WorldWideScience

Sample records for aere

  1. Adverse Event Reporting System (AERS)

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Adverse Event Reporting System (AERS) is a computerized information database designed to support the FDA's post-marketing safety surveillance program for all...

  2. Autopistas y aeródromos

    Directory of Open Access Journals (Sweden)

    Rodríguez, Georges

    1957-11-01

    Full Text Available Estado actual, realización y proyectos de algunas de las pistas de aeródromos y grandes vías de circulación en Francia. El autor se extiende, además, en algunas consideraciones de ejecución, características específicas y maquinaria auxiliar potente.

  3. SMART- Small Motor AerRospace Technology

    Science.gov (United States)

    Balucani, M.; Crescenzi, R.; Ferrari, A.; Guarrea, G.; Pontetti, G.; Orsini, F.; Quattrino, L.; Viola, F.

    2004-11-01

    This paper presents the "SMART" (Small Motor AerRospace Tecnology) propulsion system, constituted of microthrusters array realised by semiconductor technology on silicon wafers. SMART system is obtained gluing three main modules: combustion chambers, igniters and nozzles. The module was then filled with propellant and closed by gluing a piece of silicon wafer in the back side of the combustion chambers. The complete assembled module composed of 25 micro- thrusters with a 3 x 5 nozzle is presented. The measurement showed a thrust of 129 mN and impulse of 56,8 mNs burning about 70mg of propellant for the micro-thruster with nozzle and a thrust of 21 mN and impulse of 8,4 mNs for the micro-thruster without nozzle.

  4. Signal detection in FDA AERS database using Dirichlet process.

    Science.gov (United States)

    Hu, Na; Huang, Lan; Tiwari, Ram C

    2015-08-30

    In the recent two decades, data mining methods for signal detection have been developed for drug safety surveillance, using large post-market safety data. Several of these methods assume that the number of reports for each drug-adverse event combination is a Poisson random variable with mean proportional to the unknown reporting rate of the drug-adverse event pair. Here, a Bayesian method based on the Poisson-Dirichlet process (DP) model is proposed for signal detection from large databases, such as the Food and Drug Administration's Adverse Event Reporting System (AERS) database. Instead of using a parametric distribution as a common prior for the reporting rates, as is the case with existing Bayesian or empirical Bayesian methods, a nonparametric prior, namely, the DP, is used. The precision parameter and the baseline distribution of the DP, which characterize the process, are modeled hierarchically. The performance of the Poisson-DP model is compared with some other models, through an intensive simulation study using a Bayesian model selection and frequentist performance characteristics such as type-I error, false discovery rate, sensitivity, and power. For illustration, the proposed model and its extension to address a large amount of zero counts are used to analyze statin drugs for signals using the 2006-2011 AERS data. PMID:25924820

  5. Discussion forum on electron beam instruments AERE Harwell

    International Nuclear Information System (INIS)

    The purpose of this catalogue is to provide a source of information on the equipment available at AERE Harwell, to the nuclear and non-nuclear scientist. The original aim, that is, is to provide data on electron/proton beam instruments has been revised to include optical devices and ancillary preparatory equipment. The intention is to enable prospective users to have a contact who can provide further detailed information, although it must be recognised that work on certain projects completely fills the time available. This publication has been updated, first catalogue published in January 1975, to August 1980 and it is the intention that it should form part of a similar publication which incorporates details of similar equipment available throughout the UKAEA. (author)

  6. Estudio de impacto ambiental de un aeródromo

    Directory of Open Access Journals (Sweden)

    Gómez Orea, Domingo

    1996-04-01

    Full Text Available Airports and aerodromes are transport infrastructures which, apart from contributing to the mobility of people and goods, favor social development, since they promote new activities, stimulate local initiatives and reassess bordering areas. This article presents a synthesis of the Environmental Impact Study of a future aerodrome, whose design project is way at present. The aerodrome is submitted to the EIA administrative procedure due to the currently applicable specific legislation: R.D. 1302/86. The technical document submitted for study is the special plan of the aerodrome. One of the basic criteria in the conception of airports and private airfields is the compatibility with the habitability of the environment as well as with the ecological and landscape conditions. This criteria should play a part in the orientation of the runways, trajectory of the taking off and landing maneuvers..., even in the location and design og the parking spaces, hangars and other facilities. This idea suggests the design be conceived with environmental-friendly sensibility, right from the initial stages, without leaving the responsibility of this issue to the environmental study impact. The present study has its own style of approaching the dissemination, consisting of the idea that the reader will find the methodological aspects more useful than the technical data which are of consequence only in the handling of the different project stages. The aspects which are also considered important for the reader are those which allowed the team of editors to form their criteria on the issues of expenses, environmental benefits of the design, its acceptability, etc. The methodology applied is a classical one, in accordance with the requirements of the EIA regulations.

    Los aeropuertos y aeródromos son infraestructuras de transporte que, además de contribuir a la movilidad de las personas y mercancías, fomentan el desarrollo porque promocionan nuevas

  7. AerChemMIP: Quantifying the effects of chemistry and aerosols in CMIP6

    OpenAIRE

    Collins, William J; Lamarque, Jean-François; Schulz, Michael; Boucher, Olivier; Eyring, Veronika; Hegglin, Michaela I.; Maycock, Amanda; Myhre, Gunnar; Prather, Michael; Shindell, Drew; Smith, Steven J.

    2016-01-01

    The Aerosol Chemistry Model Intercomparison Project (AerChemMIP) is endorsed by the Coupled-Model Intercomparison Project 6 (CMIP6) and is designed to quantify the climate and air quality impacts of aerosols and chemically-reactive gases. These are specifically near-term climate forcers (NTCFs: tropospheric ozone and aerosols, and their precursors), methane, nitrous oxide and ozone-depleting halocarbons. The aim of AerChemMIP is to answer four scientific questions: 1. How have anthropogeni...

  8. Microbiota aeróbia conjuntival nas conjuntivites adenovirais

    Directory of Open Access Journals (Sweden)

    Nakano Eliane Mayumi

    2002-01-01

    Full Text Available Objetivos: Estudar a microbiota aeróbica conjuntival em pacientes com quadro clínico de conjuntivite viral aguda. Método: Trinta pacientes entre 18 e 40 anos portadores de conjuntivite adenoviral e 30 pacientes sem a doença foram submetidos à colheita de material da conjuntiva para cultura. Os portadores de conjuntivite adenoviral foram submetidos ao exame até 3 dias após o início dos sintomas. As culturas foram realizadas utilizando-se os meios de ágar-sangue e ágar-chocolate. Pacientes em uso de medicação tópica ou sistêmica, usuários de lentes de contato e aqueles com doença ocular prévia ou doença sistêmica foram excluídos. Resultados: Houve positividade significantemente maior das culturas de conjuntiva nos pacientes com conjuntivite adenoviral (33,3%, sendo Haemophylus influenzae em 50% e Streptococcus pneumoniae em 50% quando comparados ao grupo controle (6,6% - Staphylococcus coagulase negativo. O grupo de pacientes com conjuntivite e que apresentaram culturas positivas, não diferiu em nenhum dos critérios clínicos analisados do grupo com culturas negativas. Conclusão: Pacientes com conjuntivite adenoviral apresentaram maior freqüência de exames de cultura de amostra de conjuntiva positivas quando comparados aos controles normais. Os pacientes com conjuntivite adenoviral com cultura positiva apresentaram evolução clínica semelhante aos pacientes com cultura negativa. Os agentes isolados na microbiota conjuntival no grupo com conjuntivite foram diferentes do observado no grupo normal. Porém o resultado das culturas não apresentou correlação com a evolução clínica.

  9. Fusion Welding of AerMet 100 Alloy

    Energy Technology Data Exchange (ETDEWEB)

    ENGLEHART, DAVID A.; MICHAEL, JOSEPH R.; NOVOTNY, PAUL M.; ROBINO, CHARLES V.

    1999-08-01

    A database of mechanical properties for weldment fusion and heat-affected zones was established for AerMet{reg_sign}100 alloy, and a study of the welding metallurgy of the alloy was conducted. The properties database was developed for a matrix of weld processes (electron beam and gas-tungsten arc) welding parameters (heat inputs) and post-weld heat treatment (PWHT) conditions. In order to insure commercial utility and acceptance, the matrix was commensurate with commercial welding technology and practice. Second, the mechanical properties were correlated with fundamental understanding of microstructure and microstructural evolution in this alloy. Finally, assessments of optimal weld process/PWHT combinations for cotildent application of the alloy in probable service conditions were made. The database of weldment mechanical properties demonstrated that a wide range of properties can be obtained in welds in this alloy. In addition, it was demonstrated that acceptable welds, some with near base metal properties, could be produced from several different initial heat treatments. This capability provides a means for defining process parameters and PWHT's to achieve appropriate properties for different applications, and provides useful flexibility in design and manufacturing. The database also indicated that an important region in welds is the softened region which develops in the heat-affected zone (HAZ) and analysis within the welding metallurgy studies indicated that the development of this region is governed by a complex interaction of precipitate overaging and austenite formation. Models and experimental data were therefore developed to describe overaging and austenite formation during thermal cycling. These models and experimental data can be applied to essentially any thermal cycle, and provide a basis for predicting the evolution of microstructure and properties during thermal processing.

  10. dackel acts in the ectoderm of the zebrafish pectoral fin bud to maintain AER signaling.

    Science.gov (United States)

    Grandel, H; Draper, B W; Schulte-Merker, S

    2000-10-01

    Classical embryological studies have implied the existence of an apical ectodermal maintenance factor (AEMF) that sustains signaling from the apical ectodermal ridge (AER) during vertebrate limb development. Recent evidence suggests that AEMF activity is composed of different signals involving both a sonic hedgehog (Shh) signal and a fibroblast growth factor 10 (Fgf10) signal from the mesenchyme. In this study we show that the product of the dackel (dak) gene is one of the components that acts in the epidermis of the zebrafish pectoral fin bud to maintain signaling from the apical fold, which is homologous to the AER of tetrapods. dak acts synergistically with Shh to induce fgf4 and fgf8 expression but independently of Shh in promoting apical fold morphogenesis. The failure of dak mutant fin buds to progress from the initial fin induction phase to the autonomous outgrowth phase causes loss of both AER and Shh activity, and subsequently results in a proximodistal truncation of the fin, similar to the result obtained by ridge ablation experiments in the chicken. Further analysis of the dak mutant phenotype indicates that the activity of the transcription factor engrailed 1 (En1) in the ventral non-ridge ectoderm also depends on a maintenance signal probably provided by the ridge. This result uncovers a new interaction between the AER and the dorsoventral organizer in the zebrafish pectoral fin bud.

  11. A massa gorda de risco afeta a capacidade aeróbia de jovens adolescentes

    Directory of Open Access Journals (Sweden)

    Luís Massuça

    2013-12-01

    Full Text Available OBJETIVO: Estudar o comportamento do sexo e os efeitos da idade e da massa gorda sobre a capacidade aeróbia de jovens adolescentes. MÉTODOS: Os 621 estudantes do ensino secundário participantes no estudo (14 aos 17 anos; feminino: n = 329, idade, 15,84 ± 0,92 anos; masculino: n = 292, idade, 15,82 ± 0,87 anos foram avaliados em duas categorias: morfologia (altura, peso e % massa gorda - %MG e aptidão física (capacidade aeróbia. As medições antropométricas foram realizadas de acordo com o protocolo descrito por Marfell-Jones e a %MG foi calculada por bioimpedância. A avaliação da capacidade aeróbia foi realizada com o teste aeróbio de corrida - PACER, e VO2máx relativo foi calculado utilizando a equação de Léger. Os resultados das avaliações foram classificados de acordo com os valores normativos das tabelas de referência da bateria de testes FITNESSGRAM® As técnicas estatísticas utilizadas foram: 1 cálculo de frequências; 2 teste t de Student para amostras independentes; e 3 ANOVA two-way seguida do teste post-hoc HSD de Bonferroni. RESULTADOS: 1 existem diferenças significativas entre sexos no que se refere à %MG e ao VO2máx; 2 durante a adolescência, o VO2máx estabiliza nos rapazes e sofre um declínio nas moças; 3 independentemente do sexo, a classe de %MG e a idade cronológica têm um efeito significativo sobre a capacidade aeróbia; e 4 em jovens adolescentes, com %MG de risco, a redução da %MG para níveis saudáveis parece resultar na melhoria da capacidade aeróbia. CONCLUSÃO: O impacto da %MG na capacidade aeróbia, reforça a importância da educação física escolar na promoção da saúde cardiovascular.

  12. Articulated Entity Relationship (AER Diagram for Complete Automation of Relational Database Normalization

    Directory of Open Access Journals (Sweden)

    P. S. Dhabe

    2010-05-01

    Full Text Available In this paper an Articulated Entity Relationship (AER diagram is proposed, which is an extension of EntityRelationship (ER diagram to accommodate the Functional Dependency (FD information as its integral partfor complete automation of normalization. In current relational databases (RDBMS automation ofnormalization by top down approach is possible using ER diagram as an input, provided the FD informationis available independently, meanwhile, through user interaction. Such automation we call partial andconditional automation. To avoid this user interaction, there is a strong need to accommodate FDinformation as an element of ER diagram itself. Moreover, ER diagrams are not designed by taking intoaccount the requirements of normalization. However, for better automation of normalization it must be anintegral part of conceptual design (ER Diagram. The prime motivation behind this paper to design a systemthat need only proposed AER diagram as a sole input and normalize the database up to a given normal formin one go. This would allow more amount of automation than the current approach. Such automation we callas total and unconditional automation, which is better and complete in true sense. As the proposed AERdiagram is designed by taking in to account the normalization process, normalization up to Boyce CoddNormal Form (BCNF becomes an integral part of conceptual design. Additional advantage of AER diagramis that any modifications (addition, deletion or updation of attributes made to the AER diagram willautomatically be reflected in its FD information. Thus description of schema and FD information isguaranteed to be consistent. This cannot be assured in current approach using ER diagrams, as schema andFD information are provided to the system at two different times, separately.

  13. A polishing hybrid AER/UF membrane process for the treatment of a high DOC content surface water.

    Science.gov (United States)

    Humbert, H; Gallard, H; Croué, J-P

    2012-03-15

    The efficacy of a combined AER/UF (Anion Exchange Resin/Ultrafiltration) process for the polishing treatment of a high DOC (Dissolved Organic Carbon) content (>8 mgC/L) surface water was investigated at lab-scale using a strong base AER. Both resin dose and bead size had a significant impact on the kinetic removal of DOC for short contact times (i.e. treatment conditions were applied in combination with UF membrane filtration on water previously treated by coagulation-flocculation (i.e. 3 mgC/L). A more severe fouling was observed for each filtration run in the presence of AER. This fouling was shown to be mainly reversible and caused by the progressive attrition of the AER through the centrifugal pump leading to the production of resin particles below 50 μm in diameter. More important, the presence of AER significantly lowered the irreversible fouling (loss of permeability recorded after backwash) and reduced the DOC content of the clarified water to l.8 mgC/L (40% removal rate), concentration that remained almost constant throughout the experiment. PMID:22200260

  14. Sistema bio - inspirado basado en AER aplicado a automoción

    OpenAIRE

    González Blanco, Manuel

    2012-01-01

    VULCANO (Ref: TEC2009-10639-C04-04) En este proyecto se ha trabajado en el diseño e implementación de un sistema bio-inspirado basado en eventos y su adaptación a cámaras comerciales, evitando unos de los principales problemas de este tipo de sistemas. Por otro lado, se ha aplicado el sistema a un entorno de automoción mediante la utilización de un simulador altamente inmersivo. De este modo se ha evaluado el rendimiento y adecuación de los sistemas basados en AER para la medición de la...

  15. AERE contracts with DoE on the treatment and disposal of intermediate level wastes

    International Nuclear Information System (INIS)

    This document reports work carried out in 1983/84 under 10 contracts between DoE and AERE on the treatment and disposal of intermediate level wastes. Individual summaries are provided for each contract report within the document, under the headings: comparative evaluation of α and βγ irradiated medium level waste forms; modelling and characterisation of intermediate level waste forms based on polymers; optimisation of processing parameters for polymer and bitumen modified cements; ceramic waste forms; radionuclide release during leaching; ion exchange processes; electrical processes for the treatment of medium active liquid wastes; fast reactor fuel element cladding; dissolver residues; flowsheeting/systems study. (U.K.)

  16. Dose assessment for CEGB users of the Kodak type 2 film used in the NRPB/AERE holder

    International Nuclear Information System (INIS)

    Some work, complementary to that of the National Radiological Protection Board (NRPB) and the Atomic Energy Research Establishment (AERE), has been done at Berkeley Nuclear Laboratories (BNL) on the response of the Kodak Type 2 film in the NRPB/AERE holder. Initial results indicate that the combination forms a satisfactory dosemeter. Comparison between the BNL and NRPB results shows differences which appear to be due to the fact that the angle of incidence was 900 for the former and 350 for the latter. Some conclusions are drawn on dosimetry but in general, for CEGB users, no substantial changes from existing procedures are required. (author)

  17. Hypersensitivity reactions to anticancer agents: Data mining of the public version of the FDA adverse event reporting system, AERS

    Directory of Open Access Journals (Sweden)

    Sakaeda Toshiyuki

    2011-10-01

    Full Text Available Abstract Background Previously, adverse event reports (AERs submitted to the US Food and Drug Administration (FDA database were reviewed to confirm platinum agent-associated hypersensitivity reactions. The present study was performed to confirm whether the database could suggest the hypersensitivity reactions caused by anticancer agents, paclitaxel, docetaxel, procarbazine, asparaginase, teniposide, and etoposide. Methods After a revision of arbitrary drug names and the deletion of duplicated submissions, AERs involving candidate agents were analyzed. The National Cancer Institute Common Terminology Criteria for Adverse Events version 4.0 was applied to evaluate the susceptibility to hypersensitivity reactions, and standardized official pharmacovigilance tools were used for quantitative detection of signals, i.e., drug-associated adverse events, including the proportional reporting ratio, the reporting odds ratio, the information component given by a Bayesian confidence propagation neural network, and the empirical Bayes geometric mean. Results Based on 1,644,220 AERs from 2004 to 2009, the signals were detected for paclitaxel-associated mild, severe, and lethal hypersensitivity reactions, and docetaxel-associated lethal reactions. However, the total number of adverse events occurring with procarbazine, asparaginase, teniposide, or etoposide was not large enough to detect signals. Conclusions The FDA's adverse event reporting system, AERS, and the data mining methods used herein are useful for confirming drug-associated adverse events, but the number of co-occurrences is an important factor in signal detection.

  18. Sp6 and Sp8 transcription factors control AER formation and dorsal-ventral patterning in limb development.

    Directory of Open Access Journals (Sweden)

    Endika Haro

    2014-08-01

    Full Text Available The formation and maintenance of the apical ectodermal ridge (AER is critical for the outgrowth and patterning of the vertebrate limb. The induction of the AER is a complex process that relies on integrated interactions among the Fgf, Wnt, and Bmp signaling pathways that operate within the ectoderm and between the ectoderm and the mesoderm of the early limb bud. The transcription factors Sp6 and Sp8 are expressed in the limb ectoderm and AER during limb development. Sp6 mutant mice display a mild syndactyly phenotype while Sp8 mutants exhibit severe limb truncations. Both mutants show defects in AER maturation and in dorsal-ventral patterning. To gain further insights into the role Sp6 and Sp8 play in limb development, we have produced mice lacking both Sp6 and Sp8 activity in the limb ectoderm. Remarkably, the elimination or significant reduction in Sp6;Sp8 gene dosage leads to tetra-amelia; initial budding occurs, but neither Fgf8 nor En1 are activated. Mutants bearing a single functional allele of Sp8 (Sp6-/-;Sp8+/- exhibit a split-hand/foot malformation phenotype with double dorsal digit tips probably due to an irregular and immature AER that is not maintained in the center of the bud and on the abnormal expansion of Wnt7a expression to the ventral ectoderm. Our data are compatible with Sp6 and Sp8 working together and in a dose-dependent manner as indispensable mediators of Wnt/βcatenin and Bmp signaling in the limb ectoderm. We suggest that the function of these factors links proximal-distal and dorsal-ventral patterning.

  19. Amide-Exchange-Rate-Edited NMR (AERE-NMR) Experiment:A Novel Method for Resolving Overlapping Resonances

    Institute of Scientific and Technical Information of China (English)

    LIU Xue-Hui; LIN Dong-Hai

    2007-01-01

    This paper describes an amide-exchange-rate-edited (AERE) NMR method that can effectively alleviate the problem of resonance overlap for proteins and peptides. This method exploits the diversity of amide proton exchange rates and consists of two complementary experiments: (1) SEA (solvent exposed amide)-type NMR experiments to map exchangeable surface residues whose amides are not involved in hydrogen bonding, and (2) presat-type NMR experiments to map solvent inaccessibly buried residues or nonexchangeable residues located in hydrogen-bonded secondary structures with properly controlled saturation transfer via amide proton exchanges with the solvent. This method separates overlapping resonances in a spectrum into two complementary spectra. The AERE-NMR method was demonstrated with a sample of 15N/13C/2H(70%) labeled ribosome-inactivating protein trichosanthin of 247 residues.

  20. Iniciación educativa a la resistencia aeróbica. (III Canto en carrera: funciones y asignaciones

    Directory of Open Access Journals (Sweden)

    Antonio D. Galera

    2014-03-01

    Full Text Available El autor presenta un conjunto de factores didácticos sistemáticos para la iniciación educativa a la resistencia aeróbica, centrándose en métodos aplicables a la realidad escolar desde una perspectiva sostenible. La doctrina en que se sustenta fue desarrollada por el autor como resultado de su experiencia con un grupo de niños y niñas que participaron en un programa escolar de educación física cooperativa, uno de cuyos contenidos maestros era el desarrollo de la resistencia aeróbica. Los criterios de aplicación didáctica están contemplados desde el ámbito escolar, de primaria o de secundaria, si bien pueden adaptarse a otros ámbitos, como el entrenamiento a cualquier edad, actividades de tiempo libre, etc. El autor concluye su exposición doctrinal y presenta repertorios de cantos escolares aplicables a su propuesta de interrelación disciplinar entre educación física y educación musical para la iniciación educativa a la resistencia aeróbica desde una perspectiva sostenible.

  1. A Bio-Inspired AER Temporal Tri-Color Differentiator Pixel Array.

    Science.gov (United States)

    Farian, Łukasz; Leñero-Bardallo, Juan Antonio; Häfliger, Philipp

    2015-10-01

    This article investigates the potential of a bio-inspired vision sensor with pixels that detect transients between three primary colors. The in-pixel color processing is inspired by the retinal color opponency that are found in mammalian retinas. Color transitions in a pixel are represented by voltage spikes, which are akin to a neuron's action potential. These spikes are conveyed off-chip by the Address Event Representation (AER) protocol. To achieve sensitivity to three different color spectra within the visual spectrum, each pixel has three stacked photodiodes at different depths in the silicon substrate. The sensor has been fabricated in the standard TSMC 90 nm CMOS technology. A post-processing method to decode events into color transitions has been proposed and implemented as a custom interface to display real-time color changes in the visual scene. Experimental results are provided. Color transitions can be detected at high speed (up to 2.7 kHz). The sensor has a dynamic range of 58 dB and a power consumption of 22.5 mW. This type of sensor can be of use in industrial, robotics, automotive and other applications where essential information is contained in transient emissions shifts within the visual spectrum. PMID:26540694

  2. CAVIAR: A 45k neuron, 5M synapse, 12G connects/s AER hardware sensory-processing-learning-actuating system for high-speed visual object recognition and tracking

    OpenAIRE

    Linares-Barranco, Alejandro; Paz-Vicente, R.; Camuñas-Mesa, L.; Delbruck, Tobi; Jimenez-Moreno, Gabriel; Civit-Balcells, Antón; Serrano-Gotarredona, Teresa; Acosta, Antonio José; Linares-Barranco, Bernabé

    2009-01-01

    This paper describes CAVIAR, a massively parallel hardware implementation of a spike-based sensing-processing-learning-actuating system inspired by the physiology of the nervous system. CAVIAR uses the asychronous address-event representation (AER) communication framework and was developed in the context of a European Union funded project. It has four custom mixed-signal AER chips, five custom digital AER interface components, 45k neurons (spiking cells), up to 5M synapses, performs 12G synap...

  3. Effects of tempering process on properties and microstructure of AerMet340 steel%回火工艺对 AerMet340钢性能和微观组织的影响

    Institute of Scientific and Technical Information of China (English)

    黄顺喆; 厉勇; 王春旭; 刘宪民; 田志凌

    2015-01-01

    The effects of tempering temperature and time on the mechanical properties and microstructure of a secondary hardening ultra-high strength steel AerMet340 were investigated by means of mechanical test, SEM, TEM and XRD respectively.The results show that the tempering curve of AerMet340 steel presents secondary hardening phenomenon obviously, and the tempering process to obtain the best properties is tempered at 482 ℃ for 5 h and then air cooled.The peak values of tensile strength and yield strength are 2460 MPa and 2061 MPa, corresponding to the peak temperature respectively of 450 ℃ and 468 ℃.When tempered at lower temperatures, AerMet340 steel is mainly composed of tempered martensite andε-carbides.When tempered above 468 ℃, the wee acicular M2 C carbides precipitate with distributing of dispersion in matrix, which is one of the main reasons for the high strength of the steel.Moreover, with tempering temperature rising, the contents of Fe, Cr and Mo, as the main components of M2 C carbides, increase significantly, which makes the lattice constant of M2 C change and the precipitates are divorced from a coherent relationship with the matrix gradually.%采用力学性能测试、SEM、TEM、XRD等试验方法研究了回火温度和时间对二次硬化型超高强度钢AerMet340的力学性能及微观组织的影响。结果表明,AerMet340钢的回火曲线呈现明显的二次硬化现象,获得最佳综合性能的回火工艺为482℃×5 h空冷;抗拉强度、规定塑性延伸强度峰值分别为2460 MPa、2061 MPa,对应的回火温度分别为450、468℃;在低温回火时,AerMet340钢主要由回火马氏体和ε-碳化物组成,高于468℃回火时,基体中弥散分布着细小针状M2 C碳化物,这是该钢获得高强韧性的主要原因之一;随着回火温度的上升,合金碳化物M2 C的主要合金成分Fe、Cr、Mo含量明显升高,使得M2 C的晶格常数发生变化,并逐渐脱离了与基体的共格关系。

  4. Extraction of pure thermal neutron beam for the proposed PGNAA facility at the TRIGA research reactor of AERE, Savar, Bangladesh

    Science.gov (United States)

    Alam, Sabina; Zaman, M. A.; Islam, S. M. A.; Ahsan, M. H.

    1993-10-01

    A study on collimators and filters for the design of a spectrometer for prompt gamma neutron activation analysis (PGNAA) at one of the radial beamports of the TRIGA Mark II reactor at AERE, Savar has been carried out. On the basis of this study a collimator and a filter have been designed for the proposed PGNAA facility. Calculations have been done for measuring neutron flux at various positions of the core of the reactor using the computer code TRIGAP. Gamma dose in the core of the reactor has also been measured experimentally using TLD technique in the present work.

  5. Efeitos do treinamento aeróbio sobre o perfil lipídico de ratos com hipertireoidismo

    OpenAIRE

    Renata Valle Pedroso; Alexandre Konig Garcia Prado; Luiza Hermínia Gallo; Marcelo Costa Junior; Natália Oliveira Betolini; Rodrigo Augusto Dalia; Maria Alice Rostom de Mello; Eliete Luciano

    2012-01-01

    Há poucos estudos analisando a importante relação entre o exercício físico, agudo e crônico, e alterações metabólicas decorrentes do hipertireoidismo. O objetivo do presente estudo foi analisar o efeito de quatro semanas de treinamento aeróbio sobre o perfil lipídico de ratos com hipertireoidismo experimental. Foram utilizados 45 ratos da linhagem Wistar, divididos aleatoriamente em quatro grupos: Controle Sedentário (CS) - administrados com salina durante o período experimental, não praticar...

  6. Extraction of pure thermal neutron beam for the proposed PGNAA facility at the TRIGA research reactor of AERE, Savar, Bangladesh

    Energy Technology Data Exchange (ETDEWEB)

    Alam, S. (Physics Dept., Jahangirnagar Univ., Savar, Dhaka (Bangladesh)); Zaman, M.A. (Physics Dept., Jahangirnagar Univ., Savar, Dhaka (Bangladesh)); Islam, S.M.A. (Physics Dept., Jahangirnagar Univ., Savar, Dhaka (Bangladesh)); Ahsan, M.H. (Inst. of Nuclear Science and Technology (INST), AERE, Savar, Dhaka (Bangladesh))

    1993-10-01

    A study on collimators and filters for the design of a spectrometer for prompt gamma neutron activation analysis (PGNAA) at one of the radial beamports of the TRIGA Mark II reactor at AERE, Savar has been carried out. On the basis of this study a collimator and a filter have been designed for the proposed PGNAA facility. Calculations have been done for measuring neutron flux at various positions of the core of the reactor using the computer code TRIGAP. Gamma dose in the core of the reactor has also been measured experimentally using TLD technique in the present work. (orig.)

  7. Extraction of pure thermal neutron beam for the proposed PGNAA facility at the TRIGA research reactor of AERE, Savar, Bangladesh

    International Nuclear Information System (INIS)

    A study on collimators and filters for the design of a spectrometer for prompt gamma neutron activation analysis (PGNAA) at one of the radial beamports of the TRIGA Mark II reactor at AERE, Savar has been carried out. On the basis of this study a collimator and a filter have been designed for the proposed PGNAA facility. Calculations have been done for measuring neutron flux at various positions of the core of the reactor using the computer code TRIGAP. Gamma dose in the core of the reactor has also been measured experimentally using TLD technique in the present work. (orig.)

  8. Uncertainties in modelling Mt. Pinatubo eruption with 2-D AER model and CCM SOCOL

    Science.gov (United States)

    Kenzelmann, P.; Weisenstein, D.; Peter, T.; Luo, B. P.; Rozanov, E.; Fueglistaler, S.; Thomason, L. W.

    2009-04-01

    Large volcanic eruptions may introduce a strong forcing on climate. They challenge the skills of climate models. In addition to the short time attenuation of solar light by ashes the formation of stratospheric sulphate aerosols, due to volcanic sulphur dioxide injection into the lower stratosphere, may lead to a significant enhancement of the global albedo. The sulphate aerosols have a residence time of about 2 years. As a consequence of the enhanced sulphate aerosol concentration both the stratospheric chemistry and dynamics are strongly affected. Due to absorption of longwave and near infrared radiation the temperature in the lower stratosphere increases. So far chemistry climate models overestimate this warming [Eyring et al. 2006]. We present an extensive validation of extinction measurements and model runs of the eruption of Mt. Pinatubo in 1991. Even if Mt. Pinatubo eruption has been the best quantified volcanic eruption of this magnitude, the measurements show considerable uncertainties. For instance the total amount of sulphur emitted to the stratosphere ranges from 5-12 Mt sulphur [e.g. Guo et al. 2004, McCormick, 1992]. The largest uncertainties are in the specification of the main aerosol cloud. SAGE II, for instance, could not measure the peak of the aerosol extinction for about 1.5 years, because optical termination was reached. The gap-filling of the SAGE II [Thomason and Peter, 2006] using lidar measurements underestimates the total extinctions in the tropics for the first half year after the eruption by 30% compared to AVHRR [Rusell et. al 1992]. The same applies to the optical dataset described by Stenchikov et al. [1998]. We compare these extinction data derived from measurements with extinctions derived from AER 2D aerosol model calculations [Weisenstein et al., 2007]. Full microphysical calculations with injections of 14, 17, 20 and 26 Mt SO2 in the lower stratosphere were performed. The optical aerosol properties derived from SAGE II

  9. Building a knowledge base of severe adverse drug events based on AERS reporting data using semantic web technologies.

    Science.gov (United States)

    Jiang, Guoqian; Wang, Liwei; Liu, Hongfang; Solbrig, Harold R; Chute, Christopher G

    2013-01-01

    A semantically coded knowledge base of adverse drug events (ADEs) with severity information is critical for clinical decision support systems and translational research applications. However it remains challenging to measure and identify the severity information of ADEs. The objective of the study is to develop and evaluate a semantic web based approach for building a knowledge base of severe ADEs based on the FDA Adverse Event Reporting System (AERS) reporting data. We utilized a normalized AERS reporting dataset and extracted putative drug-ADE pairs and their associated outcome codes in the domain of cardiac disorders. We validated the drug-ADE associations using ADE datasets from SIDe Effect Resource (SIDER) and the UMLS. We leveraged the Common Terminology Criteria for Adverse Event (CTCAE) grading system and classified the ADEs into the CTCAE in the Web Ontology Language (OWL). We identified and validated 2,444 unique Drug-ADE pairs in the domain of cardiac disorders, of which 760 pairs are in Grade 5, 775 pairs in Grade 4 and 2,196 pairs in Grade 3.

  10. 75 FR 27332 - AER NY-Gen, LLC; Eagle Creek Hydro Power, LLC; Eagle Creek Water Resources, LLC; Eagle Creek Land...

    Science.gov (United States)

    2010-05-14

    ... Energy Regulatory Commission AER NY-Gen, LLC; Eagle Creek Hydro Power, LLC; Eagle Creek Water Resources... Creek Hydro Power, LLC, Eagle Creek Water Resources, LLC, and Eagle Creek Land Resources, LLC.... For the transferee: Mr. Paul Ho, Eagle Creek Hydro Power, LLC, Eagle Creek Water Resources, LLC,...

  11. 77 FR 13592 - AER NY-Gen, LLC; Eagle Creek Hydro Power, LLC, Eagle Creek Water Resources, LLC, Eagle Creek Land...

    Science.gov (United States)

    2012-03-07

    ... Energy Regulatory Commission AER NY-Gen, LLC; Eagle Creek Hydro Power, LLC, Eagle Creek Water Resources... Power, LLC, Eagle Creek Water Resources, LLC, and Eagle Creek Land Resources, LLC (transferees) filed an...) 805-1469. Transferees: Mr. Bernard H. Cherry, Eagle Creek Hydro Power, LLC, Eagle Creek...

  12. CAVIAR: a 45k neuron, 5M synapse, 12G connects/s AER hardware sensory-processing- learning-actuating system for high-speed visual object recognition and tracking.

    Science.gov (United States)

    Serrano-Gotarredona, Rafael; Oster, Matthias; Lichtsteiner, Patrick; Linares-Barranco, Alejandro; Paz-Vicente, Rafael; Gomez-Rodriguez, Francisco; Camunas-Mesa, Luis; Berner, Raphael; Rivas-Perez, Manuel; Delbruck, Tobi; Liu, Shih-Chii; Douglas, Rodney; Hafliger, Philipp; Jimenez-Moreno, Gabriel; Civit Ballcels, Anton; Serrano-Gotarredona, Teresa; Acosta-Jimenez, Antonio J; Linares-Barranco, Bernabé

    2009-09-01

    This paper describes CAVIAR, a massively parallel hardware implementation of a spike-based sensing-processing-learning-actuating system inspired by the physiology of the nervous system. CAVIAR uses the asychronous address-event representation (AER) communication framework and was developed in the context of a European Union funded project. It has four custom mixed-signal AER chips, five custom digital AER interface components, 45k neurons (spiking cells), up to 5M synapses, performs 12G synaptic operations per second, and achieves millisecond object recognition and tracking latencies. PMID:19635693

  13. Niveles de intensidad de la música durante un torneo de resistencia aeróbica en Costa Rica Music intensity levels during an aerobics endurance tournament in Costa Rica

    OpenAIRE

    Yamileth Chacón Araya; José Moncada Jiménez

    2008-01-01

    El propósito del presente artículo es describir los niveles de ruido generados en una competencia de resistencia aeróbica y se analizan las posibles implicaciones para la salud de la contaminación por ruido. La danza aeróbica es un modo de ejercicio que se ha extendido por todo el mundo, con el fin de posibilitar la práctica de una actividad física que combina música y movimiento. Al incluir el elemento musical en las clases de danza aeróbica, se expone a las personas que practican esta modal...

  14. AER Working Group D on VVER safety analysis minutes of the meeting in Rez, Czech Republic 18-20 May 1998

    International Nuclear Information System (INIS)

    AER Working Group D on VVER reactor safety analysis held its seventh meeting in Hotel Vltava in Rez near Prague during the period 18-20 May 1998. There were altogether 11 participants from 8 member organisations. The coordinator for the working group, Mr. P. Siltanen (IVO) served as chairman. In addition to the general information exchange on recent activities, the topics of the meeting included: First review of solutions to the 3-dimensional AER Dynamic Benchmark Problem No. 5 on a steam line break accident. This benchmark involves a break of the main steam header. Safety analysis of reactivity events. Recent code development work and fuel behaviour. Coolant mixing calculations and experiments related to diluted slugs. A list of participants and a list of handouts distributed at the meeting are attached to the minutes. (author)

  15. Etileno e peróxido de hidrogênio na formação de aerênquima em milho tolerante a alagamento intermitente

    Directory of Open Access Journals (Sweden)

    Marinês Ferreira Pires

    2015-09-01

    Full Text Available Resumo:O objetivo deste trabalho foi avaliar o papel do etileno e do peróxido de hidrogênio (H2O2 na formação do aerênquima em ciclos de seleção genética da cultivar de milho BRS 4154, sob alagamento. Plantas dos ciclos C1 e C18 foram submetidas a alagamento por 7 dias, com coleta das raízes aos 0 (controle, sem alagamento, 1 e 7 dias. Foram analisados: a expressão gênica das enzimas ACC sintase (ACS, ACC oxidase (ACO, dismutase do superóxido (SOD e peroxidase do ascorbato (APX; a produção de etileno e o conteúdo de H2O2; a atividade da enzima ACO; e a proporção de aerênquima no córtex. Não houve expressão de ACS e ACO. Houve variação na atividade de ACO e na produção de etileno. A expressão da SOD foi maior em plantas C1 e a da APX, em C18, com redução aos 7 dias. O conteúdo de H2O2 não diferiu entre os tratamentos. A proporção de aerênquima aumentou com o tempo, tendo sido maior em plantas C18 e relacionada à taxa de formação do aerênquima. O tempo de alagamento e o nível de tolerância do ciclo de seleção influenciam a produção do etileno. A expressão da APX indica maior produção de H2O2 no início do alagamento.

  16. Microstructure and Mechanical Properties of AerMet 100 Ultra-high Strength Steel Joints by Laser Welding

    Institute of Scientific and Technical Information of China (English)

    LIU Fencheng; YU Xiaobin; HUANG Chunping; HE Lihua; CHEN Yuhua; BU Wende

    2015-01-01

    AerMet100 ultra-high strength steel plates with a thickness of 2 mm were welded using a CO2 laser welding system. The inlfuences of the welding process parameters on the morphology and microstructure of the welding joints were investigated, and the mechanical property of the welding joints was analyzed. The experimental results showed that the fusion zone of welding joint mainly consisted of columnar grains and a ifne dendrite substructure grew epitaxially from the matrix. With the other conditions remaining unchanged, a finer weld microstructure was along with the scanning speed increase. The solidification microstructure gradually transformed from cellular crystal into dendrite crystal and the spaces of dendrite secondary arms rose from the fusion line to the center of the fusion zone. In the fusion zone of the weld, the rapid cooling caused the formation of martensite, which led the microhardness of the fusion zone higher than that of the matrix and the heat affected zone. The tensile strength of the welding joints was tested as 1 700 MPa, which was about 87% of the matrix. However, the tensile strength of the welding joints without defects existed was tested as 1832 MPa, which was about 94% of the matrix.

  17. VLSI implementation of a 2.8 Gevent/s packet based AER interface with routing and event sorting functionality

    Directory of Open Access Journals (Sweden)

    Stefan eScholze

    2011-10-01

    Full Text Available State-of-the-art large scale neuromorphic systems require sophisticated spike event communication between units of the neural network. We present a high-speed communication infrastructure for a waferscale neuromorphic system, based on application-specific neuromorphic communication ICs in an FPGA-maintained environment. The ICs implement configurable axonal delays, as required for certain types of dynamic processing or for emulating spike based learning among distant cortical areas. Measurements are presented which show the efficacy of these delays in influencing behaviour of neuromorphic benchmarks. The specialized, dedicated AER communication in most current systems requires separate, low-bandwidth configuration channels. In contrast, the configuration of the waferscale neuromorphic system is also handled by the digital packet-based pulse channel, which transmits configuration data at the full bandwidth otherwise used for pulse transmission. The overall so-called pulse communication subgroup (ICs and FPGA delivers a factor 25-50 more event transmission rate than other current neuromorphic communication infrastructures.

  18. Mejora de defensas antioxidantes mediante ejercicio aeróbico en mujeres con síndrome metabólico

    Directory of Open Access Journals (Sweden)

    Manuel Rosety-Rodríguez

    2012-02-01

    Full Text Available En la actualidad se acepta que el daño oxidativo juega un papel esencial en la patogénesis del síndrome metabólico. Estudios recientes proponen al daño oxidativo como diana terapéutica frente al síndrome metabólico. Precisamente nuestro objetivo fue mejorar el estatus total antioxidante (TAS de mujeres con síndrome metabólico mediante ejercicio aeróbico. Participaron voluntariamente 100 mujeres con síndrome metabólico de acuerdo con los criterios del National Cholesterol Educational Program (Adult-Treatment-Panel-III distribuidas aleatoriamente en grupo experimental (n = 60 y control (n = 40. El grupo experimental desarrolló un programa de entrenamiento aeróbico sobre tapiz rodante de intensidad ligera/moderada de 12 semanas (5 sesiones/semana. La determinación del TAS plasmático se realizó mediante espectrofotometría utilizando kits comercializados por Randox Lab. Este protocolo fue aprobado por un Comité de Etica Institucional. Tras completar el programa de entrenamiento se incrementó significativamente el TAS (0.79 ± 0.05 vs.1.01 ± 0.03 mmol/l; p = 0.027. No hubo cambios en grupo control. El ejercicio aeróbico de intensidad ligera/moderada aumenta las defensas antioxidantes en mujeres con síndrome metabólico. Son necesarios futuros estudios longitudinales para conocer su impacto en la evolución clínica.

  19. Influencia del ritmo circadiano sobre el rendimiento físico en ejercicios aeróbicos y anaeróbicos. Una revisión

    OpenAIRE

    Bueno Pérez, Ángel Javier

    2015-01-01

    La cronobiología es la ciencia que se encarga del estudio de los cambios fisiológicos dependientes de los ritmos circadianos, estos se refieren a las variaciones internas que se repetirán cada 24 horas. El objetivo del presente estudio fue realizar una revisión sistemática sobre la influencia provocada por la variabilidad circadiana en el rendimiento cardiorrespiratorio y motor tanto aeróbico como anaeróbico. Los resultados de esta revisión indican que el rendimiento deportivo se ve afectado ...

  20. Efecto del ejercicio físico aeróbico sobre los niveles séricos de adiponectina y leptina en mujeres posmenopáusicas

    OpenAIRE

    Aranzález, Luz Helena; Mockus Sivickas, Ismena; Ramírez, Doris; Mancera, Erica; García, Óscar

    2011-01-01

    Antecedentes. Las variaciones de peso corporal se acompañan de modificaciones en los niveles circulantes de adipocinas como la adiponectina y la leptina.  Durante la posmenopausia se presenta una tendencia al incremento de peso. Se recomienda ejercicio físico, que tiene efectos sobre tejido adiposo y los factores de riesgo cardiovascular, como parte del tratamiento del sobrepeso y obesidad. Objetivo. Determinar los efectos del ejercicio físico aeróbico controlado sobre los niveles séricos de ...

  1. Mejora de defensas antioxidantes mediante ejercicio aeróbico en mujeres con síndrome metabólico

    OpenAIRE

    Manuel Rosety-Rodríguez; Antonio Díaz-Ordoñez; Ignacio Rosety; Gabriel Fornieles; Alejandra Camacho-Molina; Natalia García; Miguel Angel Rosety; Francisco J. Ordoñez

    2012-01-01

    En la actualidad se acepta que el daño oxidativo juega un papel esencial en la patogénesis del síndrome metabólico. Estudios recientes proponen al daño oxidativo como diana terapéutica frente al síndrome metabólico. Precisamente nuestro objetivo fue mejorar el estatus total antioxidante (TAS) de mujeres con síndrome metabólico mediante ejercicio aeróbico. Participaron voluntariamente 100 mujeres con síndrome metabólico de acuerdo con los criterios del National Cholesterol Educational Program ...

