the most commonly isolated species in marine fish samples. Motile aeromonads were more common in marine fish samples (93.7%) than in freshwater fish samples (10%). Vibrio alginolyticus, Vibrio fluvialis, and Vibrio damsela were isolated only in marine fish samples, representing 40.9, 38.6, and 36.3% of Vibrio isolates, respectively. In freshwater and marine fish, the highest incidences of Listeria and Aeromonas were found in skin samples; the highest incidence of Vibrio in marine fish was found in gill samples. The location of Listeria spp. and L. monocytogenes in a fish was significantly different among freshwater fish. A high incidence of these bacterial pathogens was found in the brown trout (Salmo trutta) and horse mackerel (Trachurus trachurus). Handling of contaminated fish, cross-contamination, or eating raw fish might pose a health hazard, especially in immunosuppressed individuals, elderly people, and children. This study highlights the importance of bacterial pathogens in fish intended for human consumption, but more study is needed.

  15. Investigation Into the Humaneness of Slaughter Methods for Guinea Pigs (Cavia porcelus) in the Andean Region.

    Science.gov (United States)

    Limon, Georgina; Gonzales-Gustavson, Eloy A; Gibson, Troy J

    2016-01-01

    Guinea pigs (Cavia porcelus) are an important source of nonhuman animal protein in the Andean region of South America. Specific guidelines regarding the welfare of guinea pigs before and during slaughter have yet to be developed. This study critically assessed the humaneness of 4 different stunning/slaughter methods for guinea pigs: cervical neck dislocation (n = 60), electrical head-only stunning (n = 83), carbon dioxide (CO2) stunning (n = 21), and penetrating captive bolt (n = 10). Following cervical neck dislocation, 97% of guinea pigs had at least 1 behavioral or cranial/spinal response. Six percent of guinea pigs were classified as mis-stunned after electrical stunning, and 1% were classified as mis-stunned after captive bolt. Increased respiratory effort was observed during CO2 stunning. Apart from this finding, there were no other obvious behavioral responses that could be associated with suffering. Of the methods assessed, captive bolt was deemed the most humane, effective, and practical method of stunning guinea pigs. Cervical neck dislocation should not be recommended as a slaughter method for guinea pigs.

  16. Pancarditis in a patient with tropical pyomyositis due to Aeromonas infection

    Directory of Open Access Journals (Sweden)

    Nikhil Gupta

    2015-01-01

    Full Text Available Tropical pyomyositis is a suppurative disease of the skeletal muscles. The most common site of the infection being muscles of the thigh. Staphylococcus aureus is the most common organism isolated. Aeromonas is one of the rarest organisms described as the etiologic agent for this disease. Rarely, cardiac involvement in pyomyositis has been described in the form of myocarditis and pyopericardium. Pancarditis is a very rare event in the natural course of pyomyositis. To the best of our knowledge, there is a single case report in world literature regarding involvement of all the layers of the heart in pyomyositis. We report a case of a 30-year-old immunocompetent male who had pyomyositis and developed pancarditis, which was managed successfully with conservative management.

  17. Lactobacillus plantarum (VR1 isolated from an Ayurvedic medicine (Kutajarista ameliorates in vitro cellular damage caused by Aeromonas veronii

    Directory of Open Access Journals (Sweden)

    Patole Milind S

    2011-06-01

    Full Text Available Abstract Background Lactobacillus plantarum is considered as a safe and effective probiotic microorganism. Among various sources of isolation, traditionally fermented foods are considered to be rich in Lactobacillus spp., which can be exploited for their probiotic attribute. Antibacterial property of L. plantarum has been demonstrated against various enteric pathogens in both in vitro and in vivo systems. This study was aimed at characterizing L. plantarum isolated from Kutajarista, an ayurvedic fermented biomedicine, and assessing its antagonistic property against a common enteropathogen Aeromonas veronii. Results We report the isolation of L. plantarum (VR1 from Kutajarista, and efficacy of its cell free supernatant (CFS in amelioration of cytotoxicity caused by Aeromonas veronii. On the part of probiotic attributes, VR1 was tolerant to pH 2, 0.3% bile salts and simulated gastric juice. Additionally, VR1 also exhibited adhesive property to human intestinal HT-29 cell line. Furthermore, CFS of VR1 was antibacterial to enteric pathogens like Pseudomonas aeruginosa, Staphylococcus aureus, Escherichia coli, Aeromonas veronii and clinical isolates of P. aeruginosa and E. coli. Detailed study regarding the effect of VR1 CFS on A. veronii cytotoxicity showed a significant decrease in vacuole formation and detrimental cellular changes in Vero cells. On the other hand, A. veronii CFS caused disruption of tight junction proteins ZO-1 and actin in MDCK cell line, which was prevented by pre-incubation with CFS of VR1. Conclusions This is the first study to report isolation of L. plantarum (VR1 from Kutajarista and characterisation for its probiotic attributes. Our study demonstrates the antagonistic property of VR1 to A. veronii and effect of VR1 CFS in reduction of cellular damage caused by A. veronii in both Vero and MDCK cell lines.

  18. Hematologia e sinais clínicos de Piaractus mesopotamicus infectados experimentalmente com Aeromonas hydrophila = Hematology and clinical signs of Piaractus mesopotamicus experimentally infected with Aeromonas hydrophila

    Directory of Open Access Journals (Sweden)

    Flávio Ruas Moraes

    2009-01-01

    Full Text Available Este ensaio teve como objetivo avaliar as respostas hematológicas e a ocorrência de sinais clínico-patológicos de Piaractus mesopotamicus infectados experimentalmente por Aeromonas hydrophila. Foram utilizados 324 pacus, P. mesopotamicus, com peso de 102,84 ±27,1 g, distribuídos em 27 caixas de 300 L de capacidade, sendo 14 peixes por caixa. Os peixes foram mantidos nas caixas durante um mês, recebendo dieta balanceada, período em que se evitou qualquer tipo de manejo estressante. Passado esse período, foram infectadoscom 6 x 106 UFC de A. hydrophila, injetada via intraperitoneal. As coletas e análises de sangue foram realizadas 24h antes da infecção experimental e 24h após a infecção. Os resultados permitem concluir que a infecção por A. hydrophila em P. mesopotamicus écaracterizada por escurecimento da derme e sinais clínicos-patológicos relacionados à hemorragia, anemia normocítica-hipocrômica, redução nos níveis de proteínas, globulinasplasmáticas e eosinófilos, leucopenia, linfopenia, trombocitopenia, neutrofilia e monocitose. The purpose of this study was to evaluate the hematological response and clinical sign of Piaractus mesopotamicus infected byAeromonas hydrophila. Were used 324 pacus, P. mesopotamicus weighing 102.84 ± 27.1 g distributed in 27 water tanks with 300 L of capacity, 14 fish per tank. The fish were kept in the water tanks during one month, receiving appropriate diet. In this period was avoidedstressing management. After this period, the fish were infected with 6 × 108 cfu of A. hydrophila fish-1, injected intraperitoneally. The blood collection was carried 24h before experimental infection and 24h after its. The A. hydrophila infection in P. mesopotamicus ischaracterized by dark skin and clinical signs related to hemorrhage, hypochromic normocytic anemia, decrease on plasmatic proteins and globulins levels, leucopenia, lymphopenia, thrombocytopenia, eosinophilia, neutrophilia and monocytosis.

  19. Application of a continuously stirred tank bioreactor (CSTR) for bioremediation of hydrocarbon-rich industrial wastewater effluents

    International Nuclear Information System (INIS)

    Gargouri, Boutheina; Karray, Fatma; Mhiri, Najla; Aloui, Fathi; Sayadi, Sami

    2011-01-01

    A continuously stirred tank bioreactor (CSTR) was used to optimize feasible and reliable bioprocess system in order to treat hydrocarbon-rich industrial wastewaters. A successful bioremediation was developed by an efficient acclimatized microbial consortium. After an experimental period of 225 days, the process was shown to be highly efficient in decontaminating the wastewater. The performance of the bioaugmented reactor was demonstrated by the reduction of COD rates up to 95%. The residual total petroleum hydrocarbon (TPH) decreased from 320 mg TPH l -1 to 8 mg TPH l -1 . Analysis using gas chromatography-mass spectrometry (GC-MS) identified 26 hydrocarbons. The use of the mixed cultures demonstrated high degradation performance for hydrocarbons range n-alkanes (C10-C35). Six microbial isolates from the CSTR were characterized and species identification was confirmed by sequencing the 16S rRNA genes. The partial 16S rRNA gene sequences demonstrated that 5 strains were closely related to Aeromonas punctata (Aeromonas caviae), Bacillus cereus, Ochrobactrum intermedium, Stenotrophomonas maltophilia and Rhodococcus sp. The 6th isolate was affiliated to genera Achromobacter. Besides, the treated wastewater could be considered as non toxic according to the phytotoxicity test since the germination index of Lepidium sativum ranged between 57 and 95%. The treatment provided satisfactory results and presents a feasible technology for the treatment of hydrocarbon-rich wastewater from petrochemical industries and petroleum refineries.

  20. Application of a continuously stirred tank bioreactor (CSTR) for bioremediation of hydrocarbon-rich industrial wastewater effluents

    Energy Technology Data Exchange (ETDEWEB)

    Gargouri, Boutheina; Karray, Fatma; Mhiri, Najla; Aloui, Fathi [Laboratoire des Bioprocedes Environnementaux, Pole d' Excellence Regional AUF-LBPE, Centre de Biotechnologie de Sfax, Universite de Sfax, BP 1117, 3018 Sfax (Tunisia); Sayadi, Sami, E-mail: sami.sayadi@cbs.rnrt.tn [Laboratoire des Bioprocedes Environnementaux, Pole d' Excellence Regional AUF-LBPE, Centre de Biotechnologie de Sfax, Universite de Sfax, BP 1117, 3018 Sfax (Tunisia)

    2011-05-15

    A continuously stirred tank bioreactor (CSTR) was used to optimize feasible and reliable bioprocess system in order to treat hydrocarbon-rich industrial wastewaters. A successful bioremediation was developed by an efficient acclimatized microbial consortium. After an experimental period of 225 days, the process was shown to be highly efficient in decontaminating the wastewater. The performance of the bioaugmented reactor was demonstrated by the reduction of COD rates up to 95%. The residual total petroleum hydrocarbon (TPH) decreased from 320 mg TPH l{sup -1} to 8 mg TPH l{sup -1}. Analysis using gas chromatography-mass spectrometry (GC-MS) identified 26 hydrocarbons. The use of the mixed cultures demonstrated high degradation performance for hydrocarbons range n-alkanes (C10-C35). Six microbial isolates from the CSTR were characterized and species identification was confirmed by sequencing the 16S rRNA genes. The partial 16S rRNA gene sequences demonstrated that 5 strains were closely related to Aeromonas punctata (Aeromonas caviae), Bacillus cereus, Ochrobactrum intermedium, Stenotrophomonas maltophilia and Rhodococcus sp. The 6th isolate was affiliated to genera Achromobacter. Besides, the treated wastewater could be considered as non toxic according to the phytotoxicity test since the germination index of Lepidium sativum ranged between 57 and 95%. The treatment provided satisfactory results and presents a feasible technology for the treatment of hydrocarbon-rich wastewater from petrochemical industries and petroleum refineries.

  1. Cryptosporidium homai n. sp. (Apicomplexa: Cryptosporidiiae) from the guinea pig (Cavia porcellus).

    Science.gov (United States)

    Zahedi, Alireza; Durmic, Zoey; Gofton, Alexander W; Kueh, Susan; Austen, Jill; Lawson, Malcolm; Callahan, Lauren; Jardine, John; Ryan, Una

    2017-10-15

    The morphological, biological, and molecular characterisation of a new Cryptosporidium species from the guinea pig (Cavia porcellus) are described, and the species name Cryptosporidium homai n. sp. is proposed. Histological analysis conducted on a post-mortem sample from a guinea pig euthanised due to respiratory distress, identified developmental stages of C. homai n. sp. (trophozoites and meronts) along the intestinal epithelium. Molecular analysis at 18S rRNA (18S), actin and hsp70 loci was then conducted on faeces from an additional 7 guinea pigs positive for C. homai n. sp. At the 18S, actin and hsp70 loci, C. homai n. sp. exhibited genetic distances ranging from 3.1% to 14.3%, 14.4% to 24.5%, and 6.6% to 20.9% from other Cryptosporidium spp., respectively. At the 18S locus, C. homai n. sp. shared 99.1% similarity with a previously described Cryptosporidium genotype in guinea pigs from Brazil and it is likely that they are the same species, however this cannot be confirmed as actin and hsp70 sequences from the Brazilian guinea pig genotype are not available. Phylogenetic analysis of concatenated 18S, actin and hsp70 sequences showed that C. homai n. sp. exhibited 9.1% to 17.3% genetic distance from all other Cryptosporidium spp. This clearly supports the validity of C. homai n. sp. as a separate species. Copyright © 2017 Elsevier B.V. All rights reserved.

  2. Effectiveness of ambon banana stem juice as immunostimulatory against Aeromonas hydrophila infections in catfish Clarias gariepinus

    OpenAIRE

    Qorie Astria; Sri Nuryati; Kukuh Nirmala; Alimuddin Alimuddin

    2017-01-01

    ABSTRACT Outbreaks of infectious diseases due to Aeromonas hydrophila in catfish can cause high death rates (80–100%). Fish disease control can be done using phytopharmaceutical to prevent or treat diseases of fish. One of the phytopharmaceutical that known to prevent the fish diseases is ambon banana stem Musa cavendishii var. dwarf Paxton. This study was conducted to test the effectiveness of catfish immersion using banana stem juice as an immunostimulant against bacterial infections A. hyd...

  3. Streptococcus caviae sp. nov., isolated from guinea pig faecal samples.

    Science.gov (United States)

    Palakawong Na Ayudthaya, Susakul; Hilderink, Loes J; Oost, John van der; Vos, Willem M de; Plugge, Caroline M

    2017-05-01

    A novel cellobiose-degrading and lactate-producing bacterium, strain Cavy grass 6T, was isolated from faecal samples of guinea pigs (Cavia porcellus). Cells of the strain were ovalshaped, non-motile, non-spore-forming, Gram-stain-positive and facultatively anaerobic. The strain gr at 25-40 °C (optimum 37 °C) and pH 4.5-9.5 (optimum 8.0). Phylogenetic analysis based on 16S rRNA gene sequences showed that strain Cavy grass 6T belongs to the genus Streptococcus with its closest relative being Streptococcus devriesei CCUG 47155T with only 96.5 % similarity. Comparing strain Cavy grass 6T and Streptococcus devriesei CCUG 47155T, average nucleotide identity and level of digital DNA-DNA hybridization dDDH were only 86.9 and 33.3 %, respectively. Housekeeping genes groEL and gyrA were different between strain Cavy grass 6T and other streptococci. The G+C content of strain Cavy grass 6T was 42.6±0.3 mol%. The major (>10 %) cellular fatty acids of strain Cavy grass 6T were C16:0, C20 : 1ω9c and summed feature 8 (C18 : 1ω7c and/or C18 : 1ω6c). Strain Cavy grass 6T ferment a range of plant mono- and disaccharides as well as polymeric carbohydrates, including cellobiose, dulcitol, d-glucose, maltose, raffinose, sucrose, l-sorbose, trehalose, inulin and dried grass extract, to lactate, formate, acetate and ethanol. Based on phylogenetic and physiological characteristics, Cavy grass 6T can be distinguished from other members of the genus Streptococcus. Therefore, a novel species of the genus Streptococcus, family Streptococcaceae, order Lactobacillales is proposed, Streptococcuscaviae sp. nov. (type strain Cavy grass 6T=TISTR 2371T=DSM 102819T).

  4. White Mulberry (Morus alba Foliage Methanolic Extract Can Alleviate Aeromonas hydrophila Infection in African Catfish (Clarias gariepinus

    Directory of Open Access Journals (Sweden)

    Atefeh Sheikhlar

    2014-01-01

    Full Text Available Two experiments were simultaneously conducted with Morus alba (white mulberry foliage extract (MFE as a growth promoter and treatment of Aeromonas hydrophila infection in separate 60 and 30 days trail (Experiments 1 and 2, resp. in African catfish (Clarias gariepinus. In Experiment 1, four diets, control and control supplemented with 2, 5, or 7 g MFE/kg dry matter (DM of diet, were used. In Experiment 2, fish were intraperitoneally infected with Aeromonas hydrophila and fed the same diets as experiment 1 plus additional two diets with or without antibiotic. Results of experiment 1 showed that growth was unaffected by dietary levels of MFE. Treatments with the inclusion of MFE at the levels of 5 and 7 g/Kg DM had no mortality. Red blood cells (RBC, albumin, and total protein were all higher for the treatments fed MFE (5 and 7 g/Kg DM. Results of experiment 2 showed RBC, hemoglobin, hematocrit, globulin, albumin, and total protein improved with the increase in MFE in the infected fish. The dietary MFE at the level of 7 g/kg DM reduced mortality rate. In conclusion, MFE at the level of 7 g/kg DM could be a valuable dietary supplement to cure the infected fish.

  5. First isolation of Aeromonas salmonicida subspecies salmonicida from diseased sea bass, Dicentrarchus labrax (L., cultured in Spain

    Directory of Open Access Journals (Sweden)

    Clara Fernández-Álvarez

    2016-11-01

    Full Text Available This work represents the first description of Aeromonas salmonicida subsp. salmonicida as causative agent of furunculosis in cultured sea bass, Dicentrarchus labrax (L.. Cumulative mortality in affected fish from two floating cages in the Mediterranean coast of Spain was 3.8%. Affected sea bass did not show the typical external signs of furunculosis in the first stages of the disease, however, when the disease progressed, open ulcers appeared on the skin and muscle. Internally, splenomegaly was the only pathological sign observed. Samples from diseased fish were subjected to standardized assays for pathogens screening. Negative results were obtained for parasites and fish viruses. A Gram-stain-negative rod-shaped bacterium was observed in smears from liver, kidney and spleen of all analysed fish. Pure bacterial cultures were recovered from liver, kidney and spleen of all diseased fish sampled during the two different outbreaks. Bacteriological, serological, molecular and chemotaxonomic analysis allowed the identification of the causative agent of sea bass mortalities as Aeromonas salmonicida subsp. salmonicida. The bacterial strains were susceptible to most of antimicrobial agents usually employed in aquaculture except to oxytetracycline. Pathogenicity assays demonstrated that the isolated bacteria were virulent for sea bass, turbot and rainbow trout.

  6. White Mulberry (Morus alba) Foliage Methanolic Extract Can Alleviate Aeromonas hydrophila Infection in African Catfish (Clarias gariepinus)

    Science.gov (United States)

    Sheikhlar, Atefeh; Alimon, Abd Razk; Daud, Hassan; Saad, Chee R.; Webster, Carl D.; Meng, Goh Yong

    2014-01-01

    Two experiments were simultaneously conducted with Morus alba (white mulberry) foliage extract (MFE) as a growth promoter and treatment of Aeromonas hydrophila infection in separate 60 and 30 days trail (Experiments 1 and 2, resp.) in African catfish (Clarias gariepinus). In Experiment 1, four diets, control and control supplemented with 2, 5, or 7 g MFE/kg dry matter (DM) of diet, were used. In Experiment 2, fish were intraperitoneally infected with Aeromonas hydrophila and fed the same diets as experiment 1 plus additional two diets with or without antibiotic. Results of experiment 1 showed that growth was unaffected by dietary levels of MFE. Treatments with the inclusion of MFE at the levels of 5 and 7 g/Kg DM had no mortality. Red blood cells (RBC), albumin, and total protein were all higher for the treatments fed MFE (5 and 7 g/Kg DM). Results of experiment 2 showed RBC, hemoglobin, hematocrit, globulin, albumin, and total protein improved with the increase in MFE in the infected fish. The dietary MFE at the level of 7 g/kg DM reduced mortality rate. In conclusion, MFE at the level of 7 g/kg DM could be a valuable dietary supplement to cure the infected fish. PMID:25574488

  7. White mulberry (Morus alba) foliage methanolic extract can alleviate Aeromonas hydrophila infection in African catfish (Clarias gariepinus).

    Science.gov (United States)

    Sheikhlar, Atefeh; Alimon, Abd Razk; Daud, Hassan; Saad, Chee R; Webster, Carl D; Meng, Goh Yong; Ebrahimi, Mahdi

    2014-01-01

    Two experiments were simultaneously conducted with Morus alba (white mulberry) foliage extract (MFE) as a growth promoter and treatment of Aeromonas hydrophila infection in separate 60 and 30 days trail (Experiments 1 and 2, resp.) in African catfish (Clarias gariepinus). In Experiment 1, four diets, control and control supplemented with 2, 5, or 7 g MFE/kg dry matter (DM) of diet, were used. In Experiment 2, fish were intraperitoneally infected with Aeromonas hydrophila and fed the same diets as experiment 1 plus additional two diets with or without antibiotic. Results of experiment 1 showed that growth was unaffected by dietary levels of MFE. Treatments with the inclusion of MFE at the levels of 5 and 7 g/Kg DM had no mortality. Red blood cells (RBC), albumin, and total protein were all higher for the treatments fed MFE (5 and 7 g/Kg DM). Results of experiment 2 showed RBC, hemoglobin, hematocrit, globulin, albumin, and total protein improved with the increase in MFE in the infected fish. The dietary MFE at the level of 7 g/kg DM reduced mortality rate. In conclusion, MFE at the level of 7 g/kg DM could be a valuable dietary supplement to cure the infected fish.

  8. Melanization and Pathogenicity in the Insect, Tenebrio molitor, and the Crustacean, Pacifastacus leniusculus, by Aeromonas hydrophila AH-3

    Science.gov (United States)

    Noonin, Chadanat; Jiravanichpaisal, Pikul; Söderhäll, Irene; Merino, Susana; Tomás, Juan M.; Söderhäll, Kenneth

    2010-01-01

    Aeromonas hydrophila is the most common Aeromonas species causing infections in human and other animals such as amphibians, reptiles, fish and crustaceans. Pathogenesis of Aeromonas species have been reported to be associated with virulence factors such as lipopolysaccharides (LPS), bacterial toxins, bacterial secretion systems, flagella, and other surface molecules. Several mutant strains of A. hydrophila AH-3 were initially used to study their virulence in two animal species, Pacifastacus leniusculus (crayfish) and Tenebrio molitor larvae (mealworm). The AH-3 strains used in this study have mutations in genes involving the synthesis of flagella, LPS structures, secretion systems, and some other factors, which have been reported to be involved in A. hydrophila pathogenicity. Our study shows that the LPS (O-antigen and external core) is the most determinant A. hydrophila AH-3 virulence factor in both animals. Furthermore, we studied the immune responses of these hosts to infection of virulent or non-virulent strains of A. hydrophila AH-3. The AH-3 wild type (WT) containing the complete LPS core is highly virulent and this bacterium strongly stimulated the prophenoloxidase activating system resulting in melanization in both crayfish and mealworm. In contrast, the ΔwaaE mutant which has LPS without O-antigen and external core was non-virulent and lost ability to stimulate this system and melanization in these two animals. The high phenoloxidase activity found in WT infected crayfish appears to result from a low expression of pacifastin, a prophenoloxidase activating enzyme inhibitor, and this gene expression was not changed in the ΔwaaE mutant infected animal and consequently phenoloxidase activity was not altered as compared to non-infected animals. Therefore we show that the virulence factors of A. hydrophila are the same regardless whether an insect or a crustacean is infected and the O-antigen and external core is essential for activation of the proPO system

  9. Melanization and pathogenicity in the insect, Tenebrio molitor, and the crustacean, Pacifastacus leniusculus, by Aeromonas hydrophila AH-3.

    Directory of Open Access Journals (Sweden)

    Chadanat Noonin

    Full Text Available Aeromonas hydrophila is the most common Aeromonas species causing infections in human and other animals such as amphibians, reptiles, fish and crustaceans. Pathogenesis of Aeromonas species have been reported to be associated with virulence factors such as lipopolysaccharides (LPS, bacterial toxins, bacterial secretion systems, flagella, and other surface molecules. Several mutant strains of A. hydrophila AH-3 were initially used to study their virulence in two animal species, Pacifastacus leniusculus (crayfish and Tenebrio molitor larvae (mealworm. The AH-3 strains used in this study have mutations in genes involving the synthesis of flagella, LPS structures, secretion systems, and some other factors, which have been reported to be involved in A. hydrophila pathogenicity. Our study shows that the LPS (O-antigen and external core is the most determinant A. hydrophila AH-3 virulence factor in both animals. Furthermore, we studied the immune responses of these hosts to infection of virulent or non-virulent strains of A. hydrophila AH-3. The AH-3 wild type (WT containing the complete LPS core is highly virulent and this bacterium strongly stimulated the prophenoloxidase activating system resulting in melanization in both crayfish and mealworm. In contrast, the ΔwaaE mutant which has LPS without O-antigen and external core was non-virulent and lost ability to stimulate this system and melanization in these two animals. The high phenoloxidase activity found in WT infected crayfish appears to result from a low expression of pacifastin, a prophenoloxidase activating enzyme inhibitor, and this gene expression was not changed in the ΔwaaE mutant infected animal and consequently phenoloxidase activity was not altered as compared to non-infected animals. Therefore we show that the virulence factors of A. hydrophila are the same regardless whether an insect or a crustacean is infected and the O-antigen and external core is essential for activation of the

  10. Skin diseases in companion guinea pigs (Cavia porcellus): a retrospective study of 293 cases seen at the Veterinary Medical Teaching Hospital, University of California at Davis (1990-2015).

    Science.gov (United States)

    White, Stephen D; Guzman, David Sanchez-Migallon; Paul-Murphy, Joanne; Hawkins, Michelle G

    2016-10-01

    Guinea pigs (Cavia porcellus) are popular companion animals with reported skin diseases, but most reports are accessed from textbooks or review articles. To document skin diseases and their prevalence in companion guinea pigs in northern California, USA, and to investigate predilections for the most common conditions over a 25 year period. Two hundred and ninety three guinea pigs from the hospital population met inclusion criteria. A retrospective study was performed by searching computerized medical records seen at the Veterinary Medical Teaching Hospital (VMTH), School of Veterinary Medicine, University of California from 1 January 1990 to 31 July 2015 using key words relevant to dermatology. Of the 580 guinea pigs seen at the VMTH, 50% (293) had skin disease. Of the 293 cases, 154 (52%) presented for nondermatological reasons. Guinea pigs with skin disease were significantly older than those without skin disease (P = 0.0002); females with skin disease were more likely to have cystic ovaries (P = 0.0203), although these were not always associated with alopecia. Pododermatitis and infestation with Trixacarus caviae or lice were the most common skin diseases. Ivermectin or selamectin was used for ectoparasite treatment. Abscesses unassociated with pododermatitis were the most common nodules. Benign follicular tumours were the most common neoplasm. Despite the frequent mention of dermatophytosis in the veterinary literature, only two cases of Trichophyton mentagrophytes were diagnosed. Cutaneous conditions in companion guinea pigs in the USA are common. Clinicians should include a dermatological examination when examining these rodents regardless of the reason for presentation. © 2016 ESVD and ACVD.

  11. Effect of chest wall radiotherapy in different manners using tissue equivalent bolus on skin and lung of cavia cobayas

    International Nuclear Information System (INIS)

    Huang Wei; Qu Yaqin; Song Xiangfu; Liu Shixin; Jia Xiaojing; Guo He; Yang Lei

    2009-01-01

    Objective: To probe the influence of electron beam radiotherapy in different manners using different tissue equivalent boluses on skin and lung. Methods: Adult female cavia cobayas were randomly divided into four groups as control group, half-time with bolus group, half-time with bolus group and without bolus group. Acute-irradiation animal models were established using electron beam in different manners with or without 0.5 cm tissue equivalent bolus. Pathological changes in lung, hair vesicle and fibroblast cell count were analyzed 40 clays after irradiation. Results: The radiation dermatitis in the group with bolus was slighter than that of the group without bolus, but the radiation pneumonia was reverse. With bolus, the radiation dermatitis of haft-time group was slighter than that of full-time group. The injury repair of half-time group was more active than full-time group. Conclusions: The treatment of haft-time bolus could protect lung without serious skin complications. (authors)

  12. [Dermatophyte colonization on guinea pigs (Cavia porcellus) kept in pet stores. First report from Santiago, Chile].

    Science.gov (United States)

    Thomson, Pamela; Monsalves, Pamela; Maier, Liliana; Silva, Víctor

    2015-01-01

    Dermatophytes are pathogenic fungi that can be present in the flora of mammals, such as dogs, cats and rodents, which can be a source and transmission vehicle to other hosts, including humans. In Chile, there is a steady increase of acquiring guinea pigs (Cavia porcellus) as pets, with no local studies on their colonization by dermatophytes. To determine the presence of dermatophytes on clinically healthy guinea pigs, kept in pet stores in Santiago, Chile. A total of 52 clinically healthy animals were studied using the method by Mariat and Tapia (1966). The specimen culture and identification of the dermatophytes were performed using classical mycological procedures. Four guinea pigs (7.7%) out of 52 were colonized by dermatophytes, and were identified as Trichophyton mentagrophytes (3 cases) and Trichophyton verrucosum (one case). This study shows, for the first time in Chile, that guinea pigs can be colonized by dermatophytes, which should alert administrators of pet stores, veterinarians and physicians, to keep this in mind when purchasing or looking after this type of pet in a veterinary office. Copyright © 2013 Revista Iberoamericana de Micología. Published by Elsevier Espana. All rights reserved.

  13. Female novelty and the courtship behavior of male guinea pigs (Cavia porcellus

    Directory of Open Access Journals (Sweden)

    Cohn D.W.H.

    2004-01-01

    Full Text Available In several rodent species, an increase or recovery of sexual behavior can be observed when sexually satiated males are placed in contact with a novel mate. In order to assess the influence of female novelty on the courtship behavior of guinea pigs (Cavia porcellus, four adult males were observed during four daily 15-min sessions while interacting with the same pregnant female (same-female sessions. A new female was presented during the fifth session (switched-female session. The duration of behavioral categories was obtained from videotape records using an observational software. From the first to the second session, all males decreased the time allocated to investigating (sniffing and licking, following, and mounting the female, and that response did not recover by the end of the same-female sessions. No similar decreasing tendencies were detected in the circling or rumba categories. A marked increase of investigating occurred in all males from the last same-female session (8.1, 11.9, 15.1 and 17.3 percent session time to the switched-female one (16.4, 18.4, 37.1 and 28.9 percent session time, respectively. Increases in following and circling were recorded in three of four males, and full-blown recovery of mounting in one male. No consistent changes in the females' responses to males (following or attacking were observed throughout testing. These results are consistent with the hypothesis that guinea pig males recognize individual females and that courtship responses may suffer a habituation/recovery process controlled by mate novelty.

  14. Frozen White-Leg Shrimp (Litopenaeus vannamei) in Korean Markets as a Source of Aeromonas spp. Harboring Antibiotic and Heavy Metal Resistance Genes.

    Science.gov (United States)

    De Silva, Benthotage C J; Hossain, Sabrina; Dahanayake, Pasan S; Heo, Gang-Joon

    2018-05-24

    As the most consumed shrimp variety, white-leg shrimp (Litopenaeus vannamei) owns a high market demand in Korea. This study sought to screen the frozen white-leg shrimp for Aeromonas spp. harboring antimicrobial and heavy metal resistance characteristics. A total of 44 Aeromonas spp. strains were isolated and tested for antibiotic susceptibility and heavy metal tolerance followed by PCR-based detection of resistance genes and integrons. It was observed that resistance to ampicillin and oxacillin was 100% among isolates. Besides, 95%, 89%, 86%, 80%, 66%, and 43% of the isolates were resistant to nalidixic acid, tetracycline, cephalothin, streptomycin, trimethoprim-sulfamethoxazole, and imipenem, respectively, and less resistance to other antibiotics was also observed. Cr resistance was the highest (91%) among five heavy metals tested, whereas 57%, 32%, 20%, and 9% of the isolates were tolerant to Cu, Pb, Cd, and Hg, respectively. The PCR assays implied the presence of qnrB, qnrS, tetA, tetE, aac(6')-Ib, and aphAI-IAB, and intI1 genes among 80%, 77%, 18%, 30%, 9%, 0.25%, and 82% of the isolates, respectively. There were 35 (80%) integron 1-positive isolates harboring qacE2, dfrA1, orfC, orfD, aadB, catB3, oxa-10, and aadA1 genes in varying combinations. In addition, heavy metal resistance genes, CopA, merA, and CzcA were positive in 9%, 7%, and 27% of the isolates, respectively. According to these outcomes, the frozen white-leg shrimp in Korean markets can be suggested as a source of multidrug and heavy metal-resistant Aeromonas spp. that carries genetic determinants.

  15. Identification and Characterization of MicroRNAs in the Liver of Blunt Snout Bream (Megalobrama amblycephala Infected by Aeromonas hydrophila

    Directory of Open Access Journals (Sweden)

    Lei Cui

    2016-11-01

    Full Text Available MicroRNAs (miRNAs are small RNA molecules that play key roles in regulation of various biological processes. In order to better understand the biological significance of miRNAs in the context of Aeromonas hydrophila infection in Megalobrama amblycephala, small RNA libraries obtained from fish liver at 0 (non-infection, 4, and 24 h post infection (poi were sequenced using Illumina deep sequencing technology. A total of 11,244,207, 9,212,958, and 7,939,157 clean reads were obtained from these three RNA libraries, respectively. Bioinformatics analysis identified 171 conserved miRNAs and 62 putative novel miRNAs. The existence of ten randomly selected novel miRNAs was validated by RT-PCR. Pairwise comparison suggested that 61 and 44 miRNAs were differentially expressed at 4 and 24 h poi, respectively. Furthermore, the expression profiles of nine randomly selected miRNAs were validated by qRT-PCR. MicroRNA target prediction, gene ontology (GO annotation, and Kyoto Encylopedia of Genes and Genomes (KEGG analysis indicated that a variety of biological pathways could be affected by A. hydrophila infection. Additionally, transferrin (TF and transferrin receptor (TFR genes were confirmed to be direct targets of miR-375. These results will expand our knowledge of the role of miRNAs in the immune response of M. amblycephala to A. hydrophila infection, and facilitate the development of effective strategies against A. hydrophila infection in M. amblycephala.

  16. 38 CFR 61.61 - Agreement and funding actions.

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) VA HOMELESS PROVIDERS GRANT AND PER DIEM PROGRAM § 61.61 Agreement and funding actions. (a) When an applicant for a capital grant, per diem, a special needs grant, or a technical assistance grant... under § 61.67 of this part where a capital grant recipient fails to provide supportive services and/or...

  17. In vitro antimicrobial activity of ethanolic extracts obtained from Ficus spp. leaves against the fish pathogen Aeromonas hydrophila

    Directory of Open Access Journals (Sweden)

    Tkachenko Halyna

    2016-12-01

    Full Text Available The main goal of this study was to determine in vitro antimicrobial activity of ethanolic extracts obtained from the leaves of various Ficus species against Aeromonas hydrophila isolated locally from infected rainbow trout (Oncorhynchus mykiss Walbaum with the aim of providing scientific rationale for the use of the plant in the treatment of bacterial infections induced by Aeromonas spp. in fish. Antimicrobial susceptibility testing was done on Muller-Hinton agar with the disc diffusion method. In the present study, most ethanolic extracts proved effective against the A. hydrophila tested, with 10-12 mm inhibition zones observed. A. hydrophila demonstrated the highest susceptibility to F. pumila. Among various species of Ficus with moderate activity against A. hydrophila, the highest antibacterial activities were noted for F. benghalensis, F. benjamina, F. deltoidea, F. hispida, and F. lyrata. Thus, Ficus can be used as a natural antiseptic and antimicrobial agent in veterinary practice. Further investigations need to be conducted to isolate and identify the bioactive compounds that can then be subjected to detailed pharmacological studies and the development of clinical applications. The alarming rate of increasing resistance in bacterial pathogens in aquaculture environments means that medicinal plants with antibacterial properties are very important as natural resources of new active compounds.

  18. Study on postpartum estrus of guinea pigs (Cavia cobaya using Anredera cordifolia leaf extract

    Directory of Open Access Journals (Sweden)

    D. Wijayanti

    2017-04-01

    Full Text Available Aim: The purpose of this study was to determine the postpartum estrus cycle of guinea pigs (Cavia cobaya using Anredera cordifolia leaf extract. Materials and Methods: Materials used were 8 males and 8 females of C. cobaya with body weight ranged 400-450 g. Mating ratio applied was 1:1. Treatments given were 0, 10, 50 and 90 mg of A. cordifolia leaf extract/head, designated as T0, T1, T2 and T3, respectively. Two females were subjected for each treatment. A. cordifolia leaf extract was administered orally from 10 days prepartum to 10 days postpartum. Observation of mating behavior, vulva morphology, and vaginal smear preparation was done in the afternoon for 10 days subsequence postpartum. Data were analyzed by univariate method and descriptively. Results: The results showed that the addition of A. cordifolia leaf extract 50 mg orally could accelerate the time of postpartum estrus based on the average frequency of mating behavior consisting of behavioral approach, allow the buck to sniffing her, mating positions, standing heat, lordosis position, and copulation. During estrus, vulva morphology was red color, had much mucus and no thin membrane covering vagina. There were a lot of superficial cells on vagina. Conclusion: The best treatment to accelerate occurring postpartum estrus was the addition of A. cordifolia leaf extract as many as 50 mg/head weight (T2 orally.

  19. Identification of Two Pathogenic Aeromonas Species Isolated during Production Related Epizootics from Juvenile Burbot Lota lota maculosa.

    Science.gov (United States)

    Terrazas, Marc M; Anderson, Cort L; Jacobs, Sarah J; Cain, Kenneth D

    2018-05-25

    In response to population declines of Burbot Lota lota maculosa, conservation aquaculture methods have been developed for this species. In general, Burbot are relatively resistant to many salmonid pathogens; however, cultured juvenile Burbot have experienced periodic epizootic disease outbreaks during production. A series of trials were conducted to determine the virulence of select bacteria isolated from juvenile Burbot following outbreaks that occurred in 2012 and 2013 at the University of Idaho's Aquaculture Research Institute. Initial clinical diagnostics and sampling resulted in the isolation of numerous putative bacterial pathogens. To determine which bacteria were the most likely causative agents contributing to these epizootics, juvenile Burbot were injectied intraperitoneally (IP) with select bacteria in log phase growth. Mortality associated with specific isolates was recorded, and more comprehensive challenges followed this initial screening. These challenges used side-by-side IP and immersion methods to expose Burbot to potential pathogens. The challenges resulted in significantly higher mortalities in fish following IP injection of two Aeromonas sp. isolates compared to controls (P ≤ 0.01), but no difference in mortality for immersion challenged groups was observed (P = 0.42). Results demonstrate that two isolates (Aeromonas sp.) cultured from the epizootics are virulent to Burbot. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.

  20. Vibrios and Aeromonas.

    Science.gov (United States)

    Holmberg, S D

    1988-09-01

    There are many similarities in the Vibrionaceae that cause human illness in the United States (see Table 1). Vibrios are characteristically indigenous to marine, estuarine, and brackish environments. They are distributed mainly in Gulf of Mexico coastal water, and these organisms "bloom" when the water is warm. Outbreaks of disease in humans frequently occur in summer, coinciding with multiplication of vibrios in warm water. Sporadic cases and small outbreaks of cholera continue to occur in persons living on or near the Gulf of Mexico, but infection in most persons is unrecognized. In fact, more serious and frequent illnesses result from V. vulnificus wound infections and from gastroenteritis caused by vibrios other than V. cholerae 01. Underlying hepatic or neoplastic disease (especially leukemia) apparently increases the likelihood and severity of illnesses caused by V. vulnificus and Aeromonas. Some Vibrionaceae produce clinical illness by means of enterotoxins identical or similar to cholera toxin. For many others, hemolysins, cytotoxins, and other exotoxins are necessary to produce disease; the importance of these virulence factors often is not known or the importance of these virulence factors often is not known or is of doubtful significance. Also, purported pathogenicity as demonstrated by animal models, such as fluid accumulation in ligated ileal loops, is quite nonspecific and needs to be interpreted cautiously. For Plesiomonas, a mode of pathogenesis has not been discovered. Eating raw shellfish (frequently raw oysters) has been linked epidemiologically to enteric infections with most of these bacteria; foreign travel and exposure to seawater are other frequently observed epidemiologic associations with infection. Foreign travel, particularly to the Yucatan Peninsula of Mexico, has been strongly associated with the acquisition of non-01 V. cholerae and Plesiomonas organisms. Most Vibrionaceae in the United States are susceptible in vitro--and illnesses

  1. Antimicrobial activity of some of the south-Indian spices against serotypes of Escherichia coli, Salmonella, Listeria monocytogenes and Aeromonas hydrophila Atividade antimicrobiana de condimentos do sul da India sobre Escherichia coli, Salmonella, Listeria monocytogenes e Aeromonas hydrophila

    Directory of Open Access Journals (Sweden)

    M.N. Indu

    2006-06-01

    Full Text Available Antibacterial activity of extracts of Allium sativum (garlic, Myristica fragrans (nutmeg, Zingiber officinale (ginger, Allium cepa (onion and Piper nigrum (pepper has been evaluated against 20 different serogroups of Escherichia coli, 8 serotypes of Salmonella, Listeria monocytogenes and Aeromonas hydrophila. Garlic extract showed excellent antibacterial activity against all the test organisms, except L. monocytogenes. Nutmeg showed good anti-listerial activity, although activity against E. coli and Salmonella were serotype dependent. Both garlic and nutmeg extracts were effective against A. hydrophila. Extracts of ginger showed inhibitory activity against two serogroups of E. coli: as O8 (enterotoxigenic E. coli and O88 only. Extracts of onion and pepper did not show any antibacterial activity against the test organisms.Avaliou-se a atividade antimicrobiana de extratos de alho (Allium sativum, noz-moscada (Mysritica frangrans, gengibre (Zingiber officinale cebola (Allium cepa e pimenta do reino (Piper nigrum sobre 20 sorotipos de Escherichia coli, 8 sorotipos de Salmonella, Listeria monocytogenes e Aeromonas hydrophila. O alho apresentou atividade antimicrobiana excelente sobre todos os microrganismos testados, excepto L. monocytogenes. A noz-moscada apresentou boa atividade antilisteria, emboara atividade sobre E. coli e Salmonella tenha sido sorotipo-dependente. Tanto alho como noz-moscada foram eficientes contra A. hydrophila. O extrato de gengibre apresentou atividade inibitória sobre dois sorotipos de E. coli: 08 (enterotoxigenico e 088. Os extratos de cebola e pimenta do reino não apresentaram nenhuma atividade contra os microrganismos testados.

  2. Aeromonas salmonicida subsp. salmonicida strains isolated from Chinese freshwater fish contain a novel genomic island and possible regional-specific mobile genetic elements profiles

    DEFF Research Database (Denmark)

    Long, Meng; Nielsen, Tue K; Leisner, Jørgen J

    2016-01-01

    Two strains of Aeromonas salmonicida, YK and BG, were isolated from largemouth bronze gudgeon and northern whitefish in China, and identified as A. salmonicida subsp. salmonicida based on phylogenetic analysis of vapA and 16S rRNA gene sequences. YK and BG originated from freshwater fish, one...

  3. Effectiveness of ambon banana stem juice as immunostimulatory against Aeromonas hydrophila infections in catfish Clarias gariepinus

    Directory of Open Access Journals (Sweden)

    Qorie Astria

    2017-07-01

    Full Text Available ABSTRACT Outbreaks of infectious diseases due to Aeromonas hydrophila in catfish can cause high death rates (80–100%. Fish disease control can be done using phytopharmaceutical to prevent or treat diseases of fish. One of the phytopharmaceutical that known to prevent the fish diseases is ambon banana stem Musa cavendishii var. dwarf Paxton. This study was conducted to test the effectiveness of catfish immersion using banana stem juice as an immunostimulant against bacterial infections A. hydrophila. The observed parameters were a total performance of production, hematological test, and water quality. Immersion of catfish seeds with stem juice was performed at a concentration of 5 mL/L, 13 mL/L, and 21 mL/L for 30 minutes. Each treatment consisted of three replications. A  total of 15 fishes were immersed in 1.5 L water. At day-9 after immersion, fish was infected by A. hydrophila bacteria at a dose of 104 cfu/mL. The results showed that fish treated with banana stem juice at a concentration of 13 mL/L had the survival rate of 53.33±6.67% which is higher than positive control (33.33±6.67%. Based on hematology observations on the 3rd day post-challenge test (H12 with A. hydrophila, total erythrocytes, hemoglobin, total leukocytes, phagocytic activity, differential leukocyte, and lysozyme activity was highest in treatment13 mL/L. Lower feed conversion ratio (1.08±0.04 were also obtained in treatment 13 mL/L. Thus Immersion of seeds in stem juice can boost the immune system against infections A. hydrophila. Keywords: Aeromonas hydrophila, ambon banana stem juice, soaking, catfish, immune system  ABSTRAK Wabah penyakit akibat infeksi Aeromonas hydrophila pada ikan lele dapat menyebabkan tingkat kematian yang tinggi (80–100%. Penanggulangan penyakit ikan dapat dilakukan menggunakan fitofarmaka untuk mencegah ataupun mengobati penyakit ikan. Salah satu fitofarmaka yang dapat digunakan dalam upaya pencegahan penyakit ikan adalah batang

  4. Application of a continuously stirred tank bioreactor (CSTR) for bioremediation of hydrocarbon-rich industrial wastewater effluents.

    Science.gov (United States)

    Gargouri, Boutheina; Karray, Fatma; Mhiri, Najla; Aloui, Fathi; Sayadi, Sami

    2011-05-15

    A continuously stirred tank bioreactor (CSTR) was used to optimize feasible and reliable bioprocess system in order to treat hydrocarbon-rich industrial wastewaters. A successful bioremediation was developed by an efficient acclimatized microbial consortium. After an experimental period of 225 days, the process was shown to be highly efficient in decontaminating the wastewater. The performance of the bioaugmented reactor was demonstrated by the reduction of COD rates up to 95%. The residual total petroleum hydrocarbon (TPH) decreased from 320 mg TPH l(-1) to 8 mg TPH l(-1). Analysis using gas chromatography-mass spectrometry (GC-MS) identified 26 hydrocarbons. The use of the mixed cultures demonstrated high degradation performance for hydrocarbons range n-alkanes (C10-C35). Six microbial isolates from the CSTR were characterized and species identification was confirmed by sequencing the 16S rRNA genes. The partial 16S rRNA gene sequences demonstrated that 5 strains were closely related to Aeromonas punctata (Aeromonas caviae), Bacillus cereus, Ochrobactrum intermedium, Stenotrophomonas maltophilia and Rhodococcus sp. The 6th isolate was affiliated to genera Achromobacter. Besides, the treated wastewater could be considered as non toxic according to the phytotoxicity test since the germination index of Lepidium sativum ranged between 57 and 95%. The treatment provided satisfactory results and presents a feasible technology for the treatment of hydrocarbon-rich wastewater from petrochemical industries and petroleum refineries. Copyright © 2011 Elsevier B.V. All rights reserved.

  5. Analysis of the Genome and Mobilome of a Dissimilatory Arsenate Reducing Aeromonas sp. O23A Reveals Multiple Mechanisms for Heavy Metal Resistance and Metabolism

    Directory of Open Access Journals (Sweden)

    Witold Uhrynowski

    2017-05-01

    Full Text Available Aeromonas spp. are among the most ubiquitous microorganisms, as they have been isolated from different environmental niches including waters, soil, as well as wounds and digestive tracts of poikilothermic animals and humans. Although much attention has been paid to the pathogenicity of Aeromonads, the role of these bacteria in environmentally important processes, such as transformation of heavy metals, remains to be discovered. Therefore, the aim of this study was a detailed genomic characterization of Aeromonas sp. O23A, the first representative of this genus capable of dissimilatory arsenate reduction. The strain was isolated from microbial mats from the Zloty Stok mine (SW Poland, an environment strongly contaminated with arsenic. Previous physiological studies indicated that O23A may be involved in both mobilization and immobilization of this metalloid in the environment. To discover the molecular basis of the mechanisms behind the observed abilities, the genome of O23A (∼5.0 Mbp was sequenced and annotated, and genes for arsenic respiration, heavy metal resistance (hmr and other phenotypic traits, including siderophore production, were identified. The functionality of the indicated gene modules was assessed in a series of minimal inhibitory concentration analyses for various metals and metalloids, as well as mineral dissolution experiments. Interestingly, comparative analyses revealed that O23A is related to a fish pathogen Aeromonas salmonicida subsp. salmonicida A449 which, however, does not carry genes for arsenic respiration. This indicates that the dissimilatory arsenate reduction ability may have been lost during genome reduction in pathogenic strains, or acquired through horizontal gene transfer. Therefore, particular emphasis was placed upon the mobilome of O23A, consisting of four plasmids, a phage, and numerous transposable elements, which may play a role in the dissemination of hmr and arsenic metabolism genes in the

  6. Analysis of the Genome and Mobilome of a Dissimilatory Arsenate Reducing Aeromonas sp. O23A Reveals Multiple Mechanisms for Heavy Metal Resistance and Metabolism.

    Science.gov (United States)

    Uhrynowski, Witold; Decewicz, Przemyslaw; Dziewit, Lukasz; Radlinska, Monika; Krawczyk, Pawel S; Lipinski, Leszek; Adamska, Dorota; Drewniak, Lukasz

    2017-01-01

    Aeromonas spp. are among the most ubiquitous microorganisms, as they have been isolated from different environmental niches including waters, soil, as well as wounds and digestive tracts of poikilothermic animals and humans. Although much attention has been paid to the pathogenicity of Aeromonads, the role of these bacteria in environmentally important processes, such as transformation of heavy metals, remains to be discovered. Therefore, the aim of this study was a detailed genomic characterization of Aeromonas sp. O23A, the first representative of this genus capable of dissimilatory arsenate reduction. The strain was isolated from microbial mats from the Zloty Stok mine (SW Poland), an environment strongly contaminated with arsenic. Previous physiological studies indicated that O23A may be involved in both mobilization and immobilization of this metalloid in the environment. To discover the molecular basis of the mechanisms behind the observed abilities, the genome of O23A (∼5.0 Mbp) was sequenced and annotated, and genes for arsenic respiration, heavy metal resistance ( hmr ) and other phenotypic traits, including siderophore production, were identified. The functionality of the indicated gene modules was assessed in a series of minimal inhibitory concentration analyses for various metals and metalloids, as well as mineral dissolution experiments. Interestingly, comparative analyses revealed that O23A is related to a fish pathogen Aeromonas salmonicida subsp. salmonicida A449 which, however, does not carry genes for arsenic respiration. This indicates that the dissimilatory arsenate reduction ability may have been lost during genome reduction in pathogenic strains, or acquired through horizontal gene transfer. Therefore, particular emphasis was placed upon the mobilome of O23A, consisting of four plasmids, a phage, and numerous transposable elements, which may play a role in the dissemination of hmr and arsenic metabolism genes in the environment. The obtained

  7. Analysis of the Genome and Mobilome of a Dissimilatory Arsenate Reducing Aeromonas sp. O23A Reveals Multiple Mechanisms for Heavy Metal Resistance and Metabolism

    Science.gov (United States)

    Uhrynowski, Witold; Decewicz, Przemyslaw; Dziewit, Lukasz; Radlinska, Monika; Krawczyk, Pawel S.; Lipinski, Leszek; Adamska, Dorota; Drewniak, Lukasz

    2017-01-01

    Aeromonas spp. are among the most ubiquitous microorganisms, as they have been isolated from different environmental niches including waters, soil, as well as wounds and digestive tracts of poikilothermic animals and humans. Although much attention has been paid to the pathogenicity of Aeromonads, the role of these bacteria in environmentally important processes, such as transformation of heavy metals, remains to be discovered. Therefore, the aim of this study was a detailed genomic characterization of Aeromonas sp. O23A, the first representative of this genus capable of dissimilatory arsenate reduction. The strain was isolated from microbial mats from the Zloty Stok mine (SW Poland), an environment strongly contaminated with arsenic. Previous physiological studies indicated that O23A may be involved in both mobilization and immobilization of this metalloid in the environment. To discover the molecular basis of the mechanisms behind the observed abilities, the genome of O23A (∼5.0 Mbp) was sequenced and annotated, and genes for arsenic respiration, heavy metal resistance (hmr) and other phenotypic traits, including siderophore production, were identified. The functionality of the indicated gene modules was assessed in a series of minimal inhibitory concentration analyses for various metals and metalloids, as well as mineral dissolution experiments. Interestingly, comparative analyses revealed that O23A is related to a fish pathogen Aeromonas salmonicida subsp. salmonicida A449 which, however, does not carry genes for arsenic respiration. This indicates that the dissimilatory arsenate reduction ability may have been lost during genome reduction in pathogenic strains, or acquired through horizontal gene transfer. Therefore, particular emphasis was placed upon the mobilome of O23A, consisting of four plasmids, a phage, and numerous transposable elements, which may play a role in the dissemination of hmr and arsenic metabolism genes in the environment. The obtained

  8. Therapeutic effects of marshmallow (Althaea officinalis L.) extract on plasma biochemical parameters of common carp infected with Aeromonas hydrophila

    OpenAIRE

    Banaee, Mahdi; Soleimany, Vahid; Nematdoost Haghi, Behzad

    2017-01-01

    This study evaluated preclinical and clinical safety of marshmallow (Althaea officinalis L.) extract as a naturopathic medicine in common carp deliberately infected with Aeromonas hydrophila. The fish were fed 0 (control), 2.50, 5.00 and 10.00 g of marshmallow extract for 60 days in a preclinical experiment and then, challenged with A. hydrophila for a 10-day experiment. Significant increases were observed in aspartate aminotransferase (AST), lactate dehydrogenase (LDH), alkaline phosphatase ...

  9. VAKSINASI IKAN TILAPIA (Oreochromis niloticus MENGGUNAKAN VAKSIN MONOVALEN DAN BIVALEN UNTUK PENCEGAHAN PENYAKIT MOTILE AEROMONAS SEPTICEMIA DAN STREPTOCOCCOSIS

    Directory of Open Access Journals (Sweden)

    Desy Sugiani

    2013-08-01

    Full Text Available Peningkatan respon antibodi pascavaksinasi dengan antigen tunggal dan campuran dari bakterin Aeromonas hydrophila and Streptococcus agalactiae diharapkan dapat meningkatkan daya tahan ikan tilapia (Oreochromis niloticus terhadap penyakit Motile Aeromonas Septicemia/MAS dan Streptococcosis. Sediaan vaksin disiapkan dengan metode pembuatan dan formula yang berbeda, proses inaktifasi dilakukan dengan menambahkan 3% Neutral Buffer Formalin (NBF 10% pada biakan bakteri dalam media tumbuh BHI dan TSB. Vaksinasi diberikan melalui injeksi intraperitoneal dengan sediaan vaksin monovalen A. hydrophila, monovalen S. agalactiae, dan bivalen A. hydrophila + S. agalactiae (Sel utuh, produk ektraselular/ECP, crude supernatan, campuran sel utuh + ECP, dan broth. Uji tantang dilakukan menggunakan dosis LD50 infeksi tunggal maupun ko-infeksi dari bakteri A. hydrophila dan S. agalactiae. Efektivitas dan keampuhan vaksin tersebut dihitung berdasarkan nilai RPS (Relative Percent Survival dan hasil respon hematologi. Titer antibodi dapat terdeteksi setelah satu minggu pemeliharaan pasca vaksinasi. Nilai titer antar perlakuan vaksin bivalen berbeda nyata (P<0.05 dengan vaksin monovalen dan kontrol. Nilai RPS vaksin bivalen (campuran sel utuh + ECP mencapai 100 untuk uji tantang dengan A. hydrophila dan 56,7 pada uji tantang ko-infeksi. Vaksin monovalen A. hydrophila maupun S. agalactiae hanya mampu memproteksi terhadap bakteri homolog, tidak terjadi proteksi silang di antara keduanya.

  10. UJI AKTIVITAS ANTIBAKTERI EKSTRAK RUMPUT LAUT Kappaphycus alvarezii DAN Eucheuma denticullatum TERHADAP BAKTERI Aeromonas hydrophila DAN Vibrio harveyii

    Directory of Open Access Journals (Sweden)

    Dwi Budi Wiyanto

    2010-04-01

    Full Text Available Penelitian tentang Uji Aktivitas Antibakteri Ekstrak Rumput Laut Kappaphycus alvarezii dan Eucheuma denticullatum Terhadap Bakteri Aeromonas hydrophila dan Vibrio harveyii dilakukan, mengingat banyak dijumpai  penyakit pada usaha budidaya ikan dan udang, terutama bakteri Aeromonas hydrophila dan Vibrio harveyii. Penelitian ini bertujuan untuk mengetahui efektifitas senyawa bioaktif rumput laut K. alvarezii dan E. denticullatum yang diekstrak menggunakan pelarut metanol dan etanol sebagai antibakteri terhadap A. hydrophila dan V. harveyii.  Penelitian dilakukan sebanyak dua tahap, yaitu: (1 Uji aktivitas antibakteri ekstrak rumput laut; dan (2 Analisa senyawa bioaktif yang terdapat pada ekstrak rumput laut, dimana masing-masing tahapan dianalisis menggunakan rancangan acak lengkap faktorial. Hasil penelitian menunjukkan, dua jenis ekstrak rumput laut dengan pelarut metanol dan etanol, mempunyai daya antibakteri terhadap A. hydrophila dan V. harveyii. Ekstrak E. denticullatum dengan pelarut metanol memiliki daya hambat lebih luas dibanding ekstrak K. alvarezii dengan pelarut metanol terhadap A. hydrophila (19.43±0,55 mm. Ekstrak E. denticullatum dengan pelarut metanol memiliki daya hambat lebih luas dibanding ekastrak K. alvarezii dengan pelarut metanol terhadap V. harveyii (19.85±0,23 mm. Asam heksadekanoat merupakan senyawa paling dominan dijumpai pada ekstrak rumput laut K. alvarezii, dan E. denticullatum yang diekstrak menggunakan pelarut metanol. Kata Kunci : Aktivitas Antibakteri, Rumput laut K. alvarezii dan E. denticullatum,  Bakteri A.  hydrophila dan V. harveyii. 

  11. A First Generation Comparative Chromosome Map between Guinea Pig (Cavia porcellus) and Humans.

    Science.gov (United States)

    Romanenko, Svetlana A; Perelman, Polina L; Trifonov, Vladimir A; Serdyukova, Natalia A; Li, Tangliang; Fu, Beiyuan; O'Brien, Patricia C M; Ng, Bee L; Nie, Wenhui; Liehr, Thomas; Stanyon, Roscoe; Graphodatsky, Alexander S; Yang, Fengtang

    2015-01-01

    The domesticated guinea pig, Cavia porcellus (Hystricomorpha, Rodentia), is an important laboratory species and a model for a number of human diseases. Nevertheless, genomic tools for this species are lacking; even its karyotype is poorly characterized. The guinea pig belongs to Hystricomorpha, a widespread and important group of rodents; so far the chromosomes of guinea pigs have not been compared with that of other hystricomorph species or with any other mammals. We generated full sets of chromosome-specific painting probes for the guinea pig by flow sorting and microdissection, and for the first time, mapped the chromosomal homologies between guinea pig and human by reciprocal chromosome painting. Our data demonstrate that the guinea pig karyotype has undergone extensive rearrangements: 78 synteny-conserved human autosomal segments were delimited in the guinea pig genome. The high rate of genome evolution in the guinea pig may explain why the HSA7/16 and HSA16/19 associations presumed ancestral for eutherians and the three syntenic associations (HSA1/10, 3/19, and 9/11) considered ancestral for rodents were not found in C. porcellus. The comparative chromosome map presented here is a starting point for further development of physical and genetic maps of the guinea pig as well as an aid for genome assembly assignment to specific chromosomes. Furthermore, the comparative mapping will allow a transfer of gene map data from other species. The probes developed here provide a genomic toolkit, which will make the guinea pig a key species to unravel the evolutionary biology of the Hystricomorph rodents.

  12. 75 FR 10026 - Proposed Collection; Comment Request for Forms W-2, W-2c, W-2AS, W-2GU, W-2VI, W-3, W-3c, W-3cPR...

    Science.gov (United States)

    2010-03-04

    ... W-2, W-2c, W-2AS, W-2GU, W-2VI, W-3, W-3c, W-3cPR, W-3PR, and W-3SS AGENCY: Internal Revenue Service....C. 3506(c)(2)(A)). Currently, the IRS is soliciting comments concerning Forms W-2, W-2c, W-2AS, W-2GU, W-2VI, W-3, W-3c, W- 3cPR, W-3PR, and W-3SS. DATES: Written comments should be received on or...

  13. Zaburzenia lipidowe u pacjentów z zawrotami głowy

    Directory of Open Access Journals (Sweden)

    Hanna Zielińska-Bliźniewska

    2012-11-01

    Full Text Available Wprowadzenie: Celem pracy była ocena zaburzeń lipidowych u pacjentów z zawrotami głowy. Materiał i metody: Badania przeprowadzono na grupie 918 chorych, w tym 598 kobiet i 320 mężczyzn, w wieku 18–83 lat (średnia wieku 55±0,5, leczonych w latach 2009–2011 w Klinice Otolaryngologii i Onkologii Laryngologicznej z Zespołem Pracowni Audiologicznych i Foniatrycznych Uniwersyteckiego Szpitala Klinicznego im. WAM w Łodzi z powodu zawrotów głowy. U wszystkich chorych przeprowadzono szczegółowy wywiad, badanie przedmiotowe otolaryngologiczne, otoneurologiczne. Każdy pacjent był konsultowany neurologicznie, okulistycznie i internistycznie oraz miał wykonywane USG naczyń doczaszkowych, tomografię komputerową odcinka szyjnego kręgosłupa i głowy w celu wykluczenia schorzeń organicznych ośrodkowego układu nerwowego. Przeprowadzono także badania laboratoryjne, takie jak stężenie cholesterolu całkowitego, triglicerydy, frakcję cholesterolu LDL i HDL oraz stężenie glukozy w surowicy krwi. Wyniki: W grupie 918 pacjentów z zawrotami głowy u 539 (58,71% miały one pochodzenie ośrodkowe, a u 379 chorych (41,28% charakter mieszany, w tym u 366 kobiet (67,90% rozpoznano zawroty pochodzenia ośrodkowego, a u 232 (61,21% typu mieszanego. Spośród 320 mężczyzn (34,78% z zawrotami głowy u 173 (32,09% stwierdzono zawroty pochodzenia ośrodkowego, a u 147 (38,78% typu mieszanego. Analizując stężenia frakcji lipidów u badanych, odnotowano podwyższone wartości cholesterolu całkowitego u 67,03% z nich, w tym u 71,34% mężczyzn i 64,76% kobiet. Podwyższone stężenia frakcji cholesterolu LDL zaobserwowano u 51,57% pacjentów, w tym u 54,83% mężczyzn i 49,83% kobiet. Frakcja HDL cholesterolu u większości chorych (61,99% była w normie. Również stężenie triglicerydów u większości badanych (u 69,45% nie odbiegało od normy, podobnie jak stężenie glukozy (u 59,25% mężczyzn oraz 67,78% kobiet. Wnioski: Zaburzenia

  14. Ross In Situ Uranium Recovery Project NESHAP Subpart W Construction Approval

    Science.gov (United States)

    On May 5, 2015, EPA issued a Construction Approval under the National Emission Standards for Hazardous Air Pollutants (NESHAPs) at 40 CFR Part 61, subpart W, to Strata Energy, Inc., for their Ross In Situ Recovery (ISR) Uranium Project in Crook County, WY.

  15. The influence of Aloe vera and xenograft XCB toward of bone morpho protein 2 BMP2 expression and amount of osteoblast of alveolar bone induced into tooth extraction sockets Cavia cobaya

    Directory of Open Access Journals (Sweden)

    Utari Kresnoadi

    2014-12-01

    Full Text Available Tooth extraction can cause inflammation leading to alveolar ridge resorption. In addition, prominent ridge has crucial role for making denture su-ccessfully. Thus, socket preservation is needed to prevent greater alveolar ridge resorption. An innovative material, a combination of Aloe vera and xe-nograft (XCB, is then considered as a biogenic stimulator that can reduce inflammation, as a result, the growth of alveolar bone is expected to be impro-ved. This research is aimed to prove whether the mixture of Aloe vera and xenograft can stimulate BMP2 and increase osteoblasts. Forty-eight Cavia co-baya animals were divided into eight groups each of which consisted of six animals. The mandibular incisors of those Cavia cobaya animals were then extracted and filled with PEG as Group Control, XCB as Group XCB, Aloe vera as Group Aloe vera, and a combination of Aloe vera +XCB as Group Aloe vera +XCB. Next, the first four groups were sacrificed seven days after extraction, and the second four groups were sacrificed 30 days after extrac-tion. And then, immunohistochemical and histopathology examinations were conducted to examine BMP2 expression and osteoblasts. Based on the re-sult known that the mixture of Aloe vera and xenograft can increase BMP2 expression and amount of osteoblasts. It can be concluded that the mixture of Aloe vera and xenograft can increase BMP2 expression and amount of osteoblast cel . It can be used as an alternative material to increase the growth of alveolar bone after extraction.

  16. Antimicrobial resistance of Aeromonas hydrophila isolated from different food sources: A mini-review

    Directory of Open Access Journals (Sweden)

    Deyan Stratev

    2016-09-01

    Full Text Available Summary: Aeromonas hydrophila is a Gram-negative, oxidase-positive, facultative, anaerobic, opportunistic aquatic pathogen. A. hydrophila produces virulence factors, such as hemolysins, aerolysins, adhesins, enterotoxins, phospholipase and lipase. In addition to isolation from aquatic sources, A. hydrophila has been isolated from meat and meat products, milk and dairy products, and vegetables. However, various studies showed that this opportunistic pathogen is resistant to commercial antibiotics. This is attributed to factors such as the indiscriminate use of antibiotics in aquaculture, plasmids or horizontal gene transfer. In this report, we highlight the occurrence, prevalence and antimicrobial resistance of A. hydrophila isolated from different food samples. The presence of antimicrobial-resistant A. hydrophila in food poses threats to public and aquatic animal health. Keywords: A. hydrophila, Antimicrobial resistance, Microbial food safety

  17. WEB based user's applications for NA61/SHINE experiment at CERN

    CERN Document Server

    Piwek, Mateusz

    1. Introduction The Master Thesis titled „Web based users applications for NA61/SHINE experiment at CERN” presents the World Wide Web technologies that has been used during development of the software suite for NA61/SHINE experiment. Presented software was implemented and is use by a group of approximately sixty users 1 . The NA61/SHINE is one of many projects that takes place in the European Organization for Nuclear Research – CERN located near Geneva. 1.1. About CERN CERN (French: Organisation européenne pour la recherche nucléaire 2 ) was established on 29 th of September 1954. Poland is a member state since 1991, however a for a long time before joining CERN Poland as the only country of Communist Block had an observatory status. Nowadays Polish scientists are taking a part in a main CERN's experiments such as ALICE, ATLAS or CMS. CERN's essential scientific facilities are the particle physics accelerators and detectors. The beam provided by the accelerator or collider by interacting w...

  18. Crystallization and initial X-ray analysis of polyhydroxyalkanoate granule-associated protein from Aeromonas hydrophila

    Energy Technology Data Exchange (ETDEWEB)

    Zhao, Minglian; Li, Zhenguo; Zheng, Wei; Lou, Zhiyong [MOE Key Laboratory of Protein Science, Department of Biological Sciences and Biotechnology, Tsinghua University, Beijing 100084 (China); Chen, Guo-Qiang, E-mail: chengq@stu.edu.cn [MOE Key Laboratory of Protein Science, Department of Biological Sciences and Biotechnology, Tsinghua University, Beijing 100084 (China); Multidisciplinary Research Center, Shantou University, Shantou 515063, Guangdong (China)

    2006-08-01

    The phasin PhaP{sub Ah} from A. hydrophila strain 4AK4 was crystallized using the hanging-drop vapour-diffusion method. Polyhydroxyalkanoate (PHA) granule-associated proteins (phasins) were discovered in PHA-accumulating bacteria. They play a crucial role as a structural protein during initial PHA-granule formation and granule growth and also serve as interfaces for granule stabilization in vivo. The phasin PhaP{sub Ah} from Aeromonas hydrophila strain 4AK4 was crystallized using the hanging-drop vapour-diffusion method. Single crystals were cryocooled for X-ray diffraction analysis. The phasin crystals belonged to space group P2{sub 1}2{sub 1}2{sub 1}, with unit-cell parameters a = 80.8, b = 108.9, c = 134.4 Å.

  19. Effect of Gamma Radiation and Microwave Cooking on Aeromonas Hydrophila in Bolti Fish Fillet

    International Nuclear Information System (INIS)

    Mohamad, W.S.; Megahed, A.A.; El-Ghaiaty, H.A.; Hafez, T.A.

    2016-01-01

    The objective of this study is to determine the bactericidal effect of gamma and microwave radiation on Aeromonas hydrophila inoculated in fish fillets. The study revealed that treatment of fish fillets with a dose of 1 kGy gamma radiation reduced the population of A.hydrophila by 104 cfu/g, while the dose of 2 and 3 kGy completely eliminated the microorganism. Treatment of fish fillets with microwave cooking for 1 and 2 minutes completely eliminated the microorganism. The physical examination of fish after gamma radiation treatment revealed that the used doses had no significant changes on fish fillets. The changes in protein profile (amino acids %) depended on radiation dose and period of cooking in microwave alongside controls while the total protein content was not affected.