  2. Increased Uptake of HCV Testing through a Community-Based Educational Intervention in Difficult-to-Reach People Who Inject Drugs: Results from the ANRS-AERLI Study

    Science.gov (United States)

    Roux, Perrine; Rojas Castro, Daniela; Ndiaye, Khadim; Debrus, Marie; Protopopescu, Camélia; Le Gall, Jean-Marie; Haas, Aurélie; Mora, Marion; Spire, Bruno; Suzan-Monti, Marie; Carrieri, Patrizia

    2016-01-01

    Aims The community-based AERLI intervention provided training and education to people who inject drugs (PWID) about HIV and HCV transmission risk reduction, with a focus on drug injecting practices, other injection-related complications, and access to HIV and HCV testing and care. We hypothesized that in such a population where HCV prevalence is very high and where few know their HCV serostatus, AERLI would lead to increased HCV testing. Methods The national multisite intervention study ANRS-AERLI consisted in assessing the impact of an injection-centered face-to-face educational session offered in volunteer harm reduction (HR) centers (“with intervention”) compared with standard HR centers (“without intervention”). The study included 271 PWID interviewed on three occasions: enrolment, 6 and 12 months. Participants in the intervention group received at least one face-to-face educational session during the first 6 months. Measurements The primary outcome of this analysis was reporting to have been tested for HCV during the previous 6 months. Statistical analyses used a two-step Heckman approach to account for bias arising from the non-randomized clustering design. This approach identified factors associated with HCV testing during the previous 6 months. Findings Of the 271 participants, 127 and 144 were enrolled in the control and intervention groups, respectively. Of the latter, 113 received at least one educational session. For the present analysis, we selected 114 and 88 participants eligible for HCV testing in the control and intervention groups, respectively. In the intervention group, 44% of participants reported having being tested for HCV during the previous 6 months at enrolment and 85% at 6 months or 12 months. In the control group, these percentages were 51% at enrolment and 78% at 12 months. Multivariable analyses showed that participants who received at least one educational session during follow-up were more likely to report HCV testing

  3. Big Data in AER

    Science.gov (United States)

    Kregenow, Julia M.

    2016-01-01

    Penn State University teaches Introductory Astronomy to more undergraduates than any other institution in the U.S. Using a standardized assessment instrument, we have pre-/post- tested over 20,000 students in the last 8 years in both resident and online instruction. This gives us a rare opportunity to look for long term trends in the performance of our students during a period in which online instruction has burgeoned.

  4. Resistance and uptake of cadmium by yeast, Pichia hampshirensis 4Aer, isolated from industrial effluent and its potential use in decontamination of wastewater.

    Science.gov (United States)

    Khan, Zaman; Rehman, Abdul; Hussain, Syed Z

    2016-09-01

    Pichia hampshirensis 4Aer is first ever used yeast for the bioremediation of environmental cadmium (Cd(+2)) which could maximally remove 22 mM/g and 28 mM/g Cd(+2) from aqueous medium at lab and large scales, respectively. The biosorption was found to be the function of temperature, pH of solution, initial Cd(+2) concentration and biomass dosage. Competitive biosorption was investigated in binary and multi-metal system which indicated the decrease in Cd(+2) biosorption with increasing the competitive metal ions attributed to their higher electronegativity and larger radius. FTIR analysis revealed the active participation of amide and carbonyl moieties in Cd(+2) adsorption confirmed by EDX analysis. Electron micrographs summoned further surface adsorption and increased cell size due to intracellular Cd(+2) accumulation. Cd(+2) was the causative agent of some metal binding proteins as well as prodigious increase in glutathione and other non-protein thiols levels which is the crucial for the yeast to thrive oxidative stress generated by Cd(+2). Our experimental data were consistent with Langmuir as well as Freundlich isotherm models. The yeast obeyed pseudo second order kinetic model which makes it an effective biosorbent for Cd(+2). High bioremediation potential and spontaneity and feasibility of the process make P. hampshirensis 4Aer an impending foundation for green chemistry to exterminate environmental Cd(+2). PMID:27268792

  5. Resistance and uptake of cadmium by yeast, Pichia hampshirensis 4Aer, isolated from industrial effluent and its potential use in decontamination of wastewater.

    Science.gov (United States)

    Khan, Zaman; Rehman, Abdul; Hussain, Syed Z

    2016-09-01

    Pichia hampshirensis 4Aer is first ever used yeast for the bioremediation of environmental cadmium (Cd(+2)) which could maximally remove 22 mM/g and 28 mM/g Cd(+2) from aqueous medium at lab and large scales, respectively. The biosorption was found to be the function of temperature, pH of solution, initial Cd(+2) concentration and biomass dosage. Competitive biosorption was investigated in binary and multi-metal system which indicated the decrease in Cd(+2) biosorption with increasing the competitive metal ions attributed to their higher electronegativity and larger radius. FTIR analysis revealed the active participation of amide and carbonyl moieties in Cd(+2) adsorption confirmed by EDX analysis. Electron micrographs summoned further surface adsorption and increased cell size due to intracellular Cd(+2) accumulation. Cd(+2) was the causative agent of some metal binding proteins as well as prodigious increase in glutathione and other non-protein thiols levels which is the crucial for the yeast to thrive oxidative stress generated by Cd(+2). Our experimental data were consistent with Langmuir as well as Freundlich isotherm models. The yeast obeyed pseudo second order kinetic model which makes it an effective biosorbent for Cd(+2). High bioremediation potential and spontaneity and feasibility of the process make P. hampshirensis 4Aer an impending foundation for green chemistry to exterminate environmental Cd(+2).

  6. Information about AER WG A on improvement, extension and validation of parametrized few-group libraries for VVER 440 and VVER 1000

    International Nuclear Information System (INIS)

    Joint AER Working Group A on 'Improvement, extension and validation of parameterized few-group libraries for WWER-440 and WWER-1000' and AER Working Group B on 'Core design' nineteenth meeting was hosted by VUJE a. s. in Modra - Harmonia (Slovakia) during the period of 20. to 22. April 2010. There were present altogether 12 participants from 8 member organizations and 9 papers were presented (8 of them in written form). Objectives of the meeting of WG A are: Issues connected with spectral calculations and few-groups libraries preparation, their accuracy and validation. Presentations were devoted to some aspects of transport and diffusion calculations and to the benchmark dealing with WWER-1000 core periphery power tilt. Tamas Parko (co-authors Istvan Pos and Sandor Patai Szabo) described in his presentation 'Application of Discontinuity factors in C-PORCA 7 code', Radoslav Zajac (co-authors Petr Darilek and Vladimir Necas) spoke about 'Fast Reactor Nodalisation in HELIOS Code', Gabriel Farkas presented 'Calculation of Spatial Weighting Functions of Ex-Core Neutron Detectors for WWER-440 Using Monte Carlo Approach' and Daniel Sprinzl (co-authors Vaclav Krysl, Pavel Mikolas and Jiri Svarny) provided a definition of a benchmark in ' 'MIDICORE' WWER-1000 core periphery power tilt benchmark proposal'. (Author)

  7. Avaliação da biotratabilidade do efluentede branqueamento de polpa celulósicapor processos aeróbios e anaeróbios

    Directory of Open Access Journals (Sweden)

    Míriam Cristina Santos Amaral

    2013-09-01

    Full Text Available Os efluentes da planta de branqueamento da produção de pasta celulósica apresentam, além de elevadas concentrações de matéria orgânica em termos de Demanda Química de Oxigênio (DQO e Demanda Bioquímica de Oxigênio (DBO e cor, compostos com elevada toxicidade, o que torna o tratamento destes efluentes problemático. O objetivo do presente artigo é avaliar a biotratabilidade dos efluentes de branqueamento ácido e alcalino de polpa celulósica kraft por processos aeróbios e anaeróbios por meio da caracterização, utilizando parâmetros convencionais e coletivos. Os resultados de DQO inerte, biodegradabilidade aeróbia e anaeróbia, distribuição de massas molares, produtos microbianos solúveis e substâncias poliméricas extracelulares indicaram a baixa biotratabilidade dos efluentes

  8. Entrenamiento de la capacidad aeróbica por medio de la terapia acuática en niños con parálisis cerebral tipo diplejía espástica

    OpenAIRE

    Nandy Fajardo-López; Fabiola Moscoso-Alvarado

    2013-01-01

    Antecedentes. La parálisis cerebral tipo diplejía espática genera cambios en el sistema cardiovascular que afectan la capacidad aeróbica. La terapia acuática es una estrategia terapéutica óptima tanto para el manejo de la población como para el entrenamiento de la capacidad aeróbica, por las respuestas fisiológicas que genera y porque brinda la facilidad de generar mayores cargas al sistema cardiovascular con menores riesgos que en tierra. Objetivo. Identificar las características que debe te...

  9. Efectos de la distribución y secuencia en la organización de distintas tareas de entrenamiento para la mejora de la resistencia aeróbica

    OpenAIRE

    Clemente Suárez, Vicente Javier

    2010-01-01

    Numerosos autores han investigado el efecto de diferentes entrenamientos en el rendimiento de deportistas de resistencia, pero poco se ha estudiado sobre el efecto de la distribución y la secuenciación de las tareas de entrenamiento en la mejora de la resistencia aeróbica tanto en el rendimiento aeróbico, como en variables espirométricas, parámetros de fuerza explosiva e isocinética de piernas, recuperación y fatiga del sistema nervioso central. Por ello, esta tesis doctoral pretende analizar...

  10. Potência atada na máxima fase estável de lactato e índices do desempenho aeróbio de nado

    Directory of Open Access Journals (Sweden)

    Dalton Müller Pessôa Filho

    2014-10-01

    Full Text Available INTRODUÇÃO: A perspectiva do nado atado constituir um contexto válido para a avaliação aeróbia de nadadores foi investigada no presente estudo. OBJETIVO: Analisar a relação entre a potência em máxima fase estável de lactato no nado atado (PAtadaMFEL com seu respectivo índice em nado desimpedido (velocidade em MFEL, vMFEL e com outros índices da aptidão aeróbia e desempenho de nado crawl. MÉTODOS: Dez nadadores (16,6 ± 1,4 anos foram submetidos às estimativas de: (a PAtadoCrítica (transformação da assíntota do modelo carga-tempo limite hiperbólico, CargaCríticaAtada, (b PAtadaMFEL e vMFEL (3 ou 4 esforços de 30 minutos entre 95 a 105% da Carga CríticaAtada e entre 85 a 95% da velocidade máxima nos 400 m, respectivamente, (c teste progressivo (79-100% da v400m, com incrementos de 3% para a determinação da velocidade no ponto de inflexão (vPI, e (d testes de desempenho nas distâncias de 400 (v400m, 800 (v800m e 1500 (v1500m metros. Os coeficientes de Pearson e de variância analisaram as correlações entre os parâmetros aeróbios e destes com o desempenho. O teste de Bland-Altman foi utilizado para analisar a concordância entre as concentrações de lactato nas avaliações aeróbias. RESULTADOS: O valor de PAtadaMFEL (89,2 ± 15,1 W apresentou potencial similar de explicação da variância nos desempenhos em v400m (1,29 ± 0,11 m.s-1, R2 = 0,700, v800m (1,23 ± 0,12 m.s-1, R2 = 0,770 e v1500m (1,21 ± 0,12 m.s-1, R2 = 0,698 tal como vMFEL (1,17 ± 0,11 m.s-1 e vPI (1,19 ± 0,11 m.s-1. As concentrações de lactato sanguíneo em PAtadaMFEL, vMFEL e vPI não diferem entre si e distribuíram-se dentro dos limites de concordância. CONCLUSÃO: Pode-se concluir que a aplicação de MFEL em nado atado mostrou-se válida e promissora para a avaliação aeróbia de nadadores.

  11. Atividade do sistema antioxidante e desenvolvimento de aerênquima em raízes de milho 'Saracura' Antioxidant system activity and aerenchyma formation in 'Saracura' maize roots

    Directory of Open Access Journals (Sweden)

    Fabricio José Pereira

    2010-05-01

    Full Text Available Este trabalho teve como objetivo avaliar a influência de sucessivos ciclos de seleção do milho 'Saracura' na atividade das enzimas do sistema antioxidante, e a relação dessas enzimas com a capacidade dessa variedade em desenvolver aerênquima. Sementes de 18 ciclos de seleção intercalados do milho 'Saracura' e da cultivar BR 107, sensível à hipoxia, foram semeadas em vasos e em casa de vegetação. As plantas foram submetidas ao alagamento intermitente de dois em dois dias. As amostras de raízes foram coletadas após 60 dias e analisaram-se as atividades das enzimas peroxidase do guaiacol, peroxidase do ascorbato e catalase, além da capacidade das plantas de cada ciclo desenvolverem aerênquima. Ao longo dos ciclos, as plantas apresentaram modificações na atividade das enzimas, com aumento na de peroxidase do ascorbato e diminuição na de catalase e de peroxidase do guaiacol. Observou-se, ainda, maior capacidade de desenvolver aerênquima nos últimos ciclos de seleção. A redução na atividade das enzimas do sistema antioxidante parece estar relacionada a um desbalanço na decomposição de H2O2.This work aimed to assess the influence of successive selection cycles in 'Saracura' maize on the enzyme activity of the antioxidant system and the relationship of these enzymes with the aerenchyma development capacity of this variety. Seeds of 18 intercalated selection cycles of the 'Saracura' maize and of the cultivar BR 107, sensitive to hipoxia, were sown in pots in the greenhouse. Plants were submitted to intermittent soil flooding each two days. After 60 days, the roots were sampled and analysis were done for the guaiacol peroxidase, ascorbate peroxidase, and catalase activities and for the capacity of the plants of each cycle to develop aerenchyma. The plants showed modifications in enzyme activity along the cycles, increasing the ascorbate peroxidase activity and decreasing the catalase and guaiacol peroxidase ones. A greater

  12. Aptidão aeróbia e amplitude dos domínios de intensidade de exercício no ciclismo

    Directory of Open Access Journals (Sweden)

    Renato Aparecido Corrêa Caritá

    2013-08-01

    Full Text Available INTRODUÇÃO: A determinação dos domínios de intensidade de exercício tem importantes implicações na prescrição do treino aeróbio e na elaboração de delineamentos experimentais. OBJETIVO: Analisar os efeitos do nível de aptidão aeróbia sobre a amplitude dos domínios de intensidade de exercício durante o ciclismo. MÉTODOS: Doze ciclistas (CIC, 11 corredores (COR e oito indivíduos não treinados (NT foram submetidos aos seguintes protocolos em diferentes dias: 1 teste progressivo para determinação do limiar de lactato (LL, consumo máximo de oxigênio (VO2máx e sua respectiva intensidade (IVO2máx; 2 três testes de carga constante até a exaustão a 95, 100 e 110% IVO2máx para a determinação da potência crítica (PC; 3 testes até a exaustão para determinar a intensidade superior do domínio severo (Isup. As amplitudes dos domínios (moderado pesado severo < Isup foram expressas como percentual da Isup (VO2. RESULTADOS: A amplitude do domínio moderado foi similar entre CIC (52 ± 8% e COR (47 ± 4% e significantemente maior no CIC em relação ao NT (41 ± 7%. O domínio pesado foi significantemente menor no CIC (17 ± 6% em relação ao COR (27 ± 6% e NT (27 ± 9%. Em relação ao domínio severo não foram encontradas diferenças significantes entre os CIC (31 ± 7%, COR (26 ± 5% e NT (31 ± 7%. CONCLUSÃO: O domínio pesado de exercício é mais sensível a mudanças determinadas pelo nível de aptidão aeróbia, existindo a necessidade de que se atenda ao princípio da especificidade do movimento, quando se pretende obter um elevado grau de adaptação fisiológica.

  13. Treinamento aeróbico prévio à compressão nervosa: análise da morfometria muscular de ratos

    Directory of Open Access Journals (Sweden)

    Elisangela Lourdes Artifon

    2013-02-01

    Full Text Available INTRODUÇÃO: Ciatalgia origina-se da compressão do nervo isquiático e implica em dor, parestesia, diminuição da força muscular e hipotrofia. O exercício físico é reconhecido na prevenção e reabilitação de lesões, porém quando em sobrecargas pode aumentar o risco de lesões e consequente déficit funcional. OBJETIVO: Avaliar efeitos de treinamento aeróbico prévio a modelo experimental de ciatalgia em relação a parâmetros morfométricos dos músculos sóleos de ratos. MATERIAIS E MÉTODOS: 18 ratos divididos em três grupos: simulacro (mergulho, 30 segundos; exercício regular (natação, dez minutos diários; e treinamento aeróbico progressivo (natação em tempos progressivos de dez a 60 minutos diários. Ao final de seis semanas de exercício, os ratos foram submetidos ao modelo experimental da ciatalgia. No terceiro dia após a lesão, foram eutanasiados e tiveram seus músculos sóleos dissecados, pesados e preparados para análise histológica. Variáveis analisadas: peso muscular, área de secção transversa e diâmetro médio das fibras musculares. RESULTADOS: Observou-se diferença estatisticamente significativa para todos os grupos quando se comparou músculo controle e aquele submetido à lesão isquiática. A análise intergrupos não apresentou diferença estatisticamente significativa para nenhuma das variáveis analisadas. CONCLUSÃO: Tanto o exercício físico regular quanto o treinamento aeróbico não produziram efeitos preventivos ou agravantes às consequências musculares da inatividade funcional após ciatalgia.

  14. Efecto de una intervención ACT sobre la resistencia aeróbica y evitación experiencial en marchistas

    Directory of Open Access Journals (Sweden)

    María Clara Rodríguez Salazar

    2015-12-01

    Full Text Available El presente estudio tuvo como propósito identificar el efecto de la intervención en Terapia de Aceptación y Compromiso (ACT sobre la resistencia aeróbica y conducta de evitación experiencial en un grupo de marchistas de Bogotá. Se utilizó un diseño pretest-postest con grupo control. La muestra estuvo compuesta por diez marchistas de ambos sexos, con un promedio de edad de 16.70 y un rango entre los 15 y 20 años de edad, pertenecientes a la Liga de Atletismo de Bogotá. Se eligieron por conveniencia. Se emplearon como instrumentos de medición el test de los 3000 m y el Cuestionario de Aceptación Acción (AAQ. La intervención en ACT se realizó en cuatro sesiones en las que se desarrollaron los contenidos definidos por los autores de la intervención (Wilson y Luciano, 2002. Para el análisis de los datos, se empleó estadística no paramétrica a través de la prueba U de Mann-Whitney. Los resultados señalan una mayor resistencia aeróbica en la prueba de los 3000 m en el postest del grupo experimental con respecto al grupo control, así como una mayoraceptación de los eventos internos negativos.

  15. Influência do treinamento aeróbio nos mecanismos fisiopatológicos da hipertensão arterial sistêmica

    Directory of Open Access Journals (Sweden)

    Francisco Luciano Pontes Júnior

    2010-12-01

    Full Text Available O objetivo da presente revisão foi discutir as principais influências do exercício aeróbio nos mecanismos fisiopatológicos da hipertensão sistêmica. A hipotensão pós-exercício (HPE resulta de uma redução persistente na resistência vascular periférica (RVP, mediada pelo sistema nervoso autônomo e por substâncias vasodilatadoras. A diminuição da pressão arterial com o treinamento crônico ocorre pela diminuição da RVP e do débito cardíaco em repouso, por meio da redução da atividade neural simpática e do aumento da sensibilidade barorreflexa. Além disso, o exercício crônico pode promover redução da concentração de catecolaminas, melhora do perfil metabólico, afetar a atividade funcional do endotélio vascular e promover mudanças positivas na composição corporal. Desse modo, a inclusão do exercício físico aeróbio é fortemente recomendada como estratégia não farmacológica para o tratamento da hipertensão, não apenas pelo efeito benéfico na pressão arterial, bem como na redução de fatores de risco cardiovasculares.

  16. Efeitos do treinamento de corrida em diferentes intensidades sobre a capacidade aeróbia e produção de lactato pelo músculo de ratos Wistar Running training effects in different intensities on the aerobic capacity and lactate production by the muscle of Wistar rats

    OpenAIRE

    Michel Barbosa de Araújo; Fúlvia de Barros Manchado-Gobatto; Fabrício Azevedo Voltarelli; Carla Ribeiro; Clécia Soares de Alencar Mota; Claudio Alexandre Gobatto; Maria Alice Rostom de Mello

    2009-01-01

    São raros os estudos que associam indicadores de capacidade aeróbia e os substratos produzidos pelo metabolismo muscular em ratos. Dessa forma, o objetivo do presente estudo foi verificar o efeito do treinamento de corrida em duas diferentes intensidades sobre a capacidade aeróbia e a produção de lactato pelo músculo sóleo isolado de ratos. Ratos Wistar (90 dias) tiveram a transição metabólica aeróbio-anaeróbia determinada pelo teste de máxima fase estável de lactato (MFEL). Em seguida, os ra...

  17. Influência do treinamento aeróbio e anaeróbio na massa de gordura corporal de adolescentes obesos Influencia del entrenamiento aeróbico y anaeróbico en la masa grasa corporal de adolescentes obesos Influence of the aerobic and anaerobic training on the body fat mass in obese adolescents

    Directory of Open Access Journals (Sweden)

    Ana Cláudia Fernandez

    2004-06-01

    Full Text Available O objetivo deste estudo foi verificar as influências do exercício aeróbio e anaeróbio na composição corporal de adolescentes obesos do sexo masculino. A amostra foi constituída de 28 adolescentes com idades entre 15 e 19 anos, que apresentavam obesidade grave. Os voluntários foram distribuídos aleatoriamente em três grupos: grupo I: exercício anaeróbio; grupo II: exercício aeróbio; e grupo III: controle. O grupo I realizou treinamento intervalado em cicloergômetro que consistiu de 12 "tiros" de 30" com máxima força e velocidade, pedalando com carga alta (0,8% do massa corporal x 25 watts e recuperação ativa de 3'; o grupo II realizou treinamento aeróbio em cicloergômetro pedalando com carga relativa ao limiar ventilatório por 50 minutos. Já o terceiro grupo funcionou como controle, sem atividade física. Todos os grupos tiveram orientação nutricional e o período de intervenção foi de 12 semanas (três meses. Os voluntários realizaram densitometria óssea com análise da composição corporal (DEXA e avaliações médicas e de aptidão física. Quando comparados os períodos inicial e final de intervenção foram observadas reduções nas variáveis massa corporal, IMC, na massa de gordura corporal total e de membros inferiores e na percentagem de gordura corporal de tronco nos grupos de exercício. Diferenças foram observadas entre os grupos I e III para os deltas percentuais de massa de gordura corporal total e de membros inferiores e na percentagem de gordura de membros inferiores. Os dados sugerem que o exercício físico, tanto aeróbio como anaeróbio, aliado à orientação nutricional, promove maior redução ponderal, quando comparado com a orientação nutricional somente, e que, neste estudo, o exercício anaeróbio foi mais eficiente para promover a diminuição da gordura corporal e da percentagem de gordura e o exercício aeróbio foi mais eficaz no sentido de preservar e/ou aumentar a massa magra e a

  18. Método de Cuckow para la calibración de aerómetros : diseño y puesta a punto del equipo

    Directory of Open Access Journals (Sweden)

    Joselaine Cáceres

    2011-05-01

    Full Text Available El método utilizado en el Laboratorio Tecnológico del Uruguay (LATU para calibración de aerómetros es el “Método de Cuckow para calibración de aerómetros utilizando agua adicionada con un tensoactivo como fluido patrón”. En este método se usa un tensoactivo para bajar la tensión superficial del agua destilada utilizada como fluido patrón y se verifica que la variación en la densidad de la misma, producto del agregado del tensoactivo, contribuye en forma despreciable a la incertidumbre del método y puede ser contemplada dentro de la incertidumbre aceptada para la densidad del agua destilada. Se planificó una estrategia para bajar la incertidumbre de calibración del método; para ello se diseñó un recipiente con un sistema de termostatización con recirculación de agua por camisa, lo que aporta estabilidad térmica al sistema. Se utilizóagitación mecánica para favorecer la termostatización y evitar gradientes de densidad asociados a inhomogeneidad en la temperatura. También se realizaron mejoras en el sistema de ajuste de la lectura y formación del menisco. Luego de estas mejoras se validó nuevamente el método y se demostró que se alcanza la meta propuesta de disminuir las incertidumbres de calibración, estando en condiciones de aplicarlo a calibración de aerómetros de precisión. En el presente artículo se detallan las consideraciones realizadas en el diseño y puesta a punto del equipo mejorado, fundamentalmente el recipiente y el sistema de termostatización. Se plantea la construcción del recipiente a partir de tubos de vidriodisponibles en el mercado, bajando así sus costos.AbstracThe method used in Laboratorio Tecnológico del Uruguay (LATU for hydrometers calibration is the “Cuckow method for hydrometers calibration using water added with a surfactant as a standard”. A surfactant is used to decrease the surface tension of distilated water used as a standar and is verified that the density variation

  19. Aspectos relacionados com a otimização do treinamento aeróbio para o alto rendimento Related aspects of aerobic training optimization for high performance

    Directory of Open Access Journals (Sweden)

    Mariana Fernandes Mendes de Oliveira

    2010-02-01

    Full Text Available O objetivo deste trabalho foi apresentar recomendações visando à otimização do treinamento aeróbio, a partir do conhecimento dos índices de aptidão funcional e seus mecanismos fisiológicos. Em atletas altamente treinados, a precisão na elaboração do treinamento pode ser o meio mais seguro para a melhora do rendimento, pois nesses indivíduos é comum a carga de treinamento oscilar entre o estimulo insuficiente e o aparecimento do excesso de treinamento. Existe, portanto, uma variedade muito grande de fatores que devem ser considerados na elaboração de um programa de treinamento. O entendimento dos mecanismos de fadiga e das respostas fisiológicas associadas às diferentes durações e intensidades de exercício é essencial para uma correta elaboração das sessões de treinamento. Além disso, treinos intervalados de alta intensidade são imprescindíveis para melhora de rendimento em atletas altamente treinados, porém, é recomendado que ele seja realizado após um razoável período de recuperação das sessões de treino anteriores. Assim, o contato entre o atleta e o treinador é importante para um planejamento cuidadoso dos períodos de recuperação antes da ocorrência de fadiga excessiva. O treinador deveria arquivar um histórico das cargas de treino e recuperações, aprendendo com a própria experiência os tipos de cargas que podem ser toleradas individualmente. Entre os fatores que podem afetar o rendimento aeróbio, o planejamento de um aquecimento apropriado e as condições ambientais adversas são aspectos muito importantes. Após reunir todas essas informações, é possível elaborar as bases do treinamento (frequência, volume, intensidade e recuperação visando melhora contínua do rendimento aeróbio.The objective of this work was to present recommendations aiming the aerobic training optimization, from the knowledge of the indexes of functional fitness and their physiological mechanisms. Concerning highly

  20. Measurements and ALE3D Simulations for Violence in a Scaled Thermal Explosion Experiment with LX-10 and AerMet 100 Steel

    Energy Technology Data Exchange (ETDEWEB)

    McClelland, M A; Maienschein, J L; Yoh, J J; deHaven, M R; Strand, O T

    2005-06-03

    We completed a Scaled Thermal Explosion Experiment (STEX) and performed ALE3D simulations for the HMX-based explosive, LX-10, confined in an AerMet 100 (iron-cobalt-nickel alloy) vessel. The explosive was heated at 1 C/h until cookoff at 182 C using a controlled temperature profile. During the explosion, the expansion of the tube and fragment velocities were measured with strain gauges, Photonic-Doppler-Velocimeters (PDVs), and micropower radar units. These results were combined to produce a single curve describing 15 cm of tube wall motion. A majority of the metal fragments were captured and cataloged. A fragment size distribution was constructed, and a typical fragment had a length scale of 2 cm. Based on these results, the explosion was considered to be a violent deflagration. ALE3D models for chemical, thermal, and mechanical behavior were developed for the heating and explosive processes. A four-step chemical kinetics model is employed for the HMX while a one-step model is used for the Viton. A pressure-dependent deflagration model is employed during the expansion. The mechanical behavior of the solid constituents is represented by a Steinberg-Guinan model while polynomial and gamma-law expressions are used for the equation of state of the solid and gas species, respectively. A gamma-law model is employed for the air in gaps, and a mixed material model is used for the interface between air and explosive. A Johnson-Cook model with an empirical rule for failure strain is used to describe fracture behavior. Parameters for the kinetics model were specified using measurements of the One-Dimensional-Time-to-Explosion (ODTX), while measurements for burn rate were employed to determine parameters in the burn front model. The ALE3D models provide good predictions for the thermal behavior and time to explosion, but the predicted wall expansion curve is higher than the measured curve. Possible contributions to this discrepancy include inaccuracies in the chemical models

  1. Treinamento Físico Aeróbico como Tratamento não Farmacológico da Síncope Neurocardiogênica

    Directory of Open Access Journals (Sweden)

    Vanessa Cristina Miranda Takahagi

    2014-03-01

    Full Text Available Fundamento: Caracterizada por perda súbita e transitória da consciência e do tônus postural, com recuperação rápida e espontânea, a síncope é causada por uma redução aguda da pressão arterial sistêmica e, por conseguinte, do fluxo sanguíneo cerebral. Os resultados insatisfatórios com o uso de fármacos permitiu que o tratamento não farmacológico da síncope neurocardiogênica fosse contemplado como primeira opção terapêutica. Objetivos: Comparar, em pacientes com síncope neurocardiogênica, o impacto do Treinamento Físico Aeróbico (TFA de moderada intensidade e de uma intervenção controle, na positividade do Teste de Inclinação Passiva (TIP e no tempo de tolerância ortostática. Métodos: Foram estudados 21 pacientes com história de síncope neurocardiogênica recorrente e TIP positivo. Esses foram aleatorizados em: Grupo Treinado (GT, n = 11, e Grupo Controle (GC, n = 10. O GT foi submetido a 12 semanas de TFA supervisionado, em cicloergômetro, e o GC, a um procedimento controle que consistia na realização de 15 minutos de alongamentos e 15 minutos de caminhada leve. Resultados: O GT apresentou efeito positivo ao treinamento físico, com aumento significativo do consumo de oxigênio-pico. Já o GC não apresentou nenhuma mudança estatisticamente significante, antes e após a intervenção. Após o período de intervenção, 72,7% da amostra do GT apresentou resultado negativo ao TIP, não apresentando síncope na reavaliação. Conclusão: O programa de treinamento físico aeróbico supervisionado por 12 semanas foi capaz de reduzir o número de TIP positivos, assim como foi capaz de aumentar o tempo de tolerância na posição ortostática durante o teste após o período de intervenção.

  2. Seleção de substratos padrões para ensaios respirométricos aeróbios com biomassa de sistemas de lodo ativado

    Directory of Open Access Journals (Sweden)

    Heraldo Antunes Silva Filho

    2015-03-01

    Full Text Available Nesta pesquisa investigou-se a influência de diferentes substratos na determinação da taxa específica de consumo de oxigênio de biomassa com cultura mista heterotrófica e autotrófica nitrificante, visando à caracterização do substrato mais adequado no desenvolvimento de ensaios respirométricos aeróbios. Foram utilizadas diferentes biomassas derivadas de quatro variantes de sistemas de lodo ativado. Os grupos heterotróficos e autotróficos nitrificantes foram avaliados em relação à sua velocidade de consumo dos substratos testados, sendo utilizada a técnica da respirometria aeróbia aberta semi-contínua de distintos pulsos, descrita em Van Haandel e Catunda (1982. Um respirometro automático acoplado a um computador foi utilizado em todos os testes respirométricos. Para identificar a taxa de consumo dos organismos heterotróficos, os substratos de fonte de carbono selecionados foram acetato de sódio (C2H3NaO2, acetato de etila (C4H8O2, etanol (C2H6O, glicose (C6H12O6 e fenol (C6H6O. Para o grupo autotrófico nitrificante foram utilizados bicarbonato de amônio (NH4HCO3, cloreto de amônio (NH4Cl e nitrito de sódio (NaNO2. Os resultados referentes ao grupo heterotrófico indicaram significativa diferença da taxa metabólica desses organismos na utilização dos substratos avaliados, exercendo maiores taxas de consumo de oxigênio para o acetato de sódio, enquanto para o grupo nitrificante o bicarbonato de amônio mostrou-se mais adequado. Comparando todos os sistemas estudados, observa-se a mesma tendência de maior biodegradabilidade ou afinidade aos substratos acetato de sódio e bicarbonato de amônio.

  3. Efeitos de uma única sessão de atividade motora na atenção visual de pessoas idosas: comparação entre atividade aeróbica e neuromotora

    OpenAIRE

    Canelas, Dora Cristina Calção

    2014-01-01

    Efeitos de uma única sessão de exercício na atenção visual de pessoas idosas: comparação entre exercício aeróbico e neuromotora Resumo Objetivo: O principal objetivo deste estudo foi avaliar os efeitos agudos de uma única sessão de exercício aeróbico e uma única sessão de exercício neuromotor sobre a atenção visual de pessoas idosas. Métodos: Participaram 87 indivíduos de ambos os sexos, com idades acima dos 55 anos (65,65 ± 6,64 anos), residentes no distrito de Évora, in...

  4. Fuel characteristics pertinent to the design of aircraft fuel systems, Supplement I : additional information on MIL-F-7914(AER) grade JP-5 fuel and several fuel oils

    Science.gov (United States)

    Barnett, Henry C; Hibbard, Robert R

    1953-01-01

    Since the release of the first NACA publication on fuel characteristics pertinent to the design of aircraft fuel systems (NACA-RM-E53A21), additional information has become available on MIL-F7914(AER) grade JP-5 fuel and several of the current grades of fuel oils. In order to make this information available to fuel-system designers as quickly as possible, the present report has been prepared as a supplement to NACA-RM-E53A21. Although JP-5 fuel is of greater interest in current fuel-system problems than the fuel oils, the available data are not as extensive. It is believed, however, that the limited data on JP-5 are sufficient to indicate the variations in stocks that the designer must consider under a given fuel specification. The methods used in the preparation and extrapolation of data presented in the tables and figures of this supplement are the same as those used in NACA-RM-E53A21.

  5. Desempenho de reator anaeróbio-aeróbio de leito fixo no tratamento de esgoto sanitário Performance of anaerobic-aerobic packed-bed reactor in the treatment of domestic sewage

    Directory of Open Access Journals (Sweden)

    Sérgio Brasil Abreu

    2008-06-01

    Full Text Available Este artigo relata a avaliação do desempenho de um reator anaeróbio-aeróbio, preenchido com espuma de poliuretano, para tratamento de esgoto sanitário. Inicialmente, foram testados diferentes tempos de detenção hidráulica (TDH no reator que operou apenas em condições anaeróbias. Em seguida, foi operado o reator combinado anaeróbio-aeróbio. O melhor resultado para o reator em operação exclusivamente anaeróbia foi para o TDH de 10 horas, no qual se conseguiu reduzir a DQO de 389 ± 70 mg/L para 137 ± 16 mg/L. Para o reator anaeróbio-aeróbio, a DQO foi reduzida de 259 ± 69 mg/L para 93 ± 31 mg/L para TDH de 12 h (6 h no estágio anaeróbio e 6 h no aeróbio. A comparação de todos os resultados obtidos evidenciou a importância do pós-tratamento aeróbio na remoção de parcela de matéria orgânica não removida em tratamento unicamente anaeróbio.This paper reports on the performance evaluation of an upflow anaerobic-aerobic reactor, filled with polyurethane matrices, for domestic sewage treatment. Initially, different hydraulic retention times were assayed with the reactor operating exclusively in anaerobic condition. Afterwards, anaerobic-aerobic combined reactor was operated. The anaerobic operation with HRT of 10 h provided the best organic matter removal with COD reduction from 389 ± 70 mg/L to 137 ± 16 mg/L. Under anaerobic-aerobic condition, the COD dropped from 259 ± 69 mg/L to 93 ± 31 mg/L with HRT of 12 h (6 h in anaerobic and 6 h in aerobic stages. Finally, comparing all the obtained results, it was possible to verify the importance of the aerobic post treatment in the removal of part of the organic matter not removed in an exclusively anaerobic treatment.

  6. Elaboración de cartas aeronáuticas OACI: planos de obstáculos de aeródromo, a partir de imágenes aéreas digitales de pequeño formato

    Directory of Open Access Journals (Sweden)

    Jorge Prado Molina

    2012-01-01

    Full Text Available Las cartas aeronáuticas y los planos de obstáculos de aeródromo proporcionan información sobre las obstrucciones alrededor del aeropuerto, para que el controlador aéreo y los pilotos cumplan con los procedimientos y limitaciones de su utilización. La seguridad en aviación exige la producción de cartas aeronáuticas actualizadas y precisas, adoptando los estándares de la Organización de Aviación Civil Internacional (OACI. En este artículo se describe la metodología utilizada para generar los planos de obstáculos de cinco aeródromos en México, a partir de imágenes aéreas digitales, obtenidas con cámaras de formato pequeño. A través de dos levantamientos aéreos en cada aeropuerto, a 10 000 y 5 000 pies de altura sobre el nivel del terreno, se generaron dos ortomosaicos cubriendo la zona de influencia de la terminal aérea, el aeródromo y las superficies de aproximación, de ascenso en el despegue, de transición, horizontal interna y cónica. A través de la fotointerpretación de estéreopares se identificó la mayoría de los obstáculos, y con los ortomosaicos se generaron los planos de aeródromo y de obstáculos de aeródromo tipos A, B y C. Mediante receptores satelitales geodésicos se obtuvieron 18 puntos en cada pista, para obtener sus dimensiones y establecer puntos de control terrestre para la formación de los ortomosaicos. A través de detallado trabajo de campo se comprobó la localización y altura de los obstáculos y, finalmente, después de varios procedimientos de revisión por las autoridades aeronáuticas, se concluyó la generación de las cartas OACI al integrar todos los mapas de los aeropuertos, en un sistema de información geográfica (SIG.

  7. Cálcio e o desenvolvimento de aerênquimas e atividade de celulase em plântulas de milho submetidas a hipoxia Calcium and the development of aerenchyma and celulase activity in corn seedlings subjected to hypoxia

    Directory of Open Access Journals (Sweden)

    Bárbara França Dantas

    2001-06-01

    Full Text Available A formação de aerênquimas é conhecida como uma das mais importantes adaptações anatômicas pelas quais as plantas passam quando são submetidas à deficiência de oxigênio. Esse tecido se desenvolve pela ação de enzimas de degradação ou afrouxamento da parede celular. Este trabalho foi conduzido com o objetivo de verificar o desenvolvimento de aerênquima em plântulas de milho cv. Saracura- BRS 4154, submetidas à hipoxia. Associou-se, ao desenvolvimento dessa estrutura, a atividade da celulase. Para tanto, plântulas com 4 dias de idade foram submetidas aos tratamentos de hipoxia, pela imersão em tampão de alagamento, na ausência e presença de cálcio. Após 0, 1, 2, 3 e 4 dias da aplicação dos tratamentos, foram feitos cortes anatômicos na região apical dos coleóptiles e na região intermediária da raiz para a avaliação da formação de aerênquimas, e coletado o material para os ensaios enzimáticos de celulase. A atividade celulase foi medida através de método viscosimétrico. Nas raízes, a formação de aerênquima aumentou logo após a hipoxia e atingiu 50% do total do córtex ao quarto dia de hipoxia. Este órgão apresentou uma área cortical com aerênquima em média sete vezes maior que nos coleóptiles, onde a área de espaços intercelulares atingiu 15% do córtex. A atividade da celulase em coleóptiles e raízes sofreu, inicialmente, um decréscimo devido ao estresse, aumentando em seguida, acompanhando os resultados de aerênquima. Na presença de cálcio o desenvolvimento de aerênquima foi inibido; no entanto, a atividade enzimática foi induzida.Aerenchyma formation is known as one of the most important anatomical adaptations of plants submitted to oxygen shortage. This tissue develops by action of degrading enzymes and resulting in cell wall loosening. This work was conducted with the objective of verifying aerenchyma development in corn seedlings cv. Saracura - BRS 4154, submitted to hypoxia. The

  8. Efecto del ejercicio aeróbico y la estimulación ambiental sobre la reducción de los niveles de ansiedad en el envejecimiento

    Directory of Open Access Journals (Sweden)

    Patricia Sampedro Piquero

    2015-08-01

    Full Text Available El enriquecimiento ambiental (EAM y el ejercicio aeróbico (EJ son intervenciones capaces de reducir la ansiedad durante el envejecimiento, pero poco se sabe acerca de cómo modulan las proyecciones cerebrales hacia el eje hipotálamo-pituitario adrenal (HPA. Estudiamos el efecto de un programa de EAM y de EJ durante 2 meses en ratas Wistar macho de 18 meses de edad asignadas aleatoriamente a tres grupos: control (CO, n=6, EAM (n=8 y EJ (n=8. El programa de ejercicio fue llevado a cabo 15min/día y el grupo EAM fue estabulado en una jaula de grandes dimensiones con diferentes objetos renovados frecuentemente. Mediante la histoquímica de la citocromo c oxidasa (COx estudiamos la actividad metabólica de regiones cerebrales implicadas en la respuesta de ansiedad. El EAM redujo la actividad metabólica de regiones cerebrales implicadas en activar al eje HPA (corteza infralímbica, amígdala basolateral y núcleo paravetricular hipotalámico, (p<0.05. Por otro lado, el EJ aumentó la actividad de regiones implicadas en la inhibición (corteza cingulada, núcleo del lecho de la estría terminal e hipocampo dorsal, (p<0.05. En conclusión, parece que el EAM y el EJ modulan de forma diferente la actividad de regiones cerebrales que proyectan al eje HPA y podrían constituir intervenciones eficaces para reducir los niveles de ansiedad durante el envejecimiento.

  9. Análise da potência aeróbia de futebolistas por meio de teste de campo e teste laboratorial

    Directory of Open Access Journals (Sweden)

    Cristian Javier Ramirez Lizana

    2014-12-01

    Full Text Available Introdução: Há métodos diretos e indiretos que são utilizados pelos clubes de futebol para avaliar, acompanhar e determinar o VO2max dos jogadores, sendo este muito importante para o rendimento e a recuperação dos atletas durante uma partida. Objetivo: Avaliar o nível de correlação entre as medidas de VO2max por meio da análise direta de gases e do teste de campo Yo-Yo Intermitente Recovery Level 1 (Yo-YoIR1. Métodos: Participaram do estudo 24 jogadores de futebol da categoria SUB-20 de um clube do estado de São Paulo, Brasil, com estatura 1,72±0,08 m e massa corporal 61,17±9,18 kg, com no mínimo cinco anos de prática na modalidade. Os atletas realizaram o teste de análise direta dos gases em esteira ergométrica e após 48 horas foi realizado o Yo-Yo IR1. Resultados: Os resultados apontaram uma correlação significante entre os testes (r=0,524; p<0,01, porém o Yo-Yo IR1 subestimou as medidas de análise direta dos gases em laboratório (44,98ml/kg/min e 48,14ml/kg/min, respectivamente. Conclusão: Os resultados apontaram uma correlação moderada entre as medidas de VO2max, dessa forma pode-se utilizar ambos os testes para análise da potência aeróbia dos jogadores de futebol, desde que seja repetido o mesmo protocolo nas avaliações subsequentes.

  10. Entrenamiento de la capacidad aeróbica por medio de la terapia acuática en niños con parálisis cerebral tipo diplejía espástica

    Directory of Open Access Journals (Sweden)

    Nandy Fajardo-López

    2013-12-01

    Full Text Available Antecedentes. La parálisis cerebral tipo diplejía espática genera cambios en el sistema cardiovascular que afectan la capacidad aeróbica. La terapia acuática es una estrategia terapéutica óptima tanto para el manejo de la población como para el entrenamiento de la capacidad aeróbica, por las respuestas fisiológicas que genera y porque brinda la facilidad de generar mayores cargas al sistema cardiovascular con menores riesgos que en tierra. Objetivo. Identificar las características que debe tener una propuesta de intervención fisioterapéutica para el entrenamiento de la capacidad aérobica en niños y niñas entre los 8 y los 12 años, con parálisis cerebral tipo diplejía espástica, empleando la terapia acuática. Materiales y métodos. Se desarrolló un estudio de tipo descriptivo-propositivo, en el cual se formuló una propuesta de intervención basada en información recolectada a través de referencias bibliográficas. Resultados. Se presentan en forma de propuesta de intervención, describiendo en detalle las fases del entrenamiento de la capacidad aeróbica, mediante los principios del entrenamiento y la prescripción de ejercicio físico, teniendo en cuenta las respuestas fisiológicas ante la carga, así como las características propias de la población. Conclusión. La parálisis cerebral tipo diplejía espástica, genera cambios en la capacidad aeróbica; por esto, el fisioterapeuta debe incluirla en los procesos de rehabilitación como uno de sus objetivos. Para lograrlo, la terapia acuática es una modalidad de tratamiento óptima, puesto que genera mayor seguridad de movimiento y respuestas fisiológicas favorables en el sistema cardiovascular.