  20. A novel challenge method with aeromonas salmonicida in rainbow trout for evaluation of furunculosis vaccines

    DEFF Research Database (Denmark)

    Marana, M. H.; Skov, J.; Chettri, J. K.

    2015-01-01

    Challenge methods used to induce furunculosis in rainbow trout when testing the potency of vaccines may include exposure to Aeromonas salmonicida by intraperitoneal injection, cohabitation or bath immersion. Intraperitoneal injection is effective but will not reflect systemic immunity because...... inflammatory cells at the vaccine injection site may combat injected bacteria fast. The cohabitation and bath immersion methods both mimic the natural infection route but are less effective in inducing the disease. We have tested a new challenge method mimicking that rainbow trout in fish farms might...... to be efficient in inducing a more natural disease progression in fish and a stable mortality. The method could differentiate efficacies of different vaccines with regard to adjuvant formulations and content of antigen....

  1. Validation of a Behavioral Ethogram for Assessing Postoperative Pain in Guinea Pigs (Cavia porcellus).

    Science.gov (United States)

    Dunbar, Misha L; David, Emily M; Aline, Marian R; Lofgren, Jennifer L

    2016-01-01

    Although guinea pigs (Cavia porcellus) have been used in research for more than a century and remain the most prevalent USDA-covered species, little has been elucidated regarding the recognition of clinical pain or analgesic efficacy in this species. We sought to assess pain in guinea pigs by using newer, clinically relevant methods that have been validated in other rodent species: the behavioral ethogram and cageside proxy indicator. In this study, 10 male guinea pigs underwent electronic von Frey testing of nociception, remote videorecording of behavior, and cageside assessment by using time-to-consumption (TTC) of a preferred treat test. These assessments were performed across 2 conditions (anesthesia only and castration surgery under anesthesia) at 3 time points (2, 8, and 24 h after the event). The anesthesia only condition served to control for the nonpainful but potentially distressing components of the surgical experience. Compared with those after anesthesia only conditions, subtle body movements were increased and nociceptive thresholds were decreased at 2 and 8 h after surgery. At 24 h, neither subtle body movement behaviors nor nociceptive thresholds differed between the 2 conditions. In contrast, TTC scores did not differ between the anesthesia only and surgery conditions at any time point, underscoring the challenge of identifying pain in this species through cageside evaluation. By comparing ethogram scores with measures of nociception, we validated select behaviors as pain-specific. Therefore, our novel ethogram allowed us to assess postoperative pain and may further serve as a platform for future analgesia efficacy studies in guinea pigs.

  2. Combined effect of gamma-irradiation and conventional cooking on Aeromonas hydrophila in meatball

    Energy Technology Data Exchange (ETDEWEB)

    Ozbaş, Z. Y.; Vural, H.; Aytac, S. A.

    1996-07-01

    Irradiation combined with a conventional cooking procedure was applied to meatball and the effects on bacterial load and inoculated Aeromonas hydrophila were determined. Meatball samples were irradiated by using a 60Co source at the dose levels of 0, 0.30, 0.75, 1.50, 2.50 kGy and cold stored at 4 +/- 1 degrees C for 7 days. Bacterial load and the count of A. hydrophila decreased when the irradiation dose level increased. A minimum inhibition effect was found at the dose of 0.30 kGy. Irradiation in combination with a conventional cooking procedure was found to be more effective in reducing A. hydrophila and the bacterial load in meatball. This study indicated that a dose of 0.75 kGy was sufficient to destroy approximately 10(4) cfu/g of A. hydrophila in meatball.

  3. Combined effect of gamma-irradiation and conventional cooking on Aeromonas hydrophila in meatball.

    Science.gov (United States)

    Ozbaş, Z Y; Vural, H; Aytaç, S A

    1996-01-01

    Irradiation combined with a conventional cooking procedure was applied to meatball and the effects on bacterial load and inoculated Aeromonas hydrophila were determined. Meatball samples were irradiated by using a 60Co source at the dose levels of 0, 0.30, 0.75, 1.50, 2.50 kGy and cold stored at 4 +/- 1 degrees C for 7 days. Bacterial load and the count of A. hydrophila decreased when the irradiation dose level increased. A minimum inhibition effect was found at the dose of 0.30 kGy. Irradiation in combination with a conventional cooking procedure was found to be more effective in reducing A. hydrophila and the bacterial load in meatball. This study indicated that a dose of 0.75 kGy was sufficient to destroy approximately 10(4) cfu/g of A. hydrophila in meatball.

  4. Combined effect of gamma-irradiation and conventional cooking on Aeromonas hydrophila in meatball

    International Nuclear Information System (INIS)

    Ozbaş, Z.Y.; Vural, H.; Aytac, S.A.

    1996-01-01

    Irradiation combined with a conventional cooking procedure was applied to meatball and the effects on bacterial load and inoculated Aeromonas hydrophila were determined. Meatball samples were irradiated by using a 60Co source at the dose levels of 0, 0.30, 0.75, 1.50, 2.50 kGy and cold stored at 4 +/- 1 degrees C for 7 days. Bacterial load and the count of A. hydrophila decreased when the irradiation dose level increased. A minimum inhibition effect was found at the dose of 0.30 kGy. Irradiation in combination with a conventional cooking procedure was found to be more effective in reducing A. hydrophila and the bacterial load in meatball. This study indicated that a dose of 0.75 kGy was sufficient to destroy approximately 10(4) cfu/g of A. hydrophila in meatball

  5. Growth inhibition of Aeromonas salmonicida and Yersinia ruckeri by disinfectants containing peracetic acid

    DEFF Research Database (Denmark)

    Meinelt, Thomas; Phan, T.; Behrens, S.

    2015-01-01

    contribute to sustainable aquaculture. The aim of our study was to compare the effectiveness of 6 commercial PAA products with different molecular PAA:H2O2 ratios to reduce bacterial growth of Aeromonas salmonicida and Yersinia ruckeri and to determine effective concentrations and exposure times. All...... products reduced colony-forming units (CFUs) of A. salmonicida and Y. ruckeri. Products with higher molecular PAA:H2O2 ratios inhibited growth better than products with lower molecular PAA:H2O2 ratios at the same PAA concentration; this indicates that H2O2 is not the driving force in the reduction of A....... salmonicida and Y. ruckeri growth by PAA in vitro. The practical application of the products with high molecular PAA:H2O2 ratios should be prioritized if these pathogens are diagnosed...

  6. XRD analysis and microstructure of milled and sintered V, W, C, and Co powders

    CSIR Research Space (South Africa)

    Bolokang, AS

    2011-01-01

    Full Text Available on the starting compositions of pure elements, their lattice coherency according to Hume-Rothery rules on crystal structure and atomic size, and enough milling time that provides adequate kinetics. Keywords ? X-ray analysis; ? (V,W)C; ? Co15W8C6...-1 International Journal of Refractory Metals and Hard Materials Volume 29, Issue 1, January 2011, Pages 108?111 XRD analysis and microstructure of milled and sintered V, W, C, and Co powders ? A.S. Bolokang ? M.J. Phasha ? C. Oliphant ? D. Motaung ? a...

  7. Formação de biofilme em aço inoxidável por Aeromonas hydrophila e Staphylococcus aureus usando leite e diferentes condições de cultivo Biofilm formation by Aeromonas hydrophila and Staphylococcus aureus on stainless steel using milk and different conditions of cultivation

    Directory of Open Access Journals (Sweden)

    Cleube Andrade Boari

    2009-12-01

    Full Text Available O objetivo desta pesquisa consistiu em avaliar a formação de biofilme em aço inoxidável por Aeromonas hydrophila e Staphylococcus aureus usando leite e diferentes condições de cultivo. As variáveis em estudo consistem no cultivo monoespécie e combinado, dos referidos microrganismos e nas temperaturas de 4, 7 e 18 °C. Recipientes contendo 1000 mL de leite, densidade populacional de 10(5 UFC.mL-1 de cada microrganismo e 10 cupons de aço inoxidável (10 × 20 mm foram lacrados e armazenados, sob agitação de 60 rpm, por um período de 10 dias. As análises ocorreram a cada 48 horas. Células sésseis de A.hydrophila e S. aureus foram enumeradas através do plaqueamento seletivo em ágar m-Aeromonas selective e Baird-Parker, respectivamente. Estudos sobre o tempo de geração, enumeração de células planctônicas e observação dos cupons através da microscopia eletrônica de varredura foram conduzidos. S. aureus, em monocultivo, formou biofilme a 18 °C e a 7 °C. Para 4 °C, foi observado um processo de adesão. A presença de A. hydrophila reduziu o desempenho de S. aureus. Nesta condição de cultivo multiespécie houve formação de biofilme a 18 °C. A. hydrophila, tanto em monocultivo quanto em presença de S. aureus, formou biofilme em todas as condições pesquisadas.The aim of this research was to verify the capability of biofilm formation on stainless steel by Aeromonas hydrophila and Staphylococcus aureus using milk and different conditions of cultivation. The variables consisted in mono and multi-species cultivation of these microorganisms and in the temperatures of 4, 7 and 18 °C. Containers containing 1000 mL of milk, population density of 10(5 CFU.mL-1 of each microorganism, and ten suspended chips of stainless steel AISI 304 (10 × 20 mm were used to seal up and storage, under 60 rpm of agitation for 10 days. The analyses were conducted every 48 hours. Sessile cells of A. hydrophila and S. aureus and were enumerated

  8. Assessment of Aquaflor (c), copper sulfate and potassium permanganate for control of Aeromonas hydrophila and Flavobacterium columnare infection in sunshine bass, Morone chrysops female x Morone saxatilis male

    Science.gov (United States)

    Two experiments were conducted to assess different therapeutants against a mixed infection of Aeromonas hydrophila and Flavobacterium columnare in sunshine bass (SB) (Morone chrysops female x Morone saxatilis male). Experiment 1 assessed the efficacy of copper sulfate (CuSO4), florfenicol-medicated...

  9. A Search for Non-Standard Model $W$ Helicity in Top Quark Decays

    Energy Technology Data Exchange (ETDEWEB)

    Kilminster, Benjamin John [Univ. of Rochester, NY (United States)

    2004-01-01

    The structure of the tbW vertex is probed by measuring the polarization of the W in t → W + b → l + v + b. The invariant mass of the lepton and b quark measures the W decay angle which in turn allows a comparison with polarizations expected from different possible models for the spin properties of the tbW interaction. We measure the fraction by rate of Ws produced with a V + A coupling in lieu of the Standard Model V-A to be fV + A = [special characters omitted] (stat) ± 0.21 (sys). We assign a limit of fV + A < 0.80 @ 95% Confidence Level (CL). By combining this result with a complementary observable in the same data, we assign a limit of fV + A < 0.61 @ 95% CL. We find no evidence for a non-Standard Model tbW vertex.

  10. Stereochemical and positional specificity of the lipase/acyltransferase produced by Aeromonas hydrophila.

    Science.gov (United States)

    Robertson, D L; Hilton, S; Buckley, J T

    1992-06-02

    Aeromonas species secrete a glycerophospholipid-cholesterol acyltransferase (GCAT) which shares many properties with mammalian plasma lecithin-cholesterol acetyltransferase (LCAT). We have studied the stereochemical and positional specificity of GCAT against a variety of lipid substrates using NMR spectroscopy as well as other assay methods. The results show that both the primary and secondary acyl ester bonds of L-phosphatidylcholine can be hydrolyzed but only the sn-2 fatty acid can be transferred to cholesterol. The enzyme has an absolute requirement for the L configuration at the sn-2 position of phosphatidylcholine. The secondary ester bond of D-phosphatidylcholine cannot be hydrolyzed, and this lipid is not a substrate for acyl transfer. In contrast to the phospholipases, but similar to LCAT, the enzyme does not interact stereochemically with the phosphorus of phosphatidylcholine. In fact, the phosphorus is not required for enzyme activity, as GCAT will also hydrolyze monolayers of diglyceride, although at much lower rates.

  11. Rola leptyny w regulacji metabolizmu lipidów i węglowodanów

    Directory of Open Access Journals (Sweden)

    Patrycja Gogga*

    2011-01-01

    Full Text Available Leptyna jest białkiem wydzielanym głównie przez tkankę tłuszczową, a jej stężenie we krwi jest ściśle związane z ilością zapasów energetycznych zgromadzonych w adipocytach. Jako hormon leptyna ma niezwykle szeroki zakres działania. Białko to bezpośrednio lub za pośrednictwem układu współczulnego bierze udział w regulacji metabolizmu energetycznego. Leptyna hamuje biosyntezę triacylogliceroli w wątrobie i tkance tłuszczowej, a także w mięśniach szkieletowych, obniżając tym samym ilość odkładanych w nich lipidów. W adipocytach leptyna zmniejsza ekspresję genów kodujących syntazę kwasów tłuszczowych (FAS i karboksylazę acetylo-CoA (ACC – główne enzymy szlaku biosyntezy kwasów tłuszczowych. Zwiększa z kolei ekspresję genu kodującego lipazę zależną od hormonów (HSL, co stymuluje hydrolizę triacylogliceroli w tkance tłuszczowej. Ponadto leptyna wzmaga utlenianie kwasów tłuszczowych w adipocytach, mięśniach szkieletowych oraz w mięśniu sercowym, wywołując wzrost ekspresji genów kodujących podstawowe dla tego procesu enzymy, palmitoilotransferazę karnitynową 1 (CPT1 i dehydrogenazę acylo-CoA o średniej długości łańcucha (MCAD. Wykazano również, że hormon ten zwiększa wrażliwość tkanek na insulinę i poprawia tolerancję glukozy – pod wpływem leptyny wzrasta transport glukozy do komórek oraz intensywność glikolizy.Wiadomo, że leptyna bierze udział w długoterminowej regulacji pobierania pokarmu, jednak coraz więcej badań wskazuje, że ma ona również wpływ na przemiany substratów energetycznych w tkankach obwodowych. Leptyna może zatem kontrolować homeostaz�� energetyczną organizmu wywołując zmiany metabolizmu lipidów i węglowodanów, przede wszystkim w tkance tłuszczowej i w mięśniach.

  12. Molecular detection of Aeromonas hydrophila in the aquarium gold fish and cultured rainbow trout in Chaharmahal va Bakhtiary province

    Directory of Open Access Journals (Sweden)

    firouz Fadaeifard

    2014-05-01

    Full Text Available Aeromonas hydrophilia   is the etiologic agent of motile aeromonas septicaemia, one of the most important bacterial diseases of fresh and marine water fishes. The aim of the present study was detection of A. hydrophilia in the aquarium goldfish and cultured rainbow trout in Chaharmahal va Bakhtiary province.  In this study 50 goldfish from aquarium fish shops and 60 rainbow trouts suspected of having the disease from 6 farms (10 fish in each farm were randomly collected. The average weight in goldfish and rainbow trout samples were 3-5 g and 10-20 g, respectively. Sampling was performed from kidney and liver, and inoculated into blood agar and incubated at 22°C for 24 hours. Pure colonies which are grown on the mediums were tested by catalase, oxidase and gram staining, then those of gram-negative, catalase and oxidase positive were diagnosed, and cultured on Shotts-Rimler medium (as selective medium for A. hydrophila. These mediums were incubated at 22 °C for 24-48 h. The typical colonies were tested by using oligonucleotide primers of lip gene by PCR method. In light of molecular analysis of all specimens, 9 and 6 isolates from rainbow trout and gold fishes were identified as A. hydrophila respectively. Due to the detection of A. hydrophila in both cultured rainbow trout and aquarium goldfish, the bacteria can lead to septicemia with mortality if the health management principles are not observed in fish farming.

  13. Crystallization and preliminary X-ray crystallographic analysis of CheW from Thermotoga maritima: a coupling protein of CheA and the chemotaxis receptor

    International Nuclear Information System (INIS)

    Park, SangYoun; Crane, Brian R.

    2011-01-01

    CheW from T. maritima has been crystallized (space group P6 3 , unit-cell parameters a = b = 61.265, c = 361.045 Å). Diffraction data have been collected to 3.1 Å resolution using synchrotron X-ray radiation. The CheW protein plays a key role in bacterial chemotaxis signal transduction by coupling CheA to chemotaxis receptors. CheW from Thermotoga maritima has been overexpressed in Escherichia coli and crystallized at 298 K using ammonium sulfate as a salt precipitant. X-ray diffraction data have been collected to 3.10 Å resolution at 100 K using synchrotron radiation. The crystal belonged to space group P6 3 , with unit-cell parameters a = b = 61.265, c = 361.045 Å. The asymmetric unit may contain four to six CheW molecules

  14. Antimicrobial property of lemongrass (Cymbopogon citratus) oil against pathogenic bacteria isolated from pet turtles.

    Science.gov (United States)

    De Silva, B C J; Jung, Won-Gi; Hossain, Sabrina; Wimalasena, S H M P; Pathirana, H N K S; Heo, Gang-Joon

    2017-06-01

    The usage of essential oils as antimicrobial agents is gaining attention. Besides, pet turtles were known to harbor a range of pathogenic bacteria while the turtle keeping is a growing trend worldwide.The current study examined the antimicrobial activity of lemon grass oil (LGO) against seven species of Gram negative bacteria namely; Aeromonas hydrophila , A. caviae , Citrobacter freundii , Salmonella enterica , Edwardsiella tarda , Pseudomonas aeruginosa , and Proteus mirabilis isolated from three popular species of pet turtles. Along with the results of disc diffusion, minimum inhibitory and minimum bactericidal concentration (MIC and MBC) tests, LGO was detected as effective against 6 species of bacteria excluding P. aeruginosa . MIC of LGO for the strains except P. aeruginosa ranged from 0.016 to 0.5% (V/V). The lowest MIC recorded in the E. tarda strain followed by A. hydrophilla , C. freundii , P. mirabilis , and S. enterica . Interestingly, all the bacterial species except E. tarda were showing high multiple antimicrobial resistance (MAR) index values ranging from 0.36 to 0.91 upon the 11 antibiotics tested although they were sensitive to LGO.

  15. Meningoencephalitis in farmed monosex Nile tilapia (Oreochromis niloticus L. caused by Streptococcus agalactiae

    Directory of Open Access Journals (Sweden)

    Adikesavalu Harresh

    2017-09-01

    Full Text Available Aquaculture of tilapia is a new research venture in India. With intensification in farming practices, tilapia are increasingly susceptible to bacterial infections. This article describes the isolation and identification of pathogenic bacteria from cultured monosex Nile tilapia, Oreochromis niloticus (L., that experienced moderate to severe mortalities in West Bengal, India between September and August 2014 and histopathological alterations in various organs. Gram-positive diplococci, identified as Streptococcus agalactiae with Streptococcus identification kits and 16S rDNA sequencing analysis, were isolated from the brain, operculum, and kidney. Other bacteria from the kidney were identified as Aeromonas sobria, A. caviae, Klebsiella pneumoniae ssp. pneumoniae, Escherichia coli, and Enterobacter cloacae. Staphylococcus epidermis was isolated from opercular hemorrhages. Histological sections of the infected tilapia brain revealed meningoencephalitis and granulomatous lesions. Sections from other organs indicated congestion, hemorrhagic and hyperplastic cells, necrosis, vacuolation, hemosiderin deposition, hypertrophic nuclei, melanomacrophage aggregation, and ruptured veins. This report is the first description of S. agalactiae as a primary pathogen causing meningoencephalitis in cultured tilapia in India.

  16. [Real-time PCR in rapid diagnosis of Aeromonas hydrophila necrotizing soft tissue infections].

    Science.gov (United States)

    Kohayagawa, Yoshitaka; Izumi, Yoko; Ushita, Misuzu; Niinou, Norio; Koshizaki, Masayuki; Yamamori, Yuji; Kaneko, Sakae; Fukushima, Hiroshi

    2009-11-01

    We report a case of rapidly progressive necrotizing soft tissue infection and sepsis followed by a patient's death. We suspected Vibrio vulnificus infection because the patient's underlying disease was cirrhosis and the course extremely rapid. No microbe had been detected at death. We extracted DNA from a blood culture bottle. SYBR green I real-time PCR was conducted but could not detect V. vulnificus vvh in the DNA sample. Aeromonas hydrophila was cultured and identified in blood and necrotized tissue samples. Real-time PCR was conducted to detect A. hydrophila ahh1, AHCYTOEN and aerA in the DNA sample extracted from the blood culture bottle and an isolated necrotized tissue strain, but only ahh1 was positive. High-mortality in necrotizing soft tissue infections makes it is crucial to quickly detect V. vulnificus and A. hydrophila. We found real-time PCR for vvh, ahh1, AHCYTOEN, and aerA useful in detecting V. vulnificus and A. hydrophila in necrotizing soft tissue infections.

  17. Inactivation kinetics of various chemical disinfectants on Aeromonas hydrophila planktonic cells and biofilms.

    Science.gov (United States)

    Jahid, Iqbal Kabir; Ha, Sang-Do

    2014-05-01

    The present article focuses on the inactivation kinetics of various disinfectants including ethanol, sodium hypochlorite, hydrogen peroxide, peracetic acid, and benzalkonium chloride against Aeromonas hydrophila biofilms and planktonic cells. Efficacy was determined by viable plate count and compared using a modified Weibull model. The removal of the biofilms matrix was determined by the crystal violet assay and was confirmed by field-emission scanning electron microscope. The results revealed that all the experimental data and calculated Weibull α (scale) and β (shape) parameters had a good fit, as the R(2) values were between 0.88 and 0.99. Biofilms are more resistant to disinfectants than planktonic cells. Ethanol (70%) was the most effective in killing cells in the biofilms and significantly reduced (preduction as well as the effectiveness of chemical disinfectants on biofilms. The study showed that the Weibull model could successfully be used on food and food contact surfaces to determine the exact contact time for killing biofilms-forming foodborne pathogens.

  18. Diarrea del viajero asociada a Aeromonas hydrophila

    Directory of Open Access Journals (Sweden)

    M. Martín Delgado

    2001-06-01

    Full Text Available Aeromonas hydrophila es una bacteria que se encuentra frecuentemente en aguas dulces y salobres. Desde hace varios años se conoce que determinadas cepas de la especie pueden causar enfermedad en pescados y en anfibios, existiendo cierta controversia sobre su patogeneicidad en humanos. No obstante, puede dar lugar a infección en personas, que la adquieren bien a través de heridas abiertas o bien por ingestión de alimentos o agua contaminados. Sin embargo, en prácticamente la totalidad de las publicaciones se hace referencia a casos aislados más que a brotes producidos por esta bacteria. Generalmente la infección por A. hydrophila da lugar a gastroenteritis en personas sanas, pudiendo generar una septicemia en individuos inmunodeprimidos.En 1998 se produjo una alarma en el sector hotelero por un incremento considerable de los casos de gastroenteritis entre los turistas que acudían durante sus vacaciones a determinadas zonas costeras de la isla de Tenerife.Tras tener conocimiento de la situación, la Dirección General de Salud Pública inició una investigación epidemiológica con el objetivo de conocer la magnitud real del problema detectado e identificar los factores asociados a la misma, para poner en marcha las medidas correctoras y de control necesarias. El análisis inicial permitió determinar que se trataba de un proceso de gran magnitud en su extensión aunque de carácter leve, que afectaba únicamente a los turistas en una zona costera en concreto, compatible por lo tanto con la diarrea del viajero, planteándose un origen probablemente hídrico.

  19. Inducción de IgA e IgG anti-omp48 en conejos inmunizados intragástricamente con una fracción extracelular de Aeromonas veronii

    Directory of Open Access Journals (Sweden)

    Eduardo Ruiz-Bustos

    2011-01-01

    Full Text Available Una proteína de membrana externa de 48 kDa (omp48 de Aeromonas veronii (A. veronii, que tiene afinidad por secreciones de la mucosa (tal como mucina, lactoferrina, inmunoglobulinas o colágeno, induce una respuesta inmune estadísticamente significativa al ser administrada intragástricamente a conejos blancos de Nueva Zelanda. Estudios posteriores mostraron una correlación positiva entre las inmunoglobulinas y la respuesta de células productoras de anticuerpo (CPA. La administración intragástrica del antígeno induce una respuesta vigorosa, tanto local como sistémica, principalmente de inmunoglobulinas A y G contra la omp48 de A. veronii. Estas se evidenciaron por la presencia de (i células productoras de anticuerpos contra omp48 en el tracto gastrointestinal, bazo y sangre, y (ii elevados niveles de anticuerpos circulantes.La estimulación del sistema inmune de mucosa mediante antígenos bacterianos inmunogénicos, puede ser una importante alternativa para el control y prevención de enfermedades asociadas a Aeromonas.

  20. Reduction of Aeromonas hidrophyla biofilm on stainless stell surface by essential oils

    Science.gov (United States)

    Millezi, Alessandra Farias; Cardoso, Maria das Graças; Alves, Eduardo; Piccoli, Roberta Hilsdorf

    2013-01-01

    This study demonstrates the possibility of using sanitizing detergents based on natural products for the elimination and/or reduction of Aeromonas hydrophila biofilm formed on stainless steel surfaces. The goal of this work was to determine the reduction effect of sanitizing detergents containing essential oils of Thymus vulgaris (thyme) and Cymbopogon citratus (lemongrass) on biofilm formed by A. hydrophila on AISI 304 stainless steel coupons, using UHT skimmed milk as substratum. There was adhesion and biofilm formation by A. hydrophila at 28 °C, presenting 7.60 log cfu.cm−2 after the fourth day of cultivation. There was no significant difference between the lemongrass treatment and that of the thyme oil (p 0.05). The treatment with lemongrass solution reduced the biofilm by 4.51 log cfu cm−2 at 25 °C. The thyme detergent also reduced the number of cfu cm−2 by 3.84 log cycles at 25 °C. The use of the lemongrass and thyme solutions efficiently reduced the A. hydrophila biofilm. PMID:24159286

  1. Reduction of Aeromonas hidrophyla biofilm on stainless stell surface by essential oils

    Directory of Open Access Journals (Sweden)

    Alessandra Farias Millezi

    2013-01-01

    Full Text Available This study demonstrates the possibility of using sanitizing detergents based on natural products for the elimination and/or reduction of Aeromonas hydrophila biofilm formed on stainless steel surfaces. The goal of this work was to determine the reduction effect of sanitizing detergents containing essential oils of Thymus vulgaris (thyme and Cymbopogon citratus (lemongrass on biofilm formed by A. hydrophila on AISI 304 stainless steel coupons, using UHT skimmed milk as substratum. There was adhesion and biofilm formation by A. hydrophila at 28 ºC, presenting 7.60 log cfu.cm-2 after the fourth day of cultivation. There was no significant difference between the lemongrass treatment and that of the thyme oil (p 0.05. The treatment with lemongrass solution reduced the biofilm by 4.51 log cfu cm-2 at 25 ºC. The thyme detergent also reduced the number of cfu cm-2 by 3.84 log cycles at 25 ºC. The use of the lemongrass and thyme solutions efficiently reduced the A. hydrophila biofilm.

  2. Efficacy of florfenicol, copper sulfate and potassium permanganate in controlling a natural infection of Aeromonas hydrophila and Flavobacterium columnare in sunshine bass, Morone chrysops female x Morone saxatilis male

    Science.gov (United States)

    Sunshine bass (Morone chrysops female ' Morone saxatilis male) naturally infected with Aeromonas hydrophila and Flavobacterium columnare were randomly assigned to six treatments: 1) two treatments of waterborne exposures to copper sulfate (CuSO4), at 2.1 and at 4.2 mg/L (approximately one and two pe...

  3. Hyperendemic Campylobacter jejuni in guinea pigs (Cavia porcellus) raised for food in a semi-rural community of Quito, Ecuador.

    Science.gov (United States)

    Graham, Jay P; Vasco, Karla; Trueba, Gabriel

    2016-06-01

    Domestic animals and animal products are the source of pathogenic Campylobacter jejuni and C. coli in industrialized countries, yet little is known about the transmission of these bacteria in developing countries. Guinea pigs (Cavia porcellus) are commonly raised for food in the Andean region of South America, however, limited research has characterized this rodent as a reservoir of zoonotic enteric pathogens. In this study, we examined the prevalence of Campylobacter spp. in 203 fecal samples from domestic animals of 59 households in a semi-rural parish of Quito, Ecuador. Of the twelve animal species studied, guinea pigs showed the highest prevalence of C. jejuni (n = 39/40; 97.5%). Multilocus sequence typing (MLST) was used to characterize the genetic relationship of C. jejuni from domestic animals and 21 sequence types (STs) were identified. The majority of STs from guinea pigs appeared to form new clonal complexes that were not related to STs of C. jejuni isolated from other animal species and shared only a few alleles with other C. jejuni previously characterized. The study identifies guinea pigs as a major reservoir of C. jejuni and suggests that some C. jejuni strains are adapted to this animal species. © 2016 Society for Applied Microbiology and John Wiley & Sons Ltd.

  4. Rationalité économique et objectifs de gestion de la production de cobayes (Cavia porcellus L. en zones tropicales

    Directory of Open Access Journals (Sweden)

    Ndébi, G.

    2015-01-01

    Full Text Available Economic Rationality and Production Management Goals of Guinea Pigs (Cavia porcellus L. in Tropical Zones. The economic productivity of guinea pig in tropical environment was assessed from one hundred and ninety-seven pairs of measures related to reproductive female and weaning weights per litter reared in-door at the Research and Experimental Farm of the University of Dschang between February 2012 and March 2013. An econometric model of linear regression was developed to take into account the main factors affecting the relative weight productivity index at the weaning age of each gestating female. The main results reveal that the economic productivity of guinea pigs in tropical zone, already of a substantial level, could be even more improved by taking into account the main factors of variability. The analysis thus put into evidence that the relative importance of female reproductive weight; the litter size, and the total weight of the kids at weaning are factors having significant effects on the relative weight productivity index of the guinea pig. However, in linking the female weight to economic productivity, the study led to an irrational management of the reproductive herd and put in evidence that the decrease in productivity observed in guinea pig is mostly attributable to the fattening of the female.

  5. The complete and fully assembled genome sequence of Aeromonas salmonicida subsp. pectinolytica and its comparative analysis with other Aeromonas species: investigation of the mobilome in environmental and pathogenic strains.

    Science.gov (United States)

    Pfeiffer, Friedhelm; Zamora-Lagos, Maria-Antonia; Blettinger, Martin; Yeroslaviz, Assa; Dahl, Andreas; Gruber, Stephan; Habermann, Bianca H

    2018-01-05

    Due to the predominant usage of short-read sequencing to date, most bacterial genome sequences reported in the last years remain at the draft level. This precludes certain types of analyses, such as the in-depth analysis of genome plasticity. Here we report the finalized genome sequence of the environmental strain Aeromonas salmonicida subsp. pectinolytica 34mel, for which only a draft genome with 253 contigs is currently available. Successful completion of the transposon-rich genome critically depended on the PacBio long read sequencing technology. Using finalized genome sequences of A. salmonicida subsp. pectinolytica and other Aeromonads, we report the detailed analysis of the transposon composition of these bacterial species. Mobilome evolution is exemplified by a complex transposon, which has shifted from pathogenicity-related to environmental-related gene content in A. salmonicida subsp. pectinolytica 34mel. Obtaining the complete, circular genome of A. salmonicida subsp. pectinolytica allowed us to perform an in-depth analysis of its mobilome. We demonstrate the mobilome-dependent evolution of this strain's genetic profile from pathogenic to environmental.

  6. Guinea pig (Cavia porcellus) drinking preferences: do nipple drinkers compensate for behaviourally deficient diets?

    Science.gov (United States)

    Balsiger, A; Clauss, M; Liesegang, A; Dobenecker, B; Hatt, J-M

    2017-10-01

    When offered diets with hay ad libitum, rabbits (Oryctolagus cuniculus) clearly prefer open dishes over nipple drinkers, but whether this preference also applies in guinea pigs (Cavia porcellus) is unsure. We tested the drinker preference of 10 guinea pigs when offered open dishes (OD) and nipple drinkers (ND) simultaneously and measured the amount of water consumed by each animal on four different diets (grass hay 100%, or as 10% of intake on diets of fresh parsley, seed mix or pelleted complete feed, respectively) on either of the drinking systems. All animals ingested the hay portion of the combined diets first. The amount of water consumed differed significantly between individual animals. Animals drank less water on parsley than on the other diets. Nine of 10 animals clearly preferred ND when having a choice, and eight of these drank more when on ND only. The difference between the drinking systems was not consistent across all diets: on hay, similar amounts of water were drunk when on OD or ND only. Differences in water intake were reflected in urine production. Because drinking from ND in guinea pigs involves jaw movements similar to those in chewing, the results could suggest that when motivation for oral processing behaviour is not satisfied by a diet, animals may respond in using ND beyond physiological water necessity. Whereas physiological water requirements are probably better investigated with other drinking systems due to a possible overestimation when using ND, offering ND to pet guinea pigs most likely offers a form of behavioural enrichment that at the same time may increase water intake and hence act as prophylaxis against urolithiasis. Journal of Animal Physiology and Animal Nutrition © 2016 Blackwell Verlag GmbH.

  7. Jerusalem artichoke enriched diet on growth performance, immuno-hematological changes and disease resistance against Aeromonas hydrophila in Asian seabass (Lates calcarifer).

    Science.gov (United States)

    Syed Raffic Ali, Sajjad; Ambasankar, Kondusamy; Saiyad Musthafa, Mohamed; Harikrishnan, Ramasamy

    2017-11-01

    A 45 days feeding trial was conducted to study the effect of Jerusalem artichoke (JA) on growth performance, body composition, biochemical, immuno-hematological parameters and disease resistance in Asian seabass (Lates calcarifer) fingerlings against Aeromonas hydrophila. JA was supplemented at three different levels viz., control 0, 5, 10, and 20 g kg -1 in the commercial diet (403 g kg -1 protein and 89 g kg -1 lipid) in L. calcarifer. The results showed that there were no significant (P > 0.05) differences in various growth parameters, while the whole body composition showed significant differences (P  0.05) affected by dietary supplementation of JA at different concentration. However, the mean corpuscular volume (MCV) was significantly (P < 0.05) higher in the fish fed with 20 g kg -1  JA supplemented diet. Biochemical parameters revealed that glucose, urea, cholesterol, and triglyceride showed significant (P < 0.05) differences between control and treatments groups. Interestingly, 20 g kg -1  JA supplemented diet significantly modulates the innate immune response and disease resistance against Aeromonas hydrophila compared with control and other treatment groups. The results of the study revealed that 20 g kg -1  JA supplementation has a beneficial effect in the biochemical, immunological and disease resistance in L. calcarifer juveniles. Crown Copyright © 2017. Published by Elsevier Ltd. All rights reserved.

  8. Mystacial Whisker Layout and Musculature in the Guinea Pig (Cavia porcellus): A Social, Diurnal Mammal.

    Science.gov (United States)

    Grant, Robyn A; Delaunay, Mariane G; Haidarliu, Sebastian

    2017-03-01

    All mammals (apart from apes and humans) have whiskers that make use of a similar muscle arrangement. Whisker specialists, such as rats and mice, tend to be nocturnal and arboreal, relying on their whisker sense of touch to guide exploration around tree canopies at night. As such, nocturnal arboreal rodents have many whiskers that are organised into a grid-like pattern, and moved using a complex array of muscles. Indeed, most arboreal, nocturnal mammals tend to have specialised whiskers that are longer and arranged in a dense, regular grid, compared with terrestrial, diurnal mammals. The guinea pig diverged early from murid rodents (around 75 million years ago), and are ground-dwelling, diurnal animals. It would be predicted that, as a terrestrial mammal, they may have less whiskers and a reduced muscle architecture compared to arboreal, nocturnal rodents. We examined the mystacial whisker layout, musculature and movement capacity of Guinea pig (Cavia porcellus) whiskers and found that they did indeed have a disorganized whisker layout, with a fortification around the eye area. In addition, there was a reduction in musculature, especially in the intrinsic muscles. Despite guinea pigs not cyclically moving their whiskers, the mystacial musculature was still very similar to that of murid rodents. We suggest that the conserved presence of whisker layout and musculature, even in visual mammals such as primates and guinea pigs, may indicate that whiskers still play an important role in these animals, including protecting the eyes and being involved in tactile social behaviors. Anat Rec, 300:527-536, 2017. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

  9. Evaluating the clinical and physiological effects of long term ultraviolet B radiation on guinea pigs (Cavia porcellus).

    Science.gov (United States)

    Watson, Megan K; Stern, Adam W; Labelle, Amber L; Joslyn, Stephen; Fan, Timothy M; Leister, Katie; Kohles, Micah; Marshall, Kemba; Mitchell, Mark A

    2014-01-01

    Vitamin D is an important hormone in vertebrates. Most animals acquire this hormone through their diet, secondary to exposure to ultraviolet B (UVB) radiation, or a combination thereof. The objectives for this research were to evaluate the clinical and physiologic effects of artificial UVB light supplementation on guinea pigs (Cavia porcellus) and to evaluate the long-term safety of artificial UVB light supplementation over the course of six months. Twelve juvenile acromelanic Hartley guinea pigs were randomly assigned to one of two treatment groups: Group A was exposed to 12 hours of artificial UVB radiation daily and Group B received only ambient fluorescent light for 12 hours daily. Animals in both groups were offered the same diet and housed under the same conditions. Blood samples were collected every three weeks to measure blood chemistry values, parathyroid hormone, ionized calcium, and serum 25-hydroxyvitamin D3 (25-OHD3) levels. Serial ophthalmologic examinations, computed tomography scans, and dual energy x-ray absorptiometry scans were performed during the course of the study. At the end of the study the animals were euthanized and necropsied. Mean ± SD serum 25-OHD3 concentrations differed significantly in the guinea pigs (pguinea pigs to UVB radiation long term significantly increased their circulating serum 25-OHD3 levels, and that this increase was sustainable over time. Providing guinea pigs exposure to UVB may be an important husbandry consideration that is not currently recommended.

  10. Radon anomalies precursory to the 2003 Mw = 6.8 Chengkung and 2006 Mw = 6.1 Taitung earthquakes in Taiwan

    International Nuclear Information System (INIS)

    Kuo, T.; Lin, C.; Fan, K.; Chang, G.; Lewis, C.; Han, Y.; Wu, Y.; Chen, W.; Tsai, C.

    2009-01-01

    Contrary to the normally observed increase in groundwater radon that occurs prior to earthquakes, we have measured anomalous decreases in radon concentration prior to the 2003 M W = 6.8 Chengkung and 2006 M W = 6.1 Taitung earthquakes that occurred within a 55 km radius from the Antung D1 monitoring well in eastern Taiwan. The v-shaped pattern of radon anomalies recognized at Antung is valuable for detecting the aseismic strain precursory to potentially disastrous earthquakes in a fractured aquifer surrounded by ductile aquitard in seismotectonic environments in this area.

  11. A Precision measurement of the $W$ boson decaying to $\

    Energy Technology Data Exchange (ETDEWEB)

    Sengupta, Sinjini [Florida State U.

    2006-01-01

    This dissertation describes a measurement of the muon charge asymmetry from W boson decays. The charge asymmetry provides useful information about the momentum distribution of u and d quarks inside the proton. The charge asymmetry was measured using ≈ 230 pb-1 of data collected between 2002 and 2004 using the DØ detector at the Tevatron collider at Fermi National Accelerator Laboratory. In the Tevatron, protons and antiprotons collide with a center of mass energy of 1.96 TeV. The signal consists of one high transverse momentum muon and missing transverse energy while the background which comes from other events also producing a high transverse momentum muon. As the charge asymmetry depends on the number of positive and negative muons from the W boson decay in each bin of pseudorapidity, the background are removed. The resultant distribution is compared with predictions from NLO calculations using the CTEQ6.1M and the MRST02 PDFs. This is the first approved result for the W charge asymmetry from DØ.

  12. Miejsce muzeów w turystyce kulturowej w Polsce

    OpenAIRE

    Krakowiak, Beata

    2013-01-01

    The article presents the museums, their potential and their significance for cultural tourism in Poland. Its aims are achieved through a presentation of registered national museums, ‘monuments of history’, museum buildings and the cultural activities undertaken by these institutions Artykuł dotyczy potencjału muzealnego oraz jego znaczenia dla turystyki kulturowej w Polsce. Zamierzone cele pracy realizowane są poprzez prezentację muzeów rejestrowanych, narodowych, muzeów-pomników histor...

  13. Ingestion et digestibilité in vivo du Panicum maximum associé à trois compléments: tourteau de Jatophra curcas, tourteau de coton Gossypium hirsutum et Euphorbia heterophylla chez le cobaye Cavia porcellus L

    Directory of Open Access Journals (Sweden)

    N'G.D.V. Kouakou

    2010-01-01

    Full Text Available The Intake and the in vivo Digestibility of Panicum maximum Associated with Three Supplements: Jatophra curcas Cake, Gossypium hirsutum Cake and Euphorbia heterophylla (Euph in Guinea Pigs (Cavia porcellus L.. The intake and the in vivo digestibility of Panicum maximum associated with three supplements: Jatropha curcas cake, Gossypium hirsutum cake and Euphorbia heterophylla (Euph in guinea pigs (Cavia porcellus L. pigs, its association with Panicum maximum could be popularized wherever its abundance has been reported. In order used weed Euphorbia heterophylla in guinea pigs diet, comparative study of the intake and the in vivo digestibility of four treatments, Panicum maximum (Pan, Panicum maximum and Gossypium hirsutum cake (Pancoton, Panicum maximum and Euphorbia heterophylla (Paneuph and Panicum maximum and Jatropha curcas cake (Panjatro, in male guinea pigs were conducted in Yamoussoukro (Ivory Coast. The means of the intake (g DM/d were 64.8 ± 12.5; 74.3 ± 12.9; 73.7 ± 17.8 and 69.1 ± 12.3 respectively for Pan, Pancoton, Paneuph and Panjatro. Pancoton and Paneuph were significantly better ingested than Pan and Panjatro. Euphorbia heterophylla was significantly better ingested than the other two supplements (P< 0.05 and the mean daily weight gain with its association with Panicum maximum of 3.1 ± 0.6 g/d. The rate of substitution of Panicum maximum by Euphorbia heterophylla was nearly to one (1. The apparent digestibility coefficients (ADC for dry (68.0 ± 10.5% and organic matter (84.1 ± 5.2% of Paneuph were significantly higher (P< 0.05 than the ADC's for the other three treatments. Given the nutritional value of Euphorbia heterophylla in guinea pigs, its association with Panicum maximum could be popularized wherever its abundance has been reported.

  14. Growth inhibition of Aeromonas salmonicida and Yersinia ruckeri by disinfectants containing peracetic acid.

    Science.gov (United States)

    Meinelt, Thomas; Phan, Thy-My; Behrens, Sascha; Wienke, Andreas; Pedersen, Lars-Flemming; Liu, Dibo; Straus, David L

    2015-04-08

    Peracetic acid (PAA) is a therapeutic agent used for disinfection in aquaculture, but it must be investigated thoroughly in order to mitigate diseases without harming the fish. Successful disinfectants (like PAA) should not leave dangerous residues in the environment in order to successfully contribute to sustainable aquaculture. The aim of our study was to compare the effectiveness of 6 commercial PAA products with different molecular PAA:H2O2 ratios to reduce bacterial growth of Aeromonas salmonicida and Yersinia ruckeri and to determine effective concentrations and exposure times. All products reduced colony-forming units (CFUs) of A. salmonicida and Y. ruckeri. Products with higher molecular PAA:H2O2 ratios inhibited growth better than products with lower molecular PAA:H2O2 ratios at the same PAA concentration; this indicates that H2O2 is not the driving force in the reduction of A. salmonicida and Y. ruckeri growth by PAA in vitro. The practical application of the products with high molecular PAA:H2O2 ratios should be prioritized if these pathogens are diagnosed.

  15. The LBP Gene and Its Association with Resistance to Aeromonas hydrophila in Tilapia

    Science.gov (United States)

    Fu, Gui Hong; Liu, Feng; Xia, Jun Hong; Yue, Gen Hua

    2014-01-01

    Resistance to pathogens is important for the sustainability and profitability of food fish production. In immune-related genes, the lipopolysaccharide-binding protein (LBP) gene is an important mediator of the inflammatory reaction. We analyzed the cDNA and genomic structure of the LBP gene in tilapia. The full-length cDNA (1901 bp) of the gene contained a 1416 bp open reading frame, encoding 471 amino acid residues. Its genomic sequence was 5577 bp, comprising 15 exons and 14 introns. Under normal conditions, the gene was constitutively expressed in all examined tissues. The highest expression was detected in intestine and kidney. We examined the responses of the gene to challenges with two bacterial pathogens Streptcoccus agalactiae and Aeromonas hydrophila. The gene was significantly upregulated in kidney and spleen post-infection with S. agalactiae and A. hydrophila, respectively. However, the expression profiles of the gene after the challenge with the two pathogens were different. Furthermore, we identified three SNPs in the gene. There were significant associations (p tilapia resistant to A. hydrophila. PMID:25470022

  16. Roles of phagocytosis activating protein (PAP) in Aeromonas hydrophila infected Cyprinus carpio.

    Science.gov (United States)

    Wonglapsuwan, Monwadee; Kongmee, Pataraporn; Suanyuk, Naraid; Chotigeat, Wilaiwan

    2016-06-01

    Cyprinus carpio (koi) is one of the most popular ornamental fish. A major problem for C. carpio farming is bacterial infections especially by Aeromonas hydrophila. Previously studies had shown that the Phagocytosis Activating Protein (PAP) gene was involved in the innate immune response of animals. Therefore, we attempted to identify a role for the PAP gene in the immunology of C. carpio. The expression of the PAP was found in C. carpio whole blood and increased when the fish were stimulated by inactivated A. hydrophila. In addition, PAP-phMGFP DNA was injected as an immunostimulant. The survival rate and the phagocytic index were significantly increased in the A. hydrophila infected fish that received the PAP-phMGFP DNA immunostimulant. A chitosan-PAP-phMGFP nanoparticle was then developed and feeded into fish which infected with A. hydrophila. These fish had a significantly lower mortality rate than the control. Therefore, this research confirmed a key role for PAP in protection fish from bacterial infection and the chitosan-PAP-phMGFP nanoparticle could be a good prototype for fish immunostimulant in the future. Copyright © 2016 Elsevier Ltd. All rights reserved.

  17. Angiogeneza w reumatoidalnym zapaleniu stawów

    Directory of Open Access Journals (Sweden)

    Anna Kotulska

    2011-02-01

    Full Text Available Angiogeneza jest procesem powstawania nowych włosowatychnaczyń krwionośnych z uprzednio istniejących włośniczek. Angiogenezawystępuje w życiu pozapłodowym i jest regulowana przezzespół czynników proangiogennych i antyangiogennych (tab. I.Zwiększona angiogeneza towarzyszy kilku stanom chorobowym. Jestniezbędna dla wzrostu nowotworów złośliwych. Choroby nienowotworowe,w tym reumatoidalne zapalenie stawów, są także związanez nasiloną angiogenezą. Wykazano tworzenie nowych naczyńw zmienionej zapalnie błonie maziowej stawów, co jest najważniejszązmianą patologiczną u chorych na reumatoidalne zapalenie stawów.U chorych stwierdzono zaburzoną regulację czynników proangiogennychi hamujących ten proces. Leki hamujące zapalenie błonymaziowej bezpośrednio lub pośrednio ograniczają angiogenezę.Możliwe jest, że oddziaływanie na proces angiogenezy będzie stanowićjeden z mechanizmów terapeutycznych leków stosowanychu chorych na reumatoidalne zapalenie stawów.

  18. Micromamiferos andinos holocenicos del sitio arqueologico Inca Cueva 5, Ju Juy, Argentina: tafonomia, zoogeografia y reconstruccion paleoambiental

    OpenAIRE

    Ortiz, P. E.; Teta, P.

    2002-01-01

    A micromammal archaeological sequence (2120 f 120 to 780 f 100 years BP) from Inca Cueva 5 site (23" 05' S - 65" 27' W; 3700 m.a.s.l., Jujuy Province, Argentina) was studied. The following mammalian taxa were recorded: Order Didelphimorphia, Family Didelphidae, Thylamys cf. T. pallidior; Order Rodentia, Family Muridae, Akodon cf. A. albiventer, Andinomys edax, Auliscomys sublimis, Calomys lepidus, Neotomys ebriosus, Phyllotis sp.; Family Caviidae, Cavia cf. C. tschudii, Galea musteloides; Fam...

  19. GRAMÍNEAS TROPICALES EN EL ENGORDE DE CUYES MEJORADOS SEXADOS (Cavia porcellus Linnaeus EN LA ZONA DE LA MANÁ

    Directory of Open Access Journals (Sweden)

    Adolfo Sánchez Laiño

    2009-06-01

    Full Text Available La investigación de gramíneas tropicales en el engorde de cuyes en la zona de La Maná. La misma que persiguió los siguientes objetivos: Incrementar los índices productivos en cuyes (Cavia porcellus Linnaeus peruanos mejorados bajo el efecto del consumo del pasto saboya (Panicum maximun Jack, hojas de maíz (Zea mays y caña de azúcar (Saccharum officinarum L en la zona de La Maná, y determinar la rentabilidad de los tratamientos. Se utilizaron 48 cuyes peruanos mejorados sexados de 35 días de edad con un peso promedio de 305 g. Se aplicó un arreglo factorial 2 (sexo x 3 (gramíneas con cuatro repeticiones, dentro de un (DBCA. Para las comparaciones entre medidas se utilizó la prueba de Tukey al 0.05% de probabilidad. Para obtener la rentabilidad de los tratamientos se utilizó la Relación Beneficio–Costo. Se evaluó el: consumo de gramíneas (g, consumo de alimento (g, ganancia de peso (g, conversión alimenticia, peso vivo (g y rendimiento a la canal (%. Los cuyes machos presentaron el mayor (P0.05 no se vio afectado por el efecto del consumo de gramíneas. La mayor rentabilidad la registraron los cuyes machos alimentados con hoja de maíz + balanceado (52.4%.

  20. 40 CFR 61.19 - Circumvention.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 8 2010-07-01 2010-07-01 false Circumvention. 61.19 Section 61.19 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) NATIONAL EMISSION STANDARDS FOR HAZARDOUS AIR POLLUTANTS General Provisions § 61.19 Circumvention. No owner or...

  1. 10 CFR 61.4 - Communications.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Communications. 61.4 Section 61.4 Energy NUCLEAR... Provisions § 61.4 Communications. Except where otherwise specified, all communications and reports concerning...: Document Control Desk; Director, Office of Federal and State Materials and Environmental Management...

  2. 42 CFR 61.12 - Accountability.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Accountability. 61.12 Section 61.12 Public Health... FELLOWSHIPS Regular Fellowships § 61.12 Accountability. Payments shall be subject to such requirements relating to accountability as may be specified by the Surgeon General. ...

  3. 7 CFR 30.61 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Administration. 30.61 Section 30.61 Agriculture... AND STANDARDS Administration § 30.61 Administration. The Director, Tobacco Division, Agricultural... the Division and the performance of all duties assigned thereto in the administration of the Tobacco...

  4. Leucocyte profile and offspring production of guinea pig (Cavia cobaya given Anredera cordifolia leaf extract

    Directory of Open Access Journals (Sweden)

    D. Wijayanti

    2018-03-01

    Full Text Available The objective of this study was to determine leucocyte and offspring production of guinea pig (Cavia cobaya giving Anredera cordifolia leaf extract. Materials used were female 16 heads of guinea pig with body weight of 425g. The treatments were an extract of A. cordifolia leaf at doses of 0, 10, 50 and 90 mg/head, designated as T0, T1, T2 and T3, respectively. A. cordifolia leaf extract was administered orally from 10 days prepartum to 10 days postpartum. Blood was taken at 10 days prepartum and 10 days postpartum. Total birth of the offspring was observed. Data were analyzed by analysis of variance and if there was effect of treatment, then continued with Duncan multiple range test and Chi-Square test for fetal production between the given A. cordifolia leaf extract and control. The result showed that there was no significant difference for 10 days prepartum after addition of A cordifolia leaf extract treatment. The postpartum treated showed a total 50 mg/head level increaed for monocytes than that of level 0, 10 and 90 mg/head. Ten days postpartum treatment showed the total increase for leucocyte and monocytes total were 50 and 90 mg/head, respectively compared to 10 mg/head level. Total lymphocyte of 90 mg/head increased compared to level 10 and 50 mg/head. The highest total neutrophil as found at level of 50 mg/head which increased compared to the level of 0 and 10 mg/head. ProvisioningA. cordifolialeaf extract at doses level of 50 and 90 mg/head could increase litter size (P<0.05; χ2=9.267 and decreased offspring mortality (P<0.05; χ2=6.4. In conclusion, by giving 50 mg/head A. cordifolia leaf extract could increase leucocyte profile and offspring production of guinea pig.

  5. 45 CFR 61.16 - Immunity.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Immunity. 61.16 Section 61.16 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION HEALTHCARE INTEGRITY AND PROTECTION DATA BANK... Information by the Healthcare Integrity and Protection Data Bank § 61.16 Immunity. Individuals, entities or...

  6. 42 CFR 61.18 - Publications.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Publications. 61.18 Section 61.18 Public Health... FELLOWSHIPS Regular Fellowships § 61.18 Publications. Publication, distribution, and disposition of all..., that fellows shall furnish copies of such publications or other materials as may be requested by the...

  7. 78 FR 63570 - Proposed Collection; Comment Request for Forms W-8BEN, W-8BEN-E, W-8ECI, W-8EXP, and W-8IMY

    Science.gov (United States)

    2013-10-24

    ... W-8BEN, W-8BEN-E, W-8ECI, W-8EXP, and W-8IMY AGENCY: Internal Revenue Service (IRS), Treasury..., the IRS is soliciting comments concerning Form W-8BEN, Certificate of Foreign Status of Beneficial Owner for United States Tax Withholding, Form W-8BEN-E, Certificate of Status of Beneficial Owner for...

  8. Experimental infection in Cavia porcellus by infected Amblyomma ovale nymphs with Rickettsia sp. (Atlantic rainforest strain).

    Science.gov (United States)

    Brustolin, Joice Magali; da Silva Krawczak, Felipe; Alves, Marta Elena Machado; Weiller, Maria Amélia; de Souza, Camila Lopes; Rosa, Fábio Brum; Cadore, Gustavo Cauduro; Dos Anjos Lopes, Sônia Terezinha; Labruna, Marcelo Bahia; Vogel, Fernanda Silveira Flores; de Avila Botton, Sônia; Sangioni, Luís Antônio

    2018-03-01

    This study describes experimental infection of guinea pigs (Cavia porcellus) infested with naturally infected Amblyomma ovale nymphs with Rickettsia sp. (Atlantic rainforest strain), and the capacity of A. ovale nymphs to transmit this bacterium. Twenty-six guinea pigs were divided into the following groups: G1, 10 animals infested with uninfected A. ovale nymphs; G2, 10 animals infested with nymphs infected with Rickettsia sp. (Atlantic rainforest strain); and G3, 6 animals without tick infestation. Blood samples were taken 7, 14, 21, and 28 days post-infestation for serological and hematological tests. For histopathological analysis and rickettsial DNA detection, fragments of the spleen, lung, brain, and liver were harvested after euthanasia. The average feeding period for nymphs was 6.6 days for G1 and 6 days for G2. Hemolymph and PCR assays, performed to detect the causative agent in ticks, indicated that in G1, all ticks were negative, and in G2, all nymphs were positive by PCR and 80% (8/10) was positive by hemolymph tests. The only clinical change was skin scarring at the tick attachment site. Hematological parameters indicated leukopenia and total plasma protein (TPP) increased with decreased platelets in G1. In G2, leukocytosis, neutrophilia, monocytosis, an increase in platelets, and reduced TPP were observed. Only G2 guinea pigs were seroconverted (80%; 8/10). Histopathology tests indicated mild, diffuse hemosiderosis and mild, multifocal, follicular hyperplasia in the spleen. Molecular analysis did not detect Rickettsia sp. DNA in C. porcellus tissues. We demonstrated the capacity of A. ovale nymphs to transmit Rickettsia sp. (Atlantic rainforest strain) to guinea pigs.

  9. Use of recombinant human thyroid-stimulating hormone for evaluation of thyroid function in guinea pigs (Cavia porcellus).

    Science.gov (United States)

    Mayer, Jörg; Wagner, Robert; Mitchell, Mark A; Fecteau, Kellie

    2013-02-01

    To evaluate the effects of administration of recombinant human (rh) thyroid-stimulating hormone (TSH) for evaluation of thyroid function in euthyroid guinea pigs (Cavia porcellus). Prospective, experimental study. 10 healthy, sexually intact, pet guinea pigs (approx 1 year of age). Guinea pigs were given rhTSH (100 μg, IM); plasma thyroxine concentrations were determined prior to and 3 and 4 hours after rhTSH injection. The animals were housed in 2 groups on the basis of sex and fed different commercial maintenance diets according to their husbandry. There was no significant difference in thyroxine concentrations between males and females before or after rhTSH injection. There was also no difference between thyroxine concentrations at 3 versus 4 hours after rhTSH injection. There was a significant difference between thyroxine concentrations before (median, 9.05 nmol/L [0.70 μg/dL]; 10% to 90% range, 7.39 to 16.99 nmol/L [0.57 to 1.32 μg/dL]) and after (mean ± SD, 23.95 ± 4.2 nmol/L) rhTSH injection. Euthyroid guinea pigs had plasma thyroxine concentrations of at least 7.30 nmol/L (0.57 μg/dL) and an increase of at least 2.6 times prestimulation thyroxine concentrations at 3 or 4 hours after stimulation. The results suggested that rhTSH administered IM can be used for the TSH stimulation testing in guinea pigs. We suggest thyroxine concentration in a euthyroid guinea pig should at least double 3 to 4 hours after rhTSH injection.

  10. 22 CFR 61.1 - Purpose.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Purpose. 61.1 Section 61.1 Foreign Relations DEPARTMENT OF STATE PUBLIC DIPLOMACY AND EXCHANGES WORLD-WIDE FREE FLOW OF AUDIO-VISUAL MATERIALS § 61.1... formally known as the Agreement for Facilitating the International Circulation of Visual and Auditory...

  11. 40 CFR 61.91 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... included. The method for calculating effective dose equivalent and the definition of reference man are... 40 Protection of Environment 8 2010-07-01 2010-07-01 false Definitions. 61.91 Section 61.91... Other Than Radon From Department of Energy Facilities § 61.91 Definitions. As used in this subpart, all...

  12. 12 CFR 4.61 - Purpose.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Purpose. 4.61 Section 4.61 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY ORGANIZATION AND FUNCTIONS, AVAILABILITY AND RELEASE...; Contracting for Goods and Services § 4.61 Purpose. Pursuant to the Financial Institutions Reform, Recovery...

  13. 47 CFR 61.86 - Supplements.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 3 2010-10-01 2010-10-01 false Supplements. 61.86 Section 61.86... Rules for Tariff Publications of Dominant and Nondominant Carriers § 61.86 Supplements. A carrier may not file a supplement except to suspend or cancel a tariff publication, or to defer the effective date...

  14. Firmy rodzinne w Polsce w dobie globalizacji

    OpenAIRE

    Zalewska, Agnieszka

    2016-01-01

    Celem publikacji jest ukazanie dorobku naukowego, głównie polskich i ukraińskich uczonych, w zakresie uwarunkowań procesów i rezultatów internacjonalizacji przedsiębiorstw oraz jej wpływu na funkcjonowanie biznesu w dobie globalizacji. Opracowanie stanowi istotny wkład w zakresie teorii i praktyki w proces restrukturyzacji przedsiębiorstw w kierunku ich internacjonalizacji. Może posłużyć jako inspiracja do stworzenia strategii opartej na poszukiwaniach (prospector strategy), co będzie sprzyja...

  15. Production of Single W Bosons at LEP

    CERN Document Server

    Acciarri, M; Aguilar-Benítez, M; Ahlen, S P; Alpat, B; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alverson, G; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Banerjee, S; Banicz, K; Barillère, R; Barone, L; Bartalini, P; Baschirotto, A; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Bilei, G M; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böck, R K; Böhm, A; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brigljevic, V; Brock, I C; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Busenitz, J K; Button, A M; Cai, X D; Campanelli, M; Capell, M; Cara Romeo, G; Caria, M; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chan, A; Chang, Y H; Chaturvedi, U K; Chekanov, S V; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chéreau, X J; Chiefari, G; Chien, C Y; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Cohn, H O; Coignet, G; Colijn, A P; Colino, N; Commichau, V; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Dai, T S; D'Alessandro, R; De Asmundis, R; Degré, A; Deiters, K; Della Volpe, D; Denes, P; De Notaristefani, F; DiBitonto, Daryl; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Drago, E; Duchesneau, D; Duinker, P; Durán, I; Dutta, S; Easo, S; Efremenko, Yu V; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Ernenwein, J P; Extermann, Pierre; Fabre, M; Faccini, R; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Fenyi, B; Ferguson, T; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Forconi, G; Fredj, L; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Goldfarb, S; Goldstein, J; Gong, Z F; Gougas, Andreas; Gratta, Giorgio; Grünewald, M W; Gupta, V K; Gurtu, A; Gutay, L J; Hartmann, B; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Van Hoek, W C; Hofer, H; Hong, S J; Hoorani, H; Hou, S R; Hu, G; Innocente, Vincenzo; Jenkes, K; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Kasser, A; Khan, R A; Kamrad, D; Kamyshkov, Yu A; Kapustinsky, J S; Karyotakis, Yu; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, D H; Kim, J K; Kim, S C; Kim, Y G; Kinnison, W W; Kirkby, A; Kirkby, D; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Korolko, I; Koutsenko, V F; Krämer, R W; Krenz, W; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lapoint, C; Lassila-Perini, K M; Laurikainen, P; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Le Goff, J M; Leiste, R; Leonardi, E; Levchenko, P M; Li Chuan; Lieb, E H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lu, W; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Majumder, G; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Mangla, S; Marchesini, P A; Marin, A; Martin, J P; Marzano, F; Massaro, G G G; McNally, D; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Mi, Y; Mihul, A; Van Mil, A J W; Mirabelli, G; Mnich, J; Molnár, P; Monteleoni, B; Moore, R; Morganti, S; Moulik, T; Mount, R; Müller, S; Muheim, F; Muijs, A J M; Nagy, E; Nahn, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nippe, A; Nisati, A; Nowak, H; Oh, Yu D; Opitz, H; Organtini, G; Ostonen, R; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Park, H K; Park, I H; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Peach, D; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petersen, B; Petrak, S; Pevsner, A; Piccolo, D; Pieri, M; Pinto, J C; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Produit, N; Prokofev, D; Prokofiev, D O; Rahal-Callot, G; Rancoita, P G; Rattaggi, M; Raven, G; Razis, P A; Read, K; Ren, D; Rescigno, M; Reucroft, S; Van Rhee, T; Riemann, S; Riles, K; Robohm, A; Rodin, J; Roe, B P; Romero, L; Rosier-Lees, S; Rosselet, P; Van Rossum, W; Roth, S; Rubio, Juan Antonio; Ruschmeier, D; Rykaczewski, H; Salicio, J; Sánchez, E; Sanders, M P; Santocchia, A; Sarakinos, M E; Sarkar, S; Sassowsky, M; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Schmitz, P; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schwenke, J; Schwering, G; Sciacca, C; Sciarrino, D; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Sopczak, André; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, H; Stoyanov, B; Strässner, A; Strauch, K; Sudhakar, K; Sultanov, G G; Sun, L Z; Susinno, G F; Suter, H; Swain, J D; Tang, X W; Tauscher, Ludwig; Taylor, L; Ting, Samuel C C; Ting, S M; Tonutti, M; Tonwar, S C; Tóth, J; Tully, C; Tuchscherer, H; Tung, K L; Uchida, Y; Ulbricht, J; Uwer, U; Valente, E; Van de Walle, R T; Vesztergombi, G; Vetlitskii, I; Viertel, Gert M; Vivargent, M; Völkert, R; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, J C; Wang, X L; Wang, Z M; Weber, A; Wittgenstein, F; Wu, S X; Wynhoff, S; Xu, J; Xu, Z Z; Yang, B Z; Yang, C G; Yao, X Y; Ye, J B; Yeh, S C; You, J M; Zalite, A; Zalite, Yu; Zemp, P; Zeng, Y; Zhang, Z; Zhang, Z P; Zhou, B; Zhu, G Y; Zhu, R Y; Zichichi, Antonino; Ziegler, F

    1997-01-01

    We report on the observation of single W boson production in a data sample collected by the L3 detector at LEP2. The signal consists of large missing energy final states with a single energetic lepton or two hadronic jets. The cross-section is measured to be $0.61^{+0.43}_{-0.33} \\pm 0.05 \\; \\rm{pb}$ at the centre of mass energy $\\sqrt{s}=172 \\GeV{}$, consistent with the Standard Model expectation. From this measurement the following limits on the anomalous $\\gamma$WW gauge couplings are derived at 95\\% CL: $\\rm -3.6 < \\Delta \\kappa_\\gamma < 1.5$ and $\\rm -3.6 < \\lambda_\\gamma < 3.6$.

  16. Lectures on W algebras and W gravity

    International Nuclear Information System (INIS)

    Pope, C.N.

    1992-01-01

    We give a review of the extended conformal algebras, known as W algebras, which contain currents of spins higher than 2 in addition to the energy-momentum tensor. These include the non-linear W N algebras; the linear W ∞ and W 1+∞ algebras; and their super-extensions. We discuss their applications to the construction of W-gravity and W-string theories. (author). 46 refs

  17. Genome-based insights into the resistome and mobilome of multidrug-resistant Aeromonas sp. ARM81 isolated from wastewater.

    Science.gov (United States)

    Adamczuk, Marcin; Dziewit, Lukasz

    2017-01-01

    The draft genome of multidrug-resistant Aeromonas sp. ARM81 isolated from a wastewater treatment plant in Warsaw (Poland) was obtained. Sequence analysis revealed multiple genes conferring resistance to aminoglycosides, β-lactams or tetracycline. Three different β-lactamase genes were identified, including an extended-spectrum β-lactamase gene bla PER-1 . The antibiotic susceptibility was experimentally tested. Genome sequencing also allowed us to investigate the plasmidome and transposable mobilome of ARM81. Four plasmids, of which two carry phenotypic modules (i.e., genes encoding a zinc transporter ZitB and a putative glucosyltransferase), and 28 putative transposase genes were identified. The mobility of three insertion sequences (isoforms of previously identified elements ISAs12, ISKpn9 and ISAs26) was confirmed using trap plasmids.

  18. Characterization of class 1 integrons associated with R-plasmids in clinical Aeromonas salmonicida isolates from various geographical areas

    DEFF Research Database (Denmark)

    Schmidt, A.S.; Bruun, Morten Sichlau; Larsen, J.L.

    2001-01-01

    Class 1 integrons were found in 26 of 40 antibiotic-resistant isolates of the fish pathogen Aeromonas salmonicida from Northern Europe and North America. Three different dhfr genes, conferring trimethoprim resistance, and one ant(3 " )1a aminoglycoside resistance gene were identified as gene...... inserts. The gene cassettes tended to be conserved among isolates from a particular geographical area. Nineteen isolates transferred R- plasmids carrying different tet determinants to Escherichia coli in filter mating assays, and in 15 cases, the class 1 integrons were co-transferred. Transferable...... sulphadiazine, trimethoprim and streptomycin resistances were invariably encoded by integrons. It thus appears that integron-encoded antibiotic resistance genes contribute substantially to the horizontal spread of antimicrobial resistance within this species, being associated with conjugative plasmids....

  19. 25 CFR 61.15 - Special instructions.

    Science.gov (United States)

    2010-04-01

    ... Secretary may issue special instructions not inconsistent with the regulations in this part 61. ... 25 Indians 1 2010-04-01 2010-04-01 false Special instructions. 61.15 Section 61.15 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR TRIBAL GOVERNMENT PREPARATION OF ROLLS OF INDIANS § 61...

  20. 40 CFR 61.44 - Stack sampling.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 8 2010-07-01 2010-07-01 false Stack sampling. 61.44 Section 61.44 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) NATIONAL... Firing § 61.44 Stack sampling. (a) Sources subject to § 61.42(b) shall be continuously sampled, during...

  1. 40 CFR 61.21 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... dose equivalent and the definition of reference man are outlined in the International Commission on... 40 Protection of Environment 8 2010-07-01 2010-07-01 false Definitions. 61.21 Section 61.21... Underground Uranium Mines § 61.21 Definitions. As used in this subpart, all terms not defined here have the...

  2. 29 CFR Appendix A to Subpart W to... - Figures W-14 through W-28

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 8 2010-07-01 2010-07-01 false Figures W-14 through W-28 A Appendix A to Subpart W to part 1926 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION...; Overhead Protection Pt. 1926, Subpt. W, App. A Appendix A to Subpart W to part 1926—Figures W-14 through W...