  11. Efeitos do treinamento aeróbio sobre o broncoespasmo induzido pelo execicio, parâmetros metabólicos e inflamatórios em adoslescentes com excesso de peso

    OpenAIRE

    Cieslak, Fabrício

    2013-01-01

    Resumo: Estudos têm avaliado a relação entre asma e obesidade em crianças e adolescentes, entretanto, investigações sobre os efeitos do exercício físico nos parâmetros inflamatórios e o impacto sobre o broncoespasmo induzido pelo exercício (BIE) são limitadas. O objetivo desse estudo foi avaliar os efeitos de 12 semanas de treinamento aeróbio sobre o BIE, parâmetros metabólicos e inflamatórios em adolescentes com excesso de peso. Estudo longitudinal, experimental, comparativo e correlacional ...

  12. Influência do exercício aeróbio na renina de portadores de hipertensão arterial com sobrepeso Influencia del ejercicio aeróbico en la renina de portadores de hipertensión arterial con sobrepeso Effect of aerobic exercise on plasma renin in overweight patients with hypertension

    Directory of Open Access Journals (Sweden)

    Bruno Martinelli

    2010-07-01

    Full Text Available FUNDAMENTO: A atividade do sistema renina-angiotensina-aldosterona tem relação direta com sobrepeso e sedentarismo, e essas variáveis se associam à hipertensão arterial (HA. O exercício aeróbio propicia melhor controle da pressão arterial (PA por agir nos mecanismos da regulação pressórica, dentre eles, a atividade de renina plasmática (ARP. OBJETIVO: Avaliar a influência do exercício aeróbio sobre ARP em portadores de HA com sobrepeso. MÉTODOS: Foram avaliados níveis pressóricos, bioquímicos e antropométricos pré e pós-treinamento de 16 semanas, três vezes por semana, a 60%-80% da frequência cardíaca máxima. Os dados foram expressos em média ± desvio padrão ou mediana e intervalo interquartílico, e analisados pelo teste "t", Mann-Withney e ANOVA (p FUNDAMENTO: La actividad del sistema renina-angiotensina-aldosterona tiene relación directa con sobrepeso y sedentarismo, y esas variables se asocian a la hipertensión arterial (HA. El ejercicio aeróbico propicia mejor control de la presión arterial (PA por actuar en los mecanismos de la regulación presórica, entre ellos, la actividad de renina plasmática (ARP. OBJETIVO: Evaluar la influencia del ejercicio aeróbico sobre ARP en portadores de HA con sobrepeso. MÉTODOS: Fueron evaluados niveles presóricos, bioquímicos y antropométricos pre y post-entrenamiento de 16 semanas, tres veces por semana, a 60%-80% da frecuencia cardíaca máxima. Los datos fueron expresados en media ± desvío estándar o media e intervalo intercuartílico, y analizados por el teste "t", Mann-Withney y ANOVA (p BACKGROUND: The activity of the renin-angiotensin-aldosterone system (RAAS is directly related to overweight and sedentary lifestyles, both of which are associated with hypertension. Aerobic exercise helps control blood pressure (BP by acting on mechanisms of blood pressure regulation, such as plasma renin activity (PRA. OBJECTIVE: To assess the effect of aerobic exercise on

  13. Capacidade aeróbia de ratos alimentados com dieta rica em frutose Aerobic capacity of rats fed with fructose rich diet

    Directory of Open Access Journals (Sweden)

    Rodrigo Ferreira de Moura

    2008-10-01

    Full Text Available INTRODUÇÃO: Evidências apontam que a ingestão exacerbada de frutose pode desencadear distúrbios característicos da síndrome metabólica. OBJETIVOS: Analisar os efeitos da ingestão de dieta rica em frutose sobre aspectos metabólicos de ratos da linhagem Wistar. Adicionalmente, verificar a capacidade aeróbia através da identificação da máxima fase estável de lactato (MFEL. MÉTODOS: Dezesseis ratos foram separados em dois grupos de oito animais: a controle, alimentados com dieta balanceada, e b frutose, alimentados com dieta rica em frutose. Foram analisadas a tolerância à glicose (área sob a curva de glicose durante teste de tolerância à glicose, sensibilidade à insulina (taxa de remoção da glicose sérica após sobrecarga exógena de insulina, perfil lipídico sérico e concentração de lactato sanguíneo [lac]s durante exercício na intensidade da MFEL. RESULTADOS: Teste t não pareado (p INTRODUCTION: Evidence points that exacerbated ingestion of fructose may trigger disturbs characteristic of the metabolic syndrome. OBJECTIVES: To analyze the effects of a fructose rich diet on metabolic aspects of Wistar lineage rats. Additionally, to verify the aerobic capacity, through the identification of the maximal lactate steady state (MSSL. PROCEDURES: Sixteen rats were separated in two groups of eight animals: a Control, fed a balanced diet, and b fructose, fed a fructose-rich diet. The glucose tolerance, (area under serum glucose during a glucose tolerance test, insulin sensibility (glucose disappearance rate after exogenous insulin administration, serum lipid profile and blood lactate concentration [lac]b during exercise at MSSL intensity, have been analyzed. RESULTS: Non-paired t test (p<0.05 revealed difference between groups in the area under the curve of glucose and serum triglycerides, no difference in insulin sensibility or in [lac]b was detected, though. One-way ANOVA with Newman Keuls post hoc revealed difference in

  14. Microbiota bacteriana aeróbia da conjuntiva de doadores de córnea Aerobic bacterial microbiota of the conjunctiva of cornea donors

    Directory of Open Access Journals (Sweden)

    Paula Fontana Lorenzini

    2007-03-01

    Full Text Available OBJETIVOS: Determinar a microbiota bacteriana aeróbia da conjuntiva de doadores de córnea e seu padrão de suscetibilidade a antibióticos; verificar o número de córneas utilizadas para transplante e a média de tempo de preservação em solução preservante com gentamicina e estreptomicina; traçar o perfil dos doadores e receptores de córnea. MÉTODOS: Espécimes clínicos foram colhidos de saco inferior da conjuntiva de ambos os olhos, de 40 doadores de córnea. As amostras foram inoculadas em ágar sangue azida, ágar chocolate e ágar MacConkey e o antibiograma foi realizado pelo método de Kirby-Bauer. RESULTADOS: A freqüência de cultura positiva da conjuntiva de doadores de córnea foi de 72,5%, sendo que Gram-positivos totalizaram 81,6% e apenas 18,4% das amostras foram identificadas como Gram-negativos. Vancomicina inibiu 100% dos Gram-positivos, ao passo que a sensibilidade dos Gram-negativos à gentamicina foi de 53,8% e à estreptomicina foi de 30%. O sexo masculino predominou entre os doadores e receptores, a média de tempo entre o óbito e a enucleação foi de 2h e a de preservação em solução preservante com gentamicina e estreptomicina foi de 7 dias. Neoplasia e mais de uma causa associada foram as causas de óbito mais freqüentes. O ceratocone foi a principal indicação para transplante (51,7%. CONCLUSÕES: Staphylococcus coagulase negativo foi o microrganismo com o maior número de isolamentos, apresentando sensibilidade variada aos antimicrobianos. A quantidade de córneas utilizadas para transplante foi bastante inferior em relação ao total de captações. O perfil dos doadores e receptores de córnea mostrou-se heterogêneo para grande parte das variáveis analisadas.PURPOSE: To determine aerobic bacterial microbiota of the conjunctiva of cornea donors and its patterns of susceptibility to antibiotics; verify the number of corneas used for transplant and the average time of preservation in solutions with

  15. Efectos del ejercicio aeróbico en los niveles de ansiedad y depresión en las personas seropositivas para la infección por el Virus de Inmunodeficiencia Humana (VIH

    Directory of Open Access Journals (Sweden)

    Adriana Carvajal Sancho

    2001-07-01

    Full Text Available Se ha sugerido que existe una relación entre el estrés psicológico, la progresión de la infección por el Virus de Inmunodeficiencia Humana (VIH y la calidad de vida de estas personas. Algunos de los factores psicosociales que podrían afectar la progresión de la infección son la presencia de depresión y niveles altos de ansiedad. Los factores psicosociales y de comportamiento son modificables, y aparentemente es posible mejorar la calidad de vida y prolongar la sobrevida de las personas seropositivas para el VIH o con Sida por medio de una intervención psicosocial. La progresión de la infección está acompañada con el aumento de los niveles de ansiedad y depresión en esta población. La depresión y ansiedad no solo son capaces de alterar factores psicosociales (ej. apatía, autoestima, deseos de suicidio, sino que podrían estar directamente relacionados con síntomas 'de la infección, la fatiga y discapacidades físicas. Una de las terapias sugeridas para disminuir la presencia de ansiedad y depresión en la población seropositiva al VIH ha sido el ejercicio aeróbico. En la población general, el ejercicio aeróbico de intensidad moderada tiene el potencial de aliviar la ansiedad, depresión, estado de ánimo y restaurar la función inmune. Los estudios en los que se ha investigado el efecto del ejercicio aeróbico en personas con el VIH en parámetros como la ansiedad y depresión aún no son consistentes. Sin embargo, existe suficiente información experimental que indica que el ejercicio podría ser un tratamiento alternativo para mejorar la calidad de vida de esta población.

  16. O grau de melhora na função das células progenitoras endoteliais derivadas da medula óssea é dependente do volume de treinamento físico aeróbio

    Directory of Open Access Journals (Sweden)

    Tiago Fernandes

    2013-08-01

    Full Text Available INTRODUÇÃO: A angiogênese muscular esquelética induzida pelo treinamento físico aeróbio (TF é determinante na melhora da capacidade aeróbia. Entre os fatores envolvidos, as células progenitoras endoteliais (CPE derivadas da medula óssea são descritas por promoverem o reparo vascular e a angiogênese. Embora o papel do TF sobre os parâmetros das CPE tenha sido investigado, pouco se conhece sobre os efeitos de diferentes volumes de TF sobre a função das CPE da medula óssea, alterações metabólicas e capilarização muscular. OBJETIVO: Testar a hipótese de que o TF melhore a função das CPE da medula óssea, acompanhada por maior capilarização e capacidade oxidativa muscular dependentes do aumento de volume de TF. MÉTODOS: Vinte e uma ratas Wistar foram divididas em três grupos: sedentário controle (SC, treinado protocolo 1 (P1, treinado protocolo 2 (P2. P1: o treinamento de natação consistiu de 60 min, 1x/dia, cinco dias/semana/10 semanas, com 5% de sobrecarga corporal. P2: o mesmo de P1 até a oitava semana, na nona semana os animais treinaram 2x/dia e na 10ª semana 3x/dia. RESULTADOS: O TF promoveu bradicardia de repouso, aumento da tolerância ao esforço, do consumo de oxigênio de pico e da atividade da enzima citrato sintase muscular no grupo P1, sendo estas adaptações mais exacerbadas no grupo P2, indicando que a condição aeróbia foi mais proeminente com este TF. O TF melhorou a função das CPE da medula óssea em P1, sendo ainda maior esta resposta no grupo P2. Em paralelo, observa-se também um aumento no número de capilares dependentes do volume de TF. CONCLUSÃO: Estes resultados sugerem que a medula óssea como o principal reservatório de CPE é influenciada por diferentes volumes de TF, sendo possivelmente responsável pelo maior rendimento físico observado mediante uma maior mobilização endógena de CPE, participantes ativas no processo de angiogênese muscular induzido pelo TF.

  17. Aerobic bacteria, Chlamydia trachomatis, Pneumocystis carinii and Cytomegalovirus as agents of severe peneumonia in small infants Bactérias aeróbias, Chlamydia trachomatis, Pneumocystis carinii e Cytomegalovirus: agentes causadores de pneumonia grave em pequenos lactentes

    Directory of Open Access Journals (Sweden)

    Bernardo Ejzenberg

    1996-02-01

    Full Text Available The authors studied 58 infants hospitalized for pneumonia in a semi-intensive care unit. Age ranged from 1 complete to 6 incomplete months. The infants were sent from another hospital in 20 cases and from home in a further 38. Pulmonary involvement, which was alveolar in 46 cases and interstitial in 12, was bilateral in 31 children. The investigation was carried out prospectively on the etiological agents associated with respiratory infection to look for evidence of aerobic bacteria (blood cultures, Chlamydia trachomatis and Cytomegalovirus (serology, and Pneumocystis carinii (direct microscopy of tracheal aspirated material. The following infectious agents were diagnosed in 21 children (36.2%: Aerobic bacteria (8, Chlamydia trachomatis (5, Pneumocystis carinii (3, Cytomegalovirus (3, Cytomegalovirus and Chlamydia trachomatis (1, Aerobic bacteria and Cytomegalovirus (1. Seven cases of infection by Chlamydia trachomatis and/or Cytomegalovirus were diagnosed out of the 12 cases with pulmonary interstitial involvement.Os autores estudaram prospectivamente 58 lactentes internados por pneumonia em unidade semi-intensiva. A idade foi limitada entre 1 mês completo e 6 meses incompletos. A procedência das crianças foi de outro hospital em 20 casos e domiciliar em 38. O acometimento pulmonar era alveolar em 46 casos, intersticial em 12 e bilateral em 31 crianças. Foram pesquisados agentes etiológicos associados à infecção respiratória dos lactentes jovens: Bactérias aeróbias (Hemoculturas, Chlamydia trachomatis e Cytomegalovirus (sorologia, e Pneumocystis carinii (microscopia direta do aspirado traqueal. Foram diagnosticadas infecções em 21 crianças (36,2%: Bactérias aeróbias (8, Chlamydia trachomatis (5, Cytomegalovirus (3, Pneumocystis carinii (3, Cytomegalovirus e Chlamydia trachomatis (1, Bactéria aeróbia e Cytomegalovirus (1. Foram diagnosticadas 7 infecções por Chlamydia trachomatis e/ou Cytomegalovirus entre as 12 crianças com

  18. Efeitos do exercício aeróbio durante a hemodiálise em pacientes com doença renal crônica: uma revisão da literatura

    Directory of Open Access Journals (Sweden)

    Joseane Böhm

    2012-06-01

    Full Text Available INTRODUÇÃO: Pacientes com doença renal crônica (DRC têm capacidade física e funcional reduzida quando comparados à população geral. O tratamento hemodialítico torna as atividades desses pacientes restritas, favorecendo o estilo de vida sedentário e a limitação funcional. Pacientes em hemodiálise (HD são menos ativos, apresentam baixa tolerância ao exercício e alto descondicionamento físico. Em virtude dessas alterações, têm sido propostos programas de exercício físico que visam não somente ao tratamento dos sinais clínicos da doença, mas de suas repercussões na função e na qualidade de vida. OBJETIVOS: Realizar uma revisão da literatura sobre os efeitos do exercício físico em pacientes portadores de DRC submetidos a programas de exercício aeróbio em cicloergômetro para membros inferiores durante a HD. MÉTODOS: Foram realizadas consultas às bases de dados Medline, PubMed, Scielo, Embase e ScienceDirect. RESULTADOS: Analisaram-se 14 estudos experimentais randomizados controlados, considerando o período de realização da intervenção na HD, a intensidade e a frequência do exercício, a duração da intervenção e os principais resultados. CONCLUSÃO: Os estudos demonstraram que exercícios aeróbios realizados durante a HD promovem a melhora da capacidade aeróbia e o condicionamento físico, além de redução da fadiga e ansiedade, melhora da capilarização muscular e pressão arterial de repouso, aumento no tempo de duração dos exercícios e melhora na depuração da ureia.

  19. Efeitos de 24 semanas de treinamento resistido sobre índices da aptidão aeróbia de mulheres idosas Effects of 24 weeks of resistance training on aerobic fitness indexes of older women

    Directory of Open Access Journals (Sweden)

    Marcelo Guido

    2010-08-01

    Full Text Available INTRODUÇÃO E OBJETIVO: O consumo de oxigênio pico (VO2pico e o limiar anaeróbio (LA são amplamente aceitos como importantes medidas da aptidão aeróbia. Tradicionalmente, o treinamento aeróbio é visto como o principal meio de se aumentar esses índices. Em contrapartida, o treinamento resistido (TR não é tipicamente prescrito para este fim. Em indivíduos idosos, tem sido sugerido que o TR é capaz de aprimorar a capacidade aeróbia; entretanto, a temática é controversa. O objetivo do presente estudo foi verificar os efeitos do treinamento resistido sobre índices da capacidade aeróbia de mulheres idosas. METODOLOGIA: Participaram voluntariamente 50 idosas, as quais foram distribuídas em dois possíveis grupos: grupo controle (GC - n = 25; idade média 68,00 ± 6,38 e grupo treinamento (GT - n = 25; idade média 68,04 ± 6,78 anos. Todas as participantes realizaram teste ergoespirométrico em esteira conduzido até a exaustão voluntária antes e após a intervenção. O GT foi submetido a um programa de TR para os principais grupos musculares três vezes por semana durante um período de 24 semanas. Ao GC foi solicitado que mantivessem suas rotinas habituais. Split plot Anova foi utilizada para verificar possíveis diferenças intra e intergrupos. RESULTADOS: Foi observado que o GT apresentou aumento significativo nas variáveis tempo de teste e VO2, tanto no momento do LA como no momento da exaustão. No GC nenhuma das variáveis dependentes sofreu alteração significativa. CONCLUSÃO: Conclui-se que 24 semanas de TR é capaz de promover melhora no desempenho durante teste de esforço cardiopulmonar em uma amostra de mulheres idosas. Futuros estudos serão importantes para elucidar os mecanismos responsáveis por tais adaptações.INTRODUCTION AND OBJECTIVES: Peak oxygen uptake (VO2 peak and anaerobic threshold (AT have been widely accepted as important predictors of aerobic fitness. Traditionally, aerobic training is viewed as

  20. Niveles de intensidad de la música durante un torneo de resistencia aeróbica en Costa Rica Music intensity levels during an aerobics endurance tournament in Costa Rica

    Directory of Open Access Journals (Sweden)

    Yamileth Chacón Araya

    2008-07-01

    Full Text Available El propósito del presente artículo es describir los niveles de ruido generados en una competencia de resistencia aeróbica y se analizan las posibles implicaciones para la salud de la contaminación por ruido. La danza aeróbica es un modo de ejercicio que se ha extendido por todo el mundo, con el fin de posibilitar la práctica de una actividad física que combina música y movimiento. Al incluir el elemento musical en las clases de danza aeróbica, se expone a las personas que practican esta modalidad, al ruido que provoca un alto volumen. Hay investigadores que se han dedicado a estudiar la incidencia del ruido, a indicar los rangos permitidos en lugares de entretenimiento y los gimnasios e informar sobre el peligro de perder momentánea o permanentemente el sentido auditivo al exponerse continuamente a ambientes ruidosos. La presente investigación se realizó en las instalaciones deportivas de la Universidad de Costa Rica, durante un torneo de resistencia aeróbica. Se utilizó un medidor del nivel de sonido marca RadioShack® (cat. N° 33-2055. Se encontró que los niveles de sonido utilizados para esta competencia excedieron los 90dB permitidos, ya que oscilaron entre 101 y 119 dB, durante los 120 minutos de duración de la actividad. Se requiere de mayor investigación en esta área en Costa Rica y ejercer un sistema de vigilancia para la contaminación sónica en los gimnasios.The purpose of the study was to describe noise levels during an aerobics tournament and the potential health implications of noise contamination. Aerobic dance is a worldwide known exercise mode that allows people to practice a physical activity that combines both, music and movement. When music is used in aerobic dance classes people are constantly exposed to the noise produced by high volume of the music. Researchers have studied the incidence of noise to indicate the range of noise permitted in entertainment facilities and fitness centers, and to inform to

  1. Avaliação dos níveis de atividade física e capacidade aeróbia estimada em estudantes universitários

    OpenAIRE

    Trzan, Abel Góes

    2013-01-01

    Mestrado em Fisioterapia O Ingresso na Universidade proporciona uma grande alteração nos hábitos de vida dos estudantes. Os estudantes de Medicina são duas vezes mais inativos tendo alto nível de estresse acadêmico. Este projeto visa avaliar o nível de atividade física e capacidade aeróbia de estudantes universitários. A população alvo foram estudantes do 1º e 5º ano do curso de medicina entre os 18 e 30 anos. Foi teita a amostragem aleatória e estratificada, com afetação proporcional (n=8...

  2. Efeito do treinamento aeróbio nos níveis de homocisteína em indivíduos diabéticos do tipo 2

    Directory of Open Access Journals (Sweden)

    Alexandre de Souza e Silva

    2015-08-01

    Full Text Available INTRODUÇÃO: Os programas de treinamento aeróbio têm demonstrado bons resultados no controle das variáveis de risco cardiovascular em indivíduos diabéticos; no entanto, os efeitos nos níveis de homocisteína não estão claros. Objetivo: Analisar os efeitos do treinamento aeróbio nos níveis plasmáticos de homocisteína e fatores de risco cardiovascular em indivíduos diabéticos do tipo 2.MÉTODOS: Participaram do estudo 15 mulheres com diabetes do tipo 2 e média de idade 68,86 ± 11,2 anos. Todos os indivíduos da amostra foram submetidos a um teste de avaliação do consumo máximo de oxigénio (VO2máx seguindo o protocolo de Bruce, avaliação da pressão arterial e avaliação antropométrica. Foi também efetuada uma coleta de 10 ml de sangue (veia antecubital em jejum de no mínimo 12 horas. O plasma foi separado e processado para posterior análise da concentração de homocisteína (mmol/l, colesterol total (mg/dl, lipoproteína de muito baixa densidade (VLDL (mg/dl, lipoproteína de baixa densidade (LDL (mg/dl, lipoproteína de alta densidade (HDL (mg/dl, triglicérides (mg/dl e glicemia (mg/dl. Os testes foram feitos antes e após 16 semanas de treinamento aeróbio. O programa foi realizado com 2 sessões de treinamento não consecutivas por semana, com intensidade compreendida entre 60% e 70% da frequência cardíaca máxima e duração de 75 minutos por sessão.RESULTADOS: Os resultados observados revelam que o programa de exercício físico induziu uma diminuição não significativa da concentração plasmática de homocisteína. Foram ainda identificadas melhorias do perfil lipídico e do Consumo Máximo de Oxigênio (VO2máx, diminuição da glicemia, da pressão arterial diastólica, do percentual de gordura e massa gorda.CONCLUSÃO: Conclui-se que o programa de treinamento aeróbio reduziu o risco cardiovascular em indivíduos diabéticos do tipo 2, embora a alteração da homocisteína não tenha sido significativa.

  3. Perfil lipídico e glicêmico de ratos treinados em exercício aeróbio ou anaeróbio e suplementados com maltodextrina Los lípidos y los niveles de glucosa de las ratas entrenadas en condiciones aeróbicas o anaeróbicas y se complementa con maltodextrina Lipids and glucose levels of trained rats in aerobic or anaerobic conditions and supplemented with maltodextrin

    Directory of Open Access Journals (Sweden)

    Cátia Fernandes Leite

    2013-03-01

    Full Text Available OBJETIVO: verificar as alterações no perfil lipídico e glicêmico de ratos treinados, suplementados com maltodextrina. MATERIAIS E MÉTODOS: o protocolo de treinamento consistiu de 8 semanas de natação em padrão contínuo (60min.dia-1 ou intermitente (2 períodos de 30min, com intervalo de 10min, com sobrecargas correspondentes a 5% e 10% do peso corporal, respectivamente. Durante 37 dias os animais foram suplementados com uma dose diária de 0,48g.kg-1 de maltodextrina dissolvida em água ou receberam água pura. RESULTADOS: o exercício aeróbio ocasionou aumento significativo no nível glicêmico. Os exercícios e a maltodextrina não causaram alterações no perfil lipídico. CONCLUSÃO: o exercício aeróbio proporcionou elevação no nível glicêmico, não causando hipoglicemia.El objetivo fue comprobar los cambios en los lípidos y los niveles de glucosa de las ratas entrenadas complementados con maltodextrina. MATERIAL Y MÉTODOS: El protocolo consistió en 8 semanas de patrón de natación continua (60min.dia-1 o intermitente (2 períodos de 30 min, con un intervalo de 10 min, con sobrecargas que corresponden al 5% y el 10% del peso corporal. Durante 37 días los animales fueron suplementados con una dosis diaria de 0,48 g.kg-1 maltodextrina disuelta en agua o agua pura. RESULTADOS: El ejercicio aeróbico provocó un aumento significativo en los niveles de glucosa en la sangre. Los ejercicios y la maltodextrina no causó cambios en el perfil lipídico. CONCLUSIONES: El ejercicio aeróbico dio lugar en los niveles de glucosa en la sangre, sin causar hipoglucemia.The objective was to verify changes in lipids and glucose levels of trained rats supplemented with maltodextrin. MATERIALS AND METHODS: The training protocol consisted of 8 weeks of continuous swimming pattern (60min.dia-1 or intermittent (2 periods of 30 minutes, with an interval of 10 minutes, with overloads corresponding to 5% and 10% of body weight, respectively. For

  4. Respostas cardiovasculares a mudança postural e capacidade aeróbia em homens e mulheres de meia-idade antes e após treinamento físico aeróbio Cardiovascular responses to postural change and aerobic capacity among middle-aged men and women before and after aerobic physical training

    Directory of Open Access Journals (Sweden)

    ST Leite

    2008-10-01

    Full Text Available OBJETIVO: Comparar respostas cardiovasculares a Manobra Postural Passiva (Tilt Test e capacidade cardiorrespiratória em homens e mulheres de meia-idade antes e após treinamento físico aeróbio. MATERIAIS E MÉTODOS: Sete homens - GH (44,6±2,1 anos e sete mulheres - GM (51,7±4,8 anos, participaram de treinamento físico aeróbio por 12 semanas. Foi realizado protocolo de Tilt Test (cinco minutos supino, dez minutos inclinado 70º, cinco minutos supino, com monitoração da pressão arterial e freqüência cardíaca. Para mensuração da capacidade cardiorrespiratória foi realizado protocolo em cicloergômetro. RESULTADOS: Na condição sedentária, GH mostrou maior influência parassimpática no controle da freqüência cardíaca evidenciada por maior intervalo RR (iRR durante Tilt Test. Na condição treinada, os valores de iRR de ambos os grupos se assemelham, tendo as mulheres iRR maior em supino, mas na inclinação os homens mantêm iRR mais elevado. Para pressão arterial, as mulheres permanecem com valores superiores após treino, mas a freqüência cardíaca tende a se assemelhar em ambos. Já na capacidade cardiorrespiratória, homens e mulheres têm um padrão de comportamento semelhante após treino. Com exceção dos valores absolutos da freqüência cardíaca, sem diferenças entre os grupos, para todas as outras variáveis os homens obtiveram valores superiores aos das mulheres. Observa-se ainda que, após o treinamento, houve redução significativa dos valores de pressão arterial no GM, mesmo continuando superiores aos dos homens. CONCLUSÃO: O treinamento parece ter reduzido os níveis pressóricos nas mulheres, além de serem observadas melhorias na capacidade cardiorrespiratória de ambos os grupos, permanecendo os homens com melhor desempenho do que as mulheres.OBJECTIVE: To compare the cardiovascular responses to passive postural maneuvers (tilt test and the cardiorespiratory capacity in middle-aged men and women

  5. Desempenho da força em idosas após duas intensidades do exercício aeróbio Strength performance in older women after two intensities of aerobic exercise

    Directory of Open Access Journals (Sweden)

    Adriana Lemos

    2008-02-01

    Full Text Available O objetivo do presente estudo foi comparar a influência aguda de duas intensidades de característica aeróbia, sobre o número de repetições numa sessão de treinamento de força (TF em idosas fisicamente ativas. Oito voluntárias (67,5 ± 4,8 anos; 58,6 ± 2,2 kg; 156 ± 5,9 cm com experiência em ambas atividades, realizaram 20 minutos de caminhada em esteira rolante com intensidades pré-determinadas (60 ou 80% da FCmáx. e imediatamente após, realizaram uma sessão de TF nos exercícios de pressão de pernas, cadeira extensora e cadeira flexora. Para determinação da carga, foram conduzidos teste e re-teste de 10 repetições máximas (10RM nos exercícios selecionados, e a FCmáx foi determinada através de teste de esforço máximo em esteira rolante, com protocolo de Balke-Ware. O número de repetições em cada série após cada intensidade aeróbia foi analisado pela ANOVA de medidas repetidas, seguida do teste post-hoc de Scheffé. O número total de repetições em cada exercício e o número total de repetições em cada seqüência foi analisado pelo teste t-student para amostras dependentes. Os resultados dos testes demonstraram reduções significativas no número total de repetições em toda a sessão de treinamento (somatório de todas as repetições de todos os exercícios. Também foram observadas reduções no número de repetições totais por exercício nas diferentes intensidades do treino de característica aeróbia, a 60 e 80% da FCmáx. Verificou-se também que após o exercício aeróbio realizado a 80%, todos os avaliados apresentaram maior grau de cansaço, expresso através da percepção subjetiva de esforço. Tal efeito inibitório ficou mais evidenciado através da análise intersequêncial onde foi observado que a 80% da FCmáx., ocorreu maior redução do desempenho da força. Conclui-se então, que independentemente das intensidades estudadas, 20 minutos de treinamento aeróbio, podem ser suficientes

  6. Treinamento aeróbico prévio à compressão nervosa: análise da morfometria muscular de ratos Aerobic training previous to nerve compression: morphometry analysis of muscle in rats

    Directory of Open Access Journals (Sweden)

    Elisangela Lourdes Artifon

    2013-02-01

    Full Text Available INTRODUÇÃO: Ciatalgia origina-se da compressão do nervo isquiático e implica em dor, parestesia, diminuição da força muscular e hipotrofia. O exercício físico é reconhecido na prevenção e reabilitação de lesões, porém quando em sobrecargas pode aumentar o risco de lesões e consequente déficit funcional. OBJETIVO: Avaliar efeitos de treinamento aeróbico prévio a modelo experimental de ciatalgia em relação a parâmetros morfométricos dos músculos sóleos de ratos. MATERIAIS E MÉTODOS: 18 ratos divididos em três grupos: simulacro (mergulho, 30 segundos; exercício regular (natação, dez minutos diários; e treinamento aeróbico progressivo (natação em tempos progressivos de dez a 60 minutos diários. Ao final de seis semanas de exercício, os ratos foram submetidos ao modelo experimental da ciatalgia. No terceiro dia após a lesão, foram eutanasiados e tiveram seus músculos sóleos dissecados, pesados e preparados para análise histológica. Variáveis analisadas: peso muscular, área de secção transversa e diâmetro médio das fibras musculares. RESULTADOS: Observou-se diferença estatisticamente significativa para todos os grupos quando se comparou músculo controle e aquele submetido à lesão isquiática. A análise intergrupos não apresentou diferença estatisticamente significativa para nenhuma das variáveis analisadas. CONCLUSÃO: Tanto o exercício físico regular quanto o treinamento aeróbico não produziram efeitos preventivos ou agravantes às consequências musculares da inatividade funcional após ciatalgia.INTRODUCTION: Sciatica stems from compression of the sciatic nerve and results in pain, paresthesia, decreased muscle strength and hypertrophy. Exercise is recognized in the prevention and rehabilitation of injuries, but when performed in overload, it may increase the risk of injury and subsequent functional deficit. OBJECTIVE: To evaluate effects of aerobic training prior to an experimental model

  7. Treinamento aeróbico melhora a capacidade funcional de pacientes em hemodiálise crônica Aerobic exercise improves physical capacity in patients under chronic hemodialysis

    Directory of Open Access Journals (Sweden)

    Diane Michela Nery Henrique

    2010-06-01

    Full Text Available FUNDAMENTO: Na população geral, a prática regular de exercícios físicos se associa à melhora da capacidade funcional e à redução de eventos cardiovasculares. Já em portadores de doença renal crônica, uma população com significativo comprometimento da capacidade funcional e elevadas taxas de mortalidade cardiovascular, poucos estudos avaliam os efeitos da atividade física. OBJETIVO: Avaliar o efeito do treinamento aeróbico durante as sessões de hemodiálise, sobre a capacidade funcional e a pressão arterial de pacientes renais crônicos. MÉTODOS: Foram avaliados 14 pacientes portadores de doença renal crônica sob tratamento hemodialítico, antes e depois de 12 semanas de treinamento aeróbico realizado durante as sessões de hemodiálise. Os pacientes foram submetidos a monitorização ambulatorial da pressão arterial de 24 horas, teste de caminhada de 6 minutos e teste cardiopulmonar de exercício antes e depois do período de treinamento. RESULTADOS: Após o treinamento, observou-se aumento significativo da distância percorrida no teste de caminhada de 6 minutos de 509 ± 91,9 m para 555 ± 105,8 m, além de redução significativa da pressão arterial sistólica de 151 ± 18,4 mmHg para 143 ± 14,7 mmHg, da pressão arterial diastólica de 94 ± 10,5 mmHg para 91 ± 9,6 mmHg e da pressão arterial média de 114 ± 13,0 mmHg para 109 ± 11,4 mmHg. CONCLUSÃO: O treinamento aeróbico realizado durante as sessões de hemodiálise contribuiu para a melhora da capacidade funcional e para o controle da hipertensão arterial dos pacientes portadores de doença renal crônica.BACKGROUND: In the general population, regular practice of physical exercises is associated with improved physical capacity and reduction of cardiovascular events. Concerning patients with chronic kidney disease, a population with significant impairment of physical capacity and high rates of cardiovascular mortality, few studies have evaluated the effects

  8. Mejora de defensas antioxidantes mediante ejercicio aeróbico en mujeres con síndrome metabólico Aerobic training improves antioxidant defense system in women with metabolic syndrome

    Directory of Open Access Journals (Sweden)

    Manuel Rosety-Rodríguez

    2012-02-01

    Full Text Available En la actualidad se acepta que el daño oxidativo juega un papel esencial en la patogénesis del síndrome metabólico. Estudios recientes proponen al daño oxidativo como diana terapéutica frente al síndrome metabólico. Precisamente nuestro objetivo fue mejorar el estatus total antioxidante (TAS de mujeres con síndrome metabólico mediante ejercicio aeróbico. Participaron voluntariamente 100 mujeres con síndrome metabólico de acuerdo con los criterios del National Cholesterol Educational Program (Adult-Treatment-Panel-III distribuidas aleatoriamente en grupo experimental (n = 60 y control (n = 40. El grupo experimental desarrolló un programa de entrenamiento aeróbico sobre tapiz rodante de intensidad ligera/moderada de 12 semanas (5 sesiones/semana. La determinación del TAS plasmático se realizó mediante espectrofotometría utilizando kits comercializados por Randox Lab. Este protocolo fue aprobado por un Comité de Etica Institucional. Tras completar el programa de entrenamiento se incrementó significativamente el TAS (0.79 ± 0.05 vs.1.01 ± 0.03 mmol/l; p = 0.027. No hubo cambios en grupo control. El ejercicio aeróbico de intensidad ligera/moderada aumenta las defensas antioxidantes en mujeres con síndrome metabólico. Son necesarios futuros estudios longitudinales para conocer su impacto en la evolución clínica.A 12-week training protocol increased antioxidant defense system in young adult women with metabolic syndrome. It is generally accepted that oxidative stress is implicated in the pathogenesis of metabolic syndrome. Furthermore, recent studies have reported that stress may be acting as a therapeutic target in metabolic syndrome. Consequently, this study was designed to explore whether aerobic training may increase plasmatic total antioxidant status in women with metabolic syndrome. A total of 100 young adult women with metabolic syndrome according to the criteria reported by the National Cholesterol Education Program

  9. Reator compartimentado anaeróbio/aeróbio: sistema de baixo custo para tratamento de esgotos de pequenas comunidades Anaerobic/aerobic baffled reactor: low cost system for sewage treatment in small communities

    Directory of Open Access Journals (Sweden)

    Gustavo H. R. da Silva

    2005-06-01

    Full Text Available No Brasil são conhecidas e usadas várias técnicas de tratamento de esgoto, desde os mais sofisticados sistemas de tratamento aos mais simples processos. Uma alternativa economicamente viável aos sistemas de tratamento de esgotos sanitários é o processo anaeróbio, o qual tem recebido especial atenção nas pesquisas desenvolvidas no País, notadamente os reatores anaeróbios de alta taxa, unidades compactas e com boa eficiência de tratamento. Dentre as alternativas tecnológicas capazes de proporcionar as referidas variações das condições ambientais necessárias à ocorrência dos processos, está o uso de reatores compartimentados anaeróbio/aeróbio. Este trabalho apresenta, como alternativa, um reator compartimentado anaeróbio/aeróbio, tratando esgoto sanitário, como possibilidade de ser utilizado em pequenas comunidades urbanas e rurais. O desempenho do sistema foi avaliado em diversos tempos de detenção hidráulica (TDH, nos quais os melhores valores de Demanda Química de Oxigênio Total (DQOtotal - 73,7% e Sólidos em Suspensão Totais (SST - 78,8%, foram obtidos com TDHtotal de 8 horas (4 horas para a fase anaeróbia e 4 horas para a fase aeróbia. O reator compartimentado apresentou a característica de estabilidade operacional necessária aos sistemas de baixo custo.Several techniques of sewage treatment, from the most sophisticated to the simplest processes, are known in Brazil. An economically viable alternative for the systems of treatment of sanitary sewage is the anaerobic process, which has been given special attention in Brazilian research programs, mainly in the field of high rate anaerobic reactors as they are compact units and have high efficiency. The use of baffled anaerobic/aerobic reactors is one technological solution to provide the necessary variations in environmental conditions to foster the processes mentioned. In this paper an alternative is presented in the form of a baffled anaerobic

  10. Aerobic stability of triticale silage in single culture or in mixtures with oat and/or legumes Estabilidade aeróbia de silagens de triticale em cultivo exclusivo ou em misturas com aveia e/ou leguminosas

    Directory of Open Access Journals (Sweden)

    Valter Harry Bumbieris Junior

    2010-11-01

    Full Text Available The objective of the present study was to evaluate the aerobic stability and losses during the fermentation process of triticale silages in single crop or in mixtures with oats and/or legumes. The following crops were used for silage production: triticale (X. Triticosecale Wittimack, triticale intercropped with forage pea (Pisum arvense and triticale intercropped with oats (Avena strigosa Schreb, forage pea and vetch (Vicia sativa. The dry matter content and its recovery did not differ among the silages. Buffer capacity was higher for tricale silage intercropped with oats, forage pea and vetch(88.67 m eq. NaOH/100 g DM followed by triticale intercropped with forage pea (80.80 m eq. NaOH/100 g DM. Electric conductivity values were higher in the intercropped triticale silages. Triticale silage presented the lowest temperatures observed in the silos, and the silages of intercropped triticale silages presented higher heat retention and higher pH values. Silage of triticale intercropped with oats and legumes presented lower aerobic stability but it did not reduce the aerobic stability of the total feed. Dry matter recovery during storage and in stability evaluations in aerobiosis is similar among the silages.O objetivo neste trabalho foi avaliar a estabilidade aeróbia e as perdas durante o processo de fermentação de silagens de triticale em cultivo exclusivo ou em misturas com aveia e/ou leguminosas. As culturas utilizadas para produção das silagens foram: triticale (X. Triticosecale Wittimack; triticale em consórcio com ervilha-forrageira (Pisum arvense; e triticale em consórcio com aveia (Avena strigosa Schreb, ervilha-forrageira e ervilhaca (Vicia sativa. O teor de matéria seca e a recuperação de matéria seca não diferiram entre as silagens. A capacidade tampão foi maior para a silagem de triticale cultivado em consórcio com aveia, ervilha-forrageira e ervilhaca (88,67 m eq. NaOH/100 g de MS, seguida da silagem de triticale cultivado

  11. O papel do esteroide anabolizante sobre a hipertrofia e força muscular em treinamentos de resistência aeróbia e de força

    Directory of Open Access Journals (Sweden)

    Everton Crivoi do Carmo

    2011-06-01

    Full Text Available INTRODUÇÃO: Os efeitos dos esteroides anabolizantes (EA sobre a massa muscular e força são controversos e dependentes do treinamento realizado e das fibras musculares recrutadas. Com isso, o objetivo deste estudo foi avaliar os efeitos da associação de EA ao treinamento de força ou aeróbio sobre a hipertrofia e força muscular. MÉTODOS: Ratos Wistar (42 foram divididos em seis grupos: sedentário (SC, n = 7, sedentário anabolizante (SA, n = 7, treinado natação controle (TNC, n = 7, treinado natação anabolizante (TNA, n = 7, treinado força controle (TFC, n = 7 e treinado força anabolizante (TFA, n = 7. O EA foi administrado duas vezes por semana (10mg/kg/semana. Os protocolos de treinamento foram realizados durante 10 semanas, cinco sessões semanais. Foram avaliadas a hipertrofia dos músculos sóleo, plantar e gastrocnêmio (massa muscular corrigida pelo comprimento da tíbia, a proteína total muscular (Bradford e a força muscular em patas traseiras (testes de resistência à inclinação. RESULTADOS: Não foram observadas diferenças significantes na hipertrofia do músculo sóleo. Os grupos TFC e TFA apresentaram, respectivamente, hipertrofia de 18% e 31% no músculo plantar comparado ao grupo SC. A hipertrofia foi 13% maior no grupo TFA em relação ao grupo TFC. Resultados semelhantes foram encontrados no músculo gastrocnêmio. Os grupos TFC e TFA apresentaram significantes aumentos na quantidade total de proteína nos músculos plantares, sendo essa mais pronunciada no grupo TFA e positivamente correlaciona a hipertrofia muscular. Observamos aumento de força nas patas traseiras nos grupos TCF e TAF. CONCLUSÃO: A administração de EA ou sua associação ao treinamento aeróbio não aumenta a massa muscular e força. Porém, à associação ao treinamento de força leva a maior hipertrofia muscular em fibras glicolíticas. Portanto, o tipo de treinamento físico, recrutamento muscular e características das fibras

  12. Leptina e exercício físico aeróbio: implicações da adiposidade corporal e insulina Leptin and endurance exercise: implications of adiposity and insulin

    Directory of Open Access Journals (Sweden)

    Fabiana Braga Benatti

    2007-08-01

    Full Text Available Atualmente, a obesidade pode ser classificada como uma pandemia e suas conseqüências vão desde o diabetes mellitus até a doença cardíaca. Tanto fatores genéticos como ambientais contribuem para isso, porém, em humanos, o componente genético ainda é pouco definido. Com a clonagem do gene ob de ratos e do seu receptor, foi descoberta a leptina, o "hormônio da saciedade". A leptina é secretada, principalmente, pelo tecido adiposo e reflete a quantidade de gordura depositada no tecido adiposo de um indivíduo. Entretanto, diversos fatores influenciam sua expressão e síntese, tais como jejum, atividade simpática, exercício físico e alterações no balanço energético. Os efeitos da atividade física aeróbia sobre esse hormônio ainda não estão muito claros, visto que existem muitas contradições na literatura sobre sua possível ação na regulação da leptina. Estudos transversais sugerem que as concentrações plasmáticas de leptina não são alteradas após uma sessão de exercício aeróbio. Entretanto, se o esforço físico for extremo, como em uma ultramaratona, na qual há um balanço energético negativo, induzido pela atividade física extenuante, ocorre diminuição dessas concentrações. Além disso, exercícios de longa duração (> 60 min parecem estar associados à diminuição tardia das concentrações de leptina, aproximadamente 48h após a atividade, provavelmente em função de um possível desequilíbrio energético. Em relação aos estudos longitudinais, após o treinamento aeróbio, alguns autores não observam alterações na leptina plasmática, outros encontram alterações em função apenas das alterações da adiposidade e, por fim, alguns estudos observam diminuição da concentração plasmática e/ou expressão de leptina, independentemente de alterações da massa gorda. Tal fato sugere que haja outro, ou outros, fatores, além do conteúdo de gordura corporal, que modulam a diminuição das

  13. Relação entre a administração de esteróide anabólico androgênico, treinamento físico aeróbio e supercompensação do glicogênio Relación entre la administración de un esteroide anabólico androgénico, el tratamiento físico aeróbico y la supercompensación del glucógeno Relation between anabolic androgenic steroid administration, aerobic physical training and glycogen supercompensation

    Directory of Open Access Journals (Sweden)

    Tatiana S Cunha

    2005-06-01

    Full Text Available A supercompensação do glicogênio é uma das adaptações induzidas pelo treinamento físico. Visando potencializar este fenômeno, muitos atletas utilizam doses suprafisiológicas de esteróides anabólicos androgênicos (EAA. O objetivo deste estudo foi avaliar em ratos os efeitos da nandrolona e do exercício aeróbio sobre o peso corporal, triglicerídeos, glicose e reservas de glicogênio. Ratos Wistar machos foram aleatoriamente divididos em quatro grupos: sedentário + veículo (SV, treinado + veículo (TV, sedentário + EAA (SEAA e treinado + EAA (TEAA, n = 7-14/grupo. Receberam injeção i.m. de nandrolona ou veículo durante nove semanas e durante o mesmo período os animais treinados foram submetidos a exercício aeróbio. Os dados foram analisados por ANOVA bifatorial e Tukey (p (SV: 0,2 ± 0,02 = SEAA: 0,21 ± 0,02mg/100mg]. A glicemia e as reservas de glicogênio do sóleo permaneceram inalteradas. O uso de doses suprafisiológicas de nandrolona não potencializou nenhum dos efeitos obtidos em resposta ao treinamento aeróbio.La supercompensación de glucógeno es una de las adaptaciones inducidas por el entrenamiento físico. Visualizando potencializar este fenómeno, muchos atletas utilizan dosis suprafisiológicas de estos esteroides anabólicos androgénicos (EAA. El objetivo de este estudio fue el de evaluar en ratas los efectos de nandrolona y del ejercicio aeróbico sobre el peso corporal, los triglicéridos, la gluclosa y las reservas de glucógeno. Ratas Wistar machos fueron aleatóriamente divididas en 4 grupos: sedentarios + vehículo (SV, entrenada + vehículo (EV, sedentario + EAA (SEAA y entrenada + EAA (EEAA, n = 7-14/grupo. Recibieron una inyección intramuscular de nandrolona en vehículo durante dos semanas y durante este mismo período los animales entrenados fueron sometidos a ejercicio aeróbico. Los datos fueron analizados usando las pruebas estadísticas ANOVA bifactorial y Tukey (p (SV: 0,2 ± 0,02 = SEAA

  14. Validade do teste de 30 minutos (T-30 na determinação da capacidade aeróbia, parâmetros de braçada e performance aeróbia de nadadores treinados Validity of 30 minutes test (T-30 in aerobic capacity, stroke parameters and aerobic performance determination of trained swimmers

    Directory of Open Access Journals (Sweden)

    Rafael Deminice

    2007-06-01

    Full Text Available O objetivo do presente estudo foi verificar a utilização da velocidade de 30 minutos (VT-30, freqüência de braçada (fB, comprimento de braçada (CB e índice de braçada (IB, obtidos no teste T-30, como métodos não-invasivos para determinação da performance aeróbia e técnica de nadadores treinados. Catorze nadadores submeteram-se a três esforços de 400m (85, 90 e 100% do esforço máximo para determinação da velocidade de limiar anaeróbio (VLan correspondente à concentração fixa de 3,5mM de lactato e um esforço máximo de 30 minutos (VT-30. fB, CB e IB foram calculados nos 10m centrais da piscina (nado limpo para o teste T-30 (fBT-30, CBT-30 e IBT-30 e progressivo. Através da relação entre VLan e parâmetros de braçada no teste progressivo, determinaram-se freqüência de braçada de limiar (fBLan, comprimento de braçada de limiar (CBLan e índice de braçada de limiar (IBLan. O tempo para realizar 400m em máximo esforço foi considerado como parâmetro de performance (P400. Não foi encontrada diferença significativa entre VLan (1,29 ± 0,07m.s-1 e VT-30 (1,29 ± 0,08m.s-1, que ainda apresentaram alta correlação (r = 0,90. Os valores de fBLan (33,6 ± 4,14 ciclos/min e fBT-30 (34,9 ± 3,53 ciclos/min e de CBLan (2,09 ± 0,20m/ciclo e CBT-30 (2,09 ± 0,20m/ciclo também não foram significativamente diferentes. Correlações significativas (p The aim of the present study was to verify the use of the 30 minutes velocity (VT-30, stroke rate (SR, stroke length (SL and stroke index (SI, obtained in T-30 test, as non-invasive methods for trained swimmer's aerobic performance and technical determination. Fourteen swimmers accomplished three efforts along 400 m (85, 90 and 100% of the maximum effort for anaerobic threshold speed determination (ATS corresponding to 3.5 mM lactate fixed concentration, as well as a 30 minutes maximal effort (VT-30. SR, SL, and SI were calculated within the 10 m midsection of the swimming pool

  15. Long-term creatine supplementation improves the aerobic capacity of horses Suplementação prolongada com creatina melhora a capacidade aeróbica de eqüinos

    Directory of Open Access Journals (Sweden)

    Guilherme de Camargo Ferraz

    2006-04-01

    Full Text Available The aim of the present study was to investigate the effect of long-term oral supplementation of creatine on the physiological responses to aerobic training. Twelve purebred Arabian horses were submitted to aerobic training for 90 days, with and without creatine supplementation which consisted of the daily administration of 75g of creatine monohydrate mixed into the ration for 90 days of training. Physical conditioning was conducted on a high performance treadmill and training intensity was stipulated by calculating the V4 (velocity at which blood lactate reaches 4mmol L-1 determined monthly for each animal. The individual intensity of physical force at 80% of aerobic threshold was established. An incremental exercise test was used to set the individual V4. After a warm up period of 4 min at 4m s-1, the speed was increased at 2min intervals to 6, 8 and 10m s-1. The blood samples were collected 15s before the end of each step to determine the concentration of lactate, packed cell volume, hemoglobin and red cell values. The results demonstrated a significant increase (PO objetivo do presente estudo foi investigar os efeitos da suplementação oral com creatina sobre respostas fisiológicas ao treinamento aeróbico. Doze cavalos da raça Puro Sangue Árabe foram submetidos a treinamento aeróbico por 90 dias, com ou sem suplementação com creatina, que consistia da administração diária de 75g de monoidrato de creatina misturada à ração durante os 90 dias de treinamento. O treinamento físico foi conduzido exclusivamente em esteira rolante de alto desempenho sendo a intensidade do treinamento estabelecida em 80% da velocidade obtida através da V4 (velocidade na qual a concentração sangüínea de lactato atinge 4mmol L-1 determinada mensalmente para cada animal. Para o estabelecimento da V4 individual foi empregado um teste físico de esforço crescente em que, após um período de aquecimento de 4min a 4m s-1, a velocidade era aumentada

  16. Influencia del ejercicio físico aeróbico durante el embarazo en los niveles de hemoglobina y de hierro maternos. (Influence of the physical aerobic exercise during pregnancy in the maternal haemoglobin and iron levels.

    Directory of Open Access Journals (Sweden)

    James Stirling

    2008-04-01

    Full Text Available Resumen Son bien conocidos los efectos beneficiosos que el ejercicio físico tiene sobre la salud en general, aunque no se cuenta con la misma información cuando se desarrolla durante el embarazo. La mayor incertidumbre es saber si pueden coexistir ambos procesos, ejercicio y embarazo, sin conflictos materno-fetales y sin resultados del embarazo alterados. Especialmente cuando día a día, son más las mujeres que desean continuar ejercitándose de alguna forma, durante su embarazo. El objetivo de este trabajo es conocer la influencia del ejercicio físico aeróbico moderado desarrollado durante el segundo y tercer trimestres en los niveles de hemoglobina y de hierro maternos. Material y métodos: Se llevó acabo un estudio experimental que incluyó un total de 142 gestantes. Grupo casos: integrado por 72 mujeres. Grupo control: integrado por 70 mujeres. Los parámetros maternos estudiados fueron: niveles de hierro, nivel de hemoglobina previo al parto, edad gestacional, tipo de parto. Fetales: Peso de nacimiento, talla, perímetro craneal, test de Apgar (1´y 5´. Resultados: No se encontraron diferencias significativas a nivel estadístico entre ambos grupos (p menor que 0,05, el grupo de casos (ejercicio presento medias similares en los niveles de hemoglobina: 12.1 ± 0.8 y de hierro: 65.90 ± 7.1; que el grupo de control: hemoglobina: 12.3 ± 0.8 y hierro: 66.42 ± 8.4. El peso de nacimiento fue inferior en el grupo de casos dentro de valores normales (-142.1 grs.. Conclusión: El ejercicio aeróbico moderado desarrollado durante el segundo y tercer trimestre de embarazo parece no alterar los niveles de hierro y hemoglobina maternos. Abstract They are very well-known the beneficial effects that the physical exercise has about the health in general, although it is not had the same information when it refers to a pro- cess of remarkable importance: the pregnancy. The biggest uncertainty is to know if both processes, exercise and pregnancy can

  17. Estabilidade aeróbia de silagens do capim-marandu submetidas a diferentes intensidades de compactação na ensilagem Aerobic stability of marandu grass silages submitted to different packing intensities during ensiling

    Directory of Open Access Journals (Sweden)

    Rafael Camargo do Amaral

    2008-06-01

    Full Text Available Objetivou-se avaliar a estabilidade aeróbia das silagens de capim-marandu submetidas a diferentes pressões de compactação. A espécie forrageira foi colhida aos 60 dias de crescimento vegetativo. O delineamento experimental utilizado foi o inteiramente casualizado com quatro repetições, utilizando-se o modelo de medidas repetidas no tempo. Os tratamentos constituíram-se de quatro densidades (100, 120, 140 e 160 kg MS/m³. As alterações químicas das silagens foram determinadas com 0, 3 e 6 dias após a abertura. As leituras das temperaturas das silagens foram obtidas em intervalos de 12 horas, 156 horas após a acomodação dos baldes na câmara climática, utilizando-se o termômetro inserido a 10 cm no centro da massa de silagem. As silagens de maiores valores de densidade alcançaram máxima temperatura em maior tempo que as densidades inferiores, evidenciando a maior estabilidade decorrente de melhor compactação da massa ensilada. Com o avançar do tempo de exposição aeróbia, as silagens tiveram aumento nos valores de pH e decréscimos nos teores de nitrogênio amoniacal (N-NH3. Verificou-se queda nos teores de NIDN (nitrogênio insolúvel em detergente neutro e da fração B3 com o aumento da densidade, o que caracterizou a participação dessa fração durante o processo de proteólise após a quebra da vedação. Os teores de fibras em detergente neutro e detergente ácido durante a exposição ao ar sofreram acréscimo, sendo os maiores valores obtidos nas silagens de menor densidade. As silagens mais densas apresentaram maiores coeficientes de digestibilidade verdadeira in vitro que os demais tratamentos.This trial aimed to evaluate the aerobic stability of marandu grass silages submitted to different packing intensities. The forage was harvested at 60 days of regrowth. The following packing densities were evaluated: 100, 120, 140, and 160 kg DM/m³. Silage chemical changes were determined 0, 3, and 6 days after air

  18. Avaliação da potência aeróbia de praticantes de Rugby em Cadeira de Rodas através de um teste de quadra

    Directory of Open Access Journals (Sweden)

    Lucinar Jupir Forner Flores

    2013-06-01

    Full Text Available O presente estudo teve por finalidade estimar a potência aeróbia em atletas com LME praticantes de RCR, correlacionar os níveis de VO2máx com a classificação funcional (CF dos atletas e analisar o comportamento da FC antes e pós-teste. A amostra foi composta por 10 atletas com LME, do sexo masculino e idade média de 29,6±6,5anos. Os atletas foram submetidos ao teste de corrida de 12 minutos e monitorados com o frequêncimetro cardíaco. A média do VO2máx foi de 18,3±8,1ml(kg.min-1 e da FCmáx de 114,6±25,3bpm. Os valores de VO2máx obtidos no estudo são classificados como médio para a população com tetraplegia. Observou-se que existe correlação moderada (r=0,77 entre a CF e o VO2máx entre atletas praticantes de RCR e por fim, observou-se baixos valores de FC frente á um teste submáximo, fato que pode estar relacionado à diminuição da atuação simpática após LME.

  19. Avaliação da produção de óxido nítrico em ratos, submetidos aos exercícios aeróbio e anaeróbio Evaluation of the production of nitric oxide in mice, submitted to aerobic and anaerobic exercises

    Directory of Open Access Journals (Sweden)

    Vanessa Guimarães de Freitas Cruvelo D'Ávila

    2008-12-01

    Full Text Available Óxido nítrico (NO exerce influências muito importantes em vários processos fisiológicos. Neste trabalho avaliamos a produção de NO sanguíneo em ratos Wistar, submetidos ao nado aeróbio e anaeróbio agudos. A formação do óxido nítrico foi verificada através da dosagem dos produtos de oxidação estáveis do metabolismo do óxido nítrico (nitratos. Para isso utilizamos o método colorimétrico de Griess. Verificamos a existência de uma diferença significativa (p = 0,000261 na produção de óxido nítrico entre a realização do nado aeróbio e o anaeróbio, na qual o aeróbio mostrou-se mais eficiente na promoção de níveis mais elevados. O exercício aeróbio agudo com duração de no mínimo 10 minutos mostrou-se mais eficaz no quesito produção de NO em relação ao exercício de 5 minutos. A positiva relação observada entre o exercício aeróbio e a formação de NO pode ajudar a explicar os efeitos benéficos do exercício na saúde cardiovascular. Sabemos que a prática de exercício aeróbio e sua duração aumentam a biodisponibilidade de NO, o qual é considerado importante regulador fisiológico da pressão arterial.Nitric Oxide (NO exerts important influences in several physiological processes. In this work we evaluated the production of sanguine NO in Wistar rats, submitted to the acute aerobic and anaerobic exercises. The formation of nitric oxide was verified through the dosage of the end products of oxidation of the metabolism of nitric oxide (nitrates. For this we used the colorimetric Griess method. We verified the existence of a significant difference (p = 0.000261 in the production of NO among the accomplishment of the aerobic swimming and the anaerobic, where the aerobic was shown more efficient in the promotion of higher levels. The acute aerobic exercise with duration of at least 10 minutes was shown more effective in the requirement production of NO in relation to the 5 minutes exercise. The positive

  20. Treinamento aeróbio não altera pressão arterial de mulheres menopausadas e com síndrome metabólica Aerobic training does not alter blood pressure in menopausal women with metabolic syndrome

    Directory of Open Access Journals (Sweden)

    Aluísio Henrique Rodrigues de Andrade Lima

    2012-11-01

    Full Text Available FUNDAMENTO: A Hipertensão arterial (HA é uma condição tanto agravante quanto agravada pela Síndrome Metabólica (SM. A menopausa pode tornar o tratamento da hipertensão mais difícil porque é uma condição que favorece a piora nos componentes da SM. Embora existam evidências de que o treinamento com exercícios físicos reduza a pressão arterial, se as condições da menopausa e da SM afetam os benefícios induzidos pelo exercício é algo ainda não evidenciado. OBJETIVO: Comparar os efeitos do treinamento aeróbio na pressão arterial entre mulheres com SM não menopausadas e menopausadas. MÉTODOS: Foram recrutadas 44 mulheres divididas em quatro grupos experimentais: controle não menopausada (CNM: 39,5 ± 1,1 anos, n = 11; controle menopausada (CM: 54,9 ± 1,7 anos, n = 12; aeróbio não menopausada (ANM: 43,1 ± 2,1 anos, n = 11 e aeróbio menopausada (AM: 52,1 ± 1,6 anos, n = 10. Os grupos de exercício realizaram treinamento aeróbio durante três meses, cinco vezes por semana, com intensidade entre 60% e 70% da frequência cardíaca de reserva. A pressão arterial de repouso e a resposta pressórica clínica após 60 minutos de exercício foram medidas antes e após o período treinamento. O teste de ANOVA de dois fatores foi usado, considerando p 0,05. CONCLUSÃO: Três meses de treinamento aeróbio melhora componentes da SM, mas não altera a pressão arterial de repouso, nem a resposta pressórica aguda após uma sessão de exercício aeróbio em mulheres com SM.BACKGROUND: Arterial Hypertension (AH is an aggravating condition for Metabolic Syndrome (MS, as well as being aggravated by it. Menopause can make hypertension treatment more difficult, as it favors the worsening of MS components. Although there is evidence that exercise training reduces blood pressure, whether menopause and SM affect the exercise-induced benefits is yet to be elucidated. OBJECTIVE: To compare the effects of aerobic training on blood pressure in

  1. The clinical importance of cardiopulmonary exercise testing and aerobic training in patients with heart failure A importância clínica de testes de exercícios cardiopulmonares e treinamento aeróbico em pacientes com insuficiência cardíaca

    Directory of Open Access Journals (Sweden)

    R Arena

    2008-04-01

    Full Text Available INTRODUCTION: The appropriate physiological response to an acute bout of progressive aerobic exercise requires proper functioning of the pulmonary, cardiovascular and skeletal muscle systems. Unfortunately, these systems are all negatively impacted in patients with heart failure (HF, resulting in significantly diminished aerobic capacity compared with apparently healthy individuals. Cardiopulmonary exercise testing (CPX is a noninvasive assessment technique that provides valuable insight into the health and functioning of the physiological systems that dictate an individual’s aerobic capacity. The values of several key variables obtained from CPX, such as peak oxygen consumption and ventilatory efficiency, are often found to be abnormal in patients with HF. In addition to the ability of CPX variables to acutely reflect varying degrees of pathophysiology, they also possess strong prognostic significance, further bolstering their clinical value. Once thought to be contraindicated in patients with HF, participation in a chronic aerobic exercise program is now an accepted lifestyle intervention. Following several weeks/months of aerobic exercise training, an abundance of evidence now demonstrates an improvement in several pathophysiological phenomena contributing to the abnormalities frequently observed during CPX in the HF population. These exercise-induced adaptations to physiological function result in a significant improvement in aerobic capacity and quality of life. CONCLUSIONS: Furthermore, there is initial evidence to suggest that aerobic exercise training improves morbidity and mortality in patients with HF. This paper provides a review of the literature highlighting the clinical significance of aerobic exercise testing and training in this unique cardiac population.INTRODUÇÃO: A resposta fisiológica aguda ao exercício aeróbio progressivo demanda funcionamento adequado dos sistemas pulmonares, cardiovasculares e m

  2. Qualidade de vida e síndrome metabólica em mulheres brasileiras: análise da correlação com a aptidão aeróbia e a força muscular

    Directory of Open Access Journals (Sweden)

    Tatiane Gomes Teixeira

    2015-08-01

    Full Text Available A síndrome metabólica (SM é definida pela presença de, ao menos três, dentre cinco fatores de risco cardiovascular: hiperglicemia, resistência à insulina, obesidade, dislipidemia e pressão arterial elevada. Embora portadores de SM apresentem baixa aptidão física e pior qualidade de vida (QV, quando comparado aos indivíduos sem SM, ainda não foram investigadas as correlações entre a aptidão física e a QV em mulheres com SM. O objetivo do presente estudo foi comparar a QV, força muscular e aptdião aeróbia, bem como analisar a correlação entre a QV e a aptidão física de mulheres com e sem SM. Participaram do estudo 49 mulheres, 21 com SM (33.5 ± 9.1 anos e 28 sem SM (32.3 ± 7.9 anos. Para avaliação da QV, aptidão aeróbia e força muscular foram utilizados, respectivamente, o questionário Short Form Health Survey 36 (SF-36, o teste de caminhada de 6 minutos (6-C e o teste de preensão manual. As mulheres com SM apresentaram pior QV, percorreram menor distância no 6-C e obtiveram menor força muscular relativa. Foi observada correlação positiva entre a aptidão aeróbia e quatro domínios da QV: capacidade funcional, limitação por aspectos físicos, dor e aspectos sociais da funcionalidade. Mulheres com SM apresentam menor de força muscular e aptidão aeróbia, bem como piores escores de QV no estado de saúde geral, capacidade funcional, dor no corpo, limitação por aspectos emocionais, aspectos sociais da funcionalidade e limitação por aspectos físicos quando comparado com mulheres sem SM.

  3. Influência do treinamento aeróbio sobre o cortisol e glicose plasmáticos em equinos Influence of the aerobic training on cortisol and glucose levels in horses

    Directory of Open Access Journals (Sweden)

    G.C. Ferraz

    2010-02-01

    Full Text Available Estudou-se a resposta do cortisol e da glicemia em 12 equinos da raça Puro Sangue Árabe destreinados (T0 por oito meses e submetidos a um período de 90 dias de treinamento aeróbio (T90. Para avaliação dos efeitos do treinamento, empregou-se teste ergométrico constituído de exercício progressivo em esteira rolante, acompanhado por colheitas de sangue 15 segundos antes do término de cada etapa de esforço. A velocidade (intensidade do treino foi definida como sendo 80% da V4 (velocidade na qual a lactacidemia atinge 4mmol/L. Adicionalmente, no último mês de treinamento, foi instituído, uma vez por semana, exercício com velocidades variáveis, chamado "fartlek". Após 90 dias de treinamento, a concentração plasmática de cortisol elevou-se e após o teste de esforço (20min, houve aumento da glicemia. Este resultado reflete a possibilidade de adaptação ao treinamento. Conclui-se que o cortisol plasmático pode ser utilizado como ferramenta na avaliação de um programa de treinamento em equinos.Cortisol and glucose responses were evaluated in 12 Arabian (PSA horses submitted to a detraining period of eight months (T0 and to 90 days of aerobic training (T90. For the evaluation of the effect of training, a standardized incremental exercise test in a treadmill was used. Fifteen seconds before the ending of each effort step, blood samples were collected. The speed (intensity of the training was defined as being 80% of the V4 (speed at which the blood lactate concentration reaches 4mmol/L. Additionally, in the last month of training, velocity play, a type of exercise with varying velocities called "fartlek" was instituted, once a week. Results showed that after 90 days of training, the plasmatic concentrations of cortisol and glucose increased when compared to the untrained horses. This result reflects the possibility of adaptation to the training. The blood cortisol levels may be used as a tool for the evaluation of a training program

  4. Gasto energético aeróbico y anaeróbico en un circuito con cargas a seis intensidades diferentes. (Aerobic and anaerobic energy expenditure during at circuit weight training through six different intensities.

    Directory of Open Access Journals (Sweden)

    Rocío Cupeiro Coto

    2011-07-01

    Full Text Available ResumenEl entrenamiento con cargas es una actividad anaeróbica glucolítica intensa y se ha comprobado que el error en las estimaciones del gasto energético en esta actividad varía entre un 13 y un 30%. El principal objetivo de este trabajo es describir la contribución anaeróbica de energía en un circuito con cargas. Doce hombres (20-26 años y diecisiete mujeres (18-29 años estudiantes de Ciencias de la Actividad Física y del Deporte realizaron un entrenamiento en circuito de cargas a 6 intensidades diferentes (entre el 30% y 80% de su 15RM. Durante la totalidad de los circuitos se registró el gasto energético aeróbico por calorimetría indirecta, la frecuencia cardiaca con pulsómetro Polar® y la concentración de lactato en sangre capilar para medir la contribución anaeróbica. El incremento que produjo la energía anaeróbica se situó entre el 5,1% y un máximo del 13,5%, lo que hace evidente que medir o no la contribución anaeróbica en el entrenamiento en circuito puede provocar un error medio del 9,65%. Existen diferencias significativas (PAbstractResistance training is an intense anaerobic glycolytic activity and has been shown that estimates of energy expenditure in this activity turn out into an error that varies between 13 and 30%. The main aim of this paper is to describe the anaerobic energy contribution in circuit weight training. Twelve men (20-26 years and seventeen women (18-29 years students in Science of Physical Activity and Sport performed circuit training at six different intensities (between 30% and 80% of 15RM. During all the circuits aerobic energy expenditure was registered by indirect calorimetry, heart rate with Polar® monitors and lactate concentration in capillary blood to measure the anaerobic contribution. The increased due to anaerobic energy was between 5,1% and a maximum of 13,5%, which clearly means that to measure or not the anaerobic contribution in circuit training can lead to an average

  5. Treinamento aeróbio de natação aumenta a atividade de enzimas antioxidantes e o conteúdo de glicogênio no musculoesquelético de ratos

    Directory of Open Access Journals (Sweden)

    Roberto Carlos Vieira Junior

    2013-06-01

    Full Text Available INTRODUÇÃO: São escassos os estudos os quais verificaram os efeitos do exercício físico sobre os biomarcadores de estresse oxidativo e sua relação com o glicogênio muscular. OBJETIVO: O presente estudo verificou o efeito do treinamento aeróbio de natação (TAN sobre os biomarcadores de estresse oxidativo, conteúdo de glicogênio e crescimento celular no músculo esquelético de ratos. MÉTODOS: Dezoito ratos Wistar macho (60 dias foram divididos em dois grupos: Grupo Sedentário (SG; n = 10: ratos sedentários; e Grupo Treinado (TG; n = 8: ratos submetidos ao TAN (5,0 % do peso corporal, 1h/dia, 5X/semana, durante oito semanas. A atividade das enzimas antioxidantes (AEA superóxido dismutase (SOD; U/ml, catalase (CAT; µmol/min/100 mg e glutationa peroxidase (GPx; nmol/min/100 mg, bem como a concentração das substâncias que reagem ao ácido tiobarbitúrico (TBARs; nmolMDA/mg proteína foram determinadas no músculo gastrocnêmio direito. Os conteúdos de glicogênio (mg/100 mg, proteína (g/100 g e DNA (g/100 g foram mensurados no músculo gastrocnêmio esquerdo. RESULTADOS: A AEA foi maior no TG (CAT: 0,87 ± 0,04; SOD: 6,49 ± 0,045; GPX: 6,49 ± 0,52 quando comparados com SG (CAT: 0,52 ± 0,03; SOD: 4,1 ± 0,37; GPx: 2,94 ± 0,56. Os níveis de TBARs foram menores em TG (TG: 2,35 ± 0,41; SG: 8,90 ± 0,47. O conteúdo de glicogênio muscular (SG: 0,108 ± 0,013; TG: 0,320 ± 0,012 e a razão proteína/DNA (SG: 24,94 ± 3,25; TG: 41,68 ± 4,02 foram maiores no TG. CONCLUSÃO: Em conjunto, estes dados confirmam que o TAN melhorou a defesa antioxidante, a qual pode estar associada ao aumento do conteúdo de glicogênio no músculo esquelético dos animais.

  6. Efeito da atividade física associada à orientação alimentar em adolescentes obesos: comparação entre o exercício aeróbio e anaeróbio Efecto de la actividad física asociada a la orientación alimentar en adolescentes obesos: comparación entre el ejercicio aeróbico y anaeróbico Effect of physical activity associated with nutritional orientation for obese adolescents: comparison between aerobic and anaerobic exercise

    OpenAIRE

    Renata Viccari Sabia; José Ernesto dos Santos; Rosane Pilot Pessa Ribeiro

    2004-01-01

    A obesidade na adolescência é uma doença universal de prevalência mundial crescente, assumindo caráter epidemiológico como problema de saúde pública na sociedade moderna. Este trabalho teve como objetivo comparar o efeito do exercício físico aeróbio contínuo e anaeróbio intermitente associado à orientação alimentar sobre a composição corporal, as medidas bioquímicas e a capacidade física de adolescentes obesos. Foram investigados 28 adolescentes (média de idade = 13 anos), com índice de massa...

  7. Redução da pressão arterial, da IMC e da glicose após treinamento aeróbico em idosas com diabete tipo 2 Decrease in blood pressure, body mass index and glycemia after aerobic training in elderly women with type 2 diabetes

    Directory of Open Access Journals (Sweden)

    Luciana Zaranza Monteiro

    2010-10-01

    Full Text Available FUNDAMENTO: O processo de envelhecimento associa-se ao desenvolvimento de várias doenças, que podem ser amenizadas pela prática de atividades físicas. O treinamento aeróbico é um meio efetivo para manter e melhorar as funções cardiovasculares. Além disso, desempenha um papel fundamental na prevenção e tratamento de diversas doenças crônico-degenerativas, em especial o diabete melito. OBJETIVO: Verificar os efeitos de 13 semanas de treinamento aeróbico sobre a pressão arterial, o índice de massa corpórea e a glicemia em idosas com diabete tipo 2. MÉTODOS: Onze mulheres idosas diabéticas (61,0 ± 9,1 anos de idade, sedentárias, realizaram 13 semanas de treinamento aeróbico, compondo o grupo G2. Onze idosas (60,2 ± 6,8 anos de idade controladas não realizaram exercícios físicos durante a pesquisa, constituindo o grupo-controle (G1. O grupo G1 foi submetido somente a orientações educativas uma vez na semana, e o grupo G2, a caminhadas três vezes na semana. RESULTADOS: Houve redução significativa da glicemia e da pressão arterial diastólica nos dois grupos. Não foram encontradas reduções significativas no IMC após o treinamento aeróbico em ambos os grupos. CONCLUSÃO: Treze semanas de treinamento aeróbico foi suficiente para promover reduções significativas na pressão arterial diastólica e glicemia, portanto, esse tipo de exercício reduz os fatores de risco para doenças cardiovasculares e metabólicas.BACKGROUND: The aging process is associated with the development of several diseases, which can be attenuated by the practice of physical activities. Aerobic training is an effective method to maintain and improve cardiovascular function. Additionally, it has a crucial role in the prevention and treatment of several chronic-degenerative diseases, especially diabetes mellitus. }OBJECTIVE: To verify the effect of a 13-week aerobic training program on blood pressure (BP, body mass index (BMI and glycemia levels

  8. Comparação entre métodos invasivos e não invasivo de determinação da capacidade aeróbia em futebolistas profissionais Comparación entre métodos invasivos y no invasivos de determinación de la capacidad aeróbica en futbolistas profesionales Comparison between invasive and non-invasive methods for the determination of the aerobic capacity of professional soccer players

    Directory of Open Access Journals (Sweden)

    Adelino Sanchez Ramos da Silva

    2005-08-01

    Full Text Available O Limiar Anaeróbio (Lan pode ser determinado por protocolos que utilizam concentrações fixas de lactato sanguíneo como o OBLA (Onset of Blood Lactate Accumulation e os que utilizam procedimentos mais individualizados, como o Lactato Mínimo (Lacmin. Independente do método, a mensuração da capacidade aeróbia através do Lan nesses casos exige a utilização de equipamentos sofisticados, além do elevado custo por atleta, o que torna sua aplicação limitada. Como alternativa, um dos testes não invasivos mais empregados no meio esportivo é o de 12 minutos proposto por Cooper. O objetivo principal do presente estudo foi comparar a intensidade de exercício obtida pelo teste de 12min com as intensidades correspondentes ao Lan obtido pelo protocolo adaptado ao de Tegtbur et al. (1993 (Lac minat e pelo OBLA em futebolistas profissionais. Para tanto participaram 16 atletas pertencentes a uma equipe profissional filiada à série A3 do futebol paulista. Cada atleta foi avaliado nos três protocolos, com intervalo mínimo de 48 e máximo de 72 horas. Os resultados mostraram diferença (p El umbral anaeróbico (Lan puede ser determinado por protocolos que utilizan concentraciones fijas de lactato sanguíneo como el OBLA (Onset of Blood Lactate Accumulation y los que utilizan procedimientos mas individualizados como el Lactato Mínimo (Lacmin. Independiente del método, la medida de la capacidad aeróbica a traves del Lan en esos casos exige una utilización de equipamientos sofisticados, además del elevado costo por atleta lo que torna su aplicación limitada. Como alternativa, uno de los tests no invasivos mas empleados en el medio deportivo es el de 12 minutos propuesto por Cooper. El objetivo principal de este estudio fue el de comparar la intensidad de ejercicio obtenida por el test de 12 minutos con las intensidades obtenidas correspondientes al Lan obtenido por el protocolo adaptado al de Tegtbur et al. (1993 (Lac minat y por el OBLA en

  9. Evaluation of oxidative stress in mice subjected to aerobic exercise Avaliação do estresse oxidativo em camundongos submetidos ao exercício físico aeróbico

    Directory of Open Access Journals (Sweden)

    Mônica Cruvinel de Lima

    2012-08-01

    Full Text Available PURPOSE: To evaluate the influence of aerobic exercise on oxidative stress in mice. METHODS: The study included twenty female mice Mus musculus-Swiss divided into two groups: sedentary control (GA and exercise (GB, each containing ten animals. All animals underwent an adaptation period of seven days isolated in individual boxes. After this period, the animals in the exercise group (GB were trained in angled running wheel with circumference of 25 cm assembled on an articulated axle during five minutes for three consecutive days. On the fourth day, they underwent an exercise program of one session lasting 45 minutes. The evaluation of oxidative stress was performed by determining the levels of malondialhyde derived of lipid peroxidation by the TBA method. The samples were read in a spectrophotometer at 535 nm. RESULTS: No significant difference was observed in the intergroup comparison of MDA levels in the tissues evaluated. A significant difference was observed in the intragroup comparison of MDA levels in the control group (p = 0.0201.The Tukeys' post hoc test indicated significantly lower values of MDA in the smooth muscle in relation to plasma. In the analysis of variance in the exercise group, a significant difference between tissues (p = 0.0009, with significantly lower values in the smooth muscle in relation to plasma (pOBJETIVO: Avaliar a influência do exercício físico aeróbico sobre o estresse oxidativo em camundongos. MÉTODOS: Participaram do estudo 20 camundongos (Swiss, distribuídos em dois grupos: controle-sedentário (GA e exercício (GB cada um contendo dez animais. Todos os animais passaram por um período de adaptação de sete dias. Após os animais do grupo (GB receberam treinamento em roda giratória angulada montada sobre eixo articulado por cinco minutos durante três dias consecutivos. No quarto dia foram submetidos à única sessão de exercício por 45 minutos. A avaliação do estresse oxidativo foi realizada por

  10. Perfil fermentativo, estabilidade aeróbia e valor nutritivo de silagens de capim-marandu ensilado com aditivos Fermentative profile, aerobic stability, and nutritive value of marandu grass silages using additives at ensiling

    Directory of Open Access Journals (Sweden)

    Thiago Fernandes Bernardes

    2008-10-01

    Full Text Available Com o objetivo de avaliar as perdas em silagem de capim-marandu produzidas com aditivos foram desenvolvidos dois experimentos. No experimento 1, objetivou-se conhecer o perfil de fermentação e a estabilidade aeróbia de quatro silagens: 1 forragem não tratada (Controle; 2 tratada com Lactobacillus plantarum e Propionibacterium; 3 tratada com Lactobacillus buchneri; e 4 tratada com 0,1% de benzoato de sódio. No experimento 2, foram utilizados nove novilhos castrados Nelore (PC de 350 ± 38,9 kg, alocados em três quadrados latinos 3 x 3 para avaliação do consumo e da digestibilidade das rações contendo 85,4% das seguintes silagens de capim-marandu: 1 controle; 2 controle com L. plantarum, Pediococcus acidilactici + enzimas fibrolíticas; e 3 tratamento 2 + L. buchneri. No experimento 1, as silagens apresentaram baixas recuperações de MS durante a fermentação (média de 86% e os coeficientes de digestibilidade in vitro da matéria seca reduziram de 65,5% (momento da ensilagem para 50,0% no 60º dia após o fechamento dos silos. No experimento 2, o valor médio de consumo das rações foi de 5,7 kg MS/dia (1,6% PC e a digestibilidade de 51,6% e não diferiram entre as rações. As silagens apresentaram perdas acentuadas na fase fermentativa e o uso de aditivos não alterou essas perdas. A inoculação com bactérias não influenciou o consumo ou a digestibilidade das rações.Two trials were conducted to evaluate losses of Marandu grass silages using different additives. The fermentation profile and aerobic stability of the silages were evaluated on the first trial. The followings silages were evaluated: 1 - Marandu grass (Control, 2 - Marandu grass plus L. plantarum and Propionibacterium, 3 - Marandu grass plus L. buchneri, 4 - Marandu grass plus 0.1% of sodium benzoate. On the second experiment, it was utilized nine castrated Nellore steers (Body weight 350 ± 38.9 kg allocated in three Latin squares (3 x 3 to evaluate the intake and

  11. Estudo do raspado de conjuntiva e margem palpebral de pacientes tratados de retinoblastoma: etapa I - Microflora aeróbica Study of the conjunctival scrape and eyelid margin smears in patients treated for retinoblastoma: phase I - Aerobic microflora

    Directory of Open Access Journals (Sweden)

    Maria Carmen Menezes Santos

    2002-03-01

    Full Text Available Objetivo: A queixa de secreção ocular é muito freqüente entre os pacientes tratados de retinoblastoma submetidos à enucleação e radioterapia. A falta de dados sobre a microflora em pacientes nessas condições foi o que motivou este estudo. Métodos: Foram examinadas 114 órbitas de 58 pacientes. Este trabalho apresenta os resultados das culturas para bactérias aeróbicas e fungos, de conjuntiva e margem palpebral em 4 condições, com e sem enucleação, com e sem radioterapia. Procedeu-se à identificação dos microrganismos de acordo com o Protocolo do National Committee for Clinical Laboratory Standards e os esfregaços para citologia foram submetidos às colorações de Gram e Leishman. Resultados: A presença de microrganismos foi mais freqüente nas cavidades anoftálmicas irradiadas, tanto na conjuntiva (54,5% quanto na margem palpebral (63,6%, porém sem diferença estatisticamente significante. Além disso, em órbitas com bulbo ocular, a radiação, na fase tardia, representou um fator limitante da presença de microrganismos na conjuntiva e na margem palpebral, mas sem diferença estatisticamente significante. O Staphylococcus coagulase negativa foi o microrganismo mais freqüente na conjuntiva e margem palpebral de todos os grupos. Houve crescimento de fungo, Candida tropicalis, em apenas um caso. Conclusões: Sugere-se o uso de colírios antibióticos em pacientes tratados de retinoblastoma, portadores de cavidade anoftálmica, irradiada ou não.Purpose: Conjunctival discharge is a common complaint among patients treated for retinoblastoma who underwent enucleation and radiotherapy. Lack of data about the microflora in those patients motivated this study. Methods: One hundred and fourteen orbits of 58 patients were examined. The authors present the results of aerobic bacterial and fungal culture of conjunctival and eyelid margin smears, as well as conjunctival cytology, in 4 different conditions: with and without

  12. Comparação entre protocolos diretos e indiretos de avaliação da aptidão aeróbia em indivíduos fisicamente ativos Comparacion entre protocolos directos e indirectos de evaluación de la aptitud aeróbica en indivíduos fisicamente activos Comparison between direct and indirect protocols of aerobic fitness evaluation in physically active individuals

    Directory of Open Access Journals (Sweden)

    Luiz Gustavo da Matta Silva

    2005-08-01

    Full Text Available O limiar anaeróbio individual (IAT, o limiar glicêmico individual (IGT, a velocidade associada ao VO2max (Vmax, a velocidade média em corrida de 3.000m (Vm3km e a velocidade crítica (VC têm sido utilizados na avaliação aeróbia e prescrição de exercício para atletas-corredores. No entanto, estudos comparando estes parâmetros e sua possível aplicação para indivíduos não atletas ainda não foram realizados. Os objetivos do presente estudo foram comparar e estabelecer as relações entre IAT, IGT, Vmax, Vm3km e VC em indivíduos fisicamente ativos não atletas. Onze indivíduos fisicamente ativos e saudáveis (20,7 ± 1,8 anos; 74,2 ± 14,5kg; 48,9 ± 5,8mlO2.kg.min-1 realizaram randomicamente os seguintes testes de corrida em dias distintos: 1 determinação da Vm3km a partir do desempenho em corrida de 3.000m; 2 desempenho em corrida de 500m e 3 teste incremental em esteira ergométrica para determinação do IAT, IGT, VO2max e Vmax. A VC foi determinada por regressão linear (relação distância-tempo a partir dos testes de 3km e 500m. Não foram verificadas diferenças entre as velocidades do IAT e IGT (184,8 ± 27,7 e 182,8 ± 27,9m.min-1; P > 0,05, e entre Vmax e Vm3km (211,1 ± 30 e 213,4 ± 32,2m.min-1; P > 0,05. Apesar da alta correlação entre as variáveis estudadas, a VC (199,8 ± 30,4m.min-1 superestimou o IAT e o IGT (P El umbral anaeróbico individual (IAT, el umbral glucémico individual (IGT, la velocidad asociada al VO2max (Vmax, la velocidad media de carrera de 3.000m (Vm3km y la velocidad crítica (VC estan estudiados junto con la evaluación aeróbica y la prescripción del ejercicio para atletas corredores. Sin embargo, los estudios que comparan estos parámetros y su posible aplicación para personas no atletas no ha sido realizados aún. Los objetivos del presente estudio fueron el de comparar y establecer las relaciones entre IAT, IGT, Vmax, Vm3km y VC en individuos físicamente activos no atletas. Once

  13. Percentile values for aerobic performance running/walking field tests in children aged 6 to 17 years: influence of weight status Valores de percentiles de los tests de campo de capacidad aeróbica en niños de 6 a 17 años: influencia del peso corporal

    Directory of Open Access Journals (Sweden)

    J. Castro-Piñero

    2011-06-01

    Full Text Available The aim of this study was to provide percentiles values for four different aerobic performance tests in 2752 (1,261 girls Spanish children aged 6 to 17.9 years. Aerobic performance was assessed by the shuttle run test (20mSRT, 1-mile, 1/2-mile and 1/4-mile run/walk tests. Height and weight were measured, and body mass index was calculated. Boys had significantly better score than girls in the studied tests in all age groups, except in 1/4-mile test in 6-7 year old children. Underweight children had similar performance than their normalweight counterparts, and underweight boys had better performance than their obese counterparts. Overweight and obese children had lower performance than their normalweight counterparts. Having percentile values of the most used field tests to measure aerobic performance in youth may help to identify children and adolescents at risk for the major chronic diseases, as well as to evaluate the effects of alternative interventions.El propósito de este estudio fue proporcionar los valores de percentiles para cuatro pruebas de rendimiento aeróbico en 2752 (1261 chicas niños españoles con edades de 6 a 17,9 años. El rendimiento aeróbico se evalúo mediante la carrera durante 20 minutos (20mSRT, y las pruebas de correr / caminar 1 milla, ½ milla y ¼ de milla. Se midieron el peso y la talla y se calculó el índice de masa corporal. Los chicos tuvieron puntuaciones significativamente mejores que las chicas en las pruebas evaluadas y para todos los grupos de edad, excepto en la prueba de ¼ de milla en el grupo de 6-7 años. Los niños con peso bajo mostraron un rendimiento similar a sus homólogos con peso normal y los primeros tuvieron un rendimiento mejor que sus homólogos obesos. Los niños obesos y con sobrepeso tuvieron un menor rendimiento que sus homólogos con peso normal. El disponer de valores de percentiles para las pruebas empleadas más habitualmente para evaluar el rendimiento aeróbico en los j

  14. Aerobic and anaerobic mineralization of Salvinia molesta and Myriophyllum aquaticum leachates from a tropical reservoir (Brazil Mineralização aeróbia e anaeróbia dos lixiviados de Salvinia molesta e Myriophyllum aquaticum de um reservatório tropical (Brasil

    Directory of Open Access Journals (Sweden)

    Renato Henriques da Silva

    2011-06-01

    Full Text Available AIM: This study aimed at describing and discussing the leachates mineralization (aerobic and anaerobic of two species of aquatic macrophytes (Salvinia molesta and Myriophyllum aquaticum from a tropical reservoir (22° 00' S and 47° 54' W; METHODS: The incubations were prepared with plant leachates and reservoir water sample and were maintained during 45 days in the dark (at 20 °C. The organic carbon and the oxygen consumption kinetics were evaluated; RESULTS: Irrespective of to the experimental condition, the leachates were mainly utilized for catabolic processes (i.e., respiration, mineralization was slightly faster in an aerobic environment (1.22 fold and in this condition, the yield of refractory products was smaller (2.3%; the O/C stoichiometric ratios values (oxygen consumed per atom of carbon from mineralization of the 2 types of leachates were similar (ca. 1.12; CONCLUSIONS: According to these results we conclude that the leachate from selected macrophytes is rapidly decomposed and subsidize primariy the microbial catabolism (aerobic or anaerobic; in addition, we propose that S. molesta contributes more to the input of dissolved organic matter within the reservoir.OBJETIVO: Nesse estudo foram descritas as mineralizações (aeróbias e anaeróbias dos lixiviados de 2 espécies de macrófitas aquáticas (Salvinia molesta e Myriophyllum aquaticum que ocorrem em um reservatório tropical (22° 00' S e 47° 54' O; MÉTODOS: As incubações, preparadas com os lixiviados das plantas e amostra de água do reservatório, foram mantidas no escuro e a 20 °C, por 45 dias. Foram avaliadas as cinéticas de perda de massa do carbono orgânico e de consumo de oxigênio; RESULTADOS: Independente da condição experimental, os lixiviados foram principalmente utilizados na respiração; as mineralizações foram ligeiramente mais rápidas em meio aeróbio (1,22 vezes e nessa condição, os rendimentos dos produtos refratários foram menores (2,3%; as

  15. Exercício aeróbico, treinamento de força muscular e testes de aptidão física para adolescentes com fibrose cística: revisão da literatura Exercise testing, aerobic and strength training for adolescents with cystic fibrosis: a literature review

    OpenAIRE

    Celia Regina Moutinho de Miranda Chaves; Cristiano Queiroz de Oliveira; José Augusto Alves de Britto; Maria Ignez Capella Gaspar Elsas

    2007-01-01

    São reconhecidos os benefícios da prática do exercício físico regular para pacientes com fibrose cística. Entretanto, poucos estudos envolvem pacientes adolescentes. O objetivo deste artigo foi revisar os efeitos da prática regular de exercícios aeróbicos e de força e resistência muscular para adolescentes com fibrose cística. Os principais testes de aptidão física para esta faixa etária e a importância deles para melhora do prognóstico e tratamento da doença também foram avaliados. As inform...