  3. Występowanie dyskinez w przebiegu choroby Parkinsona leczonej preparatami lewodopy

    Directory of Open Access Journals (Sweden)

    Marzena Zaborowska

    2012-04-01

    Full Text Available Wstęp: Celem pracy była ocena występowania dyskinez podczas wieloletniego leczenia preparatami lewodopy u pacjentów z chorobą Parkinsona. Materiał i metody: Materiał kliniczny stanowiło 103 chorych z chorobą Parkinsona (54 z dyskinezami, 49 bez dyskinez, w podobnej grupie wiekowej (64,37±6,94 vs 64,94±6,81 roku. Stan kliniczny oceniano wg skali Hoehn-Yahra, Unified Parkinson’s Disease Rating Scale (UPDRS, Mini-Mental State Examination (MMSE. W każdym przypadku wykonywano badanie tomografii komputerowej głowy w celu oceny zaników mózgu lub obecności zmian naczyniopochodnych. Dodatkowo wzięto pod uwagę obecność czynników ryzyka, takich jak: nadciśnienie tętnicze, hipercholesterolemia, choroba niedokrwienna serca, cukrzyca. Wyniki: Chorzy z dyskinezami charakteryzowali się częstszym występowaniem nadciśnienia tętniczego, choroby niedokrwiennej serca, hipercholesterolemii i cukrzycy. W tej samej populacji stwierdzono częstszą obecność zaników korowych w tomografii komputerowej mózgu w porównaniu z grupą odniesienia (25 vs 8. Wśród chorych z dyskinezami dawki lewodopy były wyższe (1013,43±260,61 vs 877,55±216,46 mg, a czas leczenia dłuższy o średnio 2 lata. Wartości oceny w skali Hoehn-Yahra i UPDRS były zbliżone. Wnioski: W badaniach własnych u pacjentów z chorobą Parkinsona dyskinezy występowały częściej w przypadkach bardziej zaawansowanego procesu neurozwyrodnieniowego, co wiązało się z dłuższym czasem trwania objawów oraz stosowaniem wyższych dawek lewodopy. Korelowało to z częstszym w tej grupie występowaniem dodatkowych czynników ryzyka.

  4. 21 CFR 808.61 - Hawaii.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Hawaii. 808.61 Section 808.61 Food and Drugs FOOD... and Local Exemptions § 808.61 Hawaii. (a) The following Hawaii medical device requirements are... from preemption under section 521(b) of the act: Hawaii Revised Statutes, chapter 451A, § 14.1...

  5. Hafty w sztambuchach Biblioteki Uniwersyteckiej w Poznaniu

    Directory of Open Access Journals (Sweden)

    Karolina Nowaczyk

    2011-01-01

    Full Text Available W artykule przedstawiono hafty znajdujące się w sztambuchach z XVIII i XIX wieku pochodzących ze zbiorów Biblioteki Uniwersyteckiej w Poznaniu. Omówione zostały zarówno technika wykonania haftów, jak i ich wartość artystyczna, a także znaczenie wskazanych przykładów dla historii hafciarstwa amatorskiego na ziemiach polskich. Artykuł jest jednocześnie próbą zwrócenia uwagi na istniejącą w tamtym okresie sztukę hafciarską o wyłącznie amatorskim charakterze oraz na kopiowanie i powtarzalność wzorów, co pozwala na określenie ich jako typowych dla danej epoki.

  6. Effect of guava leaves on the growth performance and cytokine gene expression of Labeo rohita and its susceptibility to Aeromonas hydrophila infection.

    Science.gov (United States)

    Giri, Sib Sankar; Sen, Shib Sankar; Chi, Cheng; Kim, Hyoun Joong; Yun, Saekil; Park, Se Chang; Sukumaran, V

    2015-10-01

    The present study aimed to evaluate the effects of Psidium guajava L. (guava) leaves on the growth and immune response of the fish species Labeo rohita and its susceptibility to Aeromonas hydrophila infection. Diets containing five different concentrations of guava leaves (0% [basal diet], 0.1% [G1], 0.5% [G2], 1% [G3], and 1.5% [G4]) were fed to fish (average weight: 11.1 g) for 60 days. Various growth and immune parameters were examined 60 days post-feeding. Fish were challenged with A. hydrophila at the end of the trial, and mortalities were recorded over 15 days post-infection. We found that growth parameters such as percent weight gain (657.61 ± 9.74) and specific growth rate (3.37 ± 0.021) were significantly higher in G2 group than in the control (P guava leaves at any concentration on plasma IgM level. Of the cytokine-related genes examined, interleukin-1beta (IL-1β) and tumour necrosis factor-alpha (TNF-α) were up-regulated in the head-kidney, intestine, and hepatopancreas of fish fed experimental diets, and expression was significantly higher in G2 and G3 than in the control group. In contrast, gene expression of IL-10, transforming growth factor-beta (TGF-β), inducible nitric oxide synthase (iNOS), cyclooxygenase-2 (COX-2), and transcription factor nuclear factor-κB (NF-κB) were down-regulated in the treatment groups. Moreover, fish fed the G2 diet exhibited a significantly higher post-challenge survival rate (66.66%). Collectively, these results suggest that dietary supplementation with guava leaves (at 0.5% concentration) could promote growth performance and strengthen immunity of L. rohita. Guava leaves therefore represent a promising feed additive for carps in aquaculture. Copyright © 2015 Elsevier Ltd. All rights reserved.

  7. In Azospirillum brasilense, mutations in flmA or flmB genes affect polar flagellum assembly, surface polysaccharides, and attachment to maize roots.

    Science.gov (United States)

    Rossi, Fernando Ariel; Medeot, Daniela Beatriz; Liaudat, Juan Pablo; Pistorio, Mariano; Jofré, Edgardo

    2016-09-01

    Azospirillum brasilense is a soil bacterium capable of promoting plant growth. Several surface components were previously reported to be involved in the attachment of A. brasilense to root plants. Among these components are the exopolysaccharide (EPS), lipopolysaccharide (LPS) and the polar flagellum. Flagellin from polar flagellum is glycosylated and it was suggested that genes involved in such a posttranslational modification are the same ones involved in the biosynthesis of sugars present in the O-antigen of the LPS. In this work, we report on the characterization of two homologs present in A. brasilense Cd, to the well characterized flagellin modification genes, flmA and flmB, from Aeromonas caviae. We show that mutations in either flmA or flmB genes of A. brasilense resulted in non-motile cells due to alterations in the polar flagellum assembly. Moreover, these mutations also affected the capability of A. brasilense cells to adsorb to maize roots and to produce LPS and EPS. By generating a mutant containing the polar flagellum affected in their rotation, we show the importance of the bacterial motility for the early colonization of maize roots. Copyright © 2016 Elsevier GmbH. All rights reserved.

  8. Ekspansja muzeów w Europie Środkowej?

    Directory of Open Access Journals (Sweden)

    Jagodzińska, Katarzyna

    2015-06-01

    Full Text Available Przedmiotem artykułu są rozważania na temat specyfiki Europy Środkowej w zakresie kolekcji i muzeów sztuki współczesnej oraz możliwość stworzenia alternatywy regionalnej dla krajów zachodnich. Kontekstem dla tych rozważań jest ekspansjonistyczna polityka współczesnych muzeów, która w związku z licznymi nowymi inwestycjami – w szczególności Luwru, Fundacji Guggenheima, Ermitażu – budzi w świecie muzeologicznym różnorakie dylematy. Autorka omawia światowe "marki muzealne" inwestujące w Europie Środkowej, zastanawia się nad skutkami ekspansji tych "koncernów" dla kultury w regionie, wskazuje też na potencjał regionu, który można wykorzystać bez posiłkowania się nazwiskami światowych kolekcjonerów.

  9. 46 CFR 61.20-15 - Tailshaft examination.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Tailshaft examination. 61.20-15 Section 61.20-15... INSPECTIONS Periodic Tests of Machinery and Equipment § 61.20-15 Tailshaft examination. The rules in §§ 61.20-15 through 61.20-23 apply only to vessels in ocean and coastwise service. Each examination...

  10. Multiple drug resistance of Aeromonas hydrophila isolates from Chicken samples collected from Mhow and Indore city of Madhyapradesh

    Directory of Open Access Journals (Sweden)

    Kaskhedikar

    2009-02-01

    Full Text Available Fourteen antibacterial agents belonging to 9 different groups of antibiotics viz. aminoglycosides, cephalosporins, nitrofurantoin, fluroquinolones, chloramphenicol, sulphonamides, tetracyclines, penicillin and polymixin were used for in vitro sensitivity testing of Aeromonas hydrophila isolated from fifteen samples of chicken collected from retail shops in Mhow city. The sensitivity (100% was attributed to ciprofloxacin, cefuroxime, ceftriaxone, cephotaxime, chloramphenicol, gentamycin, kanamycin, nitrofurantoin, nalidixic acid and ofloxacin followed by oxytetracycline (50%. All the isolates were resistant to ampicillin and colistin antibiotics. That means, none of the isolates were found to be sensitive for penicillin and polymixin group of antibiotics. Multiple drug resistance was also observed in all A. hydrophila isolates. Out of total isolates, 100% were resistant to two antimicrobial drugs and 50% to three drugs. [Vet. World 2009; 2(1.000: 31-32

  11. Hericium caput-medusae (Bull.:Fr.) Pers. polysaccharide enhance innate immune response, immune-related genes expression and disease resistance against Aeromonas hydrophila in grass carp (Ctenopharyngodon idella).

    Science.gov (United States)

    Gou, Changlong; Wang, Jiazhen; Wang, Yuqiong; Dong, Wenlong; Shan, Xiaofeng; Lou, Yujie; Gao, Yunhang

    2018-01-01

    The objective was to add 0, 400, 800 or 1200 mg/kg of Hericium caput-medusae polysaccharide (HCMP) to the basal diet of grass carp (Ctenopharyngodon idella) and determine effects on humoral innate immunity, expression of immune-related genes and disease resistance. Adding HCMP enhanced (P < 0.05) bactericidal activity at 1, 2 and 3 weeks and also lysozyme activity, complement C3, and SOD activity at 2 and 3 weeks. Supplementing 800 or 1200 mg/kg of HCMP for 2 or 3 weeks increased (P < 0.05) serum concentrations of total protein, albumin and globulin. Two immune-related genes (IL-1β and TNF-α) were up-regulated (P < 0.05) in HCMP supplemented groups given 800 or 1200 mg/kg HCMP after 2 and 3 weeks of feeding. Expression of anti-inflammatory cytokine IL-10 was down-regulated (P < 0.05) after receiving 800 or 1200 mg/kg HCMP for 2 or 3 weeks. Fish fed 800 mg/kg HCMP had maximal disease resistance against Aeromonas hydrophila (65.4%). In conclusion, HCMP enhanced immune response and expression of immune-related genes and increased disease resistance against Aeromonas hydrophila in grass carp, with greatest effects in fish given 800 mg/kg HCMP for 3 weeks. Copyright © 2017 Elsevier Ltd. All rights reserved.

  12. 48 CFR 9904.402-61 - Interpretation.

    Science.gov (United States)

    2010-10-01

    ...-61 Section 9904.402-61 Federal Acquisition Regulations System COST ACCOUNTING STANDARDS BOARD, OFFICE OF FEDERAL PROCUREMENT POLICY, OFFICE OF MANAGEMENT AND BUDGET PROCUREMENT PRACTICES AND COST ACCOUNTING STANDARDS COST ACCOUNTING STANDARDS 9904.402-61 Interpretation. (a) 9904.402, Cost Accounting...

  13. 48 CFR 9904.401-61 - Interpretation.

    Science.gov (United States)

    2010-10-01

    ...-61 Section 9904.401-61 Federal Acquisition Regulations System COST ACCOUNTING STANDARDS BOARD, OFFICE OF FEDERAL PROCUREMENT POLICY, OFFICE OF MANAGEMENT AND BUDGET PROCUREMENT PRACTICES AND COST ACCOUNTING STANDARDS COST ACCOUNTING STANDARDS 9904.401-61 Interpretation. (a) 9904.401, Cost Accounting...

  14. Production of W + W - pairs via γ * γ * → W + W - subprocess with photon transverse momenta

    Science.gov (United States)

    Łuszczak, Marta; Schäfer, Wolfgang; Szczurek, Antoni

    2018-05-01

    We discuss production of W + W - pairs in proton-proton collisions induced by two-photon fusion including, for a first time, transverse momenta of incoming photons. The unintegrated inelastic fluxes (related to proton dissociation) of photons are calculated based on modern parametrizations of deep inelastic structure functions in a broad range of their arguments ( x and Q 2). In our approach we can get separate contributions of different W helicities states. Several one- and two-dimensional differential distributions are shown and discussed. The present results are compared to the results of previous calculations within collinear factorization approach. Similar results are found except of some observables such as e.g. transverse momentum of the pair of W + and W -. We find large contributions to the cross section from the region of large photon virtualities. We show decomposition of the total cross section as well as invariant mass distribution into the polarisation states of both W bosons. The role of the longitudinal F L structure function is quantified. Its inclusion leads to a 4-5% decrease of the cross section, almost independent of M WW .

  15. Micromamiferos andinos holocenicos del sitio arqueologico Inca Cueva 5, Ju Juy, Argentina: tafonomia, zoogeografia y reconstruccion paleoambiental

    Directory of Open Access Journals (Sweden)

    Ortiz, P. E.

    2002-08-01

    Full Text Available A micromammal archaeological sequence (2120 f 120 to 780 f 100 years BP from Inca Cueva 5 site (23" 05' S - 65" 27' W; 3700 m.a.s.l., Jujuy Province, Argentina was studied. The following mammalian taxa were recorded: Order Didelphimorphia, Family Didelphidae, Thylamys cf. T. pallidior; Order Rodentia, Family Muridae, Akodon cf. A. albiventer, Andinomys edax, Auliscomys sublimis, Calomys lepidus, Neotomys ebriosus, Phyllotis sp.; Family Caviidae, Cavia cf. C. tschudii, Galea musteloides; Family Abrocomidae, Abrocoma cinerea; Family Chinchillidae, Lagidium viscacia; Family Octodontidae, Octodontomys gliroides. The taphonomy indicates that the sequence is an owl pellet accumulation inside the cave. The general landscape corresponds to the oriental border of the Puna steppe, with scattered shrub and low brush vegetation. Near the site there are small tree groups of Polylepis australis as well as small streams covered with grass and ciperaceous vegetation known as «vegas». Al1 the recorded taxa at Inca Cueva 5 exist today in Puna and Prepuna environments from Jujuy and Salta Provinces and southem Bolivia, excepting Cavia cf. C. tschudii. The modem records of this species in northem Argentina and southern Bolivia come from localities with high montane bunchgrass prairies and forests of the humid Yungas phytogeographical region. The presence of this species in the sequence suggests wetter climatic conditions on this region when the archaeological site was originated. Later drier conditions, caused probably by anthropic influence in the last 500 years, produced the retraction of Cavia tschudii to the moist eastern side of the Andes and its disappeareance of the Puna areas.El sitio arqueológico Inca Cueva 5 se encuentra en la provincia de Jujuy, Argentina, en el borde oriental de la región de la Puna (23" 05' S - 65" 27' W; 3700 m s n m y está fechado entre 2120 f 120 y 780 f 100 años radiocarbónicos AP. El estudio de una pequeña muestra de

  16. Zmienność zasobów termicznych w Polsce w aspekcie obserwowanych zmian klimatu

    Directory of Open Access Journals (Sweden)

    Agnieszka Sulikowska

    2016-06-01

    Full Text Available Obserwowany wzrost temperatury powietrza na półkuli północnej, zwłaszcza w Europie, może prowadzić do znacznych zmian w fenologii roślin, a w konsekwencji także w produkcji rolnej. Celem pracy jest ocena zróżnicowania przestrzennego zasobów termicznych na obszarze Polski oraz ich zmienności w okresie 1951–2010 w obliczu zmieniających się warunków termicznych. Analizę przeprowadzono z wykorzystaniem dobowych wartości temperatury powietrza. Zasoby termiczne zdefiniowane zostały za pomocą sum temperatur efektywnych (Growing Degree Days – GDD obliczonych dla wartości progowych temperatury powietrza: 0°C, 5°C i 10°C. Następstwem analizy zróżnicowania przestrzennego zasobów termicznych była ocena ich zmienności wieloletniej oraz tendencji zmian. Badania objęły w szczególności regiony sadownicze odznaczające się największą powierzchnią upraw drzew owocowych oraz wielkością zbiorów jabłek, śliw i wiśni. Uzyskane wyniki potwierdzają zwiększenie zasobów termicznych na obszarze kraju, będące konsekwencją wydłużającego się okresu wegetacyjnego.

  17. Virulence Factors of Aeromonas hydrophila: in the Wake of Reclassification

    Directory of Open Access Journals (Sweden)

    Cody R Rasmussen-Ivey

    2016-08-01

    Full Text Available The ubiquitous jack-of-all-trades, Aeromonas hydrophila, is a freshwater, Gram-negative bacterial pathogen under revision in regard to its phylogenetic and functional affiliation with other aeromonads. While virulence factors are expectedly diverse across A. hydrophila strains and closely related species, our mechanistic knowledge of the vast majority of these factors is based on the molecular characterization of the strains A. hydrophila AH-3 and SSU, which were reclassified as A. piscicola AH-3 in 2009 and A. dhakensis SSU in 2013. Individually, these reclassifications raise important questions involving the applicability of previous research on A. hydrophila virulence mechanisms; however, this issue is exacerbated by a lack of genomic data on other research strains. Collectively, these changes represent a fundamental gap in the literature on A. hydrophila and confirm the necessity of biochemical, molecular, and morphological techniques in the classification of research strains that are used as a foundation for future research. This review revisits what is known about virulence in A. hydrophila and the feasibility of using comparative genomics in light of this phylogenetic revision. Conflicting data between virulence factors, secretion systems, quorum sensing, and their effect on A. hydrophila pathogenicity appears to be an artifact of inappropriate taxonomic comparisons and/or be due to the fact that these properties are strain-specific. This review audits emerging data on dominant virulence factors that are present in both A. dhakensis and A. hydrophila in order to synthesize existing data with the aim of locating where future research is needed.

  18. 14 CFR 61.99 - Aeronautical experience.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Aeronautical experience. 61.99 Section 61.99 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIRMEN CERTIFICATION: PILOTS, FLIGHT INSTRUCTORS, AND GROUND INSTRUCTORS Recreational Pilots § 61.99...

  19. 48 CFR 9904.406-61 - Interpretation.

    Science.gov (United States)

    2010-10-01

    ...-61 Section 9904.406-61 Federal Acquisition Regulations System COST ACCOUNTING STANDARDS BOARD, OFFICE OF FEDERAL PROCUREMENT POLICY, OFFICE OF MANAGEMENT AND BUDGET PROCUREMENT PRACTICES AND COST ACCOUNTING STANDARDS COST ACCOUNTING STANDARDS 9904.406-61 Interpretation. (a) Questions have arisen as to...

  20. 48 CFR 9904.403-61 - Interpretation.

    Science.gov (United States)

    2010-10-01

    ...-61 Section 9904.403-61 Federal Acquisition Regulations System COST ACCOUNTING STANDARDS BOARD, OFFICE OF FEDERAL PROCUREMENT POLICY, OFFICE OF MANAGEMENT AND BUDGET PROCUREMENT PRACTICES AND COST ACCOUNTING STANDARDS COST ACCOUNTING STANDARDS 9904.403-61 Interpretation. (a) Questions have arisen as to...

  1. 7 CFR 3016.61 - Financial reporting.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Financial reporting. 3016.61 Section 3016.61... AND LOCAL GOVERNMENTS Entitlement § 3016.61 Financial reporting. The financial reporting provisions... Food Distribution Program on Indian Reservations. The financial reporting requirements for these...

  2. Doświadczalna analiza współczynników oporów lokalnych na kolankach w systemach przewodów wielowarstwowych

    Directory of Open Access Journals (Sweden)

    Natalia Krystyna Gietka

    2015-03-01

    Full Text Available Zastosowanie tworzyw sztucznych jako materiału do budowy instalacji wymusiło konieczność weryfikacji dostępnych obecnie informacji dotyczących wartości współczynników oporów lokalnych, które stanowią niezbędną wiedzę potrzebną do obliczania wartości strat energii mechanicznej, jakie powstają w trakcie przepływu. Współczynniki te mają duże znaczenie w obliczeniach hydraulicznych wymiarowanej instalacji. Wpływają one na końcowy wynik w istotny sposób, dlatego nieprawidłowe ich przyjęcie może prowadzić do poważnych w skutkach błędów. Niestety wartości podawane przez producentów, normy czy też literaturę są inne w porównaniu z wartościami uzyskiwanymi metodą doświadczalnych badań. W artykule zaprezentowane zostały wyniki badań doświadczalnych, mających na celu wyznaczenie wartości współczynników oporów lokalnych na kolankach 90° trzech określonych średnic, pochodzących od czterech wybranych producentów systemów instalacyjnych. Otrzymane wartości współczynników oporów lokalnych porównano z wartościami, jakie podawane są przez producenta złączek, wyznaczonymi według normy PN-76/M-34034: 1976 oraz dostępnymi w literaturze przedmiotu.

  3. 75 FR 38179 - Proposed Collection; Comment Request for Forms W-8BEN, W-8ECI, W-8EXP, and W-8IMY

    Science.gov (United States)

    2010-07-01

    ... W-8BEN, W-8ECI, W- 8EXP, and W-8IMY AGENCY: Internal Revenue Service (IRS), Treasury. ACTION: Notice... soliciting comments concerning Form W-8BEN, Certificate of Foreign Status of Beneficial Owner for United States Tax Withholding, Form W-8ECI, Certificate of Foreign Person's Claim for Exemption From Withholding...

  4. 32 CFR 154.61 - Security education.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 1 2010-07-01 2010-07-01 false Security education. 154.61 Section 154.61... PERSONNEL SECURITY PROGRAM REGULATION Continuing Security Responsibilities § 154.61 Security education. (a.... Through security briefings and education, the Department of Defense continues to provide for the...

  5. 40 CFR 455.61 - Special definitions.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Special definitions. 455.61 Section 455.61 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND... § 455.61 Special definitions. Process wastewater, for this subpart, means all wastewater except for...

  6. Isolation of bacterial fish pathogen Aeromonas hydrophila and therapeutic effects of medicinal plants on its invasion

    Directory of Open Access Journals (Sweden)

    Md. Tareq-Uz-Zaman

    2014-04-01

    Full Text Available Aeromonas hydrophila, a bacterial pathogen, was isolated form Pangasius hypophthalmus. For pathogenicity test, different doses were injected intramuscularly in Barbonymus gonionotus. Crude extracts were prepared from various parts Azadirachta indica, Curcuma longa, C. zedoaria, and Callotropis gigentia and applied to B. gonionotus for 7 days. Bath treatment was done up to their tolerance level and well ventilation was confirmed for aeration and 50% water was exchanged daily. Minimum inhibitory dose was detected as 7 mg/ml. High inhibitory effect was observed in case of A. indica and mixed extract of A. indica and C. gigentia. Both A. indica and C. gigentia showed the best result with 90-95% recovery of infected fish at a dose of 7 mg/l. C. zedoaria showed moderate to weak effect with 50-60% recovery at the same dose. The present study showed that medicinal plants would be an effective control measure against A. hydrophila.

  7. A Study of $W^{+}W^{-}\\gamma$ Events at LEP

    CERN Document Server

    Abbiendi, G; Åkesson, P F; Alexander, G; Allison, J; Amaral, P; Anagnostou, G; Anderson, K J; Arcelli, S; Asai, S; Axen, D A; Azuelos, Georges; Bailey, I; Barberio, E; Barlow, R J; Batley, J Richard; Bechtle, P; Behnke, T; Bell, K W; Bell, P J; Bella, G; Bellerive, A; Benelli, G; Bethke, Siegfried; Biebel, O; Boeriu, O; Bock, P; Boutemeur, M; Braibant, S; Brigliadori, L; Brown, R M; Büsser, K; Burckhart, H J; Campana, S; Carnegie, R K; Caron, B; Carter, A A; Carter, J R; Chang, C Y; Charlton, D G; Csilling, Akos; Cuffiani, M; Dado, S; de Roeck, A; De Wolf, E A; Desch, Klaus; Dienes, B; Donkers, M; Dubbert, J; Duchovni, E; Duckeck, G; Duerdoth, I P; Etzion, E; Fabbri, Franco Luigi; Feld, L; Ferrari, P; Fiedler, F; Fleck, I; Ford, M; Frey, A; Fürtjes, A; Gagnon, P; Gary, J W; Gaycken, G; Geich-Gimbel, C; Giacomelli, G; Giacomelli, P; Giunta, M; Goldberg, J; Gross, E; Grunhaus, Jacob; Gruwé, M; Günther, P O; Sen-Gupta, A; Hajdu, C; Hamann, M; Hanson, G G; Harder, K; Harel, A; Harin-Dirac, M; Hauschild, M; Hawkes, C M; Hawkings, R; Hemingway, Richard J; Hensel, C; Herten, G; Heuer, R D; Hill, J C; Hoffman, K; Horváth, D; Igo-Kemenes, P; Ishii, K; Jeremie, H; Jovanovic, P; Junk, T R; Kanaya, N; Kanzaki, J; Karapetian, G V; Karlen, Dean A; Kawagoe, K; Kawamoto, T; Keeler, Richard K; Kellogg, R G; Kennedy, B W; Kim, D H; Klein, K; Klier, A; Kluth, S; Kobayashi, T; Kobel, M; Komamiya, S; Kormos, L L; Kramer, T; Krieger, P; Von Krogh, J; Krüger, K; Kühl, T; Kupper, M; Lafferty, G D; Landsman, Hagar Yaël; Lanske, D; Layter, J G; Leins, A; Lellouch, D; Letts, J; Levinson, L; Lillich, J; Lloyd, S L; Loebinger, F K; Lü, J; Ludwig, J; MacPherson, A; Mader, W; Marcellini, S; Martin, A J; Masetti, G; Mashimo, T; Mättig, P; McDonald, W J; McKenna, J A; McMahon, T J; McPherson, R A; Meijers, F; Menges, W; Merritt, F S; Mes, H; Michelini, Aldo; Mihara, S; Mikenberg, G; Miller, D J; Moed, S; Mohr, W; Mori, T; Mutter, A; Nagai, K; Nakamura, I; Nanjo, H; Neal, H A; Nisius, R; O'Neale, S W; Oh, A; Okpara, A N; Oreglia, M J; Orito, S; Pahl, C; Pásztor, G; Pater, J R; Patrick, G N; Pilcher, J E; Pinfold, J L; Plane, D E; Poli, B; Polok, J; Pooth, O; Przybycien, M B; Quadt, A; Rabbertz, K; Rembser, C; Renkel, P; Roney, J M; Rosati, S; Rozen, Y; Runge, K; Sachs, K; Saeki, T; Sarkisyan-Grinbaum, E; Schaile, A D; Schaile, O; Scharff-Hansen, P; Schieck, J; Schörner-Sadenius, T; Schröder, M; Schumacher, M; Schwick, C; Scott, W G; Seuster, R; Shears, T G; Shen, B C; Sherwood, P; Siroli, G P; Skuja, A; Smith, A M; Sobie, R J; Söldner-Rembold, S; Spanó, F; Stahl, A; Stephens, K; Strom, D; Ströhmer, R; Tarem, S; Tasevsky, M; Taylor, R J; Teuscher, R; Thomson, M A; Torrence, E; Toya, D; Tran, P; Trigger, I; Trócsányi, Z L; Tsur, E; Turner-Watson, M F; Ueda, I; Ujvári, B; Vollmer, C F; Vannerem, P; Vertesi, R; Verzocchi, M; Voss, H; Vossebeld, Joost Herman; Waller, D; Ward, C P; Ward, D R; Watkins, P M; Watson, A T; Watson, N K; Wells, P S; Wengler, T; Wermes, N; Wetterling, D; Wilson, G W; Wilson, J A; Wolf, G; Wyatt, T R; Yamashita, S; Zer-Zion, D; Zivkovic, L

    2004-01-01

    A study of W+W- events accomanied by hard photon radiation produced in e+e- collisions at LEP is presented. Events consistent with being two on-shell W bosons and an isolated photon are selected from 681 pb^-1 of data recorded at 180 GeV < sqrt(s) < 209 GeV. For these data , 187 W+W- candidates are selected with photon energies greater than 2.5 GeV. The selected events are used to determine the W+ W- gamma cross section at five values of sqrt(s). The results are consistent with the Standard Model expectation. These data provide constraints on the related O(alpha) systematic uncertainties on the measurement of the W boson mass at LEP. Finally, the data are used to derive 95% C.L. upper limits on possible anomalous contributions to the W+ W- gamma gamma and W+ W- Z0 gamma vertices.

  8. 10 CFR 61.56 - Waste characteristics.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Waste characteristics. 61.56 Section 61.56 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) LICENSING REQUIREMENTS FOR LAND DISPOSAL OF RADIOACTIVE WASTE Technical Requirements for Land Disposal Facilities § 61.56 Waste characteristics. (a) The following requirements are...

  9. 38 CFR 61.81 - Outreach activities.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Outreach activities. 61.81 Section 61.81 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS (CONTINUED) VA HOMELESS PROVIDERS GRANT AND PER DIEM PROGRAM § 61.81 Outreach activities. Recipients of capital...

  10. Identifikasi Gen Aerolysin dan Sensitivitas Antibiotik Aeromonas Hydrophila Penyebab Kematian Tukik (Lepidochelys olivacea di Pulau Serangan, Bali

    Directory of Open Access Journals (Sweden)

    Rima Ratnanggana Prasetya

    2017-06-01

    Full Text Available The purpose of this study was to evaluate the pathogene of Aeromonas hydrophila genes (Aerolysin as the cause of Lepidochelys olivacea death and to perform the antibiotic sensitivity test for antibiotic that often used in order to provide the best antibiotic treatment in the field case. The method used was the identification test using primary cultures on Tryptic Soy Agar (TSA and Mac Conkey Agar (MCA medium, then followed by Gram staining, oxidase, catalase, and biochemical tests. Then, aerolysin genes detection was performed by using Polymerase Chain Reaction (PCR method, while oxytetracycline, chloramphenicol, streptomycin, and kanamycin were tested for their sensitivity. From five samples of dead Lepidochelys olivacea, bleeding on the liver and intestine were observed. The identification result of bacteria was found A. hydrophila, and identified the gene encoding aerolysin. The antibiotic sensitivity test showed a sensitive category of A. hydrophila with a sensitivity level were oxytetracycline, chloramphenicol, kanamycin, and streptomycin. The main cause of Lepidochelys olivacea death in Turtle Conservation and Education Centre, Serangan Island, Bali was A. hydrophila which contains aerolysin genes, in which oxytetracycline seems to be the most effective drug for the treatment. ABSTRAK Tujuan dari penelitian ini adalah membuktikan adanya gen patogen (Aerolysin pada Aeromonas hydrophila sebagai penyebab kematian tukik penyu abu-abu serta mengetahui kepekaan obat antibiotic yang sering digunakan sehingga dapat memberikan terapi yang tepat pada kasus di lapangan. Metode penelitian yang digunakan adalah uji identifikasi menggunakan kultur primer pada media Tryptic Soy Agar (TSA dan Mac Conkey Agar (MCA, dilanjutkan uji pewarnaan Gram, uji oksidase, uji katalase, dan uji biokimiawi. Setelah itu dilakukan deteksi gen aerolysin menggunakan metode Polymerase Chain Reaction (PCR, serta dilakukan uji sensitivitas antibiotik oxytetracycline

  11. 36 CFR 902.61 - Final determination.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false Final determination. 902.61 Section 902.61 Parks, Forests, and Public Property PENNSYLVANIA AVENUE DEVELOPMENT CORPORATION FREEDOM OF INFORMATION ACT Time Limitations § 902.61 Final determination. A determination with respect to any appeal made...

  12. 10 CFR 61.9 - Employee protection.

    Science.gov (United States)

    2010-01-01

    ... occurs because the employee has engaged in protected activities. An employee's engagement in protected... 10 Energy 2 2010-01-01 2010-01-01 false Employee protection. 61.9 Section 61.9 Energy NUCLEAR... Provisions § 61.9 Employee protection. (a) Discrimination by a Commission licensee, an applicant for a...

  13. 40 CFR 61.183 - Emission monitoring.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 8 2010-07-01 2010-07-01 false Emission monitoring. 61.183 Section 61... Emissions From Arsenic Trioxide and Metallic Arsenic Production Facilities § 61.183 Emission monitoring. (a..., calibrate, maintain, and operate a continuous monitoring system for the measurement of the opacity of each...

  14. 40 CFR 792.61 - Equipment design.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 31 2010-07-01 2010-07-01 true Equipment design. 792.61 Section 792.61...) GOOD LABORATORY PRACTICE STANDARDS Equipment § 792.61 Equipment design. Equipment used in the... of appropriate design and adequate capacity to function according to the protocol and shall be...

  15. 40 CFR 61.33 - Stack sampling.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 8 2010-07-01 2010-07-01 false Stack sampling. 61.33 Section 61.33 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) NATIONAL... sampling. (a) Unless a waiver of emission testing is obtained under § 61.13, each owner or operator...

  16. 7 CFR 58.61 - Political activity.

    Science.gov (United States)

    2010-01-01

    ....61 Political activity. All inspectors or graders are forbidden during the period of their respective appointments or licenses to take an active part in political management or in political campaigns. Political... 7 Agriculture 3 2010-01-01 2010-01-01 false Political activity. 58.61 Section 58.61 Agriculture...

  17. Antibiotic resistence of Aeromonas hydrophila isolated from Piaractus mesopotamicus (Holmberg, 1887 and Oreochromis niloticus (Linnaeus, 1758 Resistência de Aeromonas hydrophila isolada de Piaractus mesopotamicus (Holmberg, 1887 e Oreochromis niloticus (Linnaeus, 1758 a antibióticos

    Directory of Open Access Journals (Sweden)

    Andréa Belém-Costa

    2006-06-01

    Full Text Available One of the most important problems involving treatments with antibiotics against Aeromonas hydrophila isolated from fishes is that antibiotic resistance develops readily. The antimicrobial activity of chemotherapeutants in isolates from pacu Piaractus mesopotamicus (Holmberg, 1887 and tilapia Oreochromis niloticus (Linnaeus, 1758 was tested by the Kirby-Bauer disk method, over Mueller-Hinton surface agar previously inoculated with 100 µL of bacterial suspensions. After regular incubation, isolates from tilapia and pacu were uniformly resistant to amoxicillin, ampicillin, lincomycin, novobiocin, oxacillin, penicillin, and trimetoprim+sulfametoxazole. The A. hydrophila type strain presented resistance to the same antimicrobial substances and also against rifampicin; the bacterial isolate from pacu were the only strain resistant to tetracyclin. Isolates from both pacu and tilapia had intermediate reaction with erytromycin. The use of drugs in commercial fish farms in Brazil can favor the development of resistant bacterial strains in native fish species as already observed for exotic species, commercially produced for longer time.Um dos maiores problemas envolvendo o tratamento com antibióticos contra Aeromonas hydrophila isolada de peixes confinados é a rápida resistência ao antibiótico desenvolvida pela bactéria. A atividade antimicrobiana de quimioterapêuticos em isolados a partir de pacu Piaractus mesopotamicus (Holmberg, 1887 e tilápia Oreochromis niloticus (Linnaeus, 1758 foi verificada pelo método de difusão de antibiótico em discos de Kirby-Bauer, sobre uma superfície de Agar Mueller-Hinton previamente inoculada com 100 µL de suspensão bacteriana. Após o período de incubação, os isolados de tilápia e pacu foram uniformemente resistentes a amoxicilina, ampicilina, lincomicina, novobiocina, oxacilina, penicilina e trimetoprim+sulfametoxazol. A cepa tipo para A. hydrophila apresentou resistência às mesmas subst

  18. Gigawatt peak power generation in a relativistic klystron amplifier driven by 1 kW seed-power

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Y. [Institute of Applied Electronics, China Academy of Engineering Physics, Mianyang 621900 (China); Science and Technology on High Power Microwave Laboratory, Mianyang 621900 (China); Xie, H. Q. [College of Science, Southwestern University of Science and Technology, Mianyang 621010 (China); Li, Z. H.; Zhang, Y. J.; Ma, Q. S. [Institute of Applied Electronics, China Academy of Engineering Physics, Mianyang 621900 (China)

    2013-11-15

    An S-band high gain relativistic klystron amplifier driven by kW-level RF power is proposed and studied experimentally. In the device, the RF lossy material is introduced to suppress higher mode excitation. An output power of 1.95 GW with a gain of 62.8 dB is obtained in the simulation. Under conditions of an input RF power of 1.38 kW, a microwave pulse with power of 1.9 GW, frequency of 2.86 GHz, and duration of 105 ns is generated in the experiment, and the corresponding gain is 61.4 dB.