  16. O efeito de um programa de exercício físico aeróbio combinado com exercícios de resistência muscular localizada na melhora da circulação sistêmica e local: um estudo de caso El efecto de un programa de ejercício físico aeróbico combinado con los ejercicios de resistencia muscular localizada en la mejora de la circulacion sistemica y local. Estudio de un caso The effect of a program of combined aerobic physical exercise with exercises of localized muscular resistance in the improvement of systemic and local circulation: a case study

    Directory of Open Access Journals (Sweden)

    Ricardo Bosco

    2004-02-01

    Full Text Available INTRODUÇÃO: A trombofilia, estado que predispõe à ocorrência de trombose, decorre da existência de alterações da hemostasia, podendo ser congênita ou adquirida. A deficiência de proteína S, que ocorre pela falta do co-fator para a proteína C, é uma alteração congênita que pode resultar em trombofilia. A reabilitação física, considerada uma terapêutica eficaz, tem seu papel definido na prevenção e tratamento de doenças cardiovasculares. OBJETIVO: Este estudo se propôs a verificar a influência do exercício físico aeróbio associado aos exercícios de resistência muscular localizada na circulação sistêmica e colateral do membro superior e inferior direito e na redução das conseqüências causadas pelas retrações decorrentes das cirurgias. MATERIAL E MÉTODO: A amostra foi composta por uma paciente do sexo feminino, 19 anos, portadora da síndrome de hipercoagulabilidade (trombofilia congênita por deficiência da proteína S, com obstrução total na artéria axilar direita e parcial na artéria femoral superficial direita. O programa de exercícios foi dividido em duas fases. Fase I: Atividades para aumento da amplitude de movimentos, em que se realizavam aplicação de calor, alongamentos passivos manuais mantidos, drenagem linfática e manipulações Effleurage. Fase II: Constituída de exercício aeróbio (45 minutos de caminhada, três vezes por semana, intensidade de 60% a 85% da freqüência cardíaca máxima e exercícios de resistência muscular localizada (contrações dinâmicas, três séries com o máximo de repetições possíveis, baixa intensidade, favorecendo fatores aeróbios. RESULTADOS: 1. Melhora da circulação colateral à artéria axilar, constatada pelo aumento na velocidade de pulso sistólico (verificado através do exame doppler pulsado - na artéria radial, passou de 3,4cm/s para 16,8cm/s; na artéria braquial, de 8,7cm/s para 45,9cm/s. 2. Melhor tolerância ao exercício aeróbio. 3

  17. Efeitos do treinamento de corrida em diferentes intensidades sobre a capacidade aeróbia e produção de lactato pelo músculo de ratos Wistar Running training effects in different intensities on the aerobic capacity and lactate production by the muscle of Wistar rats

    Directory of Open Access Journals (Sweden)

    Michel Barbosa de Araújo

    2009-10-01

    Full Text Available São raros os estudos que associam indicadores de capacidade aeróbia e os substratos produzidos pelo metabolismo muscular em ratos. Dessa forma, o objetivo do presente estudo foi verificar o efeito do treinamento de corrida em duas diferentes intensidades sobre a capacidade aeróbia e a produção de lactato pelo músculo sóleo isolado de ratos. Ratos Wistar (90 dias tiveram a transição metabólica aeróbio-anaeróbia determinada pelo teste de máxima fase estável de lactato (MFEL. Em seguida, os ratos foram treinados 40 minutos/dia, cinco dias/semana, na velocidade equivalente à MFEL (TT ou 5% superior a essa (TS, por oito semanas. Como controles foram usados ratos mantidos sedentários (S. Ao final, todos os animais foram sacrificados para análise da produção de lactato pelo músculo sóleo isolado. No inicio do experimento, a maior parte dos animais obteve a MFEL na velocidade de 25m/min à concentração de 4,38 ± 0,22mmol/L sanguínea de lactato. Ao final do experimento, a maior parte dos ratos treinados na TT apresentou MFEL na velocidade de 25m/min, à concentração sanguínea de lactato 3,10 ± 0,27mmol/L. A maioria dos treinados TS teve MFEL na velocidade de 25m/min à concentração sanguínea de lactado de 3,36 ± 0,62mmol/L. Os sedentários mostraram a MFEL na velocidade de 20m/min à concentração sanguínea de lactato de 4,83 ± 0,67mmol/L. A produção de lactato (μmol/g.h pelo músculo sóleo isolado foi menor no grupo TS (3,83 ± 0,62 do que nos demais (S 4,31 ± 0,58 e TT 4,71 ± 0,39. A partir dos resultados obtidos no presente estudo, pode-se concluir que o treinamento aeróbio evitou a deterioração do condicionamento aeróbio imposta pelo avanço da idade e que o treinamento físico na intensidade superior à MFEL reduziu a produção muscular de lactato.There are few studies that associate indicators of aerobic capacity and the substrates produced by the muscular metabolism in rats. The aim of the present

  18. Changes in some hematologic variables in a group of women older tan 55 years, after a program of aerobic training Cambios en algunas variables hematológicas, en un grupo de mujeres mayores de 55 años, luego de un programa de entrenamiento aeróbico

    Directory of Open Access Journals (Sweden)

    Diana Patricia Díaz Hernández

    2003-03-01

    Full Text Available Objective: to evaluate changes in some hematologic variables after a four-month program of aerobic physical activity, in a group of healthy women, older than 55 years. Methods: 14 healthy sedentary women, older than 55 years were studied; they participated in a program of aerobic physical activity, three times per week, during four months, with an intensity between 60-85% of the maximal heart rate and with 60 minutes of duration per session. Before and after the program blood specimens were obtained to evaluate changes of hemoglobin, hematocrite, red blood cells count, average corpuscular volume, average corpuscular hemoglobin, and average concentration of corpuscular hemoglobin; by means of a maximal test in treadmill the maximal oxygen uptake (VO2max was determined. Results: significant increase was found in hemoglobin (p<0.01, hematocrite (p<0.001, average corpuscular volume (p<0.001, average corpuscular hemoglobin (p<0.01 and VO2max (p<0.05. There were no changes in red blood cell count and average concentration of corpuscular hemoglobin. Conclusion: in the studied group, a program of regular physical activity, with an intensity between 60-85% of the maximal heart rate, increased hemoglobin and hematocrite. This results suggest that aerobic training increases the transport of oxygen to tissues. Objetivo: determinar los cambios en algunas variables hematológicas luego de un programa de actividad física aeróbica, por un período de cuatro meses, en un grupo de mujeres sedentarias sanas mayores de 55 años. Método: se estudiaron 14 mujeres mayores de 55 años, sedentarias, sanas, a quienes se les realizó un programa de actividad física aeróbica tres días a la semana, durante cuatro meses consecutivos, con una intensidad entre el 60 y el 85% de la FCmax y una duración de 60 minutos. Antes y después del programa de actividad física se obtuvieron muestras de sangre para evaluar el comportamiento de la hemoglobina (Hb, el hematocrito

  19. Fermentation, losses, and aerobic stability of sugarcane silages treated with chemical or bacterial additives Fermentação, perdas e estabilidade aeróbia de silagens de cana-de-açúcar tratadas com aditivos químicos ou bacterianos

    Directory of Open Access Journals (Sweden)

    André de Faria Pedroso

    2008-12-01

    Full Text Available Utilization of sugarcane Saccharum officinarum L. silage is increasing in Brazil but intensive ethanol production during fermentation reduces forage quality. This experiment aimed to evaluate the effects of additives on fermentation and aerobic stability of sugarcane silages produced in minisilos. Treatments were (fresh basis: untreated silage (control, urea (5.0 g kg-1, sodium benzoate (1.0 g kg-1, potassium sorbate (0.3 g kg-1, Lactobacillus plantarum (1 x 10(6 cfu g-1, and Lactobacillus buchneri (3.64 x 10(5 cfu g-1. At the 94th day after ensilage, ethanol concentration was lower in urea, benzoate, sorbate and L. buchneri supplemented silages and higher in L. plantarum inoculated silage, as compared to control. Urea and benzoate treated silages showed the highest and L. plantarum treated silage the lowest in vitro dry matter digestibility. Effluent production was higher in the urea treated silage. Inoculation with L. buchneri reduced 50% ethanol production as compared to control. Urea and L. buchneri reduced yeast count. Aerobic stability was enhanced by L. buchneri and benzoate. Sodium benzoate and L. buchneri were the most promising additives, improving both silage fermentation and aerobic stability; inoculants containing L. plantarum can be deleterious to fermentation and conservation of sugarcane silages.A utilização de silagem de cana-de-açúcar (Saccharum officinarum L. está aumentando no Brasil, mas a intensa produção de etanol durante a fermentação reduz a qualidade da forragem. Este experimento visou avaliar os efeitos de aditivos na fermentação e estabilidade aeróbia de silagens de cana-de-açúcar produzidas em minisilos. Os tratamentos foram (base matéria verde: silagem sem tratamento (controle, uréia (5,0 g kg-1, benzoato de sódio (1,0 g kg-1, sorbato de potássio (0,3 g kg-1, Lactobacillus plantarum (1 x 10(6 ufc g-1 e Lactobacillus buchneri (3,64 x 10(5 ufc g-1. Aos 94 dias após a ensilagem, a concentração de

  20. Efeito do treinamento físico de membros superiores aeróbio de curta duração no deficiente físico com hipertensão leve The effect of short term Aerobic physical training using upper limbs in paraplegic persons with mild to moderate hypertension

    Directory of Open Access Journals (Sweden)

    Sandra Haddad

    1997-09-01

    Full Text Available OBJETIVO: Verificar as alterações provocadas pelo treinamento físico (TF, com membros superiores (MMSS, em condição aeróbia de curta duração, sobre variáveis dos sistemas cardiovascular e metabólico. MÉTODOS: Foram estudados 11 deficientes físicos (DF paraplégicos, com média de idade de 59 anos, sendo 7 homens e 4 mulheres, com lesão de T9 a T11 e grau leve de hipertensão arterial sistêmica (HAS. Os DF foram avaliados antes e após 12 semanas de um programa de TF supervisionado de MMSS, por meio de teste ergométrico (TE em cicloergômetro mecânico adaptado para MMSS, utilizando-se protocolo intermitente com incremento de carga de 125kgm/min (20w para mulheres e 140kgm/min (25w para homens a cada 3min., em velocidade que variou de 83 a 95rpm. O consumo de oxigênio (VO2 foi calculado de acordo com a equação para MMSS do American College of Sports Medicine. A intensidade do exercício durante o programa de TF foi estabelecida pela reserva de freqüência cardíaca (RFC de Karvonen, com variação de 65% a 85% e escala de percepção subjetiva ao esforço de Borg obtida pelo TE. RESULTADOS: A capacidade aeróbia máxima estimada aumentou 22% (930±349 vs 1138±290mL/min; p=0,003; a pressão arterial sistólica (PAS e diastólica (PAD em repouso e no exercício submáximo diminuíram em 4%, 15% e 5%, 5%, respectivamente. CONCLUSÃO: O TF aeróbio de intensidade leve a moderada com MMSS, além de melhorar a aptidão funcional exerce também papel importante como modelo terapêutico não medicamentoso na resposta hipertensiva observada em DF paraplégicos.PURPOSE: To study the modifications induced by physical training (PT using upper limbs in aerobic condition of short duration on cardiovascular and metabolic variables. METHODS: Eleven paraplegic persons, with a mean age of 59 years, 7 men and 4 women with lesions at T9 through T11 and mild hypertension (HAS were studied. The patients were studied before and after 12 weeks of a

  1. Benefícios do treinamento aeróbio e/ou resistido em indivíduos HIV+: uma revisão sistemática Benefits of aerobic and/or resistance training in HIV-positive patients: a systematic review

    Directory of Open Access Journals (Sweden)

    Hugo Fábio Souza

    2009-12-01

    Full Text Available A aids é uma doença crônica, caracterizada pela depleção dos linfócitos T, sendo o vírus HIV o seu agente causador. A sua infecção e tratamento farmacológico estão ligados às alterações físicas e fisiológicas, que podem diminuir a qualidade de vida. Sendo assim, o objetivo do estudo foi elaborar uma revisão sistemática sobre os estudos publicados no PubMed e Capes entre 1998 e 2008, com humanos soropositivos e que investigaram os impactos do treinamento aeróbio e/ou resistido nos aspectos fisiológicos, metabólicos, psicológicos, imunológicos e físicos. Foram discutidos protocolos que utilizaram apenas treinamento de força ou aeróbio e os que utilizaram ambos e a grande maioria encontrou resultados favoráveis às variáveis pesquisadas. Quanto ao modelo de prescrição para essa população, este deve ser composto por exercícios de força, de oito a 15 repetições máximas (trabalho de hipertrofia e por exercícios aeróbios (contínuo ou intervalado, com duração de 20 a 60 minutos e intensidade variando de 50 a 85% da frequência cardíaca máxima ou 45-85% do consumo máximo de oxigênio, ambos três a cinco vezes por semana. Dessa forma, ao elaborar um programa de atividade física, é importante conhecer a atual condição física e fisiológica do indivíduo HIV+, para que a sua condição de esforço não seja superestimada ou subestimada.AIDS is considered a chronic disease, characterized for depletion of the lymphocyte T CD4+, caused by the HIV virus. The HIV infection and its pharmacological treatment are linked to physiological and physical disorders, which can induce to lower quality of life. Therefore, the purpose of this work was to elaborate a systematic review about studies published in Pubmed and Capes between 1998 and 2008, which investigated physiological, metabolic, psychological and immunological changes mediated by aerobic and strength training in seropositive individuals. Protocols which only

  2. Efeitos do estado e especificidade do treinamento aeróbio na relação %VO2max versus %FCmax durante o ciclismo Effects of the state and specificity of aerobic training on the %VO2max versus %HRmax ratio during cycling

    Directory of Open Access Journals (Sweden)

    Fabrizio Caputo

    2005-01-01

    Full Text Available OBJETIVO: Determinar os efeitos do estado e especificidade de treinamento aeróbio na relação entre o percentual do consumo máximo de oxigênio (%VO2max e o percentual da frequência cardíaca máxima (%FCmax durante o exercício incremental realizado no cicloergômetro. MÉTODOS: Sete corredores, 9 ciclistas, 11 triatletas e 12 sedentários, todos do sexo masculino e aparentemente saudáveis, foram submetidos a um teste incremental até a exaustão no cicloergômetro. Regressões lineares entre %VO2max e %FCmax foram determinadas para cada indivíduo. Com base nessas regressões, foram calculados %FCmax correspondentes a determinados %VO2max (50, 60, 70, 80 e 90% de cada participante. RESULTADOS: Não foram encontradas diferenças significantes entre todos os grupos nos %FCmax para cada um dos %VO2max avaliados. Analisando-se os voluntários como um único grupo, as médias dos %FCmax correspondentes a 50, 60, 70, 80 e 90% %VO2max foram 67, 73, 80, 87, e 93%, respectivamente. CONCLUSÃO: Nos grupos analisados, a relação entre o %VO2max e %FCmax durante o exercício incremental no ciclismo não é dependente do estado e especificidade do treinamento aeróbio.OBJECTIVE: To determine the effects of the status and specificity of exercise training in the ratio between maximum oxygen consumption (%VO2max and the percentage of maximal heart rate (%HRmax during incremental exercise on a cycle ergometer. METHODS: Seven runners, 9 cyclists, 11 triathletes, and 12 sedentary individuals, all male and apparently healthy, underwent exhaustive incremental exercise on cycle ergometers. Linear regressions between %VO2max x %HRmax were determined for each individual. Based on these regressions, %HRmax was assessed corresponding to a determined %VO2max (50, 60, 70, 80, and 90% from each participant. RESULTS: Significant differences were not found between the groups in %HRmax for each of the %VO2max assessed. Analyzing the volunteers as a single group, the

  3. Estabilidade aeróbia da ração total e de silagens de capim-marandu tratadas com aditivos químicos e bacterianos Aerobic stability of total mixed ration and marandugrass silage using microbial or chemical additive

    Directory of Open Access Journals (Sweden)

    Thiago Fernandes Bernardes

    2007-08-01

    Full Text Available Esta pesquisa foi realizada com o objetivo de determinar o efeito da inclusão de aditivo químico e da inoculação de bactérias homo e heterofermentativas sobre a estabilidade aeróbia de silagens de capim-marandu e da ração total. Foram conduzidos três experimentos para avaliação do benzoato de sódio e de dois inoculantes, um contendo Lactobacillus plantarum + Propionibacterium e o segundo Lactobacillus buchneri. Após 60 dias de fermentação, os silos foram abertos e as silagens e a ração total (RT contendo silagens de capim-marandu foram colocadas em caixas de isopor e transferidas para câmara climática, a 25 ± 1ºC, para determinação das variações de temperatura na ração total e na silagem, das recuperações de MS e das alterações no pH da silagem. O delineamento experimental foi o inteiramente casualizado, em esquema de parcelas subdivididas. Houve perdas de MS e elevação dos teores de pH quando as silagens foram colocadas em condições de aerobiose. A temperatura das silagens e da RT teve discreto aumento durante os seis dias de aeração. O uso de bactérias ou de benzoato de sódio não influenciou a estabilidade aeróbia das silagens.This research evaluated the inclusion of chemical additive and the inoculation with homo and heterofermentative bacteria on the aerobic stability of the Marandu grass silages and on the total mixed ration (TMR. It was conducted three experiments to evaluate sodium benzoate and two inoculants: 1. Lactobacillus plantarum + Propionibacterium and; 2. Lactobacillus buchneri. The silos were opened after 60 days of fermentation; the silages and the TMR containing the silages were placed in a polystyrene box, and transferred to a climatic chamber kept at 25 ± 1ºC to determine the temperature changes, dry matter recovery, and pH values. The data were analyzed according to a complete randomized design, in a split plot arrangement. The silages showed DM losses and increasing pH during the

  4. Efeito do exercício aeróbio e resistido no perfil antropométrico e respostas cardiovasculares de idosos portadores de hipertensão = Aerobic exercise and resistance effect on the anthropometric profile and cardiovascular responses in elderly people with high blood pressure

    Directory of Open Access Journals (Sweden)

    Kleverton Krinski

    2006-01-01

    Full Text Available O presente estudo teve por objetivo analisar os efeitos do exercício aeróbio e resistido no perfil antropométrico e respostas cardiovasculares de idosos portadores de hipertensão arterial (HA. A amostra foi composta de 53 voluntários de ambos os sexos, todos sedentários, com idade de 64,28±4,7 anos, cor branca, portadores de HA. Foram analisados os níveis de pressão arterial (PA, freqüência cardíaca (FC peso corporal (Kg, IMC e percentual de gordura corporal (%GC, antes, durante e após seis meses de exercícios. O protocolo de treinamento foi composto por uma sessão de exercícios, dividida em 20 minutos de atividade aeróbia e 40 minutos de exercícios resistidos dinâmicos, com freqüência semanal de três vezes e duração de seis meses. Como principais resultados apresentaram-se diferenças significativas em relação ao %GC, acompanhado de umaredução linear na pressão arterial média (PAM e FC, indicando uma melhora em importantes parâmetros morfofuncionais.The present study aimed to analyze the aerobic and resistance exercise effects on the anthropometric profile and cardiovascular responses in elderly people with High Blood Pressure (HBP. The sample consisted of 53 volunteers of both genders who were allsedentary, at the age of 64.28±4.7 years old, fair skin, with HBP. The blood pressure levels, cardiac frequency (CF, body weight (Kg, BMI and body fat percentage (BF% were analyzed before, during and after the period of exercises. The training protocol consisted ofexercise sessions divided into 20 minutes of aerobic activity and 40 minutes of dynamic resistance exercises, three times a week, during a period of six months. Results showed a significant difference in relation to the BF%, followed by a linear reduction in the AverageBlood Pressure (ABP and CF, as well as an improvement in important morphofunctional parameters.

  5. Composição química e estabilidade aeróbia em silagens de milho preparadas com inoculantes bacteriano e/ou enzimático = Chemical composition and aerobic stability of corn silages made with bacterials and/or enzymatic inoculants

    Directory of Open Access Journals (Sweden)

    Agda Luzia de Godoy Gimenes

    2006-04-01

    Full Text Available Este trabalho avaliou o efeito de inoculantes bacterianos e/ou enzimáticos na composição química e na estabilidade aeróbia da silagem de milho confeccionada em minisilos. Os tratamentos foram: SC (silagem controle, SIB (silagem com inoculante bacteriano, SIBE (silagem com inoculante bacteriano e enzimático e SIE (silagem com inoculante enzimático. A adição de inoculante não alterou os teores de matéria orgânica (87,43%, proteína bruta (7,99%, fibra em detergente neutro (55,43% e fibra em detergente ácido (27,67%. Os tratamentos SIE e SC apresentaram, na abertura, o menor (3,28 e maior (3,42 pH, e, após o período de exposição ao ar, o menor (3,87 e maior (6,64 pH, respectivamente. O uso de inoculantes não influenciou os teores de N-amoniacal das silagens. Os tratamentoscom inoculantes apresentaram menor pico de temperatura, maior tempo para atingir o pico de temperatura e maior estabilidade aeróbia.This work evaluated the effect of bacterial and/or enzymatic inoculants on chemical composition and aerobic stability in corn silage, made in mini-silos. The treatments were: CS (control silage, SBI (silage with bacterial inoculant, SBEI (silage with bacterial and enzymatic inoculant and SEI (silage with enzymatic inoculant. The use of inoculants did not affect the organic matter (87,43%, crude protein (7,99%, neutral detergent fiber (55,43% and acid detergent fiber (27,67% contents. The SEI and CS treatments showed the lowest (3,28 and the highest (3,42 pH values in the beginningand after an air exposure period, showed again the lowest (3,87 and the highest (6,64 pH values, respectively. The inoculants used did not affect N-amonniacal contents of the silages. The treatments with inoculants presented the lowest temperature peak, more time to reach this temperature and the highest aerobics stability.

  6. Exercício aeróbico, treinamento de força muscular e testes de aptidão física para adolescentes com fibrose cística: revisão da literatura Exercise testing, aerobic and strength training for adolescents with cystic fibrosis: a literature review

    Directory of Open Access Journals (Sweden)

    Celia Regina Moutinho de Miranda Chaves

    2007-09-01

    Full Text Available São reconhecidos os benefícios da prática do exercício físico regular para pacientes com fibrose cística. Entretanto, poucos estudos envolvem pacientes adolescentes. O objetivo deste artigo foi revisar os efeitos da prática regular de exercícios aeróbicos e de força e resistência muscular para adolescentes com fibrose cística. Os principais testes de aptidão física para esta faixa etária e a importância deles para melhora do prognóstico e tratamento da doença também foram avaliados. As informações foram coletadas a partir de livro-texto e artigos publicados na literatura nacional e estrangeira nas seguintes bases de dados: LILACS, MEDLINE/PubMed, Biblioteca Cochrane e SciELO, abrangendo o período de 1994 a 2004. Foram utilizados os termos "exercise" e "cystic fibrosis" para seleção dos artigos. Esta pesquisa demonstrou que a prática de exercício aeróbico e treinamento de força muscular melhoram a desobstrução da árvore brônquica, diminuem a queda progressiva da função pulmonar, aumentam a massa muscular e a resistência ao exercício, promovem o desenvolvimento ósseo e melhoram a auto-estima e a qualidade de vida. Os melhores resultados foram obtidos com os programas de treinamento assistido, devido a sua maior regularidade.The benefits of regular physical exercises for cystic fibrosis patients are well known. Nevertheless, few studies involve adolescent patients. The objective of this article was to review the effects of regular practice of aerobic exercises, strength exercises and muscular exercises in adolescents with cystic fibrosis. The main physical fitness tests for this age bracket and their value in improving prognosis and treatment were assessed as well. Information was collected from text books and articles published in the national and foreign literature in the following databases: LILACS, MEDLINE/PubMed, Cochrane Library and SciELO, comprising the period of 1994 to 2004. The terms "exercise" and

  7. Efeito da atividade física associada à orientação alimentar em adolescentes obesos: comparação entre o exercício aeróbio e anaeróbio Efecto de la actividad física asociada a la orientación alimentar en adolescentes obesos: comparación entre el ejercicio aeróbico y anaeróbico Effect of physical activity associated with nutritional orientation for obese adolescents: comparison between aerobic and anaerobic exercise

    Directory of Open Access Journals (Sweden)

    Renata Viccari Sabia

    2004-10-01

    Full Text Available A obesidade na adolescência é uma doença universal de prevalência mundial crescente, assumindo caráter epidemiológico como problema de saúde pública na sociedade moderna. Este trabalho teve como objetivo comparar o efeito do exercício físico aeróbio contínuo e anaeróbio intermitente associado à orientação alimentar sobre a composição corporal, as medidas bioquímicas e a capacidade física de adolescentes obesos. Foram investigados 28 adolescentes (média de idade = 13 anos, com índice de massa corporal (IMC acima do percentil 95 para a idade e sexo, distribuídos em dois grupos de forma aleatória: exercício de caminhada contínua (GEC; n = 13 e exercício de corrida intermitente (GEI; n = 15 e submetidos a um programa de treinamento físico três vezes por semana durante 16 semanas por 20 a 40 minutos. A atividade de orientação nutricional ocorreu uma vez por semana, em grupo, por 60 minutos, durante todo o experimento. Foram realizadas, no período inicial e final, medidas de peso e altura, pregas subcutâneas, circunferências do braço (CB e muscular do braço (CMB, composição corporal por bioimpedância elétrica, análises bioquímicas séricas (glicemia e lipídios e determinação direta de consumo máximo de oxigênio (VO2max e limiar anaeróbio (LAn. Como resultados antropométricos, observamos diminuição do IMC e das pregas cutâneas com diferença significativa nos dois grupos (GEC e GEI. Na avaliação bioquímica, houve diminuição significativa nos níveis séricos de HDL e LDL, colesterol total, e aumento do triglicérides e glicemia no GEC, embora mantendo-se dentro dos valores de normalidade. No GEI, o HDL e triglicérides tiveram diminuição significativa. O VO2max aumentou estatisticamente nos dois grupos. Concluímos que a atividade física proposta e a orientação alimentar, tanto para o GEC quanto para GEI, foi suficiente e satisfatória, promovendo diminuição ponderal, melhora da composi

  8. Comparação entre os métodos rápidos SimplateR TPC- CI e PetrifilmR AC e os métodos convencionais de contagem em placas para a enumeração de aeróbios mesófilos em sorvetes Comparasion of SimplateR test and Petrifilm with plate count agar method for detection and enumeration of bacteria in ice cream

    OpenAIRE

    Anderson de Souza Sant'ana; Caetano da Conceição; Denise Rosane Perdomo Azeredo

    2002-01-01

    A contagem de aeróbios mesófilos ou contagem padrão em placas em um produto alimentício reflete a qualidade da matéria-prima, bem como as condições de processamento, manuseio e estocagem. O método de contagem em placas tradicionais requer 48h de incubação para a posterior leitura dos resultados. Comparou-se dois métodos que parecem ser uma boa alternativa para a contagem padrão em placas: SimplateR TPC-CI e PetrifilmR AC. Também avaliou-se a capacidade inibitória do 2, 3, 5 cloreto de trifeni...

  9. Treinamento aeróbio em natação melhora a resposta de parâmetros metabólicos de ratos durante teste de esforço Aerobic swimming training improves metabolic parameters response during exertion test in rats

    Directory of Open Access Journals (Sweden)

    Juliana Silveira Freitas

    2010-04-01

    Full Text Available Foram investigados os efeitos do treinamento aeróbio em natação com baixa intensidade sobre as respostas do lactato e da glicose sanguíneos de ratos durante teste de esforço. Ratos Wistar adultos foram distribuídos aleatoriamente em dois grupos: sedentário (n = 6 e treinado (n = 6. Todos receberam água e ração ad libitum e foram mantidos em ambiente com temperatura de 22 ± 2ºC e ciclo claro/escuro de 12 horas. O grupo treinado foi submetido a um programa de natação contínua sem sobrecarga, 30 min/dia, cinco dias/semana, por seis semanas. Três dias após a última sessão de treino, as concentrações sanguíneas de lactato e glicose foram medidas em três momentos durante dois testes de esforço de 20 minutos (repouso, 10 min e 20 min, sendo um sem carga e outro com carga (5% do peso corporal, separados por dois dias. Observou-se correlação inversa entre lactato e glicose durante o exercício (ρ = - 0,74; P 0,05. Conclui-se que o treinamento aeróbio em natação aplicado foi capaz de alterar as respostas do lactato e glicose sanguíneos de ratos durante os testes de esforço.The effects of low intensity aerobic swimming training on blood lactate and glucose responses in rats were investigated during exertion test. Twelve adult male Wistar rats were randomly divided into two groups: sedentary (n= 6 and trained (n= 6. All animals received water and food ad libitum and were kept in a room with temperature of 22 ± 2ºC and dark/light cycle of 12 hours. Animals from trained group were submitted to a swimming training protocol of 30 min/day, 5 days/week, for 6 weeks. Sedentary animals did not exercise. Three days after the last training session all animals were submitted to two 20-minute swimming tests with 48 hour-interval, being one unloaded and the other with a load of 5 % of body weight. Blood lactate and glucose were measured at rest, 10 min and 20 min of exercise. Negative correlation between blood lactate and glucose levels

  10. Efeitos do exercício aeróbico e anaeróbico em variáveis de risco cardíaco em adultos com sobrepeso Effects of aerobic and anaerobic exercise on cardiac risk variables in overweight adults

    Directory of Open Access Journals (Sweden)

    Mônica Medeiros Moreira

    2008-10-01

    Full Text Available FUNDAMENTO: O exercício físico aeróbico é importante aliado no combate aos fatores de risco cardiovascular. No entanto, os efeitos de exercícios de alta intensidade sobre tais fatores ainda são pouco conhecidos. OBJETIVO: Comparar os efeitos de protocolos de exercícios aeróbico e anaeróbico sobre fatores associados ao risco cardíaco. MÉTODOS: Vinte e dois indivíduos com idade média de 40±8 anos foram alocados nos grupos: controle (CO, treinamento de endurance (ET e treinamento intermitente (IT. Os protocolos tiveram duração de 12 semanas, três vezes por semana; e intensidades de 10% abaixo e 20% acima do limiar anaeróbico (LAn. Foram medidas: massa corporal total (MCT, índice de massa corporal (IMC, circunferências de cintura (CINT e quadril (QUA e a composição corporal, além das concentrações plasmáticas de glicose (GLI, colesterol total (CHO e triglicérides (TG; ainda foram calculados a razão cintura-quadril (PCCQ e o índice de conicidade (Índice C. RESULTADOS: As variáveis de MCT, IMC, CINT, GLI e a composição corporal apresentaram alterações significativas nos grupos ET e IT. Os valores de CHO e QUA foram significativamente reduzidos no grupo ET, enquanto a PCCQ mostrou redução significativa no grupo IT. O LAn e o índice C, no grupo IT foram significativamente diferentes em relação a ET. CONCLUSÃO: Tendo em vista as diferenças encontradas nas respostas das variáveis estudadas, em razão do treinamento empregado, concluímos que um programa de exercício que contemple atividades de alta e baixa intensidades seja mais completo para garantir a redução de maior número de variáveis de risco cardíaco.BACKGROUND: Aerobic exercise is an important ally in the fight against cardiovascular risk factors. However, the effects of high-intensity exercise on these factors are still poorly known. OBJECTIVE: To compare the effects of aerobic and anaerobic exercise protocols on cardiac risk factors. METHODS: 22

  11. Tratamento de águas residuárias de suinocultura em reatores anaeróbios horizontais seguidos de reator aeróbio em batelada sequencial Swine waste water treatment in horizontal anaerobic reactor followed by aerobic sequencing batch reactor

    Directory of Open Access Journals (Sweden)

    Ariane C. dos Santos

    2011-01-01

    Full Text Available Avaliou-se o desempenho de um sistema combinado anaeróbio-aeróbio para o tratamento de águas residuárias de suinocultura, com concentrações médias de sólidos suspensos totais (SST de 18.624 e 11.395 mg L-1. Foram utilizados quatro reatores anaeróbios horizontais com volume total de 49,5 L cada, um com manta de lodo (RAHML e três de leito fixo (RAHLF, instalados em série e seguidos de um reator aeróbio operado em batelada sequencial (RBS com volume total de 339 L e com alimentação contínua. Nos RAHLF, foram utilizados como meios suporte de anéis de bambu, anéis plásticos de eletroduto corrugado e anéis de bucha (Luffa cillyndrica, respectivamente. Os tempos de detenção hidráulica (TDH e as cargas orgânicas volumétricas (COV aplicadas no RAHML foram de 12 e 10 h e 53 e 61 g DQO (L d-1, respectivamente. O RBS foi operado com ciclo de 24 h e COV de 0,34 e 0,50 g DQO (L d-1. As eficiências médias de remoção de DQOtotal e SST para o conjunto de reatores anaeróbios horizontais, em série, foram de 96 e 99%, e de 96 e 95%, respectivamente. As maiores produções volumétricas de metano ocorreram nos RAHLF, com valores médios de até 0,744 m³ CH4 (m³ reator d-1. A inclusão do RBS permitiu melhorar a qualidade do efluente e a estabilidade do sistema de tratamento, atingindo eficiências de remoção de DQOtotal e SST de 99 e 99%, e de 98 e 99%, respectivamente. No RBS, ocorreu nitrificação e desnitrificação, com remoções de N-amoniacal de até 65%.An anaerobic-aerobic combined system was evaluated to treat swine wastewater with an average total suspended solids (TSS concentration of 18,624 to 11,395 mg L-1. The anaerobic treatment system was constituted by four horizontal reactors each one having a total volume of 49.5 L, one with sludge blanket (HASBR and tree with fixed film (HAFFR installed in series, followed by an aerobic sequential batch reactor (SBR with continue feeding, with total volume of 339 L. In the

  12. A relação entre o nível de condicionamento aeróbico, execução de uma pista de obstáculos e o rendimento em um teste de tiro La relación entre el nivel de acondicionamiento aeróbico, ejecución de una pista de obstáculos y el rendimiento en un test de tiro Relationship between the level of the aerobic conditioning, performance on an obstacle course, and outcome in a shooting test

    Directory of Open Access Journals (Sweden)

    Adriano da Costa Dias

    2005-12-01

    Full Text Available A preparação do militar para o combate é baseada na instrução militar que tem como fundamento a representação do campo de batalha. Entre as principais instruções estão a pista de obstáculos e a execução do tiro. O objetivo deste estudo foi verificar a influência do nível de condicionamento aeróbico sobre o rendimento na execução de uma pista de obstáculos e a realização de um teste de tiro em integrantes do Exército Brasileiro. Procurou-se, também, verificar a influência da execução de uma pista de obstáculos sobre a execução de um teste de tiro. O citado rendimento foi avaliado pelo tempo de execução de uma pista de obstáculos e resultado no teste de tiro (considerou-se a diferença entre o resultado do tiro pós e pré-esforço como índice de performance no tiro IPT. A amostra foi constituída de 28 militares homens, de 19 a 20 anos de idade. Inicialmente foi estimado o VO2máx dos indivíduos por meio do teste de Léger-Boucher. Posteriormente os militares da amostra executaram um teste de tiro, uma pista de obstáculos e, novamente, um teste de tiro. Verificou-se uma diferença significativa entre o tiro pré-esforço e pós-esforço (43,79 ± 4,02 para 40,54 ± 4,10 pontos, p La preparación del ejército para combate esta basado en la instrucción militar que el soldado tiene como fundamento en la representación del campo de batalla. Entre las instrucciones principales ellos son la pista de obstáculos y la ejecución del tiro. El objetivo de este estudio es el de verificar la influencia del nivel de acondicionamiento de ejercicio aeróbico en el ingreso en la ejecución de una pista de obstáculos y el logro de una prueba del tiro en los miembros del Ejército brasileño. Se buscaba además, verificar la influencia de la ejecución de una pista de obstáculos en la ejecución de una prueba del tiro. El estudio mencionado fue evaluado cuando se realizaron pruebas de ejecución de una pista de obstáculos y

  13. Aerobic bacterial microflora of Broad-snouted caiman (Caiman latirostris oral cavity and cloaca, originating from Parque Zoológico Arruda Câmara, Paraíba, Brazil Microflora bacteriana aeróbica da cavidade oral e cloaca de jacaré-de-papo-amarelo (Caiman latirostris procedentes do Zoológico de João Pessoa, PB, Brasil

    Directory of Open Access Journals (Sweden)

    J.S.A. Silva

    2009-03-01

    Full Text Available The objective of this study was to isolate and identify the aerobic bacterial microflora from the oral cavity mucosa and cloaca's samples, collected from Broad-snouted caiman (Caiman latirostris, born and bred in captivity at Parque Zoológico Arruda Câmara, João Pessoa, Paraíba, Brazil. The most common bacteria were Staphylococcus sp. (14.74%, Corynebacterium sp. (13.68%, Escherichia coli (13.68% and Shigella sp. (11.58%, and the less common were Citrobacter sp. (1.05%, Klebsiella pneumoniae (1.05% and Salmonella sp. (1.05%.This emphasizes the importance of these microorganisms' participation in infectious processes (sepsis and injuries caused by crocodilians.O presente estudo teve como objetivo isolar e identificar a microflora bacteriana aeróbica presente na mucosa da cavidade oral e da cloaca de exemplares de jacarés-de-papo-amarelo (Caiman latirostris nascidos e criados em cativeiro no Parque Zoológico Arruda Câmara, localizado na cidade de João Pessoa - PB. As bactérias mais freqüentes foram Staphylococcus sp. (14,74%, Corynebacterium sp.(13,68%, Escherichia coli (13,68% e Shigella sp. (11,58%, e as menos prevalentes foram Citrobacter sp.(1,05%, Klebsiella pneumoniae (1,05% e Salmonella sp. (1,05%. Ressalta-se a importância da participação desses microrganismos em processos infecciosos (septicemias e em feridas provocadas por crocodilianos.

  14. Predição da potência aeróbia (VO2máx de crianças e adolescentes em teste incremental na esteira rolante Prediction of aerobic power (VO2max of children and adolescents during an incremental treadmill test

    Directory of Open Access Journals (Sweden)

    Fabiana Andrade Machado

    2013-03-01

    Full Text Available O consumo máximo de oxigênio (VO2máx é a quantidade máxima de energia que pode ser produzida pelo metabolismo aeróbio em determinada unidade de tempo, podendo ser determinado direta ou indiretamente através de equações preditivas. O objetivo deste trabalho foi elaborar uma equação preditiva específica para determinar o VO2máx de meninos de 10 a 16 anos. Quarenta e dois meninos realizaram teste ergoespirométrico de corrida em esteira rolante com velocidade inicial de 9 km/h até exaustão voluntária. Através da regressão linear múltipla foi possível desenvolver a seguinte equação para a determinação indireta do VO2máx: VO2máx (ml/min = -1574,06 + (141,38 x Vpico + (48,34 * Massa corporal, com erro padrão de estimativa = 191,5 ml/min (4,10 ml/kg/min e o coeficiente de determinação = 0,934. Sugerimos que esta é uma fórmula adequada para predizer o VO2máx para esta população.The maximal oxygen uptake (VO2max is the maximal quantity of energy that can be produced by the aerobic metabolism in certain time unity. It can be determined direct or indirectly by predictive equations. The objective of this study was to make a specific predictive equation to determine the VO2max from boys aged 10-16 years-old. Forty-two boys underwent a treadmill running ergospirometric test, with the initial velocity set at 9 km/h, until voluntary exhaustion. By the multiple linear regression was possible to develop the following equation for the indirect determination of the VO2max: VO2max (ml/min = -1574.06 + (141.38 x Vpeak + (48.34 * Body mass, with standard error of estimate = 191.5 ml/min (4.10 ml/kg/min and coefficient of determination = 0.934. We suggest that this formula is appropriate to predict VO2max for this population.

  15. Estimación de Parámetros Cinéticos de la Degradación Aeróbica de Efluentes Lácteos usando AQUASIM v 2.1b Estimation of Kinetic Parameters of the Aerobic Degradation of Dairy Wastewater using AQUASIM v 2.1b

    Directory of Open Access Journals (Sweden)

    Miguel A Rosa

    2010-01-01

    Full Text Available Se estimaron parámetros cinéticos del mecanismo de biodegradación aeróbica de efluentes lácteos, empleando técnicas de simulación, estimación de parámetros y análisis sensitivo, disponibles en el software Aquasim v 2.1b. Se utilizó un reactor tanque agitado discontinuo de 4 litros de capacidad con inyección de aire permanente. El consumo de sustrato se representó considerando cinética de primer orden en un caso y del tipo de Monod en el otro. Se obtuvo un elevado valor de la constante de Monod, K S, lo cual limitó el análisis a la primera alternativa. Los valores hallados de los parámetros de respiración endógena k d y síntesis celular Y, fueron similares en ambos casos, mientras que el análisis sensitivo determinó parámetros de Monod no identificables. Se concluye que para este caso resulta válida una cinética de primer orden para representar el consumo de sustrato y se destaca la importancia de esta herramienta para efectuar el análisis.The kinetic constants of an aerobic biodegradation mechanism of dairy wastewaters were estimated using techniques of simulation, estimation of parameters and sensitivity analysis, available in the software Aquasim v 2.1b. A discontinuous, agitated reactor, of 4 liters capacity with a permanent air injection was used. Two kinetic models, Monod and first order were considered to represent substrate consumption as a function of time. Due to a high value of Monod's constant, K S, the data analysis was restricted to the first kinetic proposed. The values obtained for the parameters of endogenous breathing k d and cellular synthesis Y, were similar, whereas the sensitivity analysis revealed non-identifying Monod parameters. The importance of this software to carry out the analysis shown above and the validation of the first order kinetic for representing the substrate consumption are two of the most important conclusions of this work.