  19. Gigawatt peak power generation in a relativistic klystron amplifier driven by 1 kW seed-power

    Science.gov (United States)

    Wu, Y.; Xie, H. Q.; Li, Z. H.; Zhang, Y. J.; Ma, Q. S.

    2013-11-01

    An S-band high gain relativistic klystron amplifier driven by kW-level RF power is proposed and studied experimentally. In the device, the RF lossy material is introduced to suppress higher mode excitation. An output power of 1.95 GW with a gain of 62.8 dB is obtained in the simulation. Under conditions of an input RF power of 1.38 kW, a microwave pulse with power of 1.9 GW, frequency of 2.86 GHz, and duration of 105 ns is generated in the experiment, and the corresponding gain is 61.4 dB.

  20. 12__61

    African Journals Online (AJOL)

    User

    Bayero Journal of Pure and Applied Sciences, 9(2): 61 - 65 ... A study was conducted at the Faculty of Agriculture, Research Farm, Bayero University, Kano State, ... Maize is thought to have originated at least 5000 years ... hybrid development.

  1. Aeromonas veronii, a tributyltin (TBT)-degrading bacterium isolated from an estuarine environment, Ria de Aveiro in Portugal.

    Science.gov (United States)

    Cruz, Andreia; Caetano, Tânia; Suzuki, Satoru; Mendo, Sónia

    2007-12-01

    Organotin compounds are used in a variety of industrial processes therefore their subsequent discharge into the environment is widespread. Bacteria play an important role in biogeochemical transformations acting as natural decontamination agents. Therefore, screening for tributyltin (TBT)-resistant and -degrading bacteria is relevant for the selection of isolates with decontamination ability of these polluted areas. With this purpose, 50 strains were isolated from sediment and water from Ria de Aveiro and their tolerance to TBT, up to 3mM, was evaluated. Generally, occurrence of highly TBT-resistant bacteria was observed, and Gram negative bacteria exhibited more tolerance to TBT than Gram positive bacteria. A memory response was observed when bacteria were progressively exposed to increasingly higher TBT concentrations. One isolate, Aeromonas veronii Av27, highly resistant to TBT (3mM) uses this compound as carbon source and degrades it to less toxic compounds.

  2. 40 CFR 61.163 - Emission monitoring.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 8 2010-07-01 2010-07-01 false Emission monitoring. 61.163 Section 61... Emissions From Glass Manufacturing Plants § 61.163 Emission monitoring. (a) An owner or operator of a glass..., calibrate, maintain, and operate a continuous monitoring system for the measurement of the opacity of...

  3. 49 CFR 570.61 - Suspension system.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 6 2010-10-01 2010-10-01 false Suspension system. 570.61 Section 570.61... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION VEHICLE IN USE INSPECTION STANDARDS Vehicles With GVWR of More Than 10,000 Pounds § 570.61 Suspension system. (a) Suspension condition. Ball joint seals shall not be cut...

  4. 21 CFR 58.61 - Equipment design.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Equipment design. 58.61 Section 58.61 Food and... PRACTICE FOR NONCLINICAL LABORATORY STUDIES Equipment § 58.61 Equipment design. Equipment used in the... of appropriate design and adequate capacity to function according to the protocol and shall be...

  5. 10 CFR 430.61 - Prohibited acts.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 3 2010-01-01 2010-01-01 false Prohibited acts. 430.61 Section 430.61 Energy DEPARTMENT OF ENERGY ENERGY CONSERVATION ENERGY CONSERVATION PROGRAM FOR CONSUMER PRODUCTS Certification and... convenience of the user, the revised text is set forth as follows: § 430.61 Prohibited acts. (b) In accordance...

  6. Subunit vaccine candidates against Aeromonas salmonicida in rainbow trout Oncorhynchus mykiss.

    Science.gov (United States)

    Marana, Moonika Haahr; Jørgensen, Louise von Gersdorff; Skov, Jakob; Chettri, Jiwan Kumar; Holm Mattsson, Andreas; Dalsgaard, Inger; Kania, Per Walter; Buchmann, Kurt

    2017-01-01

    Aeromonas salmonicida subsp. salmonicida is the etiological agent of furunculosis and a major fish health problem in salmonid aquaculture worldwide. Injection vaccination with commercial mineral oil-adjuvanted bacterin vaccines has been partly successful in preventing the disease but in Danish rainbow trout (Oncorhynchus mykiss, Walbaum) aquaculture furunculosis outbreaks still occur. In this study we tested the efficacy of experimental subunit vaccines against A. salmonicida infection in rainbow trout. We utilized in silico screening of the proteome of A. salmonicida subsp. salmonicida strain A449 and identified potential protective protein antigens that were tested by in vivo challenge trial. A total of 14 proteins were recombinantly expressed in Escherichia coli and prepared in 3 different subunit vaccine combinations to immunize 3 groups of rainbow trout by intraperitoneal (i.p.) injection. The fish were exposed to virulent A. salmonicida 7 weeks after immunization. To assess the efficacy of the subunit vaccines we evaluated the immune response in fish after immunization and challenge infection by measuring the antibody levels and monitoring the survival of fish in different groups. The survival of fish at 3 weeks after challenge infection showed that all 3 groups of fish immunized with 3 different protein combinations exhibited significantly lower mortalities (17-30%) compared to the control groups (48% and 56%). The ELISA results revealed significantly elevated antibody levels in fish against several protein antigens, which in some cases were positively correlated to the survival.

  7. 40 CFR 74.61 - Monitoring plan.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 16 2010-07-01 2010-07-01 false Monitoring plan. 74.61 Section 74.61... OPT-INS Monitoring Emissions: Combustion Sources § 74.61 Monitoring plan. (a) Monitoring plan. The... monitoring plan that includes the information required in a monitoring plan under § 75.53 of this chapter...

  8. 22 CFR 61.9 - General information.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false General information. 61.9 Section 61.9 Foreign Relations DEPARTMENT OF STATE PUBLIC DIPLOMACY AND EXCHANGES WORLD-WIDE FREE FLOW OF AUDIO-VISUAL MATERIALS § 61.9 General information. General information and application forms may be obtained by writing to the...

  9. 40 CFR 61.34 - Air sampling.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 8 2010-07-01 2010-07-01 false Air sampling. 61.34 Section 61.34... sampling. (a) Stationary sources subject to § 61.32(b) shall locate air sampling sites in accordance with a... concentrations calculated within 30 days after filters are collected. Records of concentrations at all sampling...

  10. 7 CFR 3560.61 - Loan security.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Loan security. 3560.61 Section 3560.61 Agriculture... DIRECT MULTI-FAMILY HOUSING LOANS AND GRANTS Direct Loan and Grant Origination § 3560.61 Loan security... collateral. (2) The amount of the loan against the collateral does not exceed its estimated security value...

  11. Physical properties of W gravities and W strings

    International Nuclear Information System (INIS)

    Das, S.R.; Dhar, A.; Rama, S.K.

    1991-01-01

    This paper investigates some basic physical properties of W gravities and W strings, using a free field realization. The authors argue that the configuration space of W gravities have global characteristics in addition to the Euler characteristic. The authors identify one such global quantity to be a monopole charge and show how this charge appears in the exponents. The free energy would then involve a θ parameter. Using a BRST procedure the authors find all the physical states of W 3 and W 4 gravities, and show that physical operators are nonsingular composites of the screening charge operators. (The latter are not physical operators for N ≥ 3.) For W strings we show how the W constraints lead to the emergence of a single (and not many) extra dimension coming from the W-gravity sector. By analyzing the resulting dispersion relations the authors find that both the lower and upper critical dimensions are lowered compared to ordinary two-dimensional gravity. The pure W gravity spectrum reveals an intriguing numerological connection with unitary minimal models coupled to ordinary gravity

  12. 40 CFR 61.345 - Standards: Containers.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 8 2010-07-01 2010-07-01 false Standards: Containers. 61.345 Section... Operations § 61.345 Standards: Containers. (a) The owner or operator shall meet the following standards for each container in which waste is placed in accordance with § 61.342(c)(1)(ii) of this subpart: (1) The...

  13. 21 CFR 610.61 - Package label.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 7 2010-04-01 2010-04-01 false Package label. 610.61 Section 610.61 Food and... GENERAL BIOLOGICAL PRODUCTS STANDARDS Labeling Standards § 610.61 Package label. The following items shall appear on the label affixed to each package containing a product: (a) The proper name of the product; (b...

  14. Spuścizny konserwatorów zbiorów, kierowników i dyrektorów Biblioteki Poznańskiego Towarzystwa Przyjaciół Nauk

    Directory of Open Access Journals (Sweden)

    Michał Boksa

    2011-01-01

    Full Text Available Artykuł prezentuje sylwetki konserwatorów zbiorów, kierowników i dyrektorów Biblioteki Poznańskiego Towarzystwa Przyjaciół Nauk (PTPN oraz to, co po nich pozostało w postaci archiwaliów. Od momentu powstania Biblioteka PTPN gromadziła rękopisy lub całe spuścizny wybitnych osób, w tym kierujących tą placówką. Również inne biblioteki i archiwa zakładowe instytucji, z którymi byli oni związani, włączały do swych zbiorów ich materiały archiwalne. Spuścizny Ludwiki Dobrzyńskiej-Rybickiej i Ryszarda Marciniaka znajdują się zarówno w Bibliotece PTPN, jak i w Polskiej Akademii Nauk Archiwum w Warszawie Oddział w Poznaniu. Znaczna część materiałów archiwalnych Bolesława Erzepkiego trafiła natomiast do Działu Zbiorów Specjalnych Biblioteki Raczyńskich w Poznaniu. Szczątkowe materiały archiwalne można też znaleźć w Archiwum Uniwersytetu im. Adama Mickiewicza w Poznaniu (Ludwika Dobrzyńska-Rybicka oraz w Archiwum Biblioteki Uniwersyteckiej w Poznaniu (Ludwika Dobrzyńska-Rybicka, Jan Baumgart, Aniela Koehlerówna.

  15. 40 CFR 61.54 - Sludge sampling.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 8 2010-07-01 2010-07-01 false Sludge sampling. 61.54 Section 61.54... sampling. (a) As an alternative means for demonstrating compliance with § 61.52(b), an owner or operator... days prior to a sludge sampling test, so that he may at his option observe the test. (c) Sludge shall...

  16. Tungsten (W) bioavailability in paddy rice soils and its accumulation in rice (Oryza sativa).

    Science.gov (United States)

    James, Blessing; Zhang, Weili; Sun, Pei; Wu, Mingyan; Li, Hong Hong; Khaliq, Muhammad Athar; Jayasuriya, Pathmamali; James, Swithin; Wang, Guo

    2017-12-01

    The aim of this study was to investigate the accumulation characteristics of tungsten (W) by different indica rice cultivars from the soil and to assess the potential risks to human health via dietary intake of W in rice consumption. A total of 153 rice (ear) samples of 15 cultivars and the corresponding surface soil samples were collected from 7 cities in Fujian Province of southeastern China. The available soil W were extracted using H 2 C 2 O 4 ·2H 2 O-(NH 4 ) 2 C 2 O 4 ·H 2 O at pH 3.3). Results showed that the total soil W ranged from 2.03 mg kg -1 to 15.34 mg kg -1  and available soil W ranged from 0.03 mg kg -1 to 1.61 mg kg -1 . The W concentration in brown rice varied from 7 μg kg -1 to 283 μg kg -1 and was significantly correlated with the available soil W. The highest mean TF avail (transfer factor based on available soil W) was 0.91 for Te-you 627 (hybrid, indica rice), whereas the lowest was 0.08 for Yi-you 673 (hybrid, indica rice). The TF avail decreased with the increase in available soil W, clay content, and cation exchange capacity. The consumption of the brown rice produced from the investigated areas in some cultivars by the present study may cause risks to human health.

  17. Aspekt formalnoprawny stosowania systemów ustalania lokalizacji w czasie rzeczywistym do eliminacji marnotrawstwa w procesie budowlanym

    Directory of Open Access Journals (Sweden)

    Piotr Nowotarski

    2017-06-01

    Full Text Available W artykule przedstawiono ideę systemów typu RTLS pod kątem wykorzystania ich w celu eliminacji marnotrawstwa w procesie budowlanym. Opisywane systemy z punktu widzenia strumienia wartości są pomocne w wykrywaniu czynności niedodających wartości. Autorzy przedstawili temat w aspekcie formalno-prawnym związanym z monitorowaniem i śledzeniem pracowników podczas pracy. Zwrócono uwagę na niezbędne dokumenty, pozwolenia, zgłoszenia i zgody pracowników, które zgodnie z obowiązującym w Polsce prawem należy posiadać, aby móc wykorzystywać tego typu systemy do zbierania i przetwarzania danych o lokalizacji pracowników w trakcie wykonywania prac.

  18. Measurement of the W Boson Mass with the D0 Run II Detector using the Electron P(T) Spectrum

    Energy Technology Data Exchange (ETDEWEB)

    Andeen, Jr., Timothy R. [Northwestern Univ., Evanston, IL (United States)

    2008-06-01

    This thesis is a description of the measurement of the W boson mass using the D0 Run II detector with 770 pb-1 of p$\\bar{p}$ collision data. These collisions were produced by the Tevatron at √s = 1.96 TeV between 2002 and 2006. We use a sample of W → ev and Z → ee decays to determine the W boson mass with the transverse momentum distribution of the electron and the transverse mass distribution of the boson. We measure MW = 80340 ± 37 (stat.) ± 26 (sys. theo.) ± 51 (sys. exp.) MeV = 80340 ± 68 MeV with the transverse momentum distribution of the electron and MW = 80361 ± 28 (stat.) ± 17 (sys. theo.) ± 51 (sys. exp.) MeV = 80361 ± 61 MeV with the transverse mass distribution.

  19. 10 CFR 61.7 - Concepts.

    Science.gov (United States)

    2010-01-01

    ... COMMISSION (CONTINUED) LICENSING REQUIREMENTS FOR LAND DISPOSAL OF RADIOACTIVE WASTE General Provisions § 61... radioactive waste and not to other methods such as sea or extraterrestrial disposal. Part 61 contains... specific technical requirements for near-surface disposal of radioactive waste, a subset of land disposal...

  20. The Charge asymmetry in W bosons produced in p$\\bar{p}$ collisions at √s = 1.96 TeV

    Energy Technology Data Exchange (ETDEWEB)

    Torborg, Julie M. [Univ. of Notre Dame, IN (United States)

    2005-07-01

    The primary mode of production of W+ bosons in a p$\\bar{p}$ collider is u + $\\bar{d}$ → W+. The u quark generally carries more momentum than the $\\bar{d}$ and the resultant W+ tends to be boosted in the proton direction. Similarly, W bosons are boosted in the anti-proton direction. This is observed as an asymmetry in the rapidity distributions of positive and negative W bosons. Measurement of this asymmetry serves as a probe of the momentum distribution of partons within the proton. These distributions are required as input to the calculation of every p$\\bar{p}$ production cross section. This thesis presents the first measurement at D0 of the charge asymmetry of the W boson production cross section as measured in W → ev decays in 0.3 fb-1 of p$\\bar{p}$ collisions collected with the D0 Detector. Theoretical predictions made using the CTEQ6.1M and MRST(2004) parton distribution functions are compared with the measurement.

  1. Bose-Einstein correlations in W+ W- events at LEP2

    CERN Document Server

    van Dalen, Jorn A

    2000-01-01

    Analyses of Bose-Einstein Correlations in w+w- events at LEP2 by the four LEP collaborations are presented. In particular, Bose-Einstein correlations in w+w- overlap are investigated and the possible existence of these correlations between particles coming from different W's, which may influence the W mass measurements in the fully-hadronic channel e+e- --+ w+w- --+ qiihq3ij<. No evidence for such an inter-W Bose-Einstein correlation is found by L3 and ALEPH. Possible indication of these correlations by DELPHI is mentioned.

  2. Akcentuacja zapożyczonych leksemów czasownikowych w gwarze staroobrzędowców mieszkających w regionie suwalsko-augustowskim

    Directory of Open Access Journals (Sweden)

    Dorota Angelika Paśko-Koneczniak

    2015-12-01

    Full Text Available Stress patterns in loan verb lexemes in the dialect used by the Old Believers living in the Suwałki-Augustów region The aim of the article is to present the stress pattern phenomenon in loan verb lexemes which function in the Russian dialect of the Old Believers from the Suwałki-Augustów Region. In the last decades, the insular dialect, separated from the general Russian language, has been influenced by the Polish language. Such influence is visible, in particular, in the vocabulary, in the form of loan translations and idiomatic expressions. Stress patterns, along with the root vocabulary and the morphological system, still remains one of the indicators of the Russian essence of the dialect. The native vocabulary of the Old Believers’ dialect maintains Russian accentuation patterns. A similar situation is observed in the case of stress patterns in lexemes borrowed from Polish, which undergo a stress accentuation adaptation; that is, they feature a shift in the place of the stress in relation to the source language. In loan verb morphemes, one can notice the pattern of stress which is not fixed and depends upon the morphological form or, sometimes, the paroxitonic stress, which results from the influence of the Polish language.   Akcentuacja zapożyczonych leksemów czasownikowych w gwarze staroobrzędowców mieszkających w regionie suwalsko-augustowskim Celem artykułu jest zaprezentowanie zjawiska akcentuacji w zapożyczonych leksemach czasownikowych, funkcjonujących w rosyjskiej gwarze staroobrzędowców z regionu suwalsko-augustowskiego. W ciągu ostatnich kilkudziesięciu lat badana gwara wyspowa, odseparowana od rosyjskiego języka ogólnego, podlega znacznemu wpływowi języka polskiego. Wpływ polszczyzny widoczny jest szczególnie w zasobie leksykalnym w postaci zapożyczeń, kalk i w idiomatyce. Akcentuacja obok rdzennego zasobu leksykalnego i systemu morfologicznego nadal pozostaje jednym z wyznaczników rosyjskości gwary

  3. 45 CFR 61.3 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Definitions. 61.3 Section 61.3 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION HEALTHCARE INTEGRITY AND PROTECTION DATA BANK... welfare association, public service group or organization or professional association; and (5) An...

  4. Moment Magnitude ( M W) and Local Magnitude ( M L) Relationship for Earthquakes in Northeast India

    Science.gov (United States)

    Baruah, Santanu; Baruah, Saurabh; Bora, P. K.; Duarah, R.; Kalita, Aditya; Biswas, Rajib; Gogoi, N.; Kayal, J. R.

    2012-11-01

    An attempt has been made to examine an empirical relationship between moment magnitude ( M W) and local magnitude ( M L) for the earthquakes in the northeast Indian region. Some 364 earthquakes that were recorded during 1950-2009 are used in this study. Focal mechanism solutions of these earthquakes include 189 Harvard-CMT solutions ( M W ≥ 4.0) for the period 1976-2009, 61 published solutions and 114 solutions obtained for the local earthquakes (2.0 ≤ M L ≤ 5.0) recorded by a 27-station permanent broadband network during 2001-2009 in the region. The M W- M L relationships in seven selected zones of the region are determined by linear regression analysis. A significant variation in the M W- M L relationship and its zone specific dependence are reported here. It is found that M W is equivalent to M L with an average uncertainty of about 0.13 magnitude units. A single relationship is, however, not adequate to scale the entire northeast Indian region because of heterogeneous geologic and geotectonic environments where earthquakes occur due to collisions, subduction and complex intra-plate tectonics.

  5. Histopathology of red-sore disease (aeromonas hydrophila) in naturally and experimentally infected largemouth bass micropterus salmoides(lacepede)

    Energy Technology Data Exchange (ETDEWEB)

    Huizinga, H W [Illinois State Univ., Normal; Esch, G W; Hazen, T C

    1979-01-01

    The histopathology of red-sore disease, caused by the gram-negative bacterium, Aeromonas hydrophila, is described for largemouth bass, Micropterus salmoides. Externally, lesions range from those affecting a few scales (pin-point), to those associated with extensive chronic ulcerations; there is focal hemorrhage, oedema and dermal necrosis which exposes underlying muscles producing infiltration of mononuclear and granulocytic inflammatory cells. Internally, the liver and kidneys are foci for toxic products produced by A. hydrophila with, in the most severe cases, complete destruction of the structural integrity of both organs. Pathological changes were not serious in either the spleen or heart, even in cases with massive damage in the liver and kidney. Internal and external lesions were similar in both natural and experimentally induced infections. The pathobiology of red-sore disease in bass was postulated to be linked to elevated water temperature stimulating increased metabolism, decreased body condition and stress, leading to the increased production of corticosteroids and the concommitant rise in susceptibility to infection.

  6. Samostanowienie narodów w prawie międzynarodowym

    OpenAIRE

    Żbikowski, Wawrzyniec

    2015-01-01

    W artykule omówiono zasadę samostanowienia narodów funkcjonującą w prawie międzynarodowym od momentu uchwalenia Karty Narodów Zjednoczonych. Po przedstawieniu tła historycznego ukazano źródła funkcjonowania tej zasady oraz problematykę związaną z jej podmiotowym i przedmiotowym zakresem. Dokonano tego na podstawie analizy źródeł, praktyki oraz poglądów doktryny. Podjęto też kwestię realizacji prawa do samostanowienia jako jednego z możliwych kryteriów państwowości. W końcowej części szeroko o...

  7. SPECYFIKA REALIZACJI LINIOWYCH INWESTYCJI W PASIE DROGOWYM W AGLOMERACJI MIEJSKIEJ Z UWZGLĘDNIENIEM OBSZARÓW ZABYTKOWYCH

    Directory of Open Access Journals (Sweden)

    Andrzej MARECKI

    Full Text Available Treścią referatu jest problematyka budowlanego procesu inwestycyjnego w pasie drogowym na terenie miast. W aglomeracjach miejskich realizacja zadań związanych z budową, przebudową lub modernizacją ciągów drogowych lub sieci infrastruktury liniowej związana jest z pokonaniem szczególnych utrudnień. Wynika to nie tylko ze specyfiki technologicznej ale również z szeroko pojętej interakcji społecznych. Inwestorzy realizujący zadania w miastach muszą szukać nie tylko innowacyjnych rozwiązań technicznych ale również muszą spełniać, często - „wygórowane” oczekiwania społeczne. W referacie omówione zostaną typowe zagrożenia procesu inwestycyjnego na etapach koncepcji, projektowania, realizacji i eksploatacji - ze szczególnym uwzględnieniem aspektów dotyczących realizacji liniowych robót budowlanych na obszarach objętych warunkami ochrony, wynikającymi z zapisów ustawy o ochronie zabytków[1]. Należy podkreślić, że ochrona ta zgodnie z Art. 4 przedmiotowej Ustawy polega, na podejmowaniu przez organy administracji publicznej działań mających między innymi na celu: zapewnienie warunków prawnych, organizacyjnych i finansowych, umożliwiających trwałe zachowanie zabytków oraz ich zagospodarowanie i utrzymanie. Przekłada się to na obligatoryjny warunek prowadzenia prac konserwatorskich, restauratorskich i oczywiście robót budowlanych za pozwoleniem właściwego konserwatora zabytków i pod jego nadzorem. Realizacja liniowych zadań inwestycyjnych z natury rzeczy odbywa się nie tylko w obszarze wpływu zabytków nieruchomych ale także w bezpośrednim kontakcie z zabytkami archeologicznymi tj. – zabytkami nieruchomymi, będącymi powierzchniową, podziemną lub podwodną pozostałością egzystencji i działalności człowieka, złożoną z nawarstwień kulturowych i znajdujących się w nich wytworów bądź ich śladów. Warunkiem pogodzenia interesów stron tego skomplikowanego procesu

  8. 40 CFR 61.101 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... definition of reference man are outlined in the International Commission on Radiological Protection's... 40 Protection of Environment 8 2010-07-01 2010-07-01 false Definitions. 61.101 Section 61.101....101 Definitions. As used in this subpart, all terms not defined here have the meaning given them in...

  9. 10 CFR 61.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Definitions. 61.2 Section 61.2 Energy NUCLEAR REGULATORY....2 Definitions. As used in this part: Active maintenance means any significant remedial activity... biosphere inhabited by man and containing his food chains by emplacement in a land disposal facility...

  10. 40 CFR 61.71 - Recordkeeping.

    Science.gov (United States)

    2010-07-01

    ...: (1) A record of the leaks detected by the vinyl chloride monitoring system, as required by § 61.65(b)(8), including the concentrations of vinyl chloride measured, analyzed, and recorded by the vinyl... EMISSION STANDARDS FOR HAZARDOUS AIR POLLUTANTS National Emission Standard for Vinyl Chloride § 61.71...

  11. 10 CFR 61.57 - Labeling.

    Science.gov (United States)

    2010-01-01

    ... COMMISSION (CONTINUED) LICENSING REQUIREMENTS FOR LAND DISPOSAL OF RADIOACTIVE WASTE Technical Requirements for Land Disposal Facilities § 61.57 Labeling. Each package of waste must be clearly labeled to identify whether it is Class A waste, Class B waste, or Class C waste, in accordance with § 61.55. ...

  12. 38 CFR 4.61 - Examination.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Examination. 4.61 Section... DISABILITIES Disability Ratings The Musculoskeletal System § 4.61 Examination. With any form of arthritis (except traumatic arthritis) it is essential that the examination for rating purposes cover all major...

  13. 16 CFR 1.61 - Injunctions.

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Injunctions. 1.61 Section 1.61 Commercial Practices FEDERAL TRADE COMMISSION ORGANIZATION, PROCEDURES AND RULES OF PRACTICE GENERAL PROCEDURES... believe that it would be to the interest of the public, the Commission will apply to the courts for...

  14. ZASTOSOWANIE METOD GIS W ANALIZIE STRUKTURY PRZESTRZENNEJ OBSZARÓW WIEJSKICH GMINY SŁAWNO W POWIECIE OPOCZYŃSKIM

    Directory of Open Access Journals (Sweden)

    Przemysław LEŃ

    Full Text Available Celem pracy jest przedstawienie możliwości wykorzystania narzędzi GIS w analizie struktury przestrzennej obszarów wiejskich. Badania przeprowadzono w 34 wsiach gminy Sławno położonej w powiecie opoczyńskim, województwo łódzkie. W pracy przeprowadzono analizy dotyczące struktury władania gruntami, analizy użytkowania gruntami, jak również analizę rozdrobnienia gruntów gospodarstw indywidualnych. Otrzymane wyniki pozwolą określić stan struktury przestrzennej obszarów wiejskich Polski centralnej.

  15. Prezentacja innych dochodów całkowitych w sprawozdaniach finansowych wybranych spółek publicznych w Polsce w latach 2009–2011

    Directory of Open Access Journals (Sweden)

    Bogusława Bek-Gaik

    2013-04-01

    Full Text Available Inne całkowite dochody to nowa kategoria ekonomiczna, dopiero testowana w praktyce gospodarczej. Oczywi-sty wydaje się fakt zapotrzebowania na badanie aspektów praktycznych dotyczących prezentacji innych całkowitych dochodów w sprawozdaniu z dochodów całkowitych. Zasadniczym celem niniejszego artykułu jest zbadanie, jaką formę prezentacji innych całkowitych dochodów w sprawozdaniu z całkowitych dochodów wybrały polskie spółki giełdowe, jaka jest istotność wyniku całkowitego oraz średnia liczba pozycji ujawnia-nych w ramach innych zysków całkowitych przez badane spółki publiczne (struktura innych zysków całko-witych. Metodą badawczą zastosowaną w artykule były studia literaturowe, analiza regulacji dotyczących sprawozdania z całkowitych dochodów (głównie MSR 1 oraz analiza sprawozdań finansowych sporządzo-nych zgodnie z Międzynarodowymi Standardami Sprawozdawczości Finansowej wybranych polskich spółek publicznych w latach 2009–2011. Wyniki badań wskazują, że w praktyce mamy do czynienia z indywidual-nym podejściem do zasad prezentacji informacji o innych całkowitych dochodach. Niewątpliwą wadą takie-go sposobu prezentacji jest brak możliwości porównywania poszczególnych kategorii sprawozdań między spółkami; analiza porównawcza jest pracochłonna i wymaga poszukiwania danych w wielu notach.

  16. Rozłam w operaizmie w świetle dynamiki włoskiego ruchu robotniczego w „czerwonym dziesięcioleciu” (1969–1980

    Directory of Open Access Journals (Sweden)

    Zbigniew Marcin Kowalewski

    2015-12-01

    Full Text Available Operaizm powstał w 1960–1961 roku z inicjatywy Raniero Panzieriego jako nurt radykalnej odnowy teoretycznej marksizmu w walce z obiektywizmem i historyzmem oraz równie radykalnej odnowy strategicznej ruchu robotniczego w walce z dominującym w nim reformizmem. Miał mieć za podstawę materialistyczną lekturę Kapitału „z robotniczego punktu widzenia”. Wkrótce okazało się, że jest głęboko podzielony teoretycznie i politycznie. W 1963 roku w środowisku operaistycznym nastąpił rozłam. Większość skupiona wokół Maria Trontiego oddzieliła się, dokonując antymaterialistycznej rewizji marksizmu i stworzyła metafizykę autonomii robotniczej. Ogromna fala walk robotniczych w latach 1969–1980 przyniosła wyraźne rozstrzygnięcia w fundamentalnych kwestiach spornych, które podzieliły operaistów.

  17. Czynniki prognostyczne progresji radiologicznej w reumatoidalnym zapaleniu stawów

    Directory of Open Access Journals (Sweden)

    Piotr Wiland

    2010-08-01

    Full Text Available Możliwość przewidywania odległych konsekwencji reumatoidalnegozapalenia stawów ma zasadnicze znaczenie dla podejmowaniawłaściwych decyzji terapeutycznych u danego chorego. Markeryprognostyczne są pomocne w identyfikacji chorych o dużym ryzykuszybkiej progresji radiologicznej. Utwierdzają one lekarzaw decyzji o rozpoczęciu intensywnego leczenia u chorych z możliwąznaczną destrukcją stawów w ciągu następnych kilku lat.W artykule zaprezentowano pilotażowy model ryzyka dla przewidywaniaszybkiej progresji radiologicznej. W celu stworzenia tegomodelu posłużono się danymi, w tym wynikami badań radiologicznychpochodzącymi z badania ASPIRE, w którym porównywanomonoterapię metotreksatem z leczeniem skojarzonym metotreksatemi infliksymabem. W tym modelu wybrano wyjściowe parametry,które są łatwe do uzyskania w rutynowej praktyce klinicznej,takie jak: stężenie białka C-reaktywnego, wartość odczynuopadania krwinek czerwonych, liczbę obrzękniętych stawów orazmiano czynnika reumatoidalnego. Ten macierzowy model ryzykamoże być przydatny w ocenie ryzyka postępującego uszkodzeniastawów, szczególnie u chorych z wczesnym zapaleniem stawów.

  18. 48 CFR 9904.404-61 - Interpretation. [Reserved

    Science.gov (United States)

    2010-10-01

    ...] 9904.404-61 Section 9904.404-61 Federal Acquisition Regulations System COST ACCOUNTING STANDARDS BOARD, OFFICE OF FEDERAL PROCUREMENT POLICY, OFFICE OF MANAGEMENT AND BUDGET PROCUREMENT PRACTICES AND COST ACCOUNTING STANDARDS COST ACCOUNTING STANDARDS 9904.404-61 Interpretation. [Reserved] ...

  19. 48 CFR 9904.408-61 - Interpretation. [Reserved

    Science.gov (United States)

    2010-10-01

    ...] 9904.408-61 Section 9904.408-61 Federal Acquisition Regulations System COST ACCOUNTING STANDARDS BOARD, OFFICE OF FEDERAL PROCUREMENT POLICY, OFFICE OF MANAGEMENT AND BUDGET PROCUREMENT PRACTICES AND COST ACCOUNTING STANDARDS COST ACCOUNTING STANDARDS 9904.408-61 Interpretation. [Reserved] ...

  20. 48 CFR 9904.410-61 - Interpretation. [Reserved

    Science.gov (United States)

    2010-10-01

    ...] 9904.410-61 Section 9904.410-61 Federal Acquisition Regulations System COST ACCOUNTING STANDARDS BOARD, OFFICE OF FEDERAL PROCUREMENT POLICY, OFFICE OF MANAGEMENT AND BUDGET PROCUREMENT PRACTICES AND COST ACCOUNTING STANDARDS COST ACCOUNTING STANDARDS 9904.410-61 Interpretation. [Reserved] ...

  1. 48 CFR 9904.407-61 - Interpretation. [Reserved

    Science.gov (United States)

    2010-10-01

    ...] 9904.407-61 Section 9904.407-61 Federal Acquisition Regulations System COST ACCOUNTING STANDARDS BOARD, OFFICE OF FEDERAL PROCUREMENT POLICY, OFFICE OF MANAGEMENT AND BUDGET PROCUREMENT PRACTICES AND COST ACCOUNTING STANDARDS COST ACCOUNTING STANDARDS 9904.407-61 Interpretation. [Reserved] ...

  2. 48 CFR 9904.409-61 - Interpretation. [Reserved

    Science.gov (United States)

    2010-10-01

    ...] 9904.409-61 Section 9904.409-61 Federal Acquisition Regulations System COST ACCOUNTING STANDARDS BOARD, OFFICE OF FEDERAL PROCUREMENT POLICY, OFFICE OF MANAGEMENT AND BUDGET PROCUREMENT PRACTICES AND COST ACCOUNTING STANDARDS COST ACCOUNTING STANDARDS 9904.409-61 Interpretation. [Reserved] ...