  16. O bloqueio da síntese do óxido nítrico promove aumento da hipertrofia e da fibrose cardíaca em ratos submetidos a treinamento aeróbio Nitric oxide synthesis blockade increases hypertrophy and cardiac fibrosis in rats submitted to aerobic training

    Directory of Open Access Journals (Sweden)

    Hugo Celso Dutra de Souza

    2007-08-01

    Full Text Available OBJETIVO: O presente estudo avaliou as adaptações teciduais cardíacas em ratos submetidos a treinamento aeróbio, após o bloqueio da síntese de óxido nítrico (NO. MÉTODOS: Os animais (n = 48 foram divididos em quatro grupos: sedentários (grupo CONTROLE, hipertensos após administração de Ng-nitro-L-arginina metil éster durante sete dias (grupo L-NAME, treinados por meio de natação durante oito semanas (grupo TREINADO e treinados e tratados com L-NAME na última semana (grupo TREINADO L-NAME. Em todos os animais foi registrada a pressão arterial (PA e realizada a avaliação morfométrica cardíaca. RESULTADOS: Os grupos L-NAME e TREINADO L-NAME apresentaram-se hipertensos em relação aos demais (p OBJECTIVE: The objective of the present study was to evaluate cardiac tissue adaptations in rats submitted to aerobic training after nitric oxide (NO synthesis blockade. METHODS: The animals (n=48 were divided into four groups: sedentary (CONTROL group; hypertensive after administration of NG-nitro-L-arginine methyl ester for 7 days (L-NAME Group; trained for 8 weeks through swimming exercises (TRAINED Group;trained and treated with L-NAME during the last week (L-NAME TRAINED Group. All the animals were submitted to the experiment procedures for blood pressure (BP readings and cardiac morphometric evaluation. RESULTS: In comparison to the other groups, the L-NAME and L-NAME TRAINED groups were hypertensive (p<0.05; however, BP elevation in the L-NAME TRAINED group was significantly lower than the L-NAME group (p<0.05. The heart weight indexes for the TRAINED and L-NAME TRAINED groups were higher than the CONTROL and L-NAME groups (p<0.05. Also they had presented higher rates of macroscopic cardiac area and cardiac fibrosis in relation to the rest (p<0.05; comparisons revealed that the values for the L-NAME TRAINED group were significantly higher (p<0.05 than the others. CONCLUSION: Short term NO synthesis blockade in sedentary animals

  17. Evaluación del proceso de descomposición aeróbica de egeria densa como alimento potencial para especies acuáticas (An assessment of the aerobic decomposition of Egeria densa as a potencial source of food for aquatic species

    Directory of Open Access Journals (Sweden)

    Nacif Osorio, Yamel

    2007-04-01

    Full Text Available ResumenLas plantas acuáticas son ampliamente conocidas como fuentes de alimento. En el caso de los organismos omnívorodetritívoros,el nivel de descomposición que presentan los vegetales al ser ingeridos determinan su contenido nutritivo. En este trabajo se evaluó el contenido nutrimental de la macrófita Egeria densa en estado de descomposición aeróbica a distintos tiempos, analizando los cambios que ocurren en la composición de su tejido, así como los principales agentes bióticos y abióticos que inciden en el proceso. Serealizó una caracterización físico-química del hábitat donde se recolectó esta especie. En el laboratorio se aplicó un diseño 2 X 2, con factores como temperatura (ambiente:21ºC y 25ºC y tamaño del vegetal (macrófita entera y fraccionada en segmentos < de 50mm,acondicionado con un inóculo bacteriano proveniente del sedimento del sitio de recolección. Se practicaron estudios microbiológicos en los inóculos aplicados inicialmente y del proceso de descomposición a través de su modificación semanal, sobre la cantidad y tipo de bacterias: coliformes fecales, totales y en grupos específicos deenterobacterias y algunas bacterias atógenas. Para analizar los cambios ocurridos en la composición del ensilado, se analizaron muestras semanales en su contenido de proteína, carbohidratos,lípidos, materia orgánica, minerales y contenido energético.A partir de los resultados de degradación del vegetal, se determinó un tiempo óptimo de acción bacteriana (2-3 semanas, para obtener material cuyo contenido nutritivo y energético pueda ser empleado como alimento en especies acuáticas de hábitos alimenticiosomnívoro– detritívoro.

  18. Condicionamento físico aeróbio moderado promove redução no rápido ganho de peso de ratos adultos desnutridos nos períodos de gestação e lactação Moderate aerobic physical conditioning reduces the fast weight gain of adult rats malnourished during pregnancy and lactation

    Directory of Open Access Journals (Sweden)

    Tâmara Nunes de Araújo

    2010-04-01

    Full Text Available OBJETIVO: Foram avaliados os efeitos do condicionamento físico aeróbio moderado sobre o peso corporal e o ganho de peso de animais submetidos à desnutrição na gestação e lactação e alimentados com dieta normoprotéica após o desmame. MÉTODOS: Ratos machos Wistar foram gerados e amamentados por nutrizes alimentadas com dieta normoprotéica (caseína 17% e dieta hipoprotéica (caseína 8%, formando os grupos Nutridos (n=18 e Desnutridos (n=17 inicialmente e, após o desmame, foram alimentados com dieta normoprotéica padrão do biotério (Labina®, Purina. Aos 60 dias de vida, os animais foram subdivididos em quatro grupos: Nutrido Sedentário (n=9, Nutrido Condicionado (n=7, Desnutrido na Gestação e Lactação Sedentário (n=8 e Desnutrido na Gestação e Lactação Condicionado (n=9. O condicionamento físico aeróbio moderado foi realizado em esteira elétrica durante 8 semanas, 5 dias/ semana, 60min/dia e os animais sofreram eutanásia após o término do protocolo. Realizaram-se as análises do peso corporal (g e do ganho de peso corporal (%. RESULTADOS: Observou-se menor peso corporal nos grupos Desnutrido na Gestação e Lactação Sedentário (247,00: 134,00 - 335,00 e Desnutrido na Gestação e Lactação Condicionado (245,00: 166,00 - 324,50 comparados respectivamente, aos grupos Nutrido Sedentário (303,75: 176,00 - 372,00 e Nutrido Condicionado (290,25: 190,00 - 372,00 (pOBJECTIVE: The objective of this study was to assess the effects of moderate aerobic physical conditioning on the body weight and weight gain of rats whose mothers were fed a low protein diet during gestation and lactation. METHODS: Male Wistar rats were bred from dams fed a normal- (17% casein or low-protein (8% casein diet, constituting the initial nourished (n=18 and malnourished (n=17 groups. After weaning, they were fed the standard diet of the laboratory, with normal protein content (Labina®, Purina. At the age of 60 days, the animals were divided

  19. Efectos del entrenamiento físico en piscina climatizada sobre la capacidad aeróbica de un grupo de niños asmáticos. (Effects of the physical training in a warm-water pool on the aerobic power of a group of asthmatic children.

    Directory of Open Access Journals (Sweden)

    Juan David Fernández Villada

    2009-07-01

    Full Text Available ResumenObjetivo: Observar cambios en la capacidad aeróbica de un grupo de niños asmáticos después de un entrenamiento físico en piscina climatizada (EFPC. Método: 22 niños asmáticos, se dividieron en grupo experimental (GE y grupo control (GC de 11 cada uno. El GE se sometió a un EFPC durante 18 semanas de manera controlada, mientras el GC solo hacía sus actividades cotidianas. A ambos grupos se les realizó pruebas de esfuerzo en banda rodante para determinar el máximo consumo de oxígeno en METS y la frecuencia cardiaca máxima (FCM. Se midió en cada sesión de EFPC si los niños presentaban asma inducida por esfuerzo (AIE. Resultados: Al iniciar el estudio, el promedio de METS y de la FCM fueron similares en ambos grupos (Anova METS p = 0.5568; Anova FCM p = 0.5198; METS: GE 11.61 ± 2.33 DS, GC 11.05 ± 2.08 DS; FCM: GE 165.09 ± 13.85 DS, GC 161.46 ± 12.12 DS. Al finalizar, sólo el GE mejoró en los promedios de los METS de la diferencia pre-post según la prueba de observaciones apareadas (METS GE 6.65 ± 3.46 DS; Anova p = 0.0006. La FCM también aumentó, siendo significativa en el GE (FCM: GE 22.45 ± 19.04 DS; Anova FCM p = 0.0823. Solo el 6,06% de las mediciones presentaron AIE. Conclusión: Se encontró aumento significativo de la capacidad aeróbica en el GE, comparado con el GC. Se sugiere que utilizar piscina climatizada para el entrenamiento físico del asmático puede disminuir el AIE.Abstract Objective: To observe changes in the aerobic power in a group of asthmatic children after of a physical training in warm-water pool (EFPC. Method: 22 asthmatic children, who were divided in to an experimental group (GE and a control group (GC of 11 each. The GE was submitted to an EFPC for 18 weeks in a controlled way, while the GC only did their daily activities. Treadmill ergometer testing were conducted to both groups, to determine the maximal oxygen consumption in MET and the maximum heart rate (FCM. Each section of the

  20. O treinamento físico aeróbio inibe a sinalização apoptótica muscular esquelética mediada por VEGF-VEGR2 em ratos espontaneamente hipertensos Aerobic exercise training inhibits skeletal muscular apoptotic signaling mediated by VEGF-VEGR2 in spontaneously hypertesive rats

    Directory of Open Access Journals (Sweden)

    Tiago Fernandes

    2012-12-01

    Full Text Available O treinamento físico aeróbio (TF tem sido utilizado como um importante tratamento não farmacológico da hipertensão arterial (HA, uma vez que ele corrige a rarefação microvascular e reduz a pressão arterial. Estudos mostram que as anormalidades microvasculares estão diretamente associadas às alterações do fator de crescimento vascular endotelial (VEGF e do VEGF receptor 2 (VEGFR2, bem como a um desequilíbrio da sinalização apoptótica na HA. Entretanto, pouco se conhece sobre os efeitos do TF sobre estes parâmetros na HA. Nós hipotetizamos que o TF recupere os fatores angiogênicos e promova um equilíbrio entre as proteínas anti e pró-apoptóticas da família Bcl-2 potencialmente, contribuindo para a revascularização e regressão da doença. Ratos espontaneamente hipertensos (SHR, n = 14 e Wistar Kyoto (WKY, n = 14 com 12 semanas de vida e divididos em quatro grupos: SHR, SHR treinado (SHR-T, WKY e WKY treinado (WKY-T foram estudados. Como esperado, 10 semanas de TF foram efetivas em reduzir a pressão arterial em SHR-T. Além disso, o TF promoveu bradicardia de repouso nos grupos de animais treinados (WKY-T e SHR-T, sendo considerado como um importante marcador de TF aeróbio. O TF também corrigiu a rarefação capilar em SHR-T e esta resposta se deve em grande parte por uma recuperação dos níveis periféricos de VEGF e um aumento na expressão de VEGFR2. Em paralelo, foi observada uma normalização das vias apoptóticas, com aumento da expressão de proteínas antiapoptóticas (Bcl-2 e Bcl-x e redução das pró-apoptóticas (Bad acompanhada pela fosforilação de Bad. Estes resultados sugerem que o TF promove revascularização periférica na HA dependente de um fino balanço de reguladores positivos e negativos de angiogênese.Aerobic exercise training (ET has been established as an important non-pharmacological treatment for hypertension, since it corrects the microvascular rarefaction and decreases blood pressure

  1. Efeito do exercício aeróbio e resistido no perfil antropométrico e respostas cardiovasculares de idosos portadores de hipertensão - DOI: 10.4025/actascihealthsci.v28i1.1093 Aerobic exercise and resistance effect on the anthropometric profile and cardiovascular responses in elderly people with high blood pressure - DOI: 10.4025/actascihealthsci.v28i1.1093

    Directory of Open Access Journals (Sweden)

    Hassan Mohamed Elsangedy

    2006-03-01

    Full Text Available O presente estudo teve por objetivo analisar os efeitos do exercício aeróbio e resistido no perfil antropométrico e respostas cardiovasculares de idosos portadores de hipertensão arterial (HA. A amostra foi composta de 53 voluntários de ambos os sexos, todos sedentários, com idade de 64,28±4,7 anos, cor branca, portadores de HA. Foram analisados os níveis de pressão arterial (PA, freqüência cardíaca (FC peso corporal (Kg, IMC e percentual de gordura corporal (%GC, antes, durante e após seis meses de exercícios. O protocolo de treinamento foi composto por uma sessão de exercícios, dividida em 20 minutos de atividade aeróbia e 40 minutos de exercícios resistidos dinâmicos, com freqüência semanal de três vezes e duração de seis meses. Como principais resultados apresentaram-se diferenças significativas em relação ao %GC, acompanhado de uma redução linear na pressão arterial média (PAM e FC, indicando uma melhora em importantes parâmetros morfofuncionaisThe present study aimed to analyze the aerobic and resistance exercise effects on the anthropometric profile and cardiovascular responses in elderly people with High Blood Pressure (HBP. The sample consisted of 53 volunteers of both genders who were all sedentary, at the age of 64.28±4.7 years old, fair skin, with HBP. The blood pressure levels, cardiac frequency (CF, body weight (Kg, BMI and body fat percentage (BF% were analyzed before, during and after the period of exercises. The training protocol consisted of exercise sessions divided into 20 minutes of aerobic activity and 40 minutes of dynamic resistance exercises, three times a week, during a period of six months. Results showed a significant difference in relation to the BF%, followed by a linear reduction in the Average Blood Pressure (ABP and CF, as well as an improvement in important morphofunctional parameters

  2. Composição química e estabilidade aeróbia em silagens de milho preparadas com inoculantes bacteriano e/ou enzimático - DOI: 10.4025/actascianimsci.v28i2.640 Chemical composition and aerobic stability of corn silages made with bacterials and/or enzymatic inoculants - DOI: 10.4025/actascianimsci.v28i2.640

    Directory of Open Access Journals (Sweden)

    Elzânia Sales Pereira

    2006-01-01

    Full Text Available Este trabalho avaliou o efeito de inoculantes bacterianos e/ou enzimáticos na composição química e na estabilidade aeróbia da silagem de milho confeccionada em minisilos. Os tratamentos foram: SC (silagem controle, SIB (silagem com inoculante bacteriano, SIBE (silagem com inoculante bacteriano e enzimático e SIE (silagem com inoculante enzimático. A adição de inoculante não alterou os teores de matéria orgânica (87,43%, proteína bruta (7,99%, fibra em detergente neutro (55,43% e fibra em detergente ácido (27,67%. Os tratamentos SIE e SC apresentaram, na abertura, o menor (3,28 e maior (3,42 pH, e, após o período de exposição ao ar, o menor (3,87 e maior (6,64 pH, respectivamente. O uso de inoculantes não influenciou os teores de N-amoniacal das silagens. Os tratamentos com inoculantes apresentaram menor pico de temperatura, maior tempo para atingir o pico de temperatura e maior estabilidade aeróbia.This work evaluated the effect of bacterial and/or enzymatic inoculants on chemical composition and aerobic stability in corn silage, made in mini-silos. The treatments were: CS (control silage, SBI (silage with bacterial inoculant, SBEI (silage with bacterial and enzymatic inoculant and SEI (silage with enzymatic inoculant. The use of inoculants did not affect the organic matter (87,43%, crude protein (7,99%, neutral detergent fiber (55,43% and acid detergent fiber (27,67% contents. The SEI and CS treatments showed the lowest (3,28 and the highest (3,42 pH values in the beginning and after an air exposure period, showed again the lowest (3,87 and the highest (6,64 pH values, respectively. The inoculants used did not affect N-amonniacal contents of the silages. The treatments with inoculants presented the lowest temperature peak, more time to reach this temperature and the highest aerobics stability.

  3. Adaptação enzimática da LDH em ratos submetidos a treinamento aeróbio em esteira e laser de baixa intensidade Adaptation of LDH enzyme in rats undergoing aerobic treadmill training and low intensity laser therapy

    Directory of Open Access Journals (Sweden)

    WHB Vieira

    2006-01-01

    Full Text Available OBJETIVO: Verificar a atividade e padrão eletroforético da LDH em resposta ao exercício em esteira em ratos submetidos à fotoestimulação por laser de baixa intensidade (780 etam. MÉTODO: Foram utilizados nesse estudo 54 ratos machos jovens (30dias, Winstar, com peso inicial médio de 112 ± 4,7g, os quais foram divididos em quatro grupos: dois permaneceram em repouso, GRC (grupo repouso controle, n= 9 e GRL (grupo repouso laser, n= 10, sendo o segundo irradiado por laser, e outros dois foram submetidos ao treinamento aeróbio e testes de esforço crescente em esteira (em degraus descontínuos visando à determinação do limiar de anaerobiose (LA durante 5 semanas, GEC (grupo exercício controle, n= 16 e GEL (grupo exercício laser, n= 19, sendo o último também irradiado por laser. O laser foi aplicado no quadríceps, glúteo máximo, sóleo e tibial anterior (TA, bilateralmente, imediatamente após cada sessão de treinamento, usando: 3,8J/cm², 15mW, 10s, modo contínuo, durante 5 semanas. Amostras de sóleo, TA e coração foram removidas 48 horas após a última sessão de exercício para análise eletroforética e espectrofotométrica. A estatística foi realizada através do teste ANOVA e post-hoc de TUKEY. O nível de significância foi considerado (pOBJECTIVE: To analyze the activity and electrophoretic pattern of the enzyme LDH in response to treadmill training, in rats undergoing photostimulation using low-level laser therapy (LLLT (780 etam. METHOD: Fifty-four 30-day-old male Winstar rats initially weighing 112 ± 4.7g were divided into four groups. Two groups remained at rest: resting control group (RCG, n= 9 and resting LLLT group (RLG, n= 10. The other two groups underwent a five-week treadmill program of aerobic training and non-continuous incremental effort tests, with the aim of determining the anaerobic limit. One of the latter was an exercise control group (ECG, n= 16 and the other was an exercise LLLT group (ELG, n

  4. Perdas fermentativas, composição química, estabilidade aeróbia e digestibilidade aparente de silagem de cana-de-açúcar com aditivos químico e microbiano Fermentation losses, chemical composition, aerobic stability and apparent digestibility of sugarcane ensiling with chemical and microbial additives

    Directory of Open Access Journals (Sweden)

    Geraldo Balieiro Neto

    2009-06-01

    Full Text Available O objetivo deste trabalho foi avaliar a influência da adição de cal virgem e Lactobacillus buchneri em perdas fermentativas, valor nutritivo, estabilidade aeróbia e digestibilidade aparente da silagem de cana-de-açúcar (Saccharum officinarum. O primeiro experimento avaliou perdas fermentativas, pH e temperatura, composição química e digestibilidade in vitro da matéria seca de silagens de cana-de-açúcar, com adição ou sem adição de cal ou de inoculante bacteriano (L. buchneri; o segundo avaliou o consumo de matéria seca e a digestibilidade aparente da cana-de-açúcar ensilada com os mesmos aditivos para cordeiros. Os aditivos não reduziram as perdas na ensilagem, e silagens com cal apresentaram maiores perdas por efluentes. O consumo de matéria seca da silagem com inoculante foi inferior ao da silagem com cal ou ao da cana-de-açúcar in natura. A digestibilidade aparente da matéria seca da silagem com cal foi inferior à da cana-de-açúcar in natura e à da silagem com inoculante. A digestibilidade aparente do extrato etéreo das silagens com cal foi superior à da cana-de-açúcar in natura. Os valores de nutrientes digestíveis totais da cana-de-açúcar in natura ou ensilada com inoculante ou cal foram de 61,2, 54,1 e 51,7%, respectivamente. Independentemente do aditivo, a ensilagem da cana-de-açúcar resulta em perda de nutrientes e redução de digestibilidade.The objective of this work was to evaluate the influence addition whitewash (CaO and Lactobacillus buchneri in fermentation losses, nutritional value, aerobic stability and apparent digestibility of sugarcane (Saccharum officinarum silages. A first experiment evaluated fermentation losses, pH and temperature values, chemical composition and in vitro dry matter digestibility of sugarcane silages with or without bacterial inoculants (L. buchneri or CaO. A second experiment evaluated intake and apparent digestibility of sugarcane silage with the same additives to

  5. Larval feeding behavior of the truncatus group of Thrypticus (Diptera: Dolichopodidae that breed in the aerenchyma of Pontederiaceae Comportamiento alimentario de las larvas del grupo truncatus de Thrypticus (Diptera: Dolichopodidae que se crían en el aerénquima de Pontederiaceae

    Directory of Open Access Journals (Sweden)

    M. Cristina Hernández

    2007-12-01

    -Laubach (Pontederiaceae, minando cerca de la epidermis y abriendo varios orificios al exterior. La larva de T. romus Bickel & Hernández crece en E. azurea (Sw. Kunth, formando una mina curva, corta en comparación con las otras especies. La larva de T. formosensis Bickel & Hernández se desarrolla en Pontederia cordata L. (Pontederiaceae, excavando la mina entre la epidermis y la gran celda central de los pecíolos. Por último, la larva de T. taragui Bickel & Hernández se cría en tallos sumergidos de P. subovata (Seub. in Mart. Lowden, formando una mina subepidérmica con ramificaciones hacia la estela central del tallo. No se pudieron asociar las minas correspondientes a las especies T. yanayacu, T. chanophalus y T. azuricola. No se encontraron predadores ni parásitos de larvas o pupas, se observaron casos de canibalismo entre larvas cuando el trazado de dos minas confluye. Las especies del grupo truncatus poseen un modo de alimentación sumamente específico, confinadas al aerénquima, se alimentan de la savia extraída de los orificios roídos en los haces vasculares de los pecíolos y tallos, posiblemente con levaduras simbiontes como suplemento para la nutrición. Numerosas colecciones en el campo y pruebas en el laboratorio, indican que estos insectos están asociados con plantas hospedadoras específicas dentro de la misma familia. Esta especialización sugiere una larga asociación insecto-hospedadora.

  6. Avaliação de inoculante microbiano na composição bromatológica, fermentação e estabilidade aeróbia da silagem pré-seca de alfafa Evaluation of microbial inoculant on chemical composition, fermentation characteristics and aerobic stability of alfalfa haylage

    Directory of Open Access Journals (Sweden)

    Vanessa Jaime de Almeida Magalhães

    2004-02-01

    Full Text Available O objetivo deste trabalho foi avaliar os efeitos do inoculante microbiano Silobac® (L. plantarum, P. pentosaceus, na silagem pré-seca de alfafa, em 22 silos, distribuídos em dois tratamentos, sendo 11 silos com inoculante e 11 controle, segundo o delineamento inteiramente casualizado. A alfafa foi cortada quando em estádio do meio do florescimento e os silos, confeccionados com aproximadamente 600 kg e revestidos com película de PVC branca. Amostras foram coletadas, logo após a abertura de cada silo, para análise bromatológica e perfil fermentativo. O inoculante diminuiu o teor de MS (inoculada = 44,7 vs. controle = 51,2% e aumentou a concentração de ácido acético (2,35 vs. 0,89% MS, em relação ao grupo controle. O inoculante também revelou diminuição no escore de bolor obtido a 10 cm de profundidade, mas não a 30 ou 50 cm. Não foram observados efeitos sobre os teores de PB (15,9 vs. 16,4% MS, NIDN (14,7 vs. 16,2% do N total, NIDA (11,2 vs. 11,6% do N total, FDN (47,1 vs. 46,7% MS, FDA (40,2 vs. 39,8% MS, celulose (29,7 vs. 28,6% MS, hemicelulose (6,94 vs. 6,89% MS, LDA (10,4 vs. 11,1% MS, carboidratos solúveis (2,97 vs. 2,44% MS e amido (0,82 vs. 0,69% MS, DIVMS (61,6 vs. 62,5% MS, poder tampão (52,9 vs. 51,7 meq./100g MS, as concentrações de etanol (0,018 vs. 0,024% MS e dos ácidos propiônico (0,00 vs. 0,00% MS, butírico (0,00 vs. 0,00% MS e lático (5,62 vs. 4,45% MS, a relação lático:acético (4,57 vs. 4,87, bem como sobre o pH (4,96 vs. 5,33, as concentrações de N-NH3 (8,19 vs. 5,21% do N total e a estabilidade aeróbia.The objective of this study was to evaluate the effects of microbial inoculant Silobac® (L. plantarum, P. pentosaceus on alfalfa haylage, in twenty-two big bales, allotted to two treatment, eleven with inoculant and eleven control, assigned to a totally randomized design. Alfalfa crop was harvested at middle bloom stage and conditioned in silage bales of about 600 kg capacity and covered with

  7. Milk contamination in different points of the process: I Aerobic mesophilics and psychrotrophics microorganisms/ Contaminação do leite em diferentes pontos do processo de produção: I. Microrganismos aeróbios mesófilos e psicrotróficos

    Directory of Open Access Journals (Sweden)

    Mykel Stefanni Pereira

    2001-05-01

    torno de 4ºC selecionam uma microbiota denominada psicrotrófica, que independentemente de sua temperatura ótima de crescimento, multiplica-se bem sob refrigeração e produz enzimas termorresistentes, que comprometem a qualidade principalmente de derivados lácteos e leite UAT. Este trabalho tem como objetivo determinar os principais pontos de contaminação do leite por mesófilos e psicrotróficos no processo de produção leiteira, bem como a eficiência da refrigeração no controle do crescimento destes microrganismos. Avaliou-se cinco (5 propriedades leiteiras da região de Londrina- PR, analisando-se diversos pontos do processo de produção e pesquisando-se microrganismos aeróbios mesófilos (35ºC/48hs e psicrotróficos (21ºC/25 hs. Os principais pontos de contaminação foram os latões, tanques de expansão, água residual de equipamentos e utensílios de ordenha e tetos higienizados inadequadamente. Água residual dos tanques de expansão, de latões, tetos higienizados inadequadamente e a clarificadora foram os pontos com maior contagem de psicrotróficos. A quantidade de psicrotróficos encontrada em todos os segmentos do processo de produção pesquisados, foi superior ao que considera-se tolerável (10% da quantidade de mesófilos. No leite refrigerado, o número de psicrotróficos superou o de mesófilos, mostrando que a contagem de mesófilos pode subestimar a real quantidade de microrganismos presentes, sendo os psicrotróficos os indicadores de contaminação ideais neste produto. Como a refrigeração a 4oC não inibe o crescimento deste grupo de microrganismos, deve-se evitar sua incorporação ao leite durante a produção, havendo necessidade da associação de boas práticas em todo o processo produtivo.

  8. Assessment of the efficiency of SimPlate™ total plate count color indicator (TPC CI to quantify mesophilic aerobic microorganisms in pasteurized milk Avaliação da eficiência do SimPlate™ Total Plate Count Color Indicator (TPC CI para enumeração de microrganismos aeróbios mesófilos em leite pasteurizado

    Directory of Open Access Journals (Sweden)

    Luís Augusto Nero

    2002-01-01

    Full Text Available The SimPlate™ TPC CI system is a rapid method to count mesophilic aerobic microorganisms (MAM in foods, based on the use of resazurine to indicate bacterial growth. Its efficiency in pasteurized milk was evaluated using 142 pasteurized milk samples (38 type A, 43 type B and 61 type C collected in Londrina, PR. The standard plating method, using Plate Count Agar (PCA was used for comparison. The plates of both systems were incubated at 35ºC and read after 24h and 48h. The occurrence of false-positive and false-negative wells and the predominant microorganisms in them were also evaluated. The results were compared by simple correlation and mean variance analyses. The correlation (r and mean variance values were 0.6811 and 0.7583 for the results obtained after 24h, respectively, and 0.9126 and 0.0842 for the results obtained after 48h, respectively. These results indicate that the performance of the system increases when the plates are incubated for 48h. When the three types of milk were evaluated separately, these values were 0.9285 and 0.0817 for type A milk, 0.9231 and 0.0466 for type B milk and 0.7209 and 0.1082 for type C milk. These results indicate that the better the quality of the milk the better the performance of SimPlate™ TPC CI. False-negative wells, found more frequently in samples with high MAM counts, were caused by Gram positive microorganisms, poorly detected by the SimPlate™ TPC CI system because they grew slowly and had low reduction capacity. The results indicated a higher efficiency of the SimPlate™ TPC CI system in the reading at 48h.O sistema SimPlate™ TPC CI é um método rápido para enumeração de microrganismos aeróbios mesófilos (MAM em alimentos que utiliza a resazurina como substância indicadora de crescimento bacteriano. Para avaliar sua eficiência em leite pasteurizado, 142 amostras (38 de leite tipo A, 43 de leite tipo B e 61 de leite tipo C foram colhidas em Londrina, PR, e analisadas pelo Sim

  9. Comparação entre os métodos rápidos SimplateR TPC- CI e PetrifilmR AC e os métodos convencionais de contagem em placas para a enumeração de aeróbios mesófilos em sorvetes Comparasion of SimplateR test and Petrifilm with plate count agar method for detection and enumeration of bacteria in ice cream

    Directory of Open Access Journals (Sweden)

    Anderson de Souza Sant'ana

    2002-01-01

    Full Text Available A contagem de aeróbios mesófilos ou contagem padrão em placas em um produto alimentício reflete a qualidade da matéria-prima, bem como as condições de processamento, manuseio e estocagem. O método de contagem em placas tradicionais requer 48h de incubação para a posterior leitura dos resultados. Comparou-se dois métodos que parecem ser uma boa alternativa para a contagem padrão em placas: SimplateR TPC-CI e PetrifilmR AC. Também avaliou-se a capacidade inibitória do 2, 3, 5 cloreto de trifeniltetrazólio quando adicionado ao Agar Plate Count. Este corante é incolor na forma oxidada e vermelho quando reduzido pelos microrganismos, devido à formação de formazano. O coe-ficiente de correlação obtido, através de estudos conduzidos com 60 amostras de sorvetes, entre 0,866-0,979 indicou uma equivalente sensibilidade dos métodos testados. Somente a contagem padrão em placas com TTC diferiu signicativamente da contagem padrão em placas.The mesophilic aerobic plate count or standard plate count (SPC of fresh food product reflects conditions of raw product quality, processing, handling and storage. Current standard methods require a 48h incubation period to obtain the results. Two rapid alterantive methods: SimplateTM TPC-CI and PetrifilmTM Aerobic Count (AC Plate were compared to standard methods. Also, we evaluated the inhibitory effect of 2, 3, 5 triphenyltetrazolium chloride (TTC when added to Plate Count Agar. This dye is colorless in the oxidized form and red when reduced by microorganisms, due to the formation of formazan. Sixty ice cream samples were used in this study to obtain correlation coefficients, which ranged from 0.866-0.979, indicating equivalent sensitivities to existing methods. Only plate count with TTC differed significantly from the standard plate count.

  10. Índices fisiológicos associados com a "performance" aeróbia em corredores de "endurance": efeitos da duração da prova Índices fisiológicos asociados a la "performance" aerobia en competidores de "endurance": efectos de la duración de la prueba Physiological indexes associated with aerobic performance in endurance runners: effects of race duration

    Directory of Open Access Journals (Sweden)

    Benedito Sérgio Denadai

    2004-10-01

    Full Text Available O objetivo deste estudo foi analisar a validade do consumo máximo de oxigênio (VO2max, da velocidade correspondente ao VO2max (vVO2max, do tempo de exaustão na vVO2max (Tlim, da economia de corrida (EC e do limiar anaeróbio (LAn para a predição da performance de atletas de endurance. Quatorze corredores de endurance (33,4 ± 4,4 anos; 62,7 ± 4,3kg; 166,1 ± 5,0cm; VO2max = 60,4 ± 5,9ml.kg-1.min-1 realizaram os seguintes testes: a competição simulada nas distâncias de 1.500 e 5.000m. e; b testes de laboratório para a determinação do VO2max, vVO2max, EC, LAn e Tlim na intensidades de 100% vVO2max. As velocidades (km/h da vVO2max (18,7 ± 0,8, LAn (17,3 ± 1,1 v1.500m (19,9 ± 0,8 e v5.000m (17,9 ± 0,9 foram significantemente diferentes. A regressão múltipla stepwise revelou que o LAn foi o único preditor da performance da v5.000m, explicando 50% da variação desta performance. Para a v1.500m, o Tlim e a vVO2max explicaram 88% da variação da performance. Com base em nossos resultados, pode-se concluir que a validade dos índices fisiológicos (VO2max, vVO2max, Tlim, EC e LAn, para a predição da performance aeróbia de atletas de endurance, é dependente da distância da prova (1.500 x 5.000m analisada.El objetivo de este estudio fue analizar la validez del consumo máximo de oxígeno (VO2max, de la velocidad correspondiente al VO2max (vVO2max, del tiempo de exaustión en la vVO2max (Tlim, de la economía de la carrera (EC y del umbral anaeróbico (LAn para predecir la performance de atletas de endurance. Catorce competidores de endurance (33,4 ± 4,4 años; 62,7 ± 4,3kg; 166,1 ± 5,0cm; VO2max = 60,4 ± 5,9ml.kg-1.min-1 realizaron las siguientes pruebas: a competición simulada en las distancias de 1.500 y 5.000m. e; b pruebas de laboratorio para la determinación del VO2max, vVO2max, EC, LAn y Tlim en la intensidad del 100% vVO2max. Las velocidades (km/h de la vVO2max (18,7 ± 0,8, LAn (17,3 ± 1,1 v1.500m (19,9 ± 0,8 y v5

  11. AERE contracts with DOE on the treatment and disposal of Intermediate Level Wastes

    International Nuclear Information System (INIS)

    Individual summaries are provided for each contract report, under the titles: comparative evaluation of α and βγ irradiated medium level waste forms; modelling and characterisation of intermediate level waste forms based on polymers; optimisation of processing parameters for polymer and bitumen modified cements; α damage in non-reference matrix materials; leaching mechanisms and modelling; inorganic ion exchange treatment of medium active effluents; electrical processes for the treatment of medium active liquid waste; fast reactor fuel element cladding; dissolver residues; effects of radiation on the properties of cemented MTR waste forms; equilibrium leach testing of cemented MTR waste forms; radiolytic oxidation of radionuclides; immobilisation of liquid organic wastes; quality control, non-conformances and corrective action; application of gel processes in the treatment of actinide-containing liquid wastes; the role of colloids in the release of radionuclides from nuclear waste. (author)

  12. Self-Determination: Using Agency, Efficacy and Resilience (AER) to Counter Novice Teachers' Experiences of Intensification

    Science.gov (United States)

    Keogh, Jayne; Garvis, Susanne; Pendergast, Donna; Diamond, Pat

    2012-01-01

    The intensification process associated with the first year of teaching has a significant impact on beginning teachers' personal and professional lives. This paper uses a narrative approach to investigate the electronic conversations of 16 beginning teachers on a self-initiated group email site. The participants' electronic exchanges demonstrated…

  13. Structure of CARB-4 and AER-1 CarbenicillinHydrolyzing β-Lactamases

    OpenAIRE

    Sanschagrin, François; Bejaoui, Noureddine; Levesque, Roger C.

    1998-01-01

    We determined the nucleotide sequences of blaCARB-4 encoding CARB-4 and deduced a polypeptide of 288 amino acids. The gene was characterized as a variant of group 2c carbenicillin-hydrolyzing β-lactamases such as PSE-4, PSE-1, and CARB-3. The level of DNA homology between the bla genes for these β-lactamases varied from 98.7 to 99.9%, while that between these genes and blaCARB-4 encoding CARB-4 was 86.3%. The blaCARB-4 gene was acquired from some other source because it has a G+C content of 3...

  14. Recent developments in testing new membrane systems at AERE Harwell for nuclear applications

    International Nuclear Information System (INIS)

    The development of a crossflow filtration process for the treatment of radioactive liquid waste has been carried out at the Harwell Laboratory. A number of different membranes in the ultrafiltration and microfiltration range have been tested on simulated and real radioactive effluents under both normal crossflow and electrically cleaned conditions. The membrane fluxes and alpha rejection at different operating conditions have been determined for the Harwell site low level waste. The periodic direct electrical cleaning of conductive membranes permits the use of lower crossflow velocities and pressures while maintaining or even enhancing membrane flux. Electrical cleaning has been found not to compromise membrane life. (author)

  15. Abordaje de la obesidad por el ejercicio: desterrando lo aeróbico

    OpenAIRE

    Roig, Jorge Luis

    2013-01-01

    A pesar de la inmensa cantidad de investigaciones que afirman que la mejor elección para adelgazar son los ejercicios de baja intensidad y larga duración, muchos trabajos científicos fueron mostrando que, paralelamente a la pérdida de grasa, algo no deseable también se estaba eliminando con este modelo de ejercicios en las personas no deportistas, la masa muscular. Uno de los errores básicos que se comete al analizar los caminos a elegir para el tratamiento de la obesidad es partir del pri...

  16. AERE contracts with DoE on the treatment and disposal of intermediate level wastes

    International Nuclear Information System (INIS)

    Reports are presented on work on the following topics concerned with the treatment and disposal of intermediate-level radioactive wastes: comparative evaluation of α and β γ irradiated medium level waste forms; modelling and characterisation of intermediate level waste forms based on polymers; optimisation of processing parameters for polymer and bitumen modified cements; α damage in non-reference waste form matrix materials; leaching mechanisms and modelling; inorganic ion exchange treatment of medium active effluents; electrical processes for the treatment of medium active liquid waste; fast reactor fuel element cladding; dissolver residues; effects of radiation on the properties of cemented MTR waste forms; equilibrium leach testing of cemented MTR waste forms; radiolytic oxidation of radionuclides; immobilisation of liquid organic waste; quality control, non-conformances and corrective action. (U.K.)

  17. Fungos aeróbios no intestino grosso de borregos e de ovelhas criados em pastagens tropicais

    Directory of Open Access Journals (Sweden)

    C.E.S. Freitas

    2012-02-01

    Full Text Available Fungi populations were evaluated in large intestine from sheep raised in the North of Minas Gerais, Brazil. The samples were from 39 Santa Inês crossbred ewes and 30 lambs raised on Tanzania grass (Panicum maximum cv. Tanzania, both supplemented with mineral mixtures. The clinical specimens were directly collected from rectal ampoule with sterile swabs. The development of fungal mycelium was observed in all lamb samples and positive cultures were observed in 34 ewe specimens (87.2%. After microculture of 40 colonies from lambs, 34 isolates of the genus Aspergillus, three of Paecilomyces spp., one Acremonium sp., and one Trichoderma sp. were identified. Out of the 39 isolates from ewes, 15 Paecilomyces spp., 11 Aspergillus spp., 11 Malbranchea spp., and one Onychocola sp. were identified. The results showed the predominance of the genus Aspergillus in the lambs, while the genus Paecilomyces, Malbranchea, and Aspergillus were predominant, in ewes.

  18. 77 FR 58203 - AER Energy Resources, Inc.; Alto Group Holdings, Inc.; Bizrocket.Com Inc.; Fox Petroleum, Inc...

    Science.gov (United States)

    2012-09-19

    ... and accuracy of press releases concerning the company's operations. 6. Global Technologies Group Inc... available information about the company. 7. KMA Global Solutions International Inc. is a Nevada corporation....; Geopulse Explorations Inc.; Global Technologies Group Inc.; KMA Global Solutions International, Inc.;...

  19. Study of the electronic and magnetic properties of A2Ti2O7 (A=Er, Tb

    Directory of Open Access Journals (Sweden)

    E Khorasani

    2014-04-01

    Full Text Available The geometrical frustration in the magnetic pyrochlore oxides causes interesting properties at low temperatures in these materials. Therefore, we studied two challenging materials, Er2Ti2O7 and Tb2Ti2O7, using an ab intio method, based on Density Functional Theory (DFT. To take into account the f electrons coulomb interactions correctly, we employed DFT+U, a Hubbard method correction. As spin-orbit coupling (SOC is very effective in these materials, we added SOC to the DFT+U calculations (DFT+U+SOC. Using DFT+U+SOC, we examined the effect of non-collinear magnetism. The DFT+U+SOC calculations give rise to the magnetic moments 8.2 and 7.1 for Er2Ti2O7 and Tb2Ti2O7, respectively. These values deviate from the experimental results. The reason is that the DFT calculations are trapped in the local minima, indicatinglhat we need more sophisticated methods to find the global minimum in our electronic structure calculations. Although we need structural optimization to find better magnetic moment values, unfortunately it is possible to reach incorrect structural optimization if the electronic structural optimization for finding global minima is not performed correctly

  20. Carga de treinamento durante exercício resistido e aeróbio com intensidades autosselecionada e imposta

    OpenAIRE

    Dias, Marcelo Ricardo Cabral

    2016-01-01

    Tese de Doutoramento em Ciências do Desporto A autosseleção da carga de treinamento não é uma tarefa simples para se alcançar um objetivo. A percepção do que é leve ou pesado, bem como o alcance da fadiga, é de difícil aprendizado. Portanto, é essencial que os profissionais do fitness acompanhem de perto a intensidade e o esforço percebido durante a fase de adoção de programas de exercícios. Com isso, o objetivo do presente estudo teve dois caminhos: realizar um levantamento da literatura ...

  1. List of unclassified documents by the staff of Metallurgy Division, AERE Harwell from January 1979 to July 1980

    International Nuclear Information System (INIS)

    This list constitutes unclassified material published or presented between January 1979 and July 1980, by the staff of Metallurgy Division. It covers reports, memoranda, articles in periodicals, conference papers, books and patent specifications. (author)

  2. List of unclassified documents by the staff of Metallurgy Division, AERE Harwell from January 1972 to July 1977

    International Nuclear Information System (INIS)

    This list constitutes unclassified material published or presented between January 1972 and July 1977 by the staff of Metallurgy Division. It covers reports, memoranda, bibliographies, articles in periodicals, conference papers, books, theses and patent specifications. It is planned to issue a list annually. The publications are listed under the following titles of the research teams concerned: fast reactor fuels, advanced reactor systems, fracture studies, structural materials, radiation effects, composite materials, high voltage microscope and metals fabrication, management and administration. (U.K.)

  3. Fungos aeróbios no intestino grosso de borregos e de ovelhas criados em pastagens tropicais

    OpenAIRE

    C.E.S. Freitas; F.O. Abrão; de Silva, K. L.; P.N.M. Almeida; E.R. Duarte

    2012-01-01

    Fungi populations were evaluated in large intestine from sheep raised in the North of Minas Gerais, Brazil. The samples were from 39 Santa Inês crossbred ewes and 30 lambs raised on Tanzania grass (Panicum maximum cv. Tanzania), both supplemented with mineral mixtures. The clinical specimens were directly collected from rectal ampoule with sterile swabs. The development of fungal mycelium was observed in all lamb samples and positive cultures were observed in 34 ewe specimens (87.2%). After m...

  4. Report by the AERES on the unit: Unit of researches on neutron transport and radioactivity confinement in nuclear installations under the supervision of the establishments and bodies: IRSN

    International Nuclear Information System (INIS)

    This report is a kind of audit report on a research laboratory whose activity is organized in three departments: neutron transport and criticality (themes: numerical methods, maths and statistics related to the simulation of neutral particle propagation, nuclear data, uncertainty propagation and bias estimation, code qualification and associated experimental programs, neutron transport in reactors and fuel cycle, criticality accidents), radionuclide transfer in radioactive waste disposals (site identification strategy, hydro-mechanical phenomena affecting storage performance, physical-chemical evolution factors, storage modelling), and metrology and confinement of radioactive gases and aerosols. The authors discuss an assessment of the unit activities in terms of strengths and opportunities, aspects to be improved and recommendations, productions and publications. A more detailed assessment is presented for each department in terms of scientific quality, influence and attractiveness (awards, recruitment capacity, capacity to obtain financing and to tender, participation to international programs), strategy and governance, and project

  5. Test Firing of chunk wood - Is it possible to automate the fuel supply?; Proveldning av knubbved - Aer det moejligt att automatisera braenslematningen?

    Energy Technology Data Exchange (ETDEWEB)

    Persson, Tomas; Danielsson, Bengt-Olof

    2013-05-15

    Chunk wood is a wood fuel with a fuel particle length typically between 50 and 150 mm. The ad-vantage of chunk wood compared to wood chips is that the fuel dry as fast as fuel wood, but can be produced and handled as wood chip. Technologies for efficient producing, drying and distribution of Chunk wood have been developed since the 1970:s and machines for manufacturing the fuel is available on the market, but still there is no small-scale heating equipment in operation to burn the fuel automatically. The aim of the study was to investigate how the feeding and firing of chunk wood works in a standard 200 kW biomass boiler for various types of biofuels. The main focus was on studying how the fuel feeding system works using chunk wood and if the combustion and emissions are satisfactory. The boiler have a main fuel feeding auger screw connected to the bottom of the fuel storage, followed by a cell feeder and another auger screw that is feeding the fuel into the combustion chamber. The power consumption for the fuel feeding auger screws and the CO-emissions were measured during the firing period. In order to obtain reference values for the stresses in the fuel feeding system and the CO-emissions, regular wood chips were initially fired followed by the chunk wood firing. During the chunk wood firing period several interruptions in the fuel feeding occurred, as the trigger mechanism for the motor protection stopped the fuel supply. Most of the interruptions, however, could be resolved through manual reversing of the fuel feeding auger screw. Only at two occasions the entrance to the auger screw were manually cleared from large fuel pieces. The cell feeder and the auger screw feeding the fuel into the combustion chamber were stopped twice, and to continue operating the boiler it was enough to restart the feeding system. However, as they are both operated by the same motor we do not know whether the two shutdowns that occurred were caused by feeding problems in the auger screw or in the cell feeder. The stresses on the feeder screw varied during the test and during different operating periods, but when the first fuel feeding screw stops, the power requirements was more than three times the normal. The presence of the largest pieces in the chunk wood caused problems when the fuel was entering into the screw, and these problems caused most of the interruptions and the highest screw stress. High screw stress also arises when chunk wood slices get stuck between the auger screw and the cover. By releasing the upper part of the cover, so that the lid can move upwards seemed to reduce this problem. It thus seems beneficial with a greater distance between the lid and screw when chunk wood is to be used. The combustion performance seems to be satisfactory for chunk wood firing in these tests, however only the CO-emissions were measured. If the fuel can be produced without the presence of oversized pieces, the results show that there is a good chance that the fuel can be fired in conventional wood chip boilers of about 200 kW. The most important way forward from now on is to evaluate the market of chippers for chunk wood with respect to the presence of oversized pieces. If there are no chippers that provide adequate fuel without the presence of oversized pieces and it is impossible to develop such shippers, a more methodological work have to be put on developing the fuel feeding system.