  3. 48 CFR 9904.405-61 - Interpretation. [Reserved

    Science.gov (United States)

    2010-10-01

    ...] 9904.405-61 Section 9904.405-61 Federal Acquisition Regulations System COST ACCOUNTING STANDARDS BOARD, OFFICE OF FEDERAL PROCUREMENT POLICY, OFFICE OF MANAGEMENT AND BUDGET PROCUREMENT PRACTICES AND COST ACCOUNTING STANDARDS COST ACCOUNTING STANDARDS 9904.405-61 Interpretation. [Reserved] ...

  4. 24 CFR 242.61 - Management.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Management. 242.61 Section 242.61... Management. The mortgagor shall provide for management of the hospital in a manner satisfactory to HUD. (a) Contract Management of Hospital. The mortgagor shall not execute a management agreement or any other...

  5. 33 CFR 159.61 - Vents.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Vents. 159.61 Section 159.61 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) POLLUTION MARINE... to minimize clogging by either the contents of the tank or climatic conditions such as snow or ice. ...

  6. Impact of thermal loading and other water quality parameters on the epizootiology of Aeromonas hydrophila infections of centrarchids

    International Nuclear Information System (INIS)

    Esch, G.W.; Hazen, T.C.

    1979-01-01

    During the current contract year, the following results were obtained: (1) Data from field-generated studies have shown that hematocrit, hemoglobin, total red blood cell counts, total white blood cell counts, and cortisol levels are significantly affected in largemouth bass with body conditions < 2.0, suggesting that stress, body condition, and the probability of bass acquiring red-sore disease are related. Laboratory studies appear to at least partially confirm these results. (2) Chemotaxis studies show that Aeromonas hydrophila is attracted to specific sugars and amino acids and that there appears to be a strain-related affect of fish mucous on A. hydrophila isolated from red-sore lesions. (3) Immunologic and serologic tests suggest that A. hydrophila isolated from red-sore lesions on bass from one lake system will not cross-react with antibodies in sera isolated from bass in another lake system, suggesting the existence of different strains in different lakes

  7. Motywy i ograniczenia aktywności fizycznej w grupie zawodowej pracowników biurowych = Motives and limitations of physical activity in the professional group of office workers

    Directory of Open Access Journals (Sweden)

    Anna Kowalczyk

    2015-09-01

    2. Samodzielna Pracownia Epidemiologii, Wydział Nauk o Zdrowiu, Uniwersytet Medyczny w Lublinie   Autor do korespondencji / Author for correspondence lic. Anna Kowalczyk e-mail: annakowalczyklublin@gmail.com     Streszczenie   Wprowadzenie i cel pracy. Praca ma na celu określenie czynników wspierających oraz ograniczających podejmowanie aktywności fizycznej w grupie zawodowej pracowników biurowych, w zależności od cech socjodemograficznych uczestników badania. Materiał i metoda. Grupę badaną stanowiło 937 pracowników zatrudnionych w biurach na terenie województwa lubelskiego. Zastosowaną w pracy metodą badawczą był sondaż diagnostyczny, zaś narzędziem badawczym autorski kwestionariusz ankiety składający się z 19 pytań. Analizę statystyczną przeprowadzono za pomocą programu Statistica 10.0. Wyniki. Mieszkańcy miast ponad półtora razy częściej od mieszkańców wsi skłonni są do podjęcia aktywności fizycznej w celu wyrzeźbienia sylwetki (OR=1,80; CI=1,05-3,06, na skutek odczuwanej przyjemności płynącej z aktywności fizycznej (OR=1,88; CI=1,22-2,90 oraz w wyniku przeświadczenia o prewencyjnym działaniu aktywności ruchowej na wiele schorzeń (OR=1,65; CI=1,02-2,67. Natomiast pojawienie się dziecka w rodzinie zwiększa ponad 2,6 razy prawdopodobieństwo, iż aktywność ta będzie utrudniona z powodu braku czasu (OR=2,64; CI=1,91-3,65. Matki i ojcowie rzadziej wskazują jednak na występowanie problemów zdrowotnych (OR=0,59; CI=0,36-0,96 oraz na brak mobilizacji, lenistwo (OR=0,61; CI=0,46-0,81 jako czynników ograniczających aktywność ruchową. Wnioski. Badani pracownicy biurowi podejmując aktywność fizyczną kierują się chęcią zrzucenia lub utrzymania prawidłowej masy ciała, potrzebą dbałości o zdrowie oraz możliwością odreagowania codziennego napięcia i stresu. Czynnikami najbardziej ograniczającymi aktywność fizyczną badanych pracowników są: brak czasu, uczucie zmęczenia oraz brak

  8. First lasing of the Dutch Fusion-FEM: 730 kW, 200 GHz

    Energy Technology Data Exchange (ETDEWEB)

    Urbanus, W.H. E-mail: urbanus@rijnh.nl; Bongers, W.A.; Geer, C.A.J. van der; Manintveld, P.; Plomp, J.; Pluygers, J.; Poelman, A.J.; Smeets, P.H.M.; Schueller, F.C.; Verhoeven, A.G.A.; Bratman, V.L.; Denisov, G.G.; Savilov, A.V.; Shmelyov, M.Yu.; Caplan, M.; Varfolomeev, A.A

    1999-06-01

    A high-power electrostatic free-electron maser is operated at various frequencies. An output power of 730 kW at 206 GHz is generated with a 7.2 A, 1.77 MeV electron beam, and 360 kW at 167 GHz is generated with a 7.0 A, 1.61 MeV electron beam. It is shown experimentally and by simulations that, depending on the electron beam energy, the FEM can operate in single-frequency regime. First experiments were done without electron beam energy recovery system, and the pulse length was limited to 12 {mu}s. Nevertheless, many aspects of generation of mm-wave power have been explored, such as the dependency on the electron beam energy and beam current and cavity settings such as the feedback coefficient. The achieved parameters and the FEM dynamics are in good accordance with simulations.

  9. 39 CFR 447.61 - General.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false General. 447.61 Section 447.61 Postal Service UNITED STATES POSTAL SERVICE PERSONNEL RULES OF CONDUCT FOR POSTAL EMPLOYEES Bribery, Undue Influence, or... employee to act or neglect to act in regard to his official responsibilities; and (2) Any information that...

  10. Etude comparative de la digestibilité in vivo de l'herbe de guinée (Panicum maximum Jacq.) associée aux feuilles et tiges de patate douce (Ipomoea batatas (L.) Lam) (régime Panipo) ou à l'herbe de lait (Euphorbia heterophylla L.) (régime Paneuph) chez le lapin (Oryctolagus cuniculus L.) et le cobaye (Cavia porcellus L.)

    OpenAIRE

    Kouakou, NGDV.; Kouba, M.; Thys, E.

    2016-01-01

    Digestibility of Guinea grass (Panicum maximum Jacq.) associated with sweet potato leaves and stems (Ipomoea batatas (L.) Lam) (Panipo diet) or poison milk (Euphorbia heterophylla L.) (Paneuph diet) in Rabbits (Oryctolagus cuniculus L.) and in Guinea Pigs (Cavia porcellus L.). A comparative study of in vivo digestibility of Guinea grass (Panicum maximum Jacq.) associated with sweet potato leaves and stems (Ipomoea batatas (L.) Lam) (Panipo diet) or with poison milk (Euphorbia heterophylla L.)...

  11. Polityka rachunkowości spółek notowanych na GPW w Warszawie w zakresie ujmowania przychodów z kontraktów deweloperskich

    Directory of Open Access Journals (Sweden)

    Renata Dyląg

    2010-04-01

    Full Text Available Głównym przedmiotem działalności jednostek z branży deweloperskiej jest rea-lizacja kontraktów deweloperskich, polegających na budowie (bezpośrednio lub poprzez podwykonawców a następnie sprzedaży powierzchni w budynkach handlowych, rozrywkowych, biurowych, hotelowych i mieszkalnych. Brak precyzyjnych rozwią-zań dotyczących ujmowania przychodów z tych kontraktów powodował, że niektóre jednostki ujmowały przychody w momencie przekazania nieruchomości nabywcy (zgodnie z MSR 18 „Przychody”, natomiast inne ujmowały przychody w trakcie trwania okresu budowy tej nieruchomości (zgodnie z MSR 11 „Umowy o budowę”. Celem artykułu jest ocena – przyjmowanych przez spółki deweloperskie noto-wane na warszawskiej Giełdzie Papierów Wartościowych – rozwiązań dotyczących ujmowania przychodów i wyników z kontraktów deweloperskich oraz zaprezento-wanie wpływu interpretacji KIMSF 15 „Umowy dotyczące budowy nieruchomości” na sprawozdawczość tych spółek.

  12. 42 CFR 61.19 - Copyright and reproduction.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Copyright and reproduction. 61.19 Section 61.19 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES FELLOWSHIPS, INTERNSHIPS, TRAINING FELLOWSHIPS Regular Fellowships § 61.19 Copyright and reproduction. Where the work accomplished...

  13. 49 CFR 38.61 - Public information system.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false Public information system. 38.61 Section 38.61... SPECIFICATIONS FOR TRANSPORTATION VEHICLES Rapid Rail Vehicles and Systems § 38.61 Public information system. (a... other passenger information. Alternative systems or devices which provide equivalent access are also...

  14. $W^+ W^-$ + Jet: Compact Analytic Results

    Energy Technology Data Exchange (ETDEWEB)

    Campbell, John [Fermilab; Miller, David [Glasgow U.; Robens, Tania [Dresden, Tech. U.

    2016-01-14

    In the second run of the LHC, which started in April 2015, an accurate understanding of Standard Model processes is more crucial than ever. Processes including electroweak gauge bosons serve as standard candles for SM measurements, and equally constitute important background for BSM searches. We here present the NLO QCD virtual contributions to W+W- + jet in an analytic format obtained through unitarity methods and show results for the full process using an implementation into the Monte Carlo event generator MCFM. Phenomenologically, we investigate total as well as differential cross sections for the LHC with 14 TeV center-of-mass energy, as well as a future 100 TeV proton-proton machine. In the format presented here, the one-loop virtual contributions also serve as important ingredients in the calculation of W+W- pair production at NNLO.

  15. 7 CFR 1215.61 - Books and records.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Books and records. 1215.61 Section 1215.61... CONSUMER INFORMATION Popcorn Promotion, Research, and Consumer Information Order Reports, Books, and Records § 1215.61 Books and records. Each person who is subject to this subpart shall maintain and make...

  16. 7 CFR 1218.61 - Books and records.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Books and records. 1218.61 Section 1218.61..., AND INFORMATION ORDER Blueberry Promotion, Research, and Information Order Reports, Books, and Records § 1218.61 Books and records. Each first handler, producer, and importer subject to this subpart shall...

  17. 7 CFR 1216.61 - Books and records.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Books and records. 1216.61 Section 1216.61... INFORMATION ORDER Peanut Promotion, Research, and Information Order Reports, Books, and Records § 1216.61 Books and records. Each first handler and producer subject to this subpart shall maintain and make...

  18. 7 CFR 1219.61 - Books and records.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Books and records. 1219.61 Section 1219.61..., AND INFORMATION Hass Avocado Promotion, Research, and Information Order Books, Records, and Reports § 1219.61 Books and records. Each producer, first handler, and importer subject to this subpart shall...

  19. 7 CFR 1206.61 - Books and records.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Books and records. 1206.61 Section 1206.61... INFORMATION Mango Promotion, Research, and Information Order Definitions Reports, Books, and Records § 1206.61 Books and records. Each first handler and importer shall maintain and make available for inspection by...

  20. CP violating observables in e$^{-}$e$^{+}$ --> W$^{-}$W$^{+}$

    CERN Document Server

    Chang, D; Phillips, I

    1993-01-01

    We consider various integrated lepton charge-energy asymmetries and azimuthal asymmetries as tests of CP violation in the process $e^-e^+ \\to W^-W^+$. These asymmetries are sensitive to different linear combinations of the CP violating form factors in the three gauge boson $W^-W^+$ production vertex, and can distinguish dispersive and absorptive parts of the form factors. It makes use of purely hadronic and purely leptonic modes of $W$'s decays as well as the mixed modes. The techniques of using the kinematics of jets or missing momentum to construct CP--odd observables are also employed. These CP violating observables are illustrated in the generalized Left-Right Model and the Charged Higgs Model.

  1. 26 CFR 1.61-1 - Gross income.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Gross income. 1.61-1 Section 1.61-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Definition of Gross Income, Adjusted Gross Income, and Taxable Income § 1.61-1 Gross...

  2. 25 CFR 700.61 - Fair market value.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 2 2010-04-01 2010-04-01 false Fair market value. 700.61 Section 700.61 Indians THE OFFICE OF NAVAJO AND HOPI INDIAN RELOCATION COMMISSION OPERATIONS AND RELOCATION PROCEDURES General Policies and Instructions Definitions § 700.61 Fair market value. Fair market value shall mean the value...

  3. Postawy konsumentów wobec reklam kredytów hipotecznych

    OpenAIRE

    Kmita, Emilia

    2011-01-01

    Najważniejszym aspektem poznawczym niniejszej pracy była analiza postaw konsumentów wobec reklam, ze szczególnym uwzględnieniem tych prezentujących kredyty hipoteczne. Weryfikacji postawionych przez mnie hipotez dokonałam poprzez badanie ankietowe przeprowadzone wśród klientów banku Pekao S.A. w Nowym Sączu. Wyniki badań wskazują, iż konsumenci zazwyczaj nie darzą reklam zbyt dużą sympatią czy zaufaniem. W przypadku podejmowania ważnych decyzji życiowych jakimi jest zakup własnego domu oraz w...

  4. W mass and W asymmetry at CDF

    International Nuclear Information System (INIS)

    Leone, S.

    1991-05-01

    The lepton charge asymmetry from W decaying into a lepton and a neutrino is discussed (preliminary result). This measurement gives information on parton distribution functions at low x values. The derivation of the recently published W mass value of 79.91 ± 0.39 GeV/c 2 is also presented. M W is used to set an upper limit on the top quark mass. 13 refs., 4 figs., 1 tab

  5. A study of $W^{+}W^{-}\\gamma$ events at LEP

    CERN Document Server

    Abbiendi, G; Åkesson, P F; Alexander, G; Allison, J; Amaral, P; Anagnostou, G; Anderson, K J; Arcelli, S; Asai, A; Axen, D; Azuelos, Georges; Bailey, I; Barberio, E; Barlow, R J; Batley, J Richard; Bechtle, P; Behnke, T; Bell, K W; Bell, P J; Bella, G; Bellerive, A; Benelli, G; Bethke, Siegfried; Biebel, O; Bock, P; Boeriu, O; Boutemeur, M; Braibant, S; Brigliadori, L; Brown, R M; Büsser, K; Burckhart, H J; Campana, S; Carnegie, R K; Caron, B; Carter, A A; Carter, J R; Chang, C Y; Charlton, D G; Csilling, A; Cuffiani, M; Dado, S; de Roeck, A; De Wolf, E A; Desch, Klaus; Dienes, B; Donkers, M; Dubbert, J; Duchovni, E; Duckeck, G; Duerdoth, I P; Etzion, E; Fabbri, F L; Feld, L; Ferrari, P; Fiedler, F; Fleck, I; Ford, M; Frey, A; Fürtjes, A; Gagnon, P; Gary, J W; Gaycken, G; Geich-Gimbel, C; Giacomelli, G; Giacomelli, P; Giunta, M; Goldberg, J; Gross, E; Grunhaus, Jacob; Gruwé, M; Günther, P O; Sen-Gupta, A; Hajdu, C; Hamann, M; Hanson, G G; Harder, K; Harel, A; Harin-Dirac, M; Hauschild, M; Hawkes, C M; Hawkings, R; Hemingway, R J; Hensel, C; Herten, G; Heuer, R D; Hill, J C; Hoffman, K; Horváth, D; Igo-Kemenes, P; Ishii, K; Jeremie, H; Jovanovic, P; Junk, T R; Kanaya, N; Kanzaki, J; Karapetian, G V; Karlen, D; Kawagoe, K; Kawamoto, T; Keeler, R K; Kellogg, R G; Kennedy, B W; Kim, D H; Klein, K; Klier, A; Kluth, S; Kobayashi, T; Kobel, M; Komamiya, S; Kormos, L; Kramer, T; Krieger, P; Krüger, K; Kühl, T; Kupper, M; Lafferty, G D; Landsman, H; Lanske, D; Layter, J G; Leins, A; Lellouch, D; Letts, J; Levinson, L; Lillich, J; Lloyd, S L; Loebinger, F K; Lü, J; Ludwig, J; MacPherson, A; Mader, W; Marcellini, S; Martin, A J; Masetti, G; Mashimo, T; Mättig, P; McDonald, W J; McKenna, J; McMahon, T J; McPherson, R A; Meijers, F; Menges, W; Merritt, F S; Mes, H; Michelini, A; Mihara, S; Mikenberg, G; Miller, D J; Moed, S; Mohr, W; Mori, T; Mutter, A; Nagai, K; Nakamura, I; Nanjo, H; Neal, H A; Nisius, R; O'Neale, S W; Oh, A; Okpara, A; Oreglia, M J; Orito, S; Pahl, C; Pásztor, G; Pater, J R; Patrick, G N; Pilcher, J E; Pinfold, J L; Plane, D E; Poli, B; Polok, J; Pooth, O; Przybycien, M B; Quadt, A; Rabbertz, K; Rembser, C; Renkel, P; Roney, J M; Rosati, S; Rozen, Y; Runge, K; Sachs, K; Saeki, T; Sarkisyan-Grinbaum, E; Schaile, A D; Schaile, O; Scharff-Hansen, P; Schieck, J; Schörner-Sadenius, T; Schröder, M; Schumacher, M; Schwick, C; Scott, W G; Seuster, R; Shears, T G; Shen, B C; Sherwood, P; Siroli, G; Skuja, A; Smith, A M; Sobie, R J; Söldner-Rembold, S; Spanó, F; Stahl, A; Stephens, K; Ströhmer, R; Strom, D; Tarem, S; Tasevsky, M; Taylor, R J; Teuscher, R; Thomson, M A; Torrence, E; Toya, D; Tran, P; Trigger, I; Trócsányi, Z L; Tsur, E; Turner-Watson, M F; Ueda, I; Ujvári, B; Vannerem, P; Vertesi, R; Verzocchi, M; Vollmer, C F; Voss, H; Vossebeld, Joost Herman; Waller, D; Ward, C P; Ward, D R; Watkins, P M; Watson, A T; Watson, N K; Wells, P S; Wengler, T; Wermes, N; Wetterling, D; Wilson, G W; Wilson, J A; Wolf, G; Wyatt, T R; Yamashita, S; Zer-Zion, D; Zivkovic, L; Von Krogh, J

    2004-01-01

    A study of W/sup +/W/sup -/ events accompanied by hard photon radiation, E/sub gamma />2.5 GeV, produced in e^{+}e^{-} collisions at LEP is presented. Events consistent with being two on- shell W-bosons and an isolated photon are selected from 681 pb/sup -1 / of data recorded at 180 GeV< square root s<209 GeV. From the sample of 187 selected W/sup +/W/sup -/ gamma candidates with photon energies greater than 2.5 GeV, the W/sup +/W/sup -/ gamma cross- section is determined at five values of square root s. The results are consistent with the standard model expectation. Averaging over all energies, the ratio of the observed cross-section to the standard model expectation is R(data/SM)=0.99+or-0.09+or-0.04, where the errors represent the statistical and systematic uncertainties respectively. These data provide constraints on the related O( alpha ) systematic uncertainties on the measurement of the W-boson mass at LEP. Finally, the data are used to derive 95% confidence level upper limits on possible anomalo...

  6. Charakterystyka etiologiczna udarów mózgu leczonych w Klinice Neurologii UM w Białymstoku z analizą czynników ryzyka

    Directory of Open Access Journals (Sweden)

    Anna Syta-Krzyżanowska

    2010-03-01

    Full Text Available Wstęp: W przeprowadzonych w Polsce badaniach epidemiologicznych stwierdzono utrzymujący się od kilkunastu lat wysoki współczynnik zapadalności na pierwszy w życiu udar mózgu, wzrastający wykładniczo z wiekiem oraz połączony z wciąż dużą śmiertelnością. Poznanie czynników ryzyka oraz wprowadzenie profilaktyki może istotnie zmniejszyć powyższe wskaźniki. Celem pracy było przeprowadzenie analizy epidemiologicznej pacjentów z udarem mózgu hospitalizowanych na Pododdziale Udarowym Kliniki Neurologii USK w Białymstoku. Uwzględniono w szczególności etiologię z czynnikami ryzyka oraz śmiertelnością w zależności od wieku i płci chorych. Materiał i metody: Rozpatrzono wszystkie przypadki pacjentów hospitalizowanych w Klinice Neurologii USK w Białymstoku z powodu udaru mózgu w ciągu pełnego roku kalendarzowego. Posłużono się ankietami prowadzonymi w ramach Narodowego Programu Profilaktyki i Leczenia Chorób Sercowo-Naczyniowych (POLKARD. Obliczenia statystyczne wykonywano przy użyciu programu Statistica w wersji 8.0. Wyniki: Przeanalizowano wyniki 408 pacjentów, w tym 185 (45,3% kobiet oraz 223 (54,7% mężczyzn z rozpoznanym: krwotokiem podpajęczynówkowym – 6,9%, krwotokiem śródmózgowym – 12,5% oraz udarem niedokrwiennym – 80,6%. Etiologię zatorową pochodzenia sercowego zdiagnozowano u 39,4%, zakrzep dużych naczyń u 35%, natomiast udar zatokowy u 11,6% pacjentów. Najczęstszym czynnikiem ryzyka udaru niedokrwiennego mózgu było nadciśnienie tętnicze (81,2%, następnie migotanie przedsionków i choroba niedokrwienna serca (38%. Zmarło 11,6% chorych z udarem niedokrwiennym mózgu oraz 21,5% z udarem krwotocznym. Średnia śmiertelność wyniosła 13,5%. Wnioski: Najczęstszym czynnikiem ryzyka udaru mózgu było nadciśnienie tętnicze, które szczególnie często współwystępowało z dodatkowym czynnikiem ryzyka udaru niedokrwiennego mózgu. Prowadzenie leczenia udaru mózgu w pododdzia

  7. Linearizing W-algebras

    International Nuclear Information System (INIS)

    Krivonos, S.O.; Sorin, A.S.

    1994-06-01

    We show that the Zamolodchikov's and Polyakov-Bershadsky nonlinear algebras W 3 and W (2) 3 can be embedded as subalgebras into some linear algebras with finite set of currents. Using these linear algebras we find new field realizations of W (2) 3 and W 3 which could be a starting point for constructing new versions of W-string theories. We also reveal a number of hidden relationships between W 3 and W (2) 3 . We conjecture that similar linear algebras can exist for other W-algebra as well. (author). 10 refs

  8. Evaluation of Pain Assessment Techniques and Analgesia Efficacy in a Female Guinea Pig (Cavia porcellus) Model of Surgical Pain

    Science.gov (United States)

    Oliver, Vanessa L; Athavale, Stephanie; Simon, Katherine E; Kendall, Lon V; Nemzek, Jean A; Lofgren, Jennifer L

    2017-01-01

    Guinea pigs (Cavia porcellus) are a frequently used species in research, often involving potentially painful procedures. Therefore, evidence-based recommendations regarding analgesia are critically needed to optimize their wellbeing. Our laboratory examined the efficacy of carprofen and extended-release (ER) buprenorphine, alone and as a multimodal combination, for relieving postsurgical pain in guinea pigs. Animals were assessed by using evoked (mechanical hypersensitivity), nonevoked (video ethogram, cageside ethogram, time-to-consumption test), and clinical (weight loss) measurements for 96 h during baseline, anesthesia–analgesia, and hysterectomy conditions. In addition, ER buprenorphine was evaluated pharmacologically. Guinea pigs treated with a single analgesic showed increased mechanical sensitivity for at least 96 h and indices of pain according to the video ethogram for as long as 8 h, compared with levels recorded during anesthesia–analgesia. In contrast, animals given both analgesics demonstrated increased mechanical sensitivity and behavioral evidence of pain for only 2 h after surgery compared with anesthesia–analgesia. The cageside ethogram and time-to-consumption tests failed to identify differences between conditions or treatment groups, highlighting the difficulty of identifying pain in guinea pigs without remote observation. Guinea pigs treated with multimodal analgesia or ER buprenorphine lost at least 10% of their baseline weights, whereas weight loss in carprofen animals was significantly lower (3%). Plasma levels for ER buprenorphine exceeded 0.9 ng/mL from 8 to 96 h after injection. Of the 3 analgesia regimens evaluated, multimodal analgesia provided the most effective pain control in guinea pigs. However the weight loss in the ER buprenorphine–treated animals may need to be considered during analgesia selection. PMID:28724492

  9. 46 CFR 61.20-18 - Examination requirements.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Examination requirements. 61.20-18 Section 61.20-18... INSPECTIONS Periodic Tests of Machinery and Equipment § 61.20-18 Examination requirements. (a) Each tailshaft must be drawn and visually inspected at each examination. (b) On tailshafts with a taper, keyway, (if...

  10. 46 CFR 61.20-5 - Drydock examination.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Drydock examination. 61.20-5 Section 61.20-5 Shipping... INSPECTIONS Periodic Tests of Machinery and Equipment § 61.20-5 Drydock examination. (a) When any vessel is drydocked, examination shall be made of the propeller, stern bushing, sea connection, and fastenings if...

  11. 46 CFR 61.20-17 - Examination intervals.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Examination intervals. 61.20-17 Section 61.20-17... INSPECTIONS Periodic Tests of Machinery and Equipment § 61.20-17 Examination intervals. (a) A lubricant that... examination interval. (b) Except as provided in paragraphs (c) through (f) of this section, each tailshaft on...

  12. 46 CFR 61.20-1 - Steering gear.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Steering gear. 61.20-1 Section 61.20-1 Shipping COAST... Periodic Tests of Machinery and Equipment § 61.20-1 Steering gear. (a) The marine inspector must inspect the steering gear at each inspection for certification for vessels whose Certificate of Inspections...

  13. Historia i znaczenie zbiorów Biblioteki Katedry Filologii Germańskiej Uniwersytetu Mikołaja Kopernika w Toruniu – depozyt w Bibliotece Uniwersyteckiej w Toruniu

    Directory of Open Access Journals (Sweden)

    Wiesław Sieradzan

    2014-12-01

    Full Text Available Jedną z bardziej interesujących części zbiorów Biblioteki Głównej UMK jest znajdujący się tam od niedawna depozyt Biblioteki Katedry Filologii Germańskiej. Jego geneza łączy się nierozerwalnie z dziejami Uniwersytetu oraz samej Katedry, kształcącej germanistów już od ponad 40 lat. Celem autora jest poznanie tego księgozbioru, zarówno pod względem jego proweniencji, jak i wartości dla germanistów i historyków. Ważną kwestia jest ustalenie głównych twórców biblioteki germanistycznej po II wojnie światowej, jak również po reaktywacji Katedry Filologii Germańskiej w 1969 r. Depozyt Katedry Filologii Germańskiej w BG UMK liczy 7627 tomów. Już sam fakt sposobu jego powstawania, szczególnie po II wojnie światowej, głównie drogą zabezpieczania zbiorów poniemieckich, a ponadto zakupów i darów, musiał wpłynąć na różnorodność gatunkową oraz proweniencję. W depozycie daje się zauważyć mnogość ośrodków, z których nastąpiło rozproszenie zbiorów bibliotecznych. W ujęciu geograficznym jest to obszar od Greifswaldu na zachodzie po Królewiec na wschodzie. Od Gdańska i Słupska na północy aż po Dzierżoniów (Reichenbach, Świdnicę (Schweidnitz oraz Wrocław na południu. W księgozbiorze tym można wyróżnić prozę i poezję niemiecką ze szczególnym uwzględnieniem twórców z XIX i pierwszej połowy XX w., następnie opracowania krytyczne literatury niemieckiej, słowniki języka niemieckiego w tym rozmaitych jego dialektów.Ustalenia niewątpliwie autora potwierdzają tezę, że charakteryzowany księgozbiór ma niewątpliwie nie tylko ciekawą proweniencję, często udokumentowaną znakami własnościowymi w postaci pięknych exlibrisów lub superexlibrisów, ale przede wszystkim znaczną wagę dla filologów germańskich. Może bowiem stanowić cenną pomoc naukową dla badań językoznawczych i historycznych (historia Niemiec i Skandynawii. Kryje on jeszcze, pomimo powyższych ustale

  14. PIERWIASTKI ŚLADOWE W WYBRANYCH WODACH MINERALNYCH DOSTĘPNYCH W HANDLU

    Directory of Open Access Journals (Sweden)

    Adam Paweł PIECH

    Full Text Available Butelkowane wody mineralne stanowią istotne źródło zaspokajania zapotrzebowania na wodę w codziennej diecie człowieka. Ze względu na łatwość przyswajania przez organizm składników mineralnych zawartych w wodach mineralnych konieczne jest świadome wybieranie produktu o składzie dostosowanym do indywidualnych potrzeb. Oprócz makroskładników, których charakterystyka ilościowa zawsze widnieje na etykietach, wody mineralne zawierają również mikroelementy. Celem pracy była analiza koncentracji pierwiastków śladowych w 22 butelkowanych wodach mineralnych dostępnych w handlu na terenie Rzeszowa. Artykuł zawiera główne zagadnienia dotyczące znaczenia wody dla prawidłowego funkcjonowania organizmu oraz wpływu mikroelementów na zdrowie człowieka. W badaniach zastosowano metodę całkowitego odbicia promieniowania rentgenowskiego TXRF. Analizy wykazały obecność 18 pierwiastków śladowych w badanych wodach: Al, As, Ba, Br, Co, Cr, Cu, Fe, Ge, I, Mn, Ni, P, Rb, Se, Sr, Ti, Zn. Najwyższe stężenia mikroskładników w przeważającej większości występują w wodach leczniczych. Żadna z badanych wód mogąca służyć jako stałe źródło płynów w diecie (wody nisko-, średnio- i wysokozmineralizowane nie zawiera mikroskładników w ilości, która pozwalałaby na fizjologiczno-odżywcze oddziaływanie na organizm. Dodatkowo wykazano, że pomiędzy stężeniem bromu i germanu istnieje silna korelacja dodatnia R2 = 0,993.

  15. 21 CFR 801.61 - Statement of identity.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Statement of identity. 801.61 Section 801.61 Food... DEVICES LABELING Labeling Requirements for Over-the-Counter Devices § 801.61 Statement of identity. (a... principal features a statement of the identity of the commodity. (b) Such statement of identity shall be in...

  16. 7 CFR 1209.61 - Books and records.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Books and records. 1209.61 Section 1209.61..., Books and Records § 1209.61 Books and records. Each persons who is subject to this subpart shall maintain and make available for inspection by the Council or the Secretary such books and records as are...

  17. 31 CFR 315.61 - Payment after death.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Payment after death. 315.61 Section 315.61 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL..., Absentees, et al. § 315.61 Payment after death. After the death of the ward, and at any time prior to the...

  18. 46 CFR 61.30-10 - Hydrostatic test.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Hydrostatic test. 61.30-10 Section 61.30-10 Shipping... INSPECTIONS Tests and Inspections of Fired Thermal Fluid Heaters § 61.30-10 Hydrostatic test. All new installations of thermal fluid heaters must be given a hydrostatic test of 11/2 times the maximum allowable...

  19. 40 CFR 66.61 - Duty to pay.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 15 2010-07-01 2010-07-01 false Duty to pay. 66.61 Section 66.61... COLLECTION OF NONCOMPLIANCE PENALTIES BY EPA Payment § 66.61 Duty to pay. (a) Except where the owner or... who submits a petition pursuant to § 66.52 shall pay the penalty amount calculated by the owner or...

  20. 21 CFR 201.61 - Statement of identity.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Statement of identity. 201.61 Section 201.61 Food...: GENERAL LABELING Labeling Requirements for Over-the-Counter Drugs § 201.61 Statement of identity. (a) The... features a statement of the identity of the commodity. (b) Such statement of identity shall be in terms of...

  1. 46 CFR 61.15-5 - Steam piping.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Steam piping. 61.15-5 Section 61.15-5 Shipping COAST... Periodic Tests of Piping Systems § 61.15-5 Steam piping. (a) Main steam piping shall be subjected to a... removed and the piping thoroughly examined. (b) All steam piping subject to pressure from the main boiler...

  2. 7 CFR 61.30 - Examination of sampler.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Examination of sampler. 61.30 Section 61.30... Cottonseed Samplers § 61.30 Examination of sampler. Each applicant for a license as a sampler and each... examination or test to show his ability properly to perform the duties for which he is applying for a license...

  3. PRZEBIEG SYMULACJI KOMPUTEROWEJ PROCESU OCZYSZCZANIA SCIEKÓW KOMUNALNYCH W REAKTORZE OSADU CZYNNEGO

    Directory of Open Access Journals (Sweden)

    Zbigniew KOWALEWSKI

    2016-05-01

    Full Text Available Celem badań było ustalenie wpływu ilości i zakresu parametrów jakości ścieków surowych na wiarygodność wyników symulacji, co umożliwiłoby ustalenie optymalnej częstotliwości ich monitoringu, niezbędnego do pozyskiwania danych do modelowania w programach ASM. W artykule przedstawiono metodykę prowadzenia symulacji komputerowej procesu oczyszczania ścieków komunalnych w reaktorach biologicznych z osadem czynnym. Zaprezentowano sposób przygotowania i przetwarzania danych wejściowych do modelu oraz sposoby oceny i weryfikacji wyników symulacji za pomocą testów statystycznych. Modelowanie było wykonane w programie BioWin na przykładzie oczyszczalni ścieków komunalnych „Kujawy” w Krakowie. W oparciu o wstępne wyniki niniejszych badań można wnioskować, że w celu uzyskania wiarygodnych wyników symulacji pracy bioreaktora w modelu ASM niezbędne jest prowadzenie monitoringu podstawowych paramentów jakości ścieków online.