  6. Pneumothorax as an Adverse Drug Event: An Exploratory Aggregate Analysis of the US FDA AERS Database Including a Confounding by Indication Analysis Inspired by Cornfield's Condition

    OpenAIRE

    Hauben, Manfred; Hung, Eric Y.

    2013-01-01

    Introduction: Pneumothorax is either primary or secondary. Secondary pneumothorax is usually due to trauma, including various non-pharmacologic iatrogenic triggers. Although not normally thought of as an adverse drug event (ADE) secondary pneumothorax is associated with numerous drugs, though it is often difficult to determine whether this association is causal in nature, or reflects an epiphenomenon of efficacy or inefficacy, or confounding by indication (CBI). Herein we explore this associa...

  7. Formation of Stylet Sheaths in aere (in air from eight species of phytophagous hemipterans from six families (Suborders: Auchenorrhyncha and Sternorrhyncha.

    Directory of Open Access Journals (Sweden)

    J Kent Morgan

    Full Text Available Stylet sheath formation is a common feature among phytophagous hemipterans. These sheaths are considered essential to promote a successful feeding event. Stylet sheath compositions are largely unknown and their mode of solidification remains to be elucidated. This report demonstrates the formation and solidification of in āere (in air produced stylet sheaths by six hemipteran families: Diaphorina citri (Psyllidae, Asian citrus psyllid, Aphis nerii (Aphididae, oleander/milkweed aphid, Toxoptera citricida (Aphididae, brown citrus aphid, Aphis gossypii (Aphididae, cotton melon aphid, Bemisia tabaci biotype B (Aleyrodidae, whitefly, Homalodisca vitripennis (Cicadellidae, glassy-winged sharpshooter, Ferrisia virgata (Pseudococcidae, striped mealybug, and Protopulvinaria pyriformis (Coccidae, pyriform scale. Examination of in āere produced stylet sheaths by confocal and scanning electron microscopy shows a common morphology of an initial flange laid down on the surface of the membrane followed by continuous hollow core structures with sequentially stacked hardened bulbous droplets. Single and multi-branched sheaths were common, whereas mealybug and scale insects typically produced multi-branched sheaths. Micrographs of the in āere formed flanges indicate flange sealing upon stylet bundle extraction in D. citri and the aphids, while the B. tabaci whitefly and H. vitripennis glassy-winged sharpshooter flanges remain unsealed. Structural similarity of in āere sheaths are apparent in stylet sheaths formed in planta, in artificial diets, or in water. The use of 'Solvy', a dissolvable membrane, for intact stylet sheath isolation is reported. These observations illustrate for the first time this mode of stylet sheath synthesis adding to the understanding of stylet sheath formation in phytophagous hemipterans and providing tools for future use in structural and compositional analysis.

  8. Análise da potência aeróbia de futebolistas por meio de teste de campo e teste laboratorial

    OpenAIRE

    Cristian Javier Ramirez Lizana; Felipe Belozo; Thiago Lourenço; René Brenzikofer; Denise Vaz Macedo; Milton ShoitiMisuta; Alcides José Scaglia

    2014-01-01

    Introdução: Há métodos diretos e indiretos que são utilizados pelos clubes de futebol para avaliar, acompanhar e determinar o VO2max dos jogadores, sendo este muito importante para o rendimento e a recuperação dos atletas durante uma partida. Objetivo: Avaliar o nível de correlação entre as medidas de VO2max por meio da análise direta de gases e do teste de campo Yo-Yo Intermitente Recovery Level 1 (Yo-YoIR1). Métodos: Participaram do estudo 24 jogadores de futebol da categoria SUB-2...

  9. Exercício aeróbico agudo restaura a concentração de triptofano em cérebro de ratos com hiperfenilalaninemia

    OpenAIRE

    Priscila Nicolao Mazzola; Tarsila Barros Moraes; Carolina Didonet Pederzolli; Andrea Rosa; Fernanda Rech Zanin; Juliana Coelho; Carlos Severo Dutra-Filho

    2012-01-01

    INTRODUÇÃO: A fenilcetonúria (PKU) é caracterizada pela deficiência da enzima fenilalanina hidroxilase, causando acúmulo de fenilalanina. O diagnóstico precoce e a subordinação à dieta pobre em fenilalanina são importantes para prevenir os efeitos prejudiciais da hiperfenilalaninemia. Não aderir estritamente à dieta provoca, entre outros efeitos, um desequilíbrio entre os aminoácidos neutros que usam o mesmo transportador da fenilalanina na barreira hematoencefálica, causando, então, a diminu...

  10. Passengers’ perceptions of low cost airlines and full service carriers: a case study involving Ryanair, Aer Lingus, Air Asia and Malaysia Airlines

    OpenAIRE

    O'Connell, John F.; Williams, George

    2005-01-01

    Direct competition between full service airlines and no-frills carriers is intensifying across the world. US and European full service airlines have lost a significant proportion of their passengers to low cost carriers, the experience now being repeated in the domestic markets of Asia. This paper attempts to provide answers to a number of critical questions: What are the key drivers of each type of airline's business model? Is there a difference in passengers’ perceptions between low cost ca...

  11. Efecto agudo de dos intensidades de ejercicio aeróbico sobre la presión arterial en reposo de personas normotensas

    Directory of Open Access Journals (Sweden)

    M. Gamboa Granados

    2014-09-01

    Conclusión: Se comprueba la existencia del efecto hipotensor en la presión arterial sistólica después de realizar 2 sesiones de ejercicio en banda sin fin, sin embargo los mejores resultados se obtuvieron al realizar ejercicio a una intensidad del 70% de la frecuencia cardiaca reserva.

  12. Report by the AERES on the unit: Department of Nuclear Technology under the supervision of the establishments and bodies: Atomic Energy Commission (CEA)

    International Nuclear Information System (INIS)

    This report is a kind of audit report on a research laboratory, the DTN (Department of Nuclear Technology) which comprises four departments: technology of industrial reactors, advanced technologies and processes, transfer modelling and nuclear measurements, thermal-hydraulic and technological studies. The authors discuss an assessment of the whole unit activities in terms of strengths and opportunities, aspects to be improved, risks and recommendations, productions and publications, scientific quality, influence and attractiveness (awards, recruitment capacity, capacity to obtain financing and to tender, participation to international programs), strategy and governance, and project. The same discussion is proposed for the different research themes: design of nuclear installation circuits and components, thermal-hydraulic and severe accidents, instrumentation for nuclear measurements and process control, transfers in reactors and in the environment

  13. Tratamiento Biológico Combinado Anaeróbico/Aeróbico de Estiércol Generado en la Cría Intensiva de Cerdo

    OpenAIRE

    Dinamarca, Angela

    2010-01-01

    En la actualidad, la problemática asociada a la gestión de los residuos orgánicos del sec-tor ganadero porcino se debe a los sistemas de intensificación productiva. Estos sistemas permiten una mayor eficiencia e incrementos en la producción pero, no obstante, también generan un alto impacto negativo sobre el ambiente. Por esta razón, resulta necesaria la aplicación de una gestión integral para este tipo de residuos, tomando como objetivo fun-damental la valorización de los mismos. En este ...

  14. Report by the AERES on the unit: Reactor Study Department (DER) under the supervision of the establishments and bodies: Atomic Energy and Alternative Energies Commission (CEA)

    International Nuclear Information System (INIS)

    This report is a kind of audit report on a research laboratory, the DER (Departement d'Etudes des Reacteurs, Reactor Study Department) whose activity if focused on four main themes: neutron transport simulation in reactor cores, thermal-hydraulic simulation of reactors, design and safety of innovative reactors, nuclear instrumentation for reactors. The authors discuss an assessment of the whole unit activities in terms of strengths and opportunities, aspects to be improved, risks and recommendations, productions and publications, scientific quality, influence and attractiveness (awards, recruitment capacity, capacity to obtain financing and to tender, participation to international programs), strategy and governance, and project. These same aspects are then discussed and commented for each theme

  15. Internal valves in populations of Meridion circulare from the A'er Mountain region of northeastern China: Implications for taxonomy and systematics

    Institute of Scientific and Technical Information of China (English)

    J.P. KOCIOLEK; Yan LIU; Quanxi WANG

    2011-01-01

    A population of Meridion circulare var.circulare (Greville) C.A.Agardh from Inner Mongolia was found to produce Innenschalen or internal spores.Examination of this population with light and scanning electron microscopy showed morphological differentiation between vegetative and spore morphologies.Vegetative valves typically bear costae and one rimoportula at the headpole.Spores lack costae and have two rimoportulae,one at the headpole and the other at the footpole.There is plasticity in the production of valve morphologies,and a variety of vegetative valve and spore combinations are evident.This population of M.circulare var.circulare has initial valves of over 90μm in length,and all of the initial cells encountered are acostate and bear two rimoportulae.These observations suggest that either spores are the product of sexual reproduction,or that initial valves may be produced parthenogenetically in Meridion.Spores as products of the sexual process have not been reported in diatoms previously,and parthenogenesis in Meridion was reported previously but discounted in other published reports.The plasticity of valve morphologies expressed in M.circulare var.ciculare,between vegetative valves and spores (and back) across a short temporal period suggests that diatoms can alter their cell wall structure dramatically and quickly in response to external variables.

  16. Standardizing adverse drug event reporting data

    OpenAIRE

    Wang, Liwei; Jiang, Guoqian; Li, Dingcheng; Liu, Hongfang

    2014-01-01

    Background The Adverse Event Reporting System (AERS) is an FDA database providing rich information on voluntary reports of adverse drug events (ADEs). Normalizing data in the AERS would improve the mining capacity of the AERS for drug safety signal detection and promote semantic interoperability between the AERS and other data sources. In this study, we normalize the AERS and build a publicly available normalized ADE data source. The drug information in the AERS is normalized to RxNorm, a sta...

  17. Report by the AERES on the unit: Reactor Study Department (DER) under the supervision of the establishments and bodies: Atomic Energy and Alternative Energies Commission (CEA); Rapport de l'AERES sur l'unite: Departement d'Etudes des Reacteurs (DER) sous tutelle des etablissements et organismes: CEA

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2011-02-15

    This report is a kind of audit report on a research laboratory, the DER (Departement d'Etudes des Reacteurs, Reactor Study Department) whose activity if focused on four main themes: neutron transport simulation in reactor cores, thermal-hydraulic simulation of reactors, design and safety of innovative reactors, nuclear instrumentation for reactors. The authors discuss an assessment of the whole unit activities in terms of strengths and opportunities, aspects to be improved, risks and recommendations, productions and publications, scientific quality, influence and attractiveness (awards, recruitment capacity, capacity to obtain financing and to tender, participation to international programs), strategy and governance, and project. These same aspects are then discussed and commented for each theme

  18. Report by the AERES on the unit: Fuel Study Department (DEC) under the supervision of the establishments and bodies: Atomic Energy and Alternative Energies Commission (CEA); Rapport de l'AERES sur l'unite: Departement d'Etudes des Combustibles (DEC) sous tutelle des etablissements et organismes: Commissariat a l'Energie Atomique et aux Energies Alternatives (CEA)

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2011-03-15

    This report is a kind of audit report on a research laboratory, the DEC (Departement d'Etudes des Combustibles, Fuel Study Department) which comprises four departments: a department of analysis and characterization of fuel behaviour (SA3C) which comprises four laboratories, a Plutonium, Uranium and Minor Actinides department (SPUA) which comprises four laboratories, a department for the investigation and simulation of fuel behaviour (four laboratories) and the Leca-Star department (3 laboratories and a project group). The authors discuss an assessment of the whole unit activities in terms of strengths and opportunities, aspects to be improved, risks and recommendations, productions and publications on different themes (fundamental research on fuels, fuel design, fabrications, characterizations and property measurements, experimental irradiations, characterization of irradiated fuels and chemical and radio-chemical analysis, modelling and simulation). A more detailed assessment is presented for each theme in terms of scientific quality, influence and attractiveness (awards, recruitment capacity, capacity to obtain financing and to tender, participation to international programs), strategy and governance, and project

  19. Swab culture monitoring of automated endoscope reprocessors after high-level disinfection

    Institute of Scientific and Technical Information of China (English)

    Lung-Sheng Lu; Keng-Liang Wu; Yi-Chun Chiu; Ming-Tzung Lin; Tsung-Hui Hu; King-Wah Chiu

    2012-01-01

    AIM:To conduct a bacterial culture study for monitoring decontamination of automated endoscope reprocessors (AERs) after high-level disinfection (HLD).METHODS:From February 2006 to January 2011,authors conducted randomized consecutive sampling each month for 7 AERs.Authors collected a total of 420 swab cultures,including 300 cultures from 5 gastroscope AERs,and 120 cultures from 2 colonoscope AERs.Swab cultures were obtained from the residual water from the AERs after a full reprocessing cycle.Samples were cultured to test for aerobic bacteria,anaerobic bacteria,and mycobacterium tuberculosis.RESULTS:The positive culture rate of the AERs was 2.0% (6/300) for gastroscope AERs and 0.8% (1/120)for colonoscope AERs.All the positive cultures,including 6 from gastroscope and 1 from colonoscope AERs,showed monofloral colonization.Of the gastroscope AER samples,50% (3/6) were colonized by aerobic bacterial and 50% (3/6) by fungal contaminations.CONCLUSION:A full reprocessing cycle of an AER with HLD is adequate for disinfection of the machine.Swab culture is a useful method for monitoring AER decontamination after each reprocessing cycle.Fungal contamination of AERs after reprocessing should also be kept in mind.

  20. Respuesta del lulo La Selva (Solanum quitoense x Solanum hirtum a la aplicación de fermentados aeróbicos tipo bocashi y fertilizante químico

    Directory of Open Access Journals (Sweden)

    Víctor Hugo Ramírez-Builes

    2010-04-01

    Full Text Available En un suelo derivado de cenizas volcánicas bien drenado y de alta fertilidad del municipio Ansermanuevo (zona cafetera de Colombia, en el cultivo de lulo (Solanum quitoense x S. hirtum se evaluaron tres fuentes orgánicas tipo bocashi, provenientes de los procesos de fermentación de pulpa de café, lombricompuesto y gallinaza y un tratamiento con fertilizante químico (10-30-10 más un testigo absoluto sin aplicación de fertilizantes. Se empleó un diseño experimental en bloques completos al azar con tres repeticiones, cada repetición estuvo constituida por 58 plantas. Las aplicaciones de materiales orgánicos mejoraron las características del suelo, estabilizando el pH, aumentando la capacidad de intercambio catiónico y la materia orgánica. En términos generales, el tratamiento de mejor desempeño fue el bocashi de gallinaza, con un promedio de cuajamiento de fruto de 38.3% y un mayor rendimiento (4.7 t/ha. Los bocashis de lombricompuesto y pulpa de café no fueron estadísticamente diferentes al tratamiento químico y todos los tratamientos fueron distintos (P < 0.05 al testigo, lo que demuestra la buena respuesta del cultivo de lulo a las aplicaciones de fuentes orgánicas.

  1. Microbiota cloacal aeróbia de cracídeos cativos no Rio Grande do Sul e sua susceptibilidade a antimicrobianos Cloacal microbiota identification and evaluation of the antimicrobial resistance in captive cracids from Rio Grande do Sul, Brazil

    Directory of Open Access Journals (Sweden)

    Helton Fernandes Santos

    2010-12-01

    Full Text Available Os cracídeos são aves silvestres que habitam as matas tropicais da América. Foram coletadas, no ano de 2007, amostras cloacais de 51 aves de dez espécies diferentes de cracídeos mantidos em cativeiros no Estado do Rio Grande do Sul. A partir dos swabs, colhidos assepticamente, foi realizado o isolamento e a caracterização bacteriana e o teste de susceptibilidade antimicrobiana dos isolados. Foram identificadas 93 cepas de bactérias. As bactérias mais frequentemente isoladas foram Escherichia coli, Staphylococcus spp. e Streptococcus spp. Todas as amostras foram negativas para o isolamento de Salmonella spp. O resultado do teste de sensibilidade mostrou que dentre as 93 cepas isoladas, todas foram sensíveis apenas ao imipinem. Adicionalmente, os menores percentuais de resistência foram observados frente ao cloranfenicol e ciprofloxacina. Os gêneros e espécies bacterianas com maior percentual de resistência a diferentes antibióticos testados foram Escherichia coli, Serratia marcescens, Staphylococcus aureus e Streptococcus spp. Com os resultados obtidos no presente trabalho, concluí-se, que a população de cracídeos estudada apresenta sua microbiota cloacal composta por vários gêneros e espécies bacterianas e que a multirresistencia pode ser um problema no futuro, uma vez que algumas cepas isoladas mostraram percentuais elevados de resistência a diferente antimicrobianos.Cracids are wildlife Galliformes which inhabits the America's tropical forests. Fifty one cloacal swabs were collected from 10 different species of captive cracids from the Rio Grande do Sul State during 2007. The cloacal swab samples were submitted to bacterial isolation, identification and, subsequently; antimicrobial susceptibility testing. Ninety three bacterial isolates were obtained from the cracid population examined. The most prevalent among the isolates were Escherichia coli, and bacteria from the Staphylococcus and Streptococcus genera. All samples tested in this study were negative for Salmonella spp. The antimicrobial susceptibility tests showed that none of the 93 strains presented resistance to the antimicrobial imipinem. In addition, the lower percentages of resistance were observed against cloranfenicol and ciprofloxacine. The bacteria genus and species with the highest percentage of resistance to the different antimicrobials examined were E. coli, Serratia marcescens, Staphylococcus spp. and Streptococcus spp. In conclusion, the data presented in this article demonstrate that the cloacal microbiota of the reported cracid population is composed of several bacterial genera and species and multi-drug resistance may be a problem for the future, since some strains showed elevated percentage of resistance against several different antimicrobials.

  2. Valores cefalométricos de las vías aeréas en una población infantil española y su relación con la clase esquelética

    OpenAIRE

    Pérez Rodríguez, Luis Miguel

    2015-01-01

    Introducción: El diagnóstico del patrón respiratorio en la telerradiografía lateral de cráneo, se realiza a través del estudio de la región adenoidea, el espacio aéreo libre de la nasofaringe y la bucofaringe, el paladar blando, la parte posterior de la lengua y la faringe. La respiración bucal está relacionada con la maloclusión de Clase II, el patrón de crecimiento vertical, la mordida cruzada posterior y la posición lingual baja. Objetivos: Identificar las normas cefalométricas de las vía...

  3. Report by the AERES on the unit: Research Centre on Ions, Materials and Photonic (CIMAP) - UMR 6252 under the supervision of the establishments and bodies: ENSICAEN, Caen University, CNRS, CEA

    International Nuclear Information System (INIS)

    This report is a kind of audit report on a research laboratory, the CIMAP (Centre of research on Ions, Materials and Photonic) whose activity is organized about two main themes: excited matter and defects (stability and fragmentation dynamics of molecules and aggregates, atom movements, defects and phase stability under irradiation, modelling of matter under electronic excitation) and materials and optics (micro- and nano-structured thin layer elaboration and investigation for microelectronics and optoelectronics, study of luminescent materials and implementation in laser devices, imagery and measurement optical instrumentation based on optical resonator properties). The authors discuss an assessment of the whole unit activities in terms of strengths and opportunities, aspects to be improved, risks and recommendations, productions and publications, scientific quality, influence and attractiveness (awards, recruitment capacity, capacity to obtain financing and to tender, participation to international programs), strategy and governance, and project. These same aspects are then discussed and commented for each sub-theme or team (AMA, SIMUL, MADIR, NIMPH, MIL, and LIOA)

  4. Magnitude da hipotensão pós-exercício aeróbio agudo: Uma revisão sistemática dos estudos randomizados

    Directory of Open Access Journals (Sweden)

    Ana Cristina Oliveira Marques-Silvestre

    2014-09-01

    Full Text Available Objetivou-se revisar sistematicamente estudos randomizados sobre a magnitude da hipotensão pós-exercício (HPE em adultos. Consultaram-se as bases Pubmed, Scielo e Lilacs, combinando os indexadores “exercise” e “hypotension”, sendo encontrados 1336 estudos. Destes, excluíram-se 1268 por títulos, 37 por resumos, 10 não randomizados, 1 por repetição de dados, restando 20. Estes foram avaliados segundo os itens de randomização, mascaramento, sigilo de alocação, análise por intenção de tratar e quantitativamente pela Escala de Jadad. As reduções das pressões sistólica (PAS e diastólica (PAD em normotensos foram inferiores à dos hipertensos (−9±3 vs −11±6 mmHg e −5±2 vs −8±6 mmHg, respetivamente. Em ambos os grupos, os indivíduos ativos apresentaram HPE maior que os sedentários (normotensos: PAS −10±4 vs −8±1 mmHg; PAD −5±1 vs −4±1 mmHg; hipertensos: PAS −16±4 vs −9±2 mmHg; PAD −7±4 vs −5±3 mmHg, respetivamente. Nestes estudos, a magnitude da HPE variou entre −4 a −19 mmHg para PAS e −2 a −9 mmHg para PAD, valores que dependem tanto das características da amostra, seus estágios pressóricos iniciais, sexo e nível de atividade física, como também do protocolo de exercício utilizado, não havendo consenso sobre a influência da sua duração ou da intensidade do exercício.

  5. Exposure of BALB/c mice to diesel engine exhaust origin secondary organic aer-osol (DE-SOA during the developmental stages impairs the social behavior in adult life of the males

    Directory of Open Access Journals (Sweden)

    Tin-Tin eWin-Shwe

    2016-01-01

    Full Text Available Secondary organic aerosol (SOA is a component of particulate matter (PM 2.5 and formed in the atmosphere by oxidation of volatile organic compounds. Recently, we have reported that inhalation exposure to diesel engine exhaust (DE originated SOA (DE-SOA affect novel object recognition ability and impair maternal behavior in adult mice. However, it is not clear whether early life exposure to SOA during the de-velopmental stages affect social behavior in adult life or not. In the present study, to investigate the effects of early life exposure to DE-SOA during the gestational and lactation stages on the social behavior in the adult life, BALB/c mice were exposed to clean air (control, DE, DE-SOA and gas without any particulate matter in the inhala-tion chambers from gestational day 14 to postnatal day 21 for 5 h a day and 5 days per week. Then adult mice were examined for changes in their social behavior at the age of 13 week by a sociability and social novelty preference, social interaction with a juvenile mouse and light-dark transition test, hypothalamic mRNA expression levels of social behavior-related genes, estrogen receptor-alpha and oxytocin receptor as well as of the oxidative stress marker gene, heme oxygenase (HO-1 by real-time RT-PCR method. In addition, hypothalamic level of neuronal excitatory marker, glutamate was determined by ELISA method. We observed that sociability and social novelty pref-erence as well as social interaction were remarkably impaired, expression levels of es-trogen receptor-alpha, oxytocin receptor mRNAs were significantly decreased, ex-pression levels of HO-1 mRNAs and glutamate levels were significantly increased in adult male mice exposed to DE-SOA compared to the control ones. Findings of this study indicate early life exposure of BALB/c mice to DE-SOA may affect their late-onset hypothalamic expression of social behavior related genes, trigger neurotoxi-city and impair social behavior in the males.

  6. Estudio de alternativas para la construcción de un hangar en el aeródromo de El Rebollar. Requena. Solución mediante pórtico mixto con celosía Pratt.

    OpenAIRE

    MACÍAS ARIAS, DAVID

    2016-01-01

    [EN] The Final Degree Project called "Study of alternatives for building a hangar in the airfield of El Rebollar. Requena", consists of the proposition of four different solutions which cover the construction of the hangar and the pavement linking it to the landing track. The airfield is situated within the municipality of Requena, a city inside the province of Valencia. The lack of space to store the aircrafts made necessary to take action, with planned dimensions of about 28x42 square me...

  7. Valoración funcional y niveles de actividad física en personas con discapacidad intelectual; efectos de un programa de actividad física aeróbico, de fuerza y equilibrio

    OpenAIRE

    Oviedo, Guillermo Ruben

    2014-01-01

    Les persones adultes amb discapacitat intel•lectual (DI) presenten baixos nivells de capacitat cardiovascular i força, al mateix temps que realitzen poca activitat física (AF) i freqüentment presenten problemes funcionals i d’equilibri. Un dels propòsits d’aquesta tesi fou investigar la fiabilitat del salt vertical en adults amb DI sobre una plataforma de contacte comparar-lo amb el test de salt de longitud sense impuls, normalment utilitzat en la bateria EUROFIT Special, per a avaluar la pot...

  8. Entrenamiento de la capacidad aeróbica por medio de la terapia acuática en niños con parálisis cerebral tipo diplejía espástica

    OpenAIRE

    Fajardo, Nandy; Moscoso, Fabiola

    2013-01-01

    Los autores de este artículo pretenden identificar las características que debe tener una propuesta de intervención fisioterapéutica para el entrenamiento de la capacidad aérobica en niños y niñas entre los 8 y los 12 años, con parálisis cerebral tipo diplejía espástica, empleando la terapia acuática.

  9. Perfil lipídico e glicêmico de ratos treinados em exercício aeróbio ou anaeróbio e suplementados com maltodextrina

    OpenAIRE

    Cátia Fernandes Leite; Cláudia Pinho Hartleben; Caroline Soares Magalhães; Airton José Rombaldi

    2013-01-01

    OBJETIVO: verificar as alterações no perfil lipídico e glicêmico de ratos treinados, suplementados com maltodextrina. MATERIAIS E MÉTODOS: o protocolo de treinamento consistiu de 8 semanas de natação em padrão contínuo (60min.dia-1) ou intermitente (2 períodos de 30min, com intervalo de 10min), com sobrecargas correspondentes a 5% e 10% do peso corporal, respectivamente. Durante 37 dias os animais foram suplementados com uma dose diária de 0,48g.kg-1 de maltodextrina dissolvida em água ou rec...

  10. Influência da cafeína na resposta pressórica ao exercício aeróbio em sujeitos hipertensos Caffeine influence on blood pressure response to aerobic exercise in hypertensive subjects

    Directory of Open Access Journals (Sweden)

    Raquel Freire Cazé

    2010-10-01

    Full Text Available A redução da pressão arterial (PA promovida pelo exercício físico é evidente segundo a literatura atual. Mecanismos neuro-humorais explicam essa resposta hipotensora, em que a diminuição da atividade simpática apresenta-se como um dos principais mecanismos. Porém, a ingestão de alimentos ricos em cafeína (CA pode suprimir esta atenuação simpática. O objetivo desse estudo foi elucidar o impacto da ingestão de CA na resposta pressórica ao exercício em pessoas hipertensas. Sete hipertensos (52,3 ± 3,3 anos, sendo cinco mulheres, realizaram duas sessões de caminhada com 40 minutos de duração, em dois dias de treinamento, tendo previamente ingerido CA (4mg/kg de peso corporal ou placebo (PL. A PA e a frequência cardíaca foram verificadas anteriormente a ingestão, após 15, 30, 45, 60 minutos da ingestão em estado de repouso e com 10, 20 e 30 minutos após o exercício. Os dados foram tratados por meio de estatística descritiva, e pelo teste não paramétrico de Wilcoxon (p Blood pressure reduction (BP promoted by physical exercise is evident according to the current literature. Neurohumoral mechanisms explain this hypotensive response, in which decrease of the sympathetic activity appears as one of its main mechanisms. However, the ingestion of caffeine-rich food (CA can suppress this sympathetic attenuation. The objective of this study was to elucidate the impact of CA ingestion in BP after exercise, in hypertensive individuals. Seven hypertensive subjects (52.3 +/-3.3 years, being 5 women, accomplished two walk sessions with 40 minutes of duration, in two days of training, having previously ingested CA (4 mg/kg of body weight or placebo (PL. BP and heart rate were verified previously to the ingestion, after 15, 30, 45, 60 minutes of the ingestion, at rest and with 10, 20 and 30 minutes after exercise. Data were treated through descriptive statistics and by the non-parametric Wilcoxon test (p<0.05. BP mean increased from 124.9/80.9 mmHg before ingestion to 129.4/84.3 mmHg 60 minutes later (p< 0.05. In the recovery period, after 30 minutes of exercise, hypotensive answer was observed in the PL procedure (decrease of 122.6/79.4 mmHg to 115.7/78.6 mmHg, while in the procedure with CA, BP was significantly higher than at rest (increase of 124.9/80.9 mmHg to 136.9/90.9 mmHg, p<0.05. It was concluded that CA not only suppresses the hypotensive response to exercise, but also provokes post-exercise hypertension.

  11. Potência aeróbica máxima, freqüência cardíaca e capacidade vital em ambientes normo e hiperbárico

    Directory of Open Access Journals (Sweden)

    Carlos Alberto Moreira

    1999-10-01

    Full Text Available Este estudo se propôs verificar variáveis fisiológicas. Revisando a literatura sobre o presente trabalho, levantaram-se vários tratados especificando as reações e adaptações tanto fisiológicas quanto comportamentais ocorridas no organismo durante o mergulho. Seguiu-se o modelo da pesquisa descritiva do tipo survey, da qual participaram mergulhadores da Marinha do Brasil, do sexo masculino, praticantes de atividades físicas num total de 9, com média da idade de 28 ± 4,3 anos, peso de 76,7 ± 8,32kg e estatura de 173,8 ± 6,33cm. Todos foram submetidos à avaliação de vários parâmetros fisiológicos determinados para o estudo ao nível do mar (ambiente normobárico e aos 18 metros de profundidade (ambiente hiperbárico, pressurizados em câmara hiperbárica, sendo verificadas as variáveis propostas em exercício. Os resultados são analisados no nível de significância de p 0,05 denota não existir diferença significativa entre os ambientes verificados. O consumo máximo de oxigênio (p = 0,00013; < 0,05 e a capacidade vital (p = 0,00126; < 0,05 denotam existir diferenças significativas entre os ambientes. Isto comprova a importância de conhecer as reações fisiológicas avaliadas e revisadas na literatura como componentes essenciais da performance, com ênfase na fisiologia do exercício hiperbárica.

  12. Modelagem da decomposição aeróbia de lodo de esgoto em solos com diferentes texturas Modeling of aerobic decomposition of sewage sludge in soils of different textures

    Directory of Open Access Journals (Sweden)

    Cláudia R. Teles

    2009-04-01

    Full Text Available Buscou-se, neste trabalho, avaliar o efeito do teor de argila sobre o processo de decomposição de lodo de esgoto disposto em solo e propor modelos matemáticos inserindo este efeito em seus parâmetros. Solos com texturas contrastantes originados de uma mesma matriz permitiram estabelecer melhores relações entre o teor de argila, biomassa microbiana e carbono orgânico total e a produção de CO2 do que experimentos similares da literatura em que foram utilizados solos de diferentes matrizes. O efeito do teor de argila se manifestou apenas no período inicial de 7 dias (R² = 0,59**. Modelos cinéticos foram propostos para modelar a decomposição de lodo em solos com diferentes texturas. Determinaram-se modelos de primeira ordem bifásicos, assumindo que a fase lenta e a rápida não ocorrem simultaneamente, enquanto os parâmetros do modelo correspondentes às fases lenta e rápida foram correlacionados ao teor de argila resultando em modelos matemáticos que evidenciaram o efeito deste fator no processo de decomposição ao mesmo tempo em que permitem prever seu efeito na produção de CO2.The objective of this study was to evaluate the effect of clay content on sewage sludge decomposition in soil and to propose mathematical models with clay dependent parameters. Soils with contrasting textures from the same sample matrix allowed better relationships to be derived between clay content, microbial biomass, organic carbon and CO2 production then those usually obtained in the literature. Clay effect was noticed only in the first week (R² = 0.59**. Kinetic models were proposed to model sludge decomposition in soils with different textures. Double phase first order models with non-simultaneous time scales were fitted to the data. Model parameters were correlated to clay content, emphasizing the clay effect on sewage sludge decomposition and providing a model for prediction of CO2 production.

  13. Diseño de plano de aeródromo para movimientos de tierra y rutas/modelos de superficie para aplicaciones de sistema GNSS. Aerouerto de Caudé (Teruel)

    OpenAIRE

    FERNÁNDEZ DE BOBADILLA SÁNCHEZ, PABLO

    2015-01-01

    [ES] Se realizará un estudio de los diferentes sistemas de guiado GNSS existentes en el mercado para navegación aerea tanto de ruta, como de aproximación y aterrizaje para dispositivos móviles, utilizando como base las diferentes cartas aeronaticas. En función del estudio realizado, se verá la posibilidad de desarrollar un sistema de guiado propio basandonos en los anteriores, y donde se integren las tecnologías Geomaticas. El objetivo de este proyecto es elaborar tres Planos alternativos de ...

  14. Respuesta del lulo La Selva (Solanum quitoense x Solanum hirtum a la aplicación de fermentados aeróbicos tipo bocashi y fertilizante químico

    Directory of Open Access Journals (Sweden)

    Ramírez-Builes Víctor Hugo

    2010-06-01

    Full Text Available En un suelo derivado de cenizas volcánicas bien drenado y de alta fertilidad del municipio Ansermanuevo (zona cafetera de Colombia, en el cultivo de lulo (Solanum quitoense x S. hirtum se evaluaron tres fuentes orgánicas tipo bocashi, provenientes de los procesos de fermentación de pulpa de café, lombricompuesto y gallinaza y un tratamiento con fertilizante químico (10-30-10 más un testigo absoluto sin aplicación de fertilizantes. Se empleó un diseño experimental en bloques completos al azar con tres repeticiones, cada repetición estuvo constituida por 58 plantas. Las aplicaciones de materiales orgánicos mejoraron las características del suelo, estabilizando el pH, aumentando la capacidad de intercambio catiónico y la materia orgánica. En términos generales, el tratamiento de mejor desempeño fue el bocashi de gallinaza, con un promedio de cuajamiento de fruto de 38.3% y un mayor rendimiento (4.7 t/ha. Los bocashis de lombricompuesto y pulpa de café no fueron estadísticamente diferentes al tratamiento químico y todos los tratamientos fueron distintos (P < 0.05 al testigo, lo que demuestra la buena respuesta del cultivo de lulo a las aplicaciones de fuentes orgánicas.

  15. Variaciones de los valores plasmáticos de lípidos, hidratos de carbono y hormonas en una prueba de intensidad creciente, en deportistas de resistencia aeróbica

    OpenAIRE

    Ansón Manso, Miguel Ángel; González Haro, Carlos; Escanero Marcén, Jesús Fernando; Soria Aznar, Marisol

    2013-01-01

    Validación de una prueba incremental para conocer el grado de entrenamiento de los deportistas y su futuro rendimiento en competición deportiva mediante la obtención del crossover o punto de cruce metabólico y verificación que las ecuaciones estequiométricas aplicadas se correlacionan con los procesos metabólicos determinantes de las mismas. Conocer la bioquímica del ejercicio y las variaciones sericas de glucosa y grasas a lo largo de todo el rango de intensidad del ejercicio y post-ejercici...

  16. A Century of American Economic Review

    OpenAIRE

    Torgler, Benno; Piatti, Marco

    2011-01-01

    Using information collected from American Economic Review publications of the last 100 years, we try to provide answers to various questions: Which are the top AER publishing institutions and countries? Which are the top AER papers based on citation success? How frequently is someone able to publish in AER? How equally is citation success distributed? Who are the top AER publishing authors? What is the level of cooperation among the authors? What drives the alphabetical name ordering? What ar...

  17. A Predictive Model for Vehicle Air Exchange Rates based on a Large, Representative Sample

    OpenAIRE

    Fruin, Scott A.; Hudda, Neelakshi; Sioutas, Constantinos; Delfino, Ralph J.

    2011-01-01

    The in-vehicle microenvironment is an important route of exposure to traffic-related pollutants, particularly ultrafine particles. However, significant particle losses can occur under conditions of low air exchange rate (AER) when windows are closed and air is recirculating. AERs are lower for newer vehicles and at lower speeds. Despite the importance of AER in affecting in-vehicle particle exposures, few studies have characterized AER and all have tested only a small number of cars. One reas...

  18. Co-Production of Quality in the Applied Education Research Scheme

    Science.gov (United States)

    Ozga, Jenny

    2007-01-01

    This contribution looks at the ways in which research quality is defined and addressed in the Applied Education Research Scheme (AERS), particularly within the network on Schools and Social Capital, which is one of the four areas of work within the overall AERS scheme. AERS is a five-year programme, funded jointly by the Scottish Executive and the…

  19. Identifying Housing and Meteorological Conditions Influencing Residential Air Exchange Rates in the DEARS and RIOPA Studies: Development of Distributions for Human Exposure Modeling

    Science.gov (United States)

    Appropriate prediction of residential air exchange rate (AER) is important for estimating human exposures in the residential microenvironment, as AER drives the infiltration of outdoor-generated air pollutants indoors. AER differences among homes may result from a number of fact...

  20. Diagrammatic Approach for Complete Automation of Relational Database Normalization at Conceptual Level

    Directory of Open Access Journals (Sweden)

    M.S. Patwardhan

    2010-11-01

    Full Text Available AER (Articulated Entity Relationship diagrams proposed by us, are the extension of EntityRelationship (ER diagrams to accommodate functional dependencies (FDs as their integral part.Accommodation of FDs in ER diagram helps to achieve total and unconditional automation of relationaldatabase normalization. In this paper we have implemented a software Integrated DevelopmentEnvironment (IDE, called AER IDE, designed by extending the Graphical Editing Framework (GEF andDraw2d plug-in functionality of Eclipse. The AER IDE helps to draw, validate, store and normalize AERdiagrams. An AER IDE has five modules. AER Editor allows creation and edition of AER diagrams usingModel View controller (MVC approach. AER diagrams are translated and stored as an xml file. AERValidator provides the facility of AER diagram validation based on a set of proposed rules. AERNormalizer allows normalization of an AER diagram, in one go, with the help of the proposed AERnormalization rules and algorithms. Thus, it allows the total and unconditional automation of relationaldatabase normalization up to a given normal form; as an integral part of AER IDE. It also serves as avisual aid for the normalization process which is always easy to understand and interpret rather thantheoretical approach. AER-XML Bidirectional Translator provides the import and export functionality ofAER diagram, to and from an XML template making it compatible with the other toolset. AER-SQLGenerator generates DDL scripts in the SQL schema format. The AER IDE is tested with ten distinct AERdiagrams with all possible combinations of AER features and validation rules.

  1. Diurnal and seasonal variation in air exchange rates and interzonal airflows measured by active and passive tracer gas in homes

    DEFF Research Database (Denmark)

    Bekö, Gabriel; Gustavsen, Sine; Frederiksen, Marie;

    2016-01-01

    dwellings across four seasons using active tracer gas. Night time AERs were also estimated in the bedrooms based on occupant-generated CO2. Passive tracer gas measurements were performed for comparison. AERs changed frequently during the day. Differences in outdoor AERs were observed between individual...... bedrooms across the four seasons was 0.49 h-1 with the active tracer gas technique and 1.20 h-1 with the CO2 method. The average winter AER in the five homes with the passive tracer (0.63 h-1) differed substantially from the corresponding AER measured with the active tracer gas (0.25 h-1). Additionally, we...

  2. Measuring and modeling air exchange rates inside taxi cabs in Los Angeles, California

    Science.gov (United States)

    Shu, Shi; Yu, Nu; Wang, Yueyan; Zhu, Yifang

    2015-12-01

    Air exchange rates (AERs) have a direct impact on traffic-related air pollutant (TRAP) levels inside vehicles. Taxi drivers are occupationally exposed to TRAP on a daily basis, yet there is limited measurement of AERs in taxi cabs. To fill this gap, AERs were quantified in 22 representative Los Angeles taxi cabs including 10 Prius, 5 Crown Victoria, 3 Camry, 3 Caravan, and 1 Uplander under realistic driving (RD) conditions. To further study the impacts of window position and ventilation settings on taxi AERs, additional tests were conducted on 14 taxis with windows closed (WC) and on the other 8 taxis with not only windows closed but also medium fan speed (WC-MFS) under outdoor air mode. Under RD conditions, the AERs in all 22 cabs had a mean of 63 h-1 with a median of 38 h-1. Similar AERs were observed under WC condition when compared to those measured under RD condition. Under WC-MFS condition, AERs were significantly increased in all taxi cabs, when compared with those measured under RD condition. A General Estimating Equation (GEE) model was developed and the modeling results showed that vehicle model was a significant factor in determining the AERs in taxi cabs under RD condition. Driving speed and car age were positively associated with AERs but not statistically significant. Overall, AERs measured in taxi cabs were much higher than typical AERs people usually encounter in indoor environments such as homes, offices, and even regular passenger vehicles.

  3. Implications of Climate Variability and Change for Smallholder Crop Production in Different Areas of Zimbabwe

    Directory of Open Access Journals (Sweden)

    K. Musiyiwa

    2014-08-01

    Full Text Available Sustainable food production in the rain-fed smallholder sector of Zimbabwe is imperative in current and future climates given the increasing proportion and role of the sector in food security. Backgrounds of the smallholder sector include low resource bases, declining soil productivity, climate variability and increasing human population. Impacts of climatic and non-climatic variables on crop production vary in different Agro-Ecological Regions (AERs. The study identifies the main climatic opportunities and constraints for sustainable rain-fed smallholder crop production systems in current and future climates. Estimated changes in rainfall and temperature by 2050 are not likely to negatively impact crop production in smallholder areas in AER I, increases in temperature may have negative impacts for most of AER III and IV. Most of AER V is likely to become unsuitable for sustainable maize production. Overall projections indicate increased differences in agricultural potential between smallholder farmers in AER I compared to those in AER II and III as well as those in AER IV and V and different management options. Proposed adaptation and coping strategies in AER I and some in AER II include intensification of agriculture and optimization of both C3 and C4 crop production while in AER III to V adoption of stress tolerant crops for family subsistence may be imperative.

  4. Predicting residential air exchange rates from questionnaires and meteorology: model evaluation in central North Carolina.

    Science.gov (United States)

    Breen, Michael S; Breen, Miyuki; Williams, Ronald W; Schultz, Bradley D

    2010-12-15

    A critical aspect of air pollution exposure models is the estimation of the air exchange rate (AER) of individual homes, where people spend most of their time. The AER, which is the airflow into and out of a building, is a primary mechanism for entry of outdoor air pollutants and removal of indoor source emissions. The mechanistic Lawrence Berkeley Laboratory (LBL) AER model was linked to a leakage area model to predict AER from questionnaires and meteorology. The LBL model was also extended to include natural ventilation (LBLX). Using literature-reported parameter values, AER predictions from LBL and LBLX models were compared to data from 642 daily AER measurements across 31 detached homes in central North Carolina, with corresponding questionnaires and meteorological observations. Data was collected on seven consecutive days during each of four consecutive seasons. For the individual model-predicted and measured AER, the median absolute difference was 43% (0.17 h(-1)) and 40% (0.17 h(-1)) for the LBL and LBLX models, respectively. Additionally, a literature-reported empirical scale factor (SF) AER model was evaluated, which showed a median absolute difference of 50% (0.25 h(-1)). The capability of the LBL, LBLX, and SF models could help reduce the AER uncertainty in air pollution exposure models used to develop exposure metrics for health studies.

  5. Effects of aer osol inhalation of heparin on arterial blood gas and coagulation function of patients with acute exacerbation of chronic obstructive pulmonary disease by mechanical ventilation%雾化吸入肝素对AECOPD机械通气患者血气及凝血功能的影响

    Institute of Scientific and Technical Information of China (English)

    牛艳霞; 程青虹; 王雯; 陈华丽; 龙检

    2014-01-01

    目的:研究雾化吸入肝素对慢性阻塞性肺疾病急性加重期( AECOPD )机械通气患者血气及凝血功能的影响。方法研究设计为随机的、前瞻性的、双盲的、临床干预的对照研究。将46例AECOPD机械通气患者随机分为肝素组(26例)和对照组(20例)。对照组使用0.45%氯化钠溶液10 mL单次雾化吸入;肝素组使用普通肝素钠(12500 IU ×4支)单次雾化吸入。不同时间点分别监测血气分析值及凝血功能值。结果肝素组动脉血氧分压( PaO2)、氧合指数( PaO2/FiO2)、动脉氧饱和度( SaO2)随着雾化时间的延长逐渐升高,优于对照组( P<0.05);与雾化前比较,第3、5、7天PaO 2、PaO 2/FiO 2、SaO 2呈逐渐上升趋势(P<0.05);两组雾化前、第3天动脉二氧化碳分压( PaCO2)比较差异无统计学意义(P>0.05),第5、7天PaCO2随着时间的延长组内比较差异有统计学意义( P<0.05);两组雾化前、第7天活化部分凝血活酶时间( APTT)、凝血酶原时间(PT)、纤维蛋白原(FIB)比较差异无统计学意义(P>0.05)。结论雾化吸入肝素治疗AECOPD机械通气患者是安全、有效的,可显著提高患者的动脉氧分压,降低二氧化碳分压,且对患者的凝血功能影响较小。%Objective To investigate the effects of aerosol inhalation of heparin on arterial blood gas and coagulation function of patients with acute exacerbation of chronic obstructive pulmonary disease ( AECOPD ) by mechanical ventilation .Methods Patients were collected for the prospective and double -blind clinical intervention . Forty six mechanically ventilated AECOPD patients were randomly divided into two groups .All patients received the same conventional treatment .The patients in the control group (20 cases) inhaled 0.45% saline (10 mL) as placebo; the patients in the heparin group (26 cases) inhaled ordinary heparin (12 500 IU ×4);both groups were single aerosol inhalation . Arterial blood analysis and coagulation function were detected in different timing .Results Compared with the control group , in the heparin group , the arterial blood gas indices of PaO 2 , PaO2/FiO2 , SaO2 with the extension of time were gradually increased (P0.05), but PaCO2 began to significantly increased in each group after 5, 7 days (P 0.05). Conclusion Atomizated inhalation o heparin for AECOPD patients by mechanical ventilation is safe and effective.It can significantly improve arterial partial pressure of oxygen , reduce carbon dioxide partial pressure, but minimal impact the patient's coagulation function .

  6. Selección mediante Simulación de una Estructura de Modelo Cinético para la Degradación Aeróbica de Efluentes de una Industria Láctea Selection by Simulation of a Model for the Kinetic Structure of an Aerobic Degradation System for Effluents from a Milk Industry

    Directory of Open Access Journals (Sweden)

    M.A. Rosa

    2004-01-01

    Full Text Available El propósito de este trabajo consiste en implementar una metodología de selección de estructuras de modelos cinéticos, para el caso concreto de la degradación aerobia de los efluentes industriales de una empresa láctea regional, utilizando como herramienta la simulación. Esta se encuentra disponible en un software comercial específico y consiste en configurar para uno o varios sustratos, un set de estructuras de modelos de complejidad creciente, con velocidades de degradación independientes, para evaluar el comportamiento del sistema mediante combinaciones de las mismas, confrontando los resultados obtenidos por simulación con los datos experimentales. Los resultados alcanzados para una estructura relativamente simple se consideran satisfactorios para ser implementados industrialmente. El aporte más importante lo constituye la convalidación tanto de la metodología propuesta como de la potencialidad del software para ser aplicado al análisis de situaciones reales, lo cual resulta de especial importancia para el análisis y diseño de plantas de tratamientoThis work consisted in implementing a methodology for the selection of kinetic model structures for a real case of aerobic degradation of industrial effluents from a regional milk industry using simulation as a tool. This tool is available in a specific commercial software and consists of making configurations for one or several substrates with a set of structural models of increasing complexity and independent degradation velocities. The behavior of the system is evaluated using various combinations of the preceding considerations and comparing the simulated results with industrial experimental data. The results obtained using a relatively simple structure were satisfactory for industrial application. The most important contribution was the proof that both the proposed methodology and the power of the software could be applied to real situations, which is of especial importance for the analysis and design of treatment plants

  7. Viabilidade do tratamento de água residuária sintética têxtil em reator aeróbio de leito fixo Viability of the synthetic textile wastewater treatment in a fixed-bed aerobic reactor

    Directory of Open Access Journals (Sweden)

    Kelly Rodrigues

    2010-03-01

    Full Text Available Um reator de escoamento contínuo, inoculado com Aspergillus niger AN400, possuía volume total de 5 L e foi operado a 29ºC, com oito horas de tempo de detenção hidráulica e 150 L.h-1 de vazão de ar, para remover 25 mg.L-1 de corante vermelho do congo de água residuária sintética. A alimentação do reator foi realizada em duas fases: Fase I, com 0,5 g.L-1 de sacarose e Fase II, sem sacarose. Na Fase I, foi possível observar eficiências de remoção de matéria orgânica (mg de DQO.L-1 e de cor (mg PT.L-1 de 80 ± 16% e 82 ± 10% (mg Pt.L-1, respectivamente. Na Fase II, a eficiência de remoção de matéria orgânica foi de 75 ± 13% e de cor (mg Pt.L-1 de 89 ± 7%. As maiores remoções de nutrientes foram alcançadas pelo reator na Fase I, com 25% de amônia, 90% de nitrito, 93% de nitrato e 21% de fósforo. Aparentemente, a presença de sacarose melhorou a remoção dos nutrientes.A continuous flow reactor, inoculated with Aspergillus niger AN400, with total volume of 5 L was operated at 29oC, with eight hours of retention hydraulic time and 150 L.h-1 of air flow rate in order to remove 25 mg.L-1 of Congo Red dye from a synthetic wastewater. The feeding of the reactor, inoculated with Aspergillus niger AN400, was done in two phases: Phase I, with 0,5 g/L of saccharose and Phase II, with no saccharose. In Phase I, it was possible to verify efficiencies of organic matter and color (mg Pt.L-1 removal of 80 ± 16% and 82 ± 10%, respectively. In Phase II, the efficiency of organic matter removal was 75 ± 13% and color removal was 89 ± 7%. The higher removals of nutrients were achieved by the reactor in Phase I with 25% to ammonia, 90% to nitrite, 93% to nitrate and 21% to phosphorus. Apparently, the presence of saccharose improved the removal of the nutrients.

  8. Co-burning of assorted industrial waste consisting of paper, plastic and wood in a bio plant not classified for waste burning; Sameldning av returbraenslen i form av papper, plast och trae i fastbraenslepanna som idag ej aer klassad foer avfall

    Energy Technology Data Exchange (ETDEWEB)

    Stroemberg, M. [Gaevle Kraftvaerme AB, Gaevle (Sweden); Erdegren, P. [JD-Gruppen AB, Solna (Sweden)

    2002-01-01

    With the purpose to investigate the possibilities to burn mixed-in assorted industrial waste in existing bio-fuelled solid fuel boilers, a test combustion was performed during one week in a 70 MW bubbling bed bio plant. The test was performed at Gaevle Kraftvaerme's bio plant 'Johannes' during the winter 2001. The purpose with the test combustion was to evaluate the environmental, technical and economical consequences of combustion with 20% (by volume) addition of assorted industrial waste. Remaining fuel was bark and RT-chips. The assorted industrial waste was taken out by manual screening of arriving waste and consisted of paper, plastic and wood from industries and bulky waste. Regarding flue gas emissions during the test combustion all anticipated new emission stipulations according the EU Directive were met with exception of TOC. For CO, the anticipated stipulation was met during the test, however due to CO-variations independent of type of solid fuel, measures must be taken to meet the anticipated more severe CO-demand. By rearranging the air supply system to the boiler, the new TOC and CO-stipulations are expected to be met. As the flue gas emissions were recorded both ahead and after the flue gas condensation, the separation herein could be calculated. For dust, SO{sub 2} and dioxin the separation rates were around 50-60% and for HCI and NH{sub 3} around 90-95%. The EU Directive stipulation for emissions to water was met for all components. During the test, the coating formation on super heater tubes was measured. The result indicates that the growth rate and chloride content of the coating increased when industrial waste was added. However it is difficult to establish what impact it will have on the life of the tubes. The analyses of the various ashes from the plant indicated an increase of primarily Cr Cu, Pb and Sb. During the test, the temperature was measured at a cross section of the furnace. The result from these measurements indicates a higher mean temperature and large variation between the various measure points with addition of waste. According to the presented calculation method, the EU Directive stipulation of 2 seconds retention time in the furnace above 850 deg C was met. For the plant in question it is estimated that an 8 MSEK investment is required in order to permanently burn with a waste mixture as described above. The operation costs are expected to increase with ca 2,5 MSEK annually (1SEK = 0.1 USD). As a conclusion the test was successful without any practical operation problems and the test result indicates that the emission stipulations can be met. If the assorted industrial waste could be delivered to the plant at a price less than 50 SEK/MWh a permanent conversion would be profitable.

  9. Influência do treinamento físico aeróbio no transporte mitocondrial de ácidos graxos de cadeia longa no músculo esquelético: papel do complexo carnitina palmitoil transferase Influence of aerobic physical training in the motochondrial transport of long chain fatty acids in the skeletal muscle: role of the carnitine palmitoil transferase

    Directory of Open Access Journals (Sweden)

    Alex Shimura Yamashita

    2008-04-01

    Full Text Available O ácido graxo (AG é uma importante fonte de energia para o músculo esquelético. Durante o exercício sua mobilização é aumentada para suprir as necessidades da musculatura ativa. Acredita-se que diversos pontos de regulação atuem no controle da oxidação dos AG, sendo o principal a atividade do complexo carnitina palmitoil transferase (CPT, entre os quais três componentes estão envolvidos: a CPT I, a CPT II e carnitina acilcarnitina translocase. A função da CPT I durante o exercício físico é controlar a entrada de AG para o interior da mitocôndria, para posterior oxidação do AG e produção de energia. Em resposta ao treinamento físico há um aumento na atividade e expressão da CPT I no músculo esquelético. Devido sua grande importância no metabolismo de lipídios, os mecanismos que controlam sua atividade e sua expressão gênica são revisados no presente estudo. Reguladores da expressão gênica de proteínas envolvidas no metabolismo de lipídios no músculo esquelético, os receptores ativados por proliferadores de peroxissomas (PPAR alfa e beta, são discutidos com um enfoque na resposta ao treinamento físico.Fatty acids are an important source of energy for the skeletal muscle. During exercise, their mobilization is increased to supply the muscle energetic needs. Many points of regulation act in the fatty acids metabolism, where the carnitine palmytoiltransferase (CPT complex is the main control system. Three compounds named CPT I, CPT II and carnitine acyl carnitine translocase (CACT are components of this system. Its function is to control the influx of fatty acids inside the mitochondria for posterior oxidation and energy production. There is a pronounced increase in both activity and gene expression of CPT I in the skeletal muscle in response to exercise. Due to its importance in lipid metabolism, the controlling mechanisms are reviewed in the present study. The modulation of gene expression by peroxisome proliferator-activated receptors (PPARs alpha and beta during the physical training is also discussed in this review.

  10. Efeito do retorno de lodo aeróbio sobre as características da biomassa presente em reatores UASB tratando esgoto sanitário Effect of aerobic sludge return on the characteristics of anaerobic biomass present in UASB reactors treating domestic sewage

    Directory of Open Access Journals (Sweden)

    Patrícia Procópio Pontes

    2009-06-01

    Full Text Available O presente trabalho buscou avaliar a influência do retorno do lodo produzido em filtros biológicos percoladores (FBP sobre as características da biomassa em reatores UASB utilizados para o tratamento de esgoto sanitário. Os experimentos foram conduzidos em reatores em escala piloto e em escala de demonstração, sendo que os reatores UASB foram operados com e sem retorno do lodo produzido nos FBP. Os resultados obtidos indicaram uma diminuição no diâmetro das partículas de lodo, durante as fases com retorno de lodo, mas apenas para as amostras de lodo tomadas nos pontos mais altos dos reatores anaeróbios. A estabilidade e a atividade metanogênica específica do lodo anaeróbio praticamente não se modificaram com o retorno de lodo. Conforme esperado, a produção específica de lodo anaeróbio aumentou com o retorno de lodo.This work aimed at evaluating the influence of the return of excess aerobic sludge produced in trickling filters (TF upon the biomass characteristics in UASB reactors used for the treatment of domestic sewage. The experiments were carried out in pilot and demonstration-scale reactors, with the UASB reactors being operated with and without the return of sludge produced in the TF. Smaller sludge particle sizes were observed when the aerobic sludge was returned to the UASB reactor, but only for sludge samples collected in the upper parts of the anaerobic reactors. Sludge stability and specific methanogenic activity were not affected by the return of sludge. As expected, the specific anaerobic sludge production increased with the return of sludge.

  11. Reproducibility of maximum aerobic power (VO2max among soccer players using a modified heck protocol Reprodutibilidade da potência aeróbia máxima (VO2max em jogadores de futebol utilizando o protocolo de heck modificado

    Directory of Open Access Journals (Sweden)

    Paulo Roberto Santos-Silva

    2007-01-01

    Full Text Available OBJECTIVE: To determine the degree of reproducibility of maximum oxygen consumption (VO2max among soccer players, using a modified Heck protocol. METHODS: 2 evaluations with an interval of 15 days between them were performed on 11 male soccer players. All the players were at a high performance level; they were training for an average of 10 hours per week, totaling 5 times a week. When they were evaluated, they were in the middle of the competitive season, playing 1 match per week. The soccer players were evaluated on an ergometric treadmill with velocity increments of 1.2 km.h-1 every 2 minutes and a fixed inclination of 3% during the test. VO2max was measured directly using a breath-by-breath metabolic gas analyzer. RESULTS: The maximum running speed and VO2max attained in the 2 tests were, respectively: (15.6 ± 1.1 vs. 15.7 ± 1.2 km.h-1; [P = .78] and (54.5 ± 3.9 vs. 55.2 ± 4.4 ml.kg-1.min-1; [P = .88]. There was high and significant correlation of VO2max between the 2 tests with a 15-day interval between them [r = 0.97; P OBJETIVO: Determinar o grau de reprodutibilidade do consumo máximo de oxigênio (VO2max em jogadores de futebol utilizando o protocolo de Heck modificado. MÉTODOS: Foram avaliados por duas vezes, com intervalo de 15 dias entre os testes, 11 futebolistas masculinos. Todos eram de alto nível, treinavam em média 10 horas por semana subdivididos em treinamentos físicos, técnicos, táticos e jogos competitivos, totalizando cinco vezes por semana e na fase em que foram avaliados se encontravam em pleno período competitivo realizando um jogo por semana. Os futebolistas foram avaliados em esteira ergométrica (1,2 km.h-1 a cada dois minutos e inclinação fixa durante o teste em 3%. O VO2max foi medido diretamente utilizando analisador metabólico de análise de gases expirados respiração-a-respiração. RESULTADOS: A velocidade máxima de corrida e o VO2max atingido nos dois testes foram respectivamente: (15,6 ± 1,1 vs. 15,7 ± 1,2 km.h-1; [p = 0,78] e (54,5 ± 3,9 vs. 55,2 ± 4,4 ml.kg-1.min-1; [P = 0,88]. Houve correlação significante e alta do VO2max entre os dois testes após 15 dias de intervalo [r = 0,97; P< 0,001]. CONCLUSÃO: O protocolo de Heck modificado foi reprodutível e o intervalo de quinze dias entre os testes ergoespirométricos não foi suficiente para modificar significativamente o VO2max dos jogadores de futebol.

  12. Respuesta del lulo La Selva (Solanum quitoense x Solanum hirtum a la aplicación de fermentados aeróbicos tipo bocashi y fertilizante químico Response of the lulo fruit cv. La Selva (Solanum quitoense x Solanum hirtum at the aerobic organic and inorganic fertilizer applications

    Directory of Open Access Journals (Sweden)

    Víctor Hugo Ramírez-Builes

    2010-04-01

    Full Text Available En un suelo derivado de cenizas volcánicas bien drenado y de alta fertilidad del municipio Ansermanuevo (zona cafetera de Colombia, en el cultivo de lulo (Solanum quitoense x S. hirtum se evaluaron tres fuentes orgánicas tipo bocashi, provenientes de los procesos de fermentación de pulpa de café, lombricompuesto y gallinaza y un tratamiento con fertilizante químico (10-30-10 más un testigo absoluto sin aplicación de fertilizantes. Se empleó un diseño experimental en bloques completos al azar con tres repeticiones, cada repetición estuvo constituida por 58 plantas. Las aplicaciones de materiales orgánicos mejoraron las características del suelo, estabilizando el pH, aumentando la capacidad de intercambio catiónico y la materia orgánica. En términos generales, el tratamiento de mejor desempeño fue el bocashi de gallinaza, con un promedio de cuajamiento de fruto de 38.3% y un mayor rendimiento (4.7 t/ha. Los bocashis de lombricompuesto y pulpa de café no fueron estadísticamente diferentes al tratamiento químico y todos los tratamientos fueron distintos (P In this study four fertilization treatments in lulo crop (Solanum quitoense x S.hirtum were evaluated, three organic with several manure sources like coffee skin , earthworm residues and chicken manure, and a four treatment consisted of inorganic fertilizer with a composition of 10-30-30 ( N,P,K and a control without fertilizer applications. A complete block random design with three replications was used and each replication with 58 plants. The organic fertilization increase the soil pH, cation exchange capacity and soil organic matter. The best treatment was the aerobic fermented, based on chicken manure with a fruit yield average of 4731 kg .ha-1, the rest of the organic treatments did no showed statistical differences with the inorganic fertilization and all were statistical different with the control without fertilizer applications, which showed a good crop response to the organic applications.

  13. Screening Azadirachta indica tree for enhancing azadirachtin and oil contents in dry areas of Gujarat, India

    Institute of Scientific and Technical Information of China (English)

    U.K. Tomar; G. Singh; N. Kaushik

    2011-01-01

    Azadirachta indica seed samples were collected from four different agro-ecological regions (AERs) viz., AER-2, AER-4, AER-5A and AER-5B of Gujarat state, India during 2000 to 2002 with an aim to assess variability in azadirachtin, oil and fatty acids content of the seeds and assess correlation of these parameters with morphological characters.Azadirachtin, oil and fatty acids content indicated significant (p<0.01)variations between years and AERs in Gujarat. The azadirachtin ranged from 142 to 9527 μg·g-1 seed kernel with an average of 2426 μg·g-1 for the state. AER-5B recorded highest azadirachtin and oil content. Fatty acid composition was found to be affected by environmental factors particularly varying degree of annual rainfall and temperature during fruit ripening period. Conclusively trees growing in AER-5B performed better in term of azadirachtin, oil and stearic acid content. Tree girth at breast height showed no significant relation with these biochemicals.

  14. A May American Economic Review Papers Seminar and an Analytic Project for Advanced Undergraduates

    Science.gov (United States)

    Elliott, Catherine S.

    2004-01-01

    The author describes two learning activities for teaching economics at the advanced undergraduate level: a May American Economic Review (AER) papers seminar and an analytic project. Both activities help students learn to "do economics." The May AER papers seminar promotes in-depth synthesis and interpretation on the basis of printed session papers…

  15. 100 Years of the American Economic Review : The Top 20 Articles

    OpenAIRE

    Kenneth J. Arrow; B. Douglas Bernheim; Martin S. Feldstein; Daniel L. McFadden; James M. Poterba; Solow, Robert M.

    2011-01-01

    This paper presents a list of the top 20 articles published in the American Economic Review during its first 100 years. This list was assembled in honor of the AER 's one-hundredth anniversary by a group of distinguished economists at the request of AER 's editor. A brief description accompanies the citations of each article.

  16. A nation-wide cross-sectional study of urinary albumin excretion rate, arterial blood pressure and blood glucose control in Danish children with type 1 diabetes mellitus. Danish Study Group of Diabetes in Childhood

    DEFF Research Database (Denmark)

    Mortensen, H B; Marinelli, K; Nørgaard, K;

    1990-01-01

    than 20 to 150 micrograms min-1 were compared with those for 569 diabetic adolescents with AER less than or equal to 20 micrograms min-1 and duration of diabetes more than 2 years. The group with AER greater than 20 to 150 micrograms min-1 had significantly higher mean age (16.5 years) than the group...

  17. Measurement of air exchange rates in different indoor environments using continuous CO2 sensors

    Institute of Scientific and Technical Information of China (English)

    Yan YOU; Can Niu; Jian Zhou; Yating Liu; Zhipeng Bai; Jiefeng Zhang; Fei He; Nan Zhang

    2012-01-01

    A new air exchange rate (AER) monitoring method using continuous CO2 sensors was developed and validated through both laboratory experiments and field studies.Controlled laboratory simulation tests were conducted in a 1-m3 environmental chamber at different AERs (0.1-10.0 hr-1).AERs were determined using the decay method based on box model assumptions.Field tests were conducted in classrooms,dormitories,meeting rooms and apartments during 2-5 weekdays using CO2 sensors coupled with data loggers.Indoor temperature,relative humidity (RH),and CO2 concentrations were continuously monitored while outdoor parameters combined with on-site climate conditions were recorded.Statistical results indicated that good laboratory performance was achieved:duplicate precision was within 10%,and the measured AERs were 90%-120% of the real AERs.Average AERs were 1.22,1.37,1.10,1.91 and 0.73 hr-1 in dormitories,air-conditioned classrooms,classrooms with an air circulation cooling system,reading rooms,and meeting rooms,respectively.In an elderly particulate matter exposure study,all the homes had AER values ranging from 0.29 to 3.46 hr-1 in fall,and 0.12 to 1.39 hr-1 in winter with a median AER of 1.15.

  18. Annual Percentage Rate and Annual Effective Rate: Resolving Confusion in Intermediate Accounting Textbooks

    Science.gov (United States)

    Vicknair, David; Wright, Jeffrey

    2015-01-01

    Evidence of confusion in intermediate accounting textbooks regarding the annual percentage rate (APR) and annual effective rate (AER) is presented. The APR and AER are briefly discussed in the context of a note payable and correct formulas for computing each is provided. Representative examples of the types of confusion that we found is presented…

  19. Mutagenic and antimutagenic effects of aqueous extract of rosemary (Rosmarinus officinalis L.) on meristematic cells of Allium cepa.

    Science.gov (United States)

    Felicidade, I; Lima, J D; Pesarini, J R; Monreal, A C D; Mantovani, M S; Ribeiro, L R; Oliveira, R J

    2014-01-01

    Polyphenolic compounds present in rosemary were found to have antioxidant properties, anticarcinogenic activity, and to increase the detoxification of pro-carcinogens. The aim of the study was to determine the effect the aqueous extract of rosemary (AER) on mutagenicity induced by methylmethane sulfonate in meristematic cells of Allium cepa, as well as to describe its mode of action. Anti-mutagenicity experiments were carried out with 3 different concentrations of AER, which alone showed no mutagenic effects. In antimutagenicity experiments, AER showed chemopreventive activity in cultured meristematic cells of A. cepa against exposure to methylmethane sulfonate. Additionally, post-treatment and simultaneous treatment using pre-incubation protocols were the most effective. Evaluation of different protocols and the percent reduction in DNA indicated bioantimutagenic as well desmutagenic modes of action for AER. AER may be chemopreventive and antimutagenic. PMID:25501210

  20. Secondary spontaneous pneumothorax associated with emphysema and ruptured bullae at the azygoesophageal recess

    International Nuclear Information System (INIS)

    With secondary spontaneous pneumothorax (SSP) associated with emphysema, lesions responsible for pneumothorax can be located anywhere along the lung surface. Among such lesions, ruptured bullae at the azygoesophageal recess (AER) have received little attention thus far. We conducted a retrospective study of 38 right SSP patients with emphysema who underwent surgery. Among them, we reviewed the clinical characteristics and technical problems of patients with surgically proven ruptured bullae at the AER. Ruptured bullae at the AER were found in 10 of 38 patients. They accounted for 26.3% of all 38 patients and for 66.7% of 15 patients whose bullae at the AER were identified by preoperative computed tomography (CT). On CT, all the bullae were relatively large and oriented in a predominantly vertical axis. At surgery, they were confirmed as white, thin-walled structures originating from the mediastinal part of the apical segment of the right lower lobe. Surgery typically consisted of stapling bullectomy with video-assisted thoracic surgery. Technical problems in surgical treatment included poor mobilization of the base of the bulla and a restricted working space. Bullae at the AER are common and possibly lead to rupture. The presence of a bulla at the AER seen by CT can be predictive of rupture. Although the AER is a unique location, video-assisted bullectomy is the method of choice for treating these lesions. (author)

  1. Effects of caffeine (3 mg on maximal oxygen consumption, plasmatic lactate and reaction time after maximum effort. Efectos de la utilización de 3 mg de cafeína sobre los niveles de potencia aeróbica máxima, de lactato plasmático y del tiempo de reacción simple, ambos después de la realización de esfuerzo máximo.

    Directory of Open Access Journals (Sweden)

    Siqueira Rodrigues, André Valentim

    2006-10-01

    Full Text Available AbstractThe stimulants caffeine effects on sport performance have been widely investigated. The Maximal Oxygen Uptake (MOU has been used inrecent researches which aim to elucidate mechanisms of caffeine during maximal effort. As a physiological pattern to evaluate the effect of caffeine during the effort and after it (recovery, plasmatic lactate is presented in many studies. In this context, the present study aimed to investigate physiological changes: VO2 MAX on an ergometric device (speed and grade on a treadmill; plasmatic lactate (L and modification of cognitive and motor performance (Reaction Time Test - RTT produced by caffeine. Five apparently healthy volunteers (26 ± 5 years; 67 ± 12.5 kg were submitted twice to the following routine: plasmatic lactate at rest (L 0, reaction time test at rest RTT (R, maximum effort test on treadmill, plasmatic lactate concentrations at minute 1 (L 1, 2 (L 2 and 4 (L 3after effort, and RTT (1. They were given either one placebo capsule (400 mg corn starch or caffeine (3 mg/kg of body weight. Two-way ANOVA with repetition was used to compare variables at placebo (P and caffeine (C moments. The caffeine moment presented non-significant reduction in RRT, non-significant increase in plasmatic lactate and non-significant modification in VO2 MAX, when compared to placebo moment. Thus, one can conclude that 3 mg/kg/bw of caffeine with 12h of abstinence, presented non-significant effects in maximal oxygen uptake, plasmatic lactate and in simple reaction time.ResumenLos efectos estimulantes de la cafeína en el desarrollo atlético vienen siendo ampliamente investigados. El consumo Máximo de Oxígeno (VO2 MAX ha sido empleado en estudios recientes que buscan elucidar los mecanismos de la cafeína durante el esfuerzo máximo através de métodos neurológico así como fisiológicos. En este contexto, este estudio objetiva analizar las variaciones generadas por la cafeína en respuestas ergoespirométrica (VO2 MAX, plasmática (Lactato-L y motora (Test del Tiempo de Reacción – TTR. Para eso, 5 individuos hígidos, todos hombres, (26 ± 5 años, 67 ± 12,5 kg se sometieron dos veces a la siguiente rutina: dosaje de lactato plasmático (L0, TTR (0, test de esfuerzo máximo en estera ergométrica, dosaje de lactato (L1, (L2, (L3, y TTR(1. Les fue administrada una cápsula de 400 mg de placebo (almidón de maíz o 3 mg/kg/peso corpóreo (pc de cafeína. Fue empleada la ANOVA de dos factores con repetición para la comparación de las variables en los momentos C, P. El momento cafeína presentó reducción no significativa en el tiempo de reacción, en el lactato plasmático y en VO2 MAX. Así, se puede concluir que cafeína 3 mg/kg/pc con abstinencia de 12 h. no presenta efectos significativos en el consumo máximo de oxígeno, así como en la concentración de lactato plasmático y en el tiempo de reacción simple.

  2. O estilo de vida de pacientes hipertensos de um programa de exercício aeróbico: estudo na Cidade de Toluca, México El estilo de vida de pacientes hipertensos de un programa de ejercicio aerobio: estudio en la Ciudad de Toluca, México The life style of the hypertensive patient of a program of aerobic exercise: study in the Toluca City, Mexico

    Directory of Open Access Journals (Sweden)

    Cleotilde Garci Reza

    2008-06-01

    Full Text Available A hipertensão arterial, assintomática e desconhecida pela maioria dos seus por tadores, é importante fator de risco para complicações cardiovasculares e renais. Este é um estudo quantitativo e descritivo. Objetivou identificar os estilos de vida associados ao incremento do descontrole da pressão ar terial em pacientes hipertensos que acodem a um programa de exercício. A coleta dos dados ocorreu num centro de saúde do município do Toluca, México, durante agosto 2006 a março 2007. Foi utilizado um questionário aplicado a 200 pacientes hipertensos, através do referencial do "Modelo de Campo de Saúde da Lalonde". O estudo mostrou que o nível de pressão do grupo estudado possui relação estatisticamente significativa com o tabagismo, consumo de álcool e tratamento. A falta do controle da pressão arterial pode propiciar a evolução de doenças cardiovasculares e coronárias.La hipertensión arterial es asintomatica y desconocida por la mayorías de sus portadores y es un impor tante factor de riesgo para complicaciones cardiovasculares y renales. Este es un estudio cuantitativo y descriptivo. Con el objetivo de evaluar el estilo de vida de pacientes hiper tensos registrados en un programa de ejercicio aerobio. La colecta de los datos ocurrió en un centro de salud del municipio de Toluca, México, durante agosto de 2006 a marzo de 2007. Fue utilizado un cuestionario aplicado a 200 pacientes hiper tensos, a través del referencial del "Modelo Campo de Salud de Lalonde". El estudio muestra que existe relación estadística entre los niveles de presión ar terial, con el tabaquismo, consumo de alcohol, y el tratamiento. La falta del control de la presión arterial puede propiciar la evolución de enfermedades cardiovasculares y coronarias.Hypertension is an asymptomatic and an unnoticed disease for the majority of hypertensive individuals and an important long-term factor of risk for cardiovascular and renal complications. It is quantitative and descriptive study. The study aims to evaluate hypertenses’s lifestyles in a program of aerobic exercise. The collection of data was made in a health center of Mexico City, during the months of August in 2006 to March in 2007. A questionnaire was applied to 200 hypertenses, using the referencial framework of Lalonde: "Field of Health Model". The study showed the existing statistic relationship between the levels of arterial pressure, smoking habits, consumption of alcohol and the monitoring of their blood pressure condition. The lack of control of the ar terial pressure may propitiate the evolution of coronary and cardiovascular illnesses.

  3. Kondase Keskuses näeb saare meeste tagaaia kunsti / Sigrid Saarep

    Index Scriptorium Estoniae

    Saarep, Sigrid

    2004-01-01

    Saaremaa, Hiiumaa ja Kihnu iseõppinud kunstnikest ja nende loomingust: Harri Aer, Lembar Linder, Maido Toll, Aleksander Tarvis, Jaan Oad, Karla Krall, Olev Johannes. Näitus "Mehed metsast ja mere äärest" Kondase Keskuses

  4. Development and Evaluation of a New Air Exchange Rate Algorithm for the Stochastic Human Exposure and Dose Simulation Model (ISES Presentation)

    Science.gov (United States)

    Previous exposure assessment panel studies have observed considerable seasonal, between-home and between-city variability in residential pollutant infiltration. This is likely a result of differences in home ventilation, or air exchange rates (AER). The Stochastic Human Exposure ...

  5. Suicide attempts, platelet monoamine oxidase and the average evoked response

    International Nuclear Information System (INIS)

    The relationship between suicides and suicide attempts and two biological measures, platelet monoamine oxidase levels (MAO) and average evoked response (AER) augmenting was examined in 79 off-medication psychiatric patients and in 68 college student volunteers chosen from the upper and lower deciles of MAO activity levels. In the patient sample, male individuals with low MAO and AER augmenting, a pattern previously associated with bipolar affective disorders, showed a significantly increased incidence of suicide attempts in comparison with either non-augmenting low MAO or high MAO patients. Within the normal volunteer group, all male low MAO probands with a family history of suicide or suicide attempts were AER augmenters themselves. Four completed suicides were found among relatives of low MAO probands whereas no high MAO proband had a relative who committed suicide. These findings suggest that the combination of low platelet MAO activity and AER augmenting may be associated with a possible genetic vulnerability to psychiatric disorders. (author)

  6. Juuru Mihkli Kiriku Oreli Fond võttis endale uue ülesande / Tauno Kibur

    Index Scriptorium Estoniae

    Kibur, Tauno

    2009-01-01

    Oreli fond on võtnud ülesandeks restaureerida koguduse ajalooline pastoraat. Hoone eskiisi tegi Raivi Juks. Oreli restaureerimist ja tulemust jääb fikseerima Juuru oreli plaat, mille muusikapalad mängis sisse Kristel Aer

  7. The Economic History of the American Economic Review : A Century's Explosion of Economics Research

    OpenAIRE

    Margo, Robert A.

    2011-01-01

    Written in celebration of the upcoming 100th anniversary of the American Economic Review (February 2011), this paper recounts the history of the journal. The recounting has an analytic core that sees the American Economic Association as an organization supplying goods and services to its members, one of which is the AER. Early in its history the AER was a multi-purpose publication with highly disparate content. Over time the economics profession expanded and more economics research was produc...

  8. Characterization of CetA and CetB, a bipartite energy taxis system in Campylobacter jejuni

    OpenAIRE

    Elliott, Kathryn T; DiRita, Victor J.

    2008-01-01

    The energy taxis receptor Aer, in Escherichia coli, senses changes in the redox state of the electron transport system via an flavin adenine dinucleotide cofactor bound to a PAS domain. The PAS domain (a sensory domain named after three proteins Per, ARNT and Sim, where it was first identified) is thought to interact directly with the Aer HAMP domain to transmit this signal to the highly conserved domain (HCD) found in chemotaxis receptors. An apparent energy taxis system in Campylobacter jej...

  9. The Sony Ericsson WTA Tour 10 year age eligibility and professional development review

    OpenAIRE

    Otis, C L; M. Crespo; Flygare, C T; Johnston, P R; Keber, A; Lloyd‐Kolkin, D; Loehr, J; Martin, K; Pluim, B M; Quinn, A; Roetert, P; Stroia, K A; Terry, P C

    2006-01-01

    Concerns have long existed over the participation of adolescent athletes in professional sports. In 2004, the Sony Ericsson WTA Tour (WTA Tour) commissioned a Professional Development Advisory Panel (PDAP) to evaluate the WTA Tour's age eligibility rule (AER) and professional development programmes (PDPs) for female tennis players since their inception in 1995. More than 75% of the 628 respondents supported the principles of the AER, and 90% indicated a need for PDPs. Statistical analysis of ...

  10. The development of automatic emotion regulation in an implicit emotional Go/NoGo paradigm and the association with depressive symptoms and anhedonia during adolescence

    Directory of Open Access Journals (Sweden)

    Wenhai Zhang

    2016-01-01

    Full Text Available Impaired automatic emotion regulation (AER is closely related to major depressive disorder. Our research in adults has identified two AER-related components, Go N2 and NoGo P3, in an implicit emotional Go/NoGo paradigm. However, it is unclear whether Go N2 and NoGo P3 reflect the development of AER in adolescents and the relationship of these components with subclinical depressive symptoms and trait anhedonia. We collected EEG data from 55 adolescents while they completed the implicit emotional Go/NoGo task. After the experiment, the subjects completed the Chinese version of the Temporal Experience of Pleasure Scale and the Beck Depression Inventory. Consistent with results in adults, we determined that Go N2 represents automatic top-down attention to emotions in Go trials, whereas NoGo P3 represents automatic response inhibition in NoGo trials. These AER components exhibited age-dependent improvement during adolescence. Additionally, NoGo P3 amplitudes elicited by viewing positive faces were positively correlated with trait anhedonia, whereas NoGo P3 amplitudes elicited by viewing negative faces were negatively correlated with depressive symptoms. Our observations provide further understanding of the neurodevelopmental mechanism of AER and yield new insight into dissociable impairments in AER in adolescents with major depressive disorder during positive and negative implicit processing.

  11. Effect of seed sludge on nitrogen removal in a novel upflow microaerobic sludge reactor for treating piggery wastewater.

    Science.gov (United States)

    Meng, Jia; Li, Jiuling; Li, Jianzheng; Wang, Cheng; Deng, Kaiwen; Sun, Kai

    2016-09-01

    Anaerobic activated sludge (AnaS) and aerobic activated sludge (AerS) were used to start up a novel upflow microaerobic sludge reactor (UMSR), respectively, and the nitrogen removal in the two reactors were evaluated when treating low C/N ratio manure-free piggery wastewater with a COD/TN ration of about 0.85. With the same hydraulic retention time 8h and TN loading rate (NLR) 0.42kg/(m(3)d), the UMSR (R2) inoculated with AerS could reach its steady state earlier and obtained a better TN removal than that in the UMSR (R1) inoculated with AnaS. However, the accumulated AnaS made R1 show a better capability in bearing shock load and demonstrated an excellent NH4(+)-N and TN removal with a NLR as high as 1.07kg/(m(3)d). Microbial community structure of the accumulated AerS and AnaS were observable different. The decreased proportion of nitrifiers restricted the ammonium oxidation in R2, and resulting in a decrease in TN removal. PMID:27218438

  12. On the scale estimation using truncated swath measurements from low Earth orbiting satellites

    Science.gov (United States)

    Liu, Qi

    2013-05-01

    Truncation effect caused by limited swath width of low Earth orbiting (LEO) satellites results in inevitable underestimation of object scale when using pixel-counting methods. A new approach is proposed to obtain more accurate object scale through truncated measurements. The approach is based upon the mean object area fraction (MOAF), which depicts the relative population of object points in a varying-size domain and proves to be less sensitive to truncation effect. The MOAF-equivalent radius (MER) is deduced by comparing the actual MOAF with the standard one inferred from a circle object. Numerical simulations are implemented to demonstrate the MER characteristics. In contrast to area-equivalent radius (AER) that is merely determined by the absolute amount of object points, MER relies on the overall spatial structure of the object. For objects with irregular shapes, the MER value is generally smaller than AER in the absence of truncation. Nevertheless, taking the actual AER as true scale, MER has significantly reduced biases compared to AER once the object is truncated. This advantage can be reinforced when focusing on size statistics of analogous objects, because negative and positive biases associated with various truncation situations coexist in MER, against the uniform negative biases of AER. When applied to MODIS cloud mask data that are restricted in individual granules, MER has consistently larger values than AER for most truncated clouds. Compared with the explicitly problematic estimation from AER due to truncation, MER offers a notable elevation on the estimated cloud size and gets closer to the truth.

  13. Comparative study on adsorption of perfluorooctane sulfonate (PFOS) and perfluorooctanoate (PFOA) by different adsorbents in water.

    Science.gov (United States)

    Yao, Yuan; Volchek, Konstantin; Brown, Carl E; Robinson, Adam; Obal, Terry

    2014-01-01

    Perfluorinated compounds (PFCs) are emerging environmental pollutants. Perfluorooctane sulfonate (PFOS) and perfluorooctanoate (PFOA) are the two primary PFC contaminants that are widely found in water, particularly in groundwater. This study compared the adsorption behaviors of PFOS and PFOA on several commercially available adsorbents in water. The tested adsorbents include granular activated carbon (GAC: Filtrasorb 400), powdered activated carbon, multi-walled carbon nanotube (MCN), double-walled carbon nanotube, anion-exchange resin (AER: IRA67), non-ion-exchange polymer, alumina, and silica. The study demonstrated that adsorption is an effective technique for the removal of PFOS/PFOA from aqueous solutions. The kinetic tests showed that the adsorption onto AER reaches equilibrium rapidly (2 h), while it takes approximately 4 and 24 h to reach equilibrium for MCN and GAC, respectively. In terms of adsorption capacity, AER and GAC were identified as the most effective adsorbents to remove PFOS/PFOA from water. Furthermore, MCN, AER, and GAC proved to have high PFOS/PFOA removal efficiencies (≥98%). AER (IRA67) and GAC (Filtrasorb 400) were thus identified as the most promising adsorbents for treating PFOS/PFOA-contaminated groundwater at mg L(-1) level based on their equilibrium times, adsorption capacities, removal efficiencies, and associated costs. PMID:25521134

  14. Annual Energy Review 2002

    Energy Technology Data Exchange (ETDEWEB)

    Seiferlein, Katherine E. [USDOE Energy Information Administration (EIA), Washington, DC (United States)

    2003-10-01

    The Annual Energy Review (AER) presents the Energy Information Administration’s historical energy statistics. For many series, statistics are given for every year from 1949 through 2002. The statistics, expressed in either physical units or British thermal units, cover all major energy activities, including consumption, production, trade, stocks, and prices, for all major energy commodities, including fossil fuels, electricity, and renewable energy sources. Publication of this report is required under Public Law 95–91 (Department of Energy Organization Act), Section 205(c), and is in keeping with responsibilities given to the Energy Information Administration (EIA) under Section 205(a)(2), which states: “The Administrator shall be responsible for carrying out a central, comprehensive, and unified energy data and information program which will collect, evaluate, assemble, analyze, and disseminate data and information....” The AER is intended for use by Members of Congress, Federal and State agencies, energy analysts, and the general public. EIA welcomes suggestions from readers regarding data series in the AER and in other EIA publications. Related Publication: Readers of the AER may also be interested in EIA’s Monthly Energy Review, which presents monthly updates of many of the data in the AER. Contact our National Energy Information Center for more information.

  15. CARACTERÍSTICAS ESPECIAIS DA GINÁSTICA DE ACADEMIA NO SEU PROCESSO EVOLUTIVO NO BRASIL

    Directory of Open Access Journals (Sweden)

    Sandra Barbosa da Costa

    2008-07-01

    Full Text Available O objetivo do presente trabalho é descrever criticamente a evolução da ginástica de academia a partir do surgimento da dança aeróbica nos Estados Unidos da América (EUA, na década de 70. Para tanto, foi utilizada a análise documental e a revisão de literatura como procedimentos denominados "Gerações da Ginástica Aeróbica". A Dança Aeróbica, versão antecessora da Ginástica Aeróbica, surgiu nos EUA com a bailarina Jacki Sorensen, como uma forma alternativa de aquisição de condicionamento cardiovascular. Esta atividade associava rítmico-musicalmente saltos e deslocamentos aproveitando elementos coreográficos da Dança. Movimentos que posteriormente passariam a ser substituídos por exercícios calistênicos, paulatinamente, introduzidos por Professores de Educação Física e artistas como Jane Fonda, transformando, assim, a dança aeróbica em ginástica aeróbica (GA. Além das características técnicas que permearam o desenvolvimento da GA, abordamos também, neste trabalho, as implicações individuais e sociais desta disciplina, devido ao fato de ela estar diretamente ligada à reprodução de valores de consumo da sociedade capitalista. Consumismo, culto ao corpo, individualismo e narcisismo são algumas das conseqüências contraditórias que marcaram seu desenvolvimento no Brasil e no mundo.

  16. The apical ectodermal ridge of the mouse model of ectrodactyly Dlx5;Dlx6-/- shows altered stratification and cell polarity, which are restored by exogenous Wnt5a ligand.

    Science.gov (United States)

    Conte, Daniele; Garaffo, Giulia; Lo Iacono, Nadia; Mantero, Stefano; Piccolo, Stefano; Cordenonsi, Michelangelo; Perez-Morga, David; Orecchia, Valeria; Poli, Valeria; Merlo, Giorgio R

    2016-02-15

    The congenital malformation split hand/foot (SHFM) is characterized by missing central fingers and dysmorphology or fusion of the remaining ones. Type-1 SHFM is linked to deletions/rearrangements of the DLX5-DLX6 locus and point mutations in the DLX5 gene. The ectrodactyly phenotype is reproduced in mice by the double knockout (DKO) of Dlx5 and Dlx6. During limb development, the apical ectodermal ridge (AER) is a key-signaling center responsible for early proximal-distal growth and patterning. In Dlx5;6 DKO hindlimbs, the central wedge of the AER loses multilayered organization and shows down-regulation of FGF8 and Dlx2. In search for the mechanism, we examined the non-canonical Wnt signaling, considering that Dwnt-5 is a target of distalless in Drosophila and the knockout of Wnt5, Ryk, Ror2 and Vangl2 in the mouse causes severe limb malformations. We found that in Dlx5;6 DKO limbs, the AER expresses lower levels of Wnt5a, shows scattered β-catenin responsive cells and altered basolateral and planar