  4. Rytuksymab – miejsce w leczeniu reumatoidalnego zapalenia stawów

    Directory of Open Access Journals (Sweden)

    Małgorzata Tłustochowicz

    2011-02-01

    Full Text Available Rytuksymab jest przeciwciałem powodującym niszczenie limfocytówB zaangażowanych w proces zapalny w chorobach autoimmunologicznych.W reumatoidalnym zapaleniu stawów jest zalecanyu chorych, u których utrzymuje się aktywny proces zapalny, mimoleczenia klasycznymi lekami modyfikującymi przebieg chorobyi lekami anty-TNF-α. U tych chorych jest lekiem bardzo skutecznym,skuteczniejszym niż inny lek z grupy anty-TNF-α. Rytuksymabmoże być stosowany przez wiele lat, a jego skuteczność utrzymujesię na tym samym poziomie. Najczęstsze zdarzenia niepożądanewystępują w czasie wlewu leku, są one głównie związane z uwalnianiemcytokin z limfocytów B. Częstość i natężenie tych reakcjiznacznie się zmniejsza po premedykacji glikokortykosteroidami,a także przy kolejnych podaniach leku. Innymi powikłaniami sąinfekcje, ale ich liczba nie jest większa niż w populacji chorych nareumatoidalne zapalenie stawów. W artykule przedstawiono praktyczneaspekty kwalifikacji chorego do leczenia rytuksymabemoraz sposób przygotowania i podawania wlewu.

  5. 46 CFR 61.05-20 - Boiler safety valves.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Boiler safety valves. 61.05-20 Section 61.05-20 Shipping... INSPECTIONS Tests and Inspections of Boilers § 61.05-20 Boiler safety valves. Each safety valve for a drum, superheater, or reheater of a boiler shall be tested at the interval specified by table 61.05-10. [CGD 95-028...

  6. Quorum sensing in Aeromonas salmonicida subsp. achromogenes and the effect of the autoinducer synthase AsaI on bacterial virulence

    DEFF Research Database (Denmark)

    Schwenteit, Johanna; Gram, Lone; Nielsen, Kristian Fog

    2011-01-01

    The Gram-negative fish pathogenic bacterium Aeromonas salmonicida possesses the LuxIRtype quorum sensing (QS) system, termed AsaIR. In this study the role of QS in A. salmonicida subsp. achromogenes virulence and pigment production was investigated. Five wild-type Asa strains induced the N......Ideficient mutant was 20-fold higher than that of the isogenic wt strain and the mean day to death of the mutant was significantly prolonged. Furthermore, the expression of two virulence factors (a toxic protease, AsaP1, and a cytotoxic factor) and a brown pigment were reduced in the mutant. AsaP1 productionwas...... virulence in fish and QS has not previously been associated with A. salmonicida infections in fish. Furthermore, AsaP1 production has not previously been shown to be QS regulated. The simplicity of the A. salmonicida subsp. achromogenes LuxIR-type QS system and the observation that synthetic QSI can inhibit...

  7. 40 CFR 428.61 - Specialized definitions.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Specialized definitions. 428.61 Section 428.61 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS RUBBER MANUFACTURING POINT SOURCE CATEGORY Medium-Sized General Molded, Extruded, and...

  8. Scyntygrafia kości w diagnostyce reumatoidalnego zapalenia stawów

    Directory of Open Access Journals (Sweden)

    Witold Tłustochowicz

    2010-04-01

    Full Text Available Celem pracy była ocena przydatności trójfazowej dynamicznejscyntygrafii kości w diagnostyce reumatoidalnego zapalenia stawów.Badaniem objęto 39 chorych hospitalizowanych i diagnozowanychz powodu dolegliwości stawowych. Przeprowadzono diagnostykęobejmującą: badanie podmiotowe, przedmiotowe, badania laboratoryjneoraz obrazowe, w tym trójfazową scyntygrafię kości z użyciemtechnetu 99m. Scyntygraficzne cechy zapalenia stawówstwierdzano, gdy obserwowano wzmożone gromadzenie znacznikawe wszystkich trzech fazach badania.Po ukończeniu diagnostyki rozpoznano u 13 chorych wczesne reumatoidalnezapalenie stawów, u 4 reumatoidalne zapalenie stawów(łącznie 17 pacjentów, a u 1 niezróżnicowane zapalenie stawów.Scyntygrafia kości wykazała cechy zapalenia stawów u 13spośród nich (72,2%, u 4 osób (22,2% wzmożone gromadzeniestwierdzono tylko w fazie statycznej, a u 1 pacjenta (5,6% uzyskanoprawidłowy wynik badania. U 21 chorych wykluczono chorobęzapalną stawów (u 19 rozpoznano fibromialgię, u 2 chorobęzwyrodnieniową. W grupie bez zapalenia stawów u 14 pacjentów(66,6% nie stwierdzono istotnych nieprawidłowości w obraziescyntygraficznym, u 6 (28,6% występowało wzmożone gromadzenieznacznika w badaniu statycznym, a u 1 chorego (4,8% opisanoscyntygraficzne cechy zapalenia stawów.Wbadanej grupie czułość scyntygrafii dynamicznej kości w wykrywaniuzapalenia stawów wynosiła 72,2% (95% CI: 57,5–76,8, a swoistość 95,2% (95% CI: 82,8–99,1. Dodatni wynik badaniadynamicznego wskazuje z dużym prawdopodobieństwem naobecność zapalenia stawów [PPV 92,9% (95% CI: 74,2–98,7].Mniej wiarygodny był ujemny wynik badania [NPV 80% (95% CI:69,5–83,3]. Wyniki niniejszej pracy wskazują, że trójfazowa scyntygrafia dynamicznakości może mieć zastosowanie w diagnostyce reumatoidalnegozapalenia stawów.

  9. Sc-W-Si and Sc-W-Ge ternary systems

    International Nuclear Information System (INIS)

    Kotur, B.Ya.; Voznyak, O.M.; Bodak, O.I.

    1989-01-01

    Phase equilibria in Sc-W-Si and Sc-W-Ge ternary systems are investigated at 1070 K. Sc 2+x W 3-x Si 4 ternary compound (0≤x≤1) is determined, its crystal structure (Ce 2 Sc 3 Si 4 structural type), as well as, change of elementary cell parameters and microhardness within homogeneity range are determined. Regularities of component interaction within Sc-M-Si(Ge) (M-Cr, Mo, W) ternary system are determined. Ternary systems with Mo and W are more closer to each other according to the phase equilibria character, than to ternary systems with Cr

  10. POTENTIAL FOR GREAT EGRETS (ARDEA ALBA) TO TRANSMIT A VIRULENT STRAIN OF AEROMONAS HYDROPHILA AMONG CHANNEL CATFISH (ICTALURUS PUNCTATUS) CULTURE PONDS.

    Science.gov (United States)

    Jubirt, Madison M; Hanson, Larry A; Hanson-Dorr, Katie C; Ford, Lorelei; Lemmons, Scott; Fioranelli, Paul; Cunningham, Fred L

    2015-07-01

    Aeromonas hydrophila is a gram-negative, rod-shaped, facultative, anaerobic bacterium that is ubiquitous in freshwater and slightly brackish aquatic environments and infects fish, humans, reptiles, and birds. Recent severe outbreaks of disease in commercial channel catfish (Ictalurus punctatus) aquaculture ponds have been associated with a highly virulent A. hydrophila strain (VAH), which is genetically distinct from less-virulent strains. The epidemiology of this disease has not been determined. Given that A. hydrophila infects birds, we hypothesized that fish-eating birds may serve as a reservoir for VAH and spread the pathogen by flying to uninfected ponds. Great Egrets (Ardea alba) were used in this transmission model because these wading birds frequently prey on farmed catfish. Great Egrets that were fed VAH-infected catfish shed VAH in feces demonstrating their potential to spread VAH.

  11. Budownictwo sakralne w diecezji łódzkiej w latach 1945-1989

    OpenAIRE

    Opaliński, Mateusz

    2017-01-01

    Tematem niniejszej rozprawy jest budownictwo sakralne w diecezji łódzkiej w latach 1945–1989. Omawiana kwestia jest emanacją ogólnego konfliktu między Kościołem rzymskokatolickim a władzami państwowymi w tzw. Polsce Ludowej. Potrzeba wznoszenia nowych miejsc sprawowania kultu religijnego była istotna z punktu widzenia Episkopatu, a także zasadna biorąc pod uwagę zmiany, jakie zaszły po 1945 r. w strukturze demograficznej i wyznaniowej. Wznoszenie obiektów sakralnych było wówczas znakiem zarów...

  12. Wykorzystanie efficiency matrix w analizie zysku na pracownika (na przykładzie MŚP w sektorze informatycznym w Estonii

    Directory of Open Access Journals (Sweden)

    Paavo Siimann

    2015-10-01

    Full Text Available Przedsiębiorstwa usługowe osiągają zyski dzięki wykorzystaniu zdolności i wiedzy pracowników. Stąd miara taka jak zysk na pracownika może być użyta w celu maksymalizacji wyników finansowych i wartości firmy. Artykuł obejmuje badanie z wykorzystaniem zmiennych: liczba pracowników, wysokość kapitału własnego, kapitału obcego, kosztów operacyjnych, przychodów netto ze sprzedaży oraz zysku przed opodatkowaniem w celu oszacowania ich wpływu na zmianę zysku na pracownika. Do próby badawczej wybrano małe i średnie przedsiębiorstwa z sektora informatycznego łącznie i jako osobne grupy. Badanie objęło lata 2009–2013. Co więcej, artykuł wskazuje, że metoda efficiency matrix rozwijana od początku lat 60. w Rosji i Estonii do lat 90. ubiegłego wieku może być stosowana także obecnie. Badania wykazały, że marża brutto oraz wartość kapitału własnego wzrastały gwałtownie w analizowanym okresie. Zysk na pracownika był mniejszy w średnich firmach, a większy w przedsiębiorstwach małych, podczas gdy kapitał własny na pracownika, przychody netto ze sprzedaży w stosunku do kosztów operacyjnych oraz marża brutto były mniejsze w małych firmach.

  13. Kinerja probiotik Bacillus sp. pada pendederan benih ikan lele Clarias sp. yang diinfeksi Aeromonas hydrophila

    Directory of Open Access Journals (Sweden)

    , Sukenda

    2016-12-01

    Full Text Available ABSTRACT This experiment was conducted to assess performance of Bacillus sp. probiotic on catfish juvenile Clarias sp. infected by Aeromonas hydrophila. The probiotic content in the diets were 0% (K+ and K-, 1%, and 2% in duplicates. This experiment used randomized design with four treatments and two replications. Juveniles with average body weight of 3.22±0.15 g/fish were reared in the 1.5×2.8×0.5 m3 pond with density of 800 fish/pond. Fish were reared for 30 days and fed three times a day at rate 8% of  total body weight. At day 31, catfish were challenged by A. hydrophila 0.1 mL (106 cfu/mL. Post infection observation was carried out ten days with density 10 fish/aquaria. The result showed that fish fed diet containing 2% probiotic gave the best probiotic performance with survival rate of catfish 83.33% after challenged, spesific growth rate 5.40%, and 0,75 of feed conversion ratio. The results of the blood profile showed significantly better results in the treatment of probiotics compared to the positive control after challenge test A. hydrophila. Probiotic Bacillus sp. has given as much as 2% on feed provides better performance on catfish juvenile. Keywords: probiotic, Bacillus sp., A. hydrophila, catfish juvenille, growth  ABSTRAK Penelitian ini bertujuan untuk menguji kinerja probiotik Bacillus sp. dalam pakan pada pendederan benih ikan lele Clarias sp. yang diinfeksi bakteri Aeromonas hydrophila. Penelitian ini menggunakan rancangan acak lengkap dengan empat perlakuan yaitu kandungan probiotik dalam pakan perlakuan yaitu 0% (K+ dan K-, 1%,  dan 2%, masing-masing dengan dua ulangan. Ikan lele yang digunakan memiliki bobot rata-rata 3,22±0,15 g/ekor, dipelihara dalam kolam terpal berukuran 1,5×2,8×0,5 m3 dengan kepadatan 800 ekor/kolam. Ikan dipelihara selama 30 hari dengan frekuensi pemberian pakan tiga kali sehari sebanyak 8% dari bobot tubuh ikan. Hari ke-31 benih lele diinjeksi bakteri A. hydrophila dosis 0,1 m

  14. Przestrzeń liturgiczna w kaplicach krzyżackich domów zakonnych w Prusach - zarys problematyki

    OpenAIRE

    Rozynkowski, Waldemar

    2018-01-01

    Z założenia każdy krzyżacki dom zakonny pełnił przede wszystkim funkcje klasztorne. Chociaż w historiografii dominuje akcentowanie cech warownych tych miejsc, to jednak nie możemy mieć wątpliwości, że krzyżacki zamek tworzył wybraną przestrzeń, która miała ułatwić zakonnikom, zarówno kapłanom jak i braciom rycerzom, spełnianie obowiązków zakonnych oraz służyć organizacji życia wspólnotowego. W konsekwencji krzyżacki dom zakonny miał pomóc każdemu z jego mieszkańców w osiągnięciu zbawienia. ...

  15. Hydrophilic Surface Modification of PDMS Microchannel for O/W and W/O/W Emulsions

    Directory of Open Access Journals (Sweden)

    Shazia Bashir

    2015-09-01

    Full Text Available A surface modification method for bonded polydimethylsiloxane (PDMS microchannels is presented herein. Polymerization of acrylic acid was performed on the surface of a microchannel using an inline atmospheric pressure dielectric barrier microplasma technique. The surface treatment changes the wettability of the microchannel from hydrophobic to hydrophilic. This is a challenging task due to the fast hydrophobic recovery of the PDMS surface after modification. This modification allows the formation of highly monodisperse oil-in-water (O/W droplets. The generation of water-in-oil-in-water (W/O/W double emulsions was successfully achieved by connecting in series a hydrophobic microchip with a modified hydrophilic microchip. An original channel blocking technique to pattern the surface wettability of a specific section of a microchip using a viscous liquid comprising a mixture of honey and glycerol, is also presented for generating W/O/W emulsions on a single chip.

  16. Nonirradiated NOD,B6.SCID Il2rγ−/− KitW41/W41 (NBSGW Mice Support Multilineage Engraftment of Human Hematopoietic Cells

    Directory of Open Access Journals (Sweden)

    Brian E. McIntosh

    2015-02-01

    Full Text Available In this study, we demonstrate a newly derived mouse model that supports engraftment of human hematopoietic stem cells (HSCs in the absence of irradiation. We cross the NOD.Cg-PrkdcscidIl2rgtm1Wjl/SzJ (NSG strain with the C57BL/6J-KitW-41J/J (C57BL/6.KitW41 strain and engraft, without irradiation, the resulting NBSGW strain with human cord blood CD34+ cells. At 12-weeks postengraftment in NBSGW mice, we observe human cell chimerism in marrow (97% ± 0.4%, peripheral blood (61% ± 2%, and spleen (94% ± 2% at levels observed with irradiation in NSG mice. We also detected a significant number of glycophorin-A-positive expressing cells in the developing NBSGW marrow. Further, the observed levels of human hematopoietic chimerism mimic those reported for both irradiated NSG and NSG-transgenic strains. This mouse model permits HSC engraftment while avoiding the complicating hematopoietic, gastrointestinal, and neurological side effects associated with irradiation and allows investigators without access to radiation to pursue engraftment studies with human HSCs.

  17. 40 CFR 61.186 - Reporting requirements.

    Science.gov (United States)

    2010-07-01

    ...) NATIONAL EMISSION STANDARDS FOR HAZARDOUS AIR POLLUTANTS National Emission Standard for Inorganic Arsenic Emissions From Arsenic Trioxide and Metallic Arsenic Production Facilities § 61.186 Reporting requirements... at least 30 days prior notice of each reference opacity level determination required in § 61.183(a...

  18. 38 CFR 61.66 - Financial management.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Financial management. 61...) VA HOMELESS PROVIDERS GRANT AND PER DIEM PROGRAM § 61.66 Financial management. (a) All recipients... management system that follows generally accepted accounting principals and provides accounting records...

  19. 15 CFR 700.61 - Rating Authorizations.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 2 2010-01-01 2010-01-01 false Rating Authorizations. 700.61 Section 700.61 Commerce and Foreign Trade Regulations Relating to Commerce and Foreign Trade (Continued) BUREAU OF INDUSTRY AND SECURITY, DEPARTMENT OF COMMERCE NATIONAL SECURITY INDUSTRIAL BASE REGULATIONS...

  20. 14 CFR 61.98 - Flight proficiency.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Flight proficiency. 61.98 Section 61.98 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIRMEN...) Navigation; (viii) Slow flight and stalls; (ix) Emergency operations; and (x) Postflight procedures. (2) For...

  1. 14 CFR 61.107 - Flight proficiency.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Flight proficiency. 61.107 Section 61.107 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIRMEN... reference maneuvers; (vii) Navigation; (viii) Slow flight and stalls; (ix) Basic instrument maneuvers; (x...

  2. 14 CFR 61.127 - Flight proficiency.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Flight proficiency. 61.127 Section 61.127 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIRMEN...; (x) High-altitude operations; and (xi) Postflight procedures. (2) For an airplane category rating...

  3. Raport z badania 2016. Specjalne Strefy Ekonomiczne w Polsce w oczach przedsiębiorców i pracowników samorządów

    OpenAIRE

    Pastusiak, Radosław; Jasiniak, Magdalena; Keller, Jakub; Krzeczewski, Bartłomiej

    2016-01-01

    Niniejszy raport prezentuje wyniki projektu realizowanego w ramach projektu badawczego nr UMO-2013/09/B/HS4/, pt. Efektywność Specjalnych Stref Ekonomicznych, przez zespół Katedry Finansów Korporacji, Wydział Ekonomiczno-Socjologiczny Uniwersytetu Łódzkiego, pod kierownictwem dr hab. Radosława Pastusiaka, prof. nadzw. UŁ. w składzie: dr Magdalena Jasiniak, mgr Jakub Keller, mgr Bartłomiej Krzeczewski. Zasadniczym celem badania było określenie efektywności funkcjonowania Specjalnych Stref Ekon...

  4. Lenin w Anglii

    Directory of Open Access Journals (Sweden)

    Mario Tronti

    2016-06-01

    Full Text Available Lenin w Anglii to słynny tekst Trontiego otwierający pierwszy numer czasopisma Classe operaia, założonego po tym, jak Tronti wraz ze współpracownikami zerwał ze środowiskiem pierwszego operaizmu skupionego wokół Quaderni Rossi. To właśnie w tym tekście Tronti sformułował słynny „kopernikański zwrot w marksizmie”, zgodnie z którym punktem wyjścia analizy rzeczywistości społecznej i historii kapitalizmu powinna być walka klasy robotniczej, a nie prawa rozwoju kapitału. Do zdefiniowania zwrotu popchnęła Trontiego przedstawiona w tekście diagnoza sytuacji włoskiej klasy robotniczej w latach 60. Kontrowersyjne tezy Trontiego i jego radykalna postawa wpłynęły znacząco na dyskusje prowadzone na radykalnej włoskiej lewicy i na działania wielu aktywistów w latach 60. i 70.

  5. Signatures of Parton Exogamy in e+ e- -> W+ W- -> hadrons

    OpenAIRE

    Ellis, John; Geiger, Klaus

    1997-01-01

    We propose possible signatures of `exogamous' combinations between partons in the different W+ and W- hadron showers in e+e- -> W+W- events with purely hadronic final states. Within the space-time model for hadronic shower development that we have proposed previously, we find a possible difference of about 10 % between the mean hadronic multiplicity in such purely hadronic final states and twice the hadronic multiplicity in events in which one W decays hadronically and the other leptonically,...

  6. Physical states and scaling properties of W gravities and W strings

    International Nuclear Information System (INIS)

    Das, S.R.; Dhar, A.; Rama, S.K.

    1992-01-01

    In this paper the authors discuss some physical aspects of W gravities and W strings. The authors identify global characteristics in W gravities (in addition to the usual Euler characteristic) and show how the dependence of the partition function on the various chemical potentials involves these quantities. The authors find the operators which create physical states in W 3 and W 4 gravities and discuss their relationship with screening operators. W strings are discussed in the framework of a natural way of coupling matter to W gravity, and the issues of extra dimensions and critical dimensions are clarified. The authors find a remarkable relationship between pure W gravities and ordinary gravity coupled to c < 1 unitary minimal models

  7. Etyka w zawodzie specjalisty rachunkowości zarządczej w podręcznikach i kształceniu w Polsce

    Directory of Open Access Journals (Sweden)

    Irena Sobańska

    2016-07-01

    Full Text Available Celem artykułu jest poznanie, jak środowisko naukowe rachunkowości wspiera zawód specjalisty ra- chunkowości zarządczej w uświadamianiu wysokich wymagań etycznych oczekiwanych od tego zawo- du. W artykule zostały przedstawione zagadnienia dotyczące etyki w zawodzie specjalisty rachunkowości zarządczej w świetle badań i standardów międzynarodowych oraz wyniki i wnioski z badań treści pol- skich podręczników akademickich i programów kształcenia. Przeprowadzone badania pozwoliły pozy- tywnie zweryfikować postawioną hipotezę, mówiącą, że w procesie kształcenia akademickiego zagad- nienia etyki zawodu specjalisty rachunkowości zarządczej nie są w ogóle lub w minimalnym zakresie objaśniane. Stanowi to wskazówkę do udoskonalenia programów kształcenia w badanym zakresie na uczelniach wyższych w Polsce.

  8. 37 CFR 11.61 - Savings clause.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Savings clause. 11.61 Section... Disciplinary Proceedings; Jurisdiction, Sanctions, Investigations, and Proceedings § 11.61 Savings clause. (a... subsequent to such effective date, if such conduct would continue to justify suspension or exclusion under...

  9. 40 CFR 61.53 - Stack sampling.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 8 2010-07-01 2010-07-01 false Stack sampling. 61.53 Section 61.53 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) NATIONAL... sampling. (a) Mercury ore processing facility. (1) Unless a waiver of emission testing is obtained under...

  10. Study of Spin and Decay-Plane Correlations of W Bosons in the $e^{+} e^{-} \\to W^{+} W^{-}$ Process at LEP

    CERN Document Server

    Achard, P; Aguilar-Benítez, M; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Anderhub, H; Andreev, V P; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Bajo, A; Baksay, G; Baksay, L; Baldew, S V; Banerjee, S; Banerjee, Sw; Barczyk, A; Barillère, R; Bartalini, P; Basile, M; Batalova, N; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Bellucci, L; Berbeco, R; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Biasini, M; Biglietti, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, G J; Böhm, A; Boldizsar, L; Borgia, B; Bottai, S; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brochu, F; Burger, J D; Burger, W J; Cai, X D; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A; Casaus, J; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada, M; Chamizo-Llatas, M; Chang, Y H; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chiefari, G; Cifarelli, Luisa; Cindolo, F; Clare, I; Clare, R; Coignet, G; Colino, N; Costantini, S; de la Cruz, B; Cucciarelli, S; van Dalen, J A; De Asmundis, R; Déglon, P L; Debreczeni, J; Degré, A; Dehmelt, K; Deiters, K; Della Volpe, D; Delmeire, E; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Dierckxsens, M; Dionisi, C; Dittmar, M; Doria, A; Dova, M T; Duchesneau, D; Duda, M; Echenard, B; Eline, A; El-Hage, A; El-Mamouni, H; Engler, A; Eppling, F J; Extermann, P; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, M; Ferguson, T; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, F; Fisher, P H; Fisher, W; Fisk, I; Forconi, G; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gentile, S; Giagu, S; Gong, Z F; Grenier, G; Grimm, O; Grünewald, M W; Guida, M; van Gulik, R; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hirschfelder, J; Hofer, H; Hohlmann, M; Holzner, G; Hou, S R; Hu, Y; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Kaur, M; Kienzle-Focacci, M N; Kim, J K; Kirkby, Jasper; Kittel, E W; Klimentov, A; König, A C; Kopal, M; Koutsenko, V F; Kraber, M; Krämer, R W; Krüger, A; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Le Goff, J M; Leiste, R; Levtchenko, M; Levchenko, P M; Li, C; Likhoded, S; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Luci, C; Luminari, L; Lustermann, W; Ma Wen Gan; Malgeri, L; Malinin, A; Maña, C; Mans, J; Martin, J P; Marzano, F; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Mohanty, G B; Muanza, G S; Muijs, A J M; Musicar, B; Musy, M; Nagy, S; Natale, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Nisati, A; Novák, T; Nowak, H; Ofierzynski, R A; Organtini, G; Pal, I; Palomares, C; Paolucci, P; Paramatti, R; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Pedace, M; Pensotti, S; Perret-Gallix, D; Petersen, B; Piccolo, D; Pierella, F; Pioppi, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Pothier, J; Prokofev, D; Prokofiev, D O; Quartieri, J; Rahal-Callot, G; Rahaman, M A; Raics, P; Raja, N; Ramelli, R; Rancoita, P G; Ranieri, R; Raspereza, A V; Razis, P; Ren, D; Rescigno, M; Reucroft, S; Riemann, S; Riles, K; Roe, B P; Romero, L; Rosca, A; Rosemann, C; Rosenbleck, C; Rosier-Lees, S; Roth, S; Rubio, J A; Ruggiero, G; Rykaczewski, H; Sakharov, A; Saremi, S; Sarkar, S; Salicio, J; Sánchez, E; Schäfer, C; Shchegelskii, V; Schopper, Herwig Franz; Schotanus, D J; Sciacca, C; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shumilov, E; Shvorob, A; Son, D; Souga, C; Spillantini, P; Steuer, M; Stickland, D P; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Sushkov, S; Suter, H; Swain, J D; Szillási, Z; Tang, X W; Tarjan, P; Tauscher, L; Taylor, L; Tellili, B; Teyssier, D; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Ulbricht, J; Valente, E; Van de Walle, R T; Vásquez, R; Veszpremi, V; Vesztergombi, G; Vetlitskii, I; Vicinanza, D; Viertel, Gert M; Villa, S; Vivargent, M; Vlachos, S; Vodopyanov, I; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Wadhwa, M; Wang, Q; Wang, X L; Wang, Z M; Weber, M; Wilkens, H; Wynhoff, S; Xia, L; Xu, Z Z; Yamamoto, J; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Yeh, S C; Zalite, A; Zalite, Yu; Zhang, Z P; Zhao, J; Zhu, G Y; Zhu, R Y; Zhuang, H L; Zichichi, A; Zimmermann, B; Zöller, M

    2005-01-01

    Data collected at LEP at centre-of-mass energies \\sqrt(s) = 189 - 209 GeV are used to study correlations of the spin of W bosons using e+e- -> W+W- -> lnqq~ events. Spin correlations are favoured by data, and found to agree with the Standard Model predictions. In addition, correlations between the W-boson decay planes are studied in e+e- -> W+W- -> lnqq~ and e+e- -> W+W- -> qq~qq~ events. Decay-plane correlations, consistent with zero and with the Standard Model predictions, are measured.

  11. Anatomia do fígado de fetos de Guinea pig em final de gestação (Cavia porcellus [Linnaeus, 1758

    Directory of Open Access Journals (Sweden)

    Mariangela Toledo Barbino

    2011-08-01

    Full Text Available http://dx.doi.org/10.5007/2175-7925.2011v24n3p97 Desenvolveu-se este trabalho com o objetivo de descrever a anatomia do fígado de fetos de Guinea pig (Cavia porcellus [Linnaeus, 1758] em final de gestação e obter caracterizações anatômicas que possam fundamentar e auxiliar na compreensão da fisiologia da circulação fetal. Coletou-se os fetos de 3 fêmeas em final de gestação, os quais foram dissecados e retirado o fígado. Estes foram analisados, descritos e fotodocumentados macroscopicamente, por microscopia de luz em coloração HE e por microscopia eletrônica de varredura. O fígado dos fetos apresenta coloração castanho avermelhada e sua divisão em lobos é nitidamente observada, assim como a presença da vesícula biliar.  O fígado divide-se em lobo lateral esquerdo, lobo medial esquerdo, lobo lateral direito, lobo medial direito, lobo quadrado e lobo caudado com processos papilar e caudado Através da microscopia de luz, observa-se o tecido intensamente vascularizado sendo que, a porção esquerda do fígado recebe o sangue oriundo da placenta pela veia umbilical, e a porção direita é irrigada pela veia porta. Através desses resultados pode-se concluir que os fetos de Guinea pig possuem estruturas semelhantes anatomicamente aos de outras espécies de mamíferos.

  12. Potencjał olejków eterycznych w profilaktyce i terapii grzybic

    Directory of Open Access Journals (Sweden)

    Monika Sienkiewicz

    2008-10-01

    Full Text Available Silne właściwości antyseptyczne olejków eterycznych znane są od wielu wieków. Są one produktami metabolizmu wtórnego roślin. Olejki eteryczne i ich składniki wykazują działanie hamujące wzrost wobec bakterii, grzybów, wirusów i pierwotniaków. Ich aktywność przeciwdrobnoustrojowa jest ściśle związana ze składem chemicznym. Do tej pory nie odnotowano doniesień o rosnącej oporności szczepów bakterii i grzybów na składniki olejków. Olejki eteryczne wykazują m.in. właściwości przeciwzapalne, przeciwbólowe i antyoksydacyjne. Do najbardziej skutecznych olejków o najsilniejszych właściwościach przeciwgrzybiczych należą olejki pozyskiwane z drzewa herbacianego, tymianku, oregano, cząbru, bazylii, szałwi, goździkowca i cynamonowca. Największą aktywnością charakteryzują się olejki zawierające fenole – tymol, karwakrol i eugenol. Olejki tymiankowy, oreganowy i cząbrowy zawierają tymol i karwakrol, natomiast pozyskiwane z goździkowca i z liści cynamonowca zawierają eugenol. Jeden z najbardziej efektywnych olejków jest pozyskiwany z drzewa herbacianego (Melaleuca alternifolia. Olejek ten wykazuje wysoką aktywność wobec Candida sp., Trichophyton sp. i Microsporum sp. Olejki tymiankowy, oreganowy i rozmarynowy ze względu na szerokie spektrum aktywności mogą być polecane w leczeniu zakażeń wywoływanych przez Candida albicans, Trichophyton sp., Epidermophyton floccosum i Microsporum canis. Olejek goździkowy i cynamonowy z liści wykazują znaczące działanie hamujące wobec Aspergillus flavus, Aspergillus parasiticus, Candida albicans i Cryptococcus neoformans. Olejki eteryczne oraz ich składniki mogą posiadać silne działanie immunostymulujące, zaliczamy do nich: olejek sosnowy, cytrynowy, geraniowy, a-pinen. Olejki eteryczne znalazły zastosowanie w leczeniu infekcji dermatologicznych pochodzenia grzybiczego. Dobre wyniki przynosi również stosowanie olejków w ginekologii i w terapii

  13. On colour rearrangement in hadronic W+W- events

    International Nuclear Information System (INIS)

    Sjoestrand, T.; Khoze, V.A.

    1994-01-01

    We discuss the possibility of colour rearrangement in e + e - →W + W - →q 1 anti q 2 q 3 anti q 4 events, i.e. that the original colour singlets q 1 anti q 2 and q 3 anti q 4 may be transmuted, for instance, into new singlets q 1 anti q 4 and q 3 anti q 2 . The effects on event properties could be quite large if such a rearrangement would occur instantaneously, so that gluon emission would be restricted to each of the new singlets separately. We argue that such a scenario is unlikely for two reasons. Firstly, the W + and W - usually decay at separate times after the W + W - production, which leads to large relative phases for energetic radiation off the two constituents of a rearranged system, and a corresponding dampening of the QCD cascades. Secondly, within the perturbative scenario the colour transmutation appears only in order α s 2 and is colour-suppressed. Colour reconnection at longer time scales is quite feasible, however, and may affect the fragmentation phase. If so, the nature of non-perturbative QCD can be probed in a new way. We formulate several alternative toy models and use these to estimate the colour reconnection probability as a function of the event kinematics. Possible consequences for LEP 2 events are illustrated, with special attention to systematic errors in W mass determinations. (orig.)

  14. 40 CFR 160.61 - Equipment design.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Equipment design. 160.61 Section 160... LABORATORY PRACTICE STANDARDS Equipment § 160.61 Equipment design. Equipment used in the generation... appropriate design and adequate capacity to function according to the protocol and shall be suitably located...

  15. Superconductivity in the W-Tc and W2C-Tc systems

    International Nuclear Information System (INIS)

    Giorgi, A.L.

    1985-01-01

    A series of compositions in the W-Tc, W 2 C-Re and W 2 C-Tc systems were prepared and examined for superconductivity. The crystal structure, lattice parameters and superconducting transition temperatures of the W 2 C-Tc are reported for the first time. Similar measurements were made on the W-Tc and W 2 C-Re systems and the results compared with previous published results for these systems. 7 refs., 2 figs., 2 tabs

  16. ANÁLISIS PROXIMAL, PERFIL DE ÁCIDOS GRASOS DE LAS VÍSCERAS DEL CUY (Cavia porcellus Y SU USO POTENCIAL EN ALIMENTACIÓN ANIMAL

    Directory of Open Access Journals (Sweden)

    A. S. Parra

    2016-01-01

    Full Text Available Con el fin de evaluar el valor nutritivo de materias primas no convencionales en la elaboración de concentrado animal, de bajo coste y que no compitan con la alimentación del hombre, en la presente investigación se analizó el contenido nutricional de las vísceras abdominales de cuy (Cavia porcellus y de su harina, usando análisis proximal y perfil de ácidos grasos mediante cromatografía de gases. Se compararon estos resultados con materias primas convencionales como la harina de pescado y con vísceras de diversos animales. Los resultados obtenidos indican que la harina de vísceras de cuy puede competir con harinas de diversas procedencias dadas sus cualidades nutricionales (58% proteína, 28% grasa, 4% cenizas; además, el alto contenido de grasa en las vísceras frescas (55% base seca está constituido principalmente ácidos grasos poliinsaturados tipo omega 3, 6 y 9, siendo relevante el contenido de ácido linolénico, ácidos grasos que en la dieta de los animales son escasos y de alto costo. Es posible concluir que los componentes nutricionales de las vísceras de cuy la convierten en una materia prima promisoria en alimentación animal, estimulando así el aprovechamiento de estos residuos.

  17. 40 CFR 123.61 - Approval process.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Approval process. 123.61 Section 123... REQUIREMENTS Program Approval, Revision, and Withdrawal § 123.61 Approval process. (a) After determining that a...; and (6) Briefly outline the fundamental aspects of the State's proposed program, and the process for...

  18. 19 CFR 210.61 - Discovery and compulsory process.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Discovery and compulsory process. 210.61 Section 210.61 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION INVESTIGATIONS OF UNFAIR PRACTICES IN IMPORT TRADE ADJUDICATION AND ENFORCEMENT Temporary Relief § 210.61 Discovery and compulsory...

  19. 7 CFR 61.32 - No discrimination in sampling.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false No discrimination in sampling. 61.32 Section 61.32... FOR SALE FOR CRUSHING PURPOSES (INSPECTION, SAMPLING AND CERTIFICATION) Regulations Licensed Cottonseed Samplers § 61.32 No discrimination in sampling. Each licensed sampler, when requested, shall...

  20. 10 CFR 61.10 - Content of application.

    Science.gov (United States)

    2010-01-01

    ... of general information, specific technical information, institutional information, and financial information as set forth in §§ 61.11 through 61.16. An environmental report prepared in accordance with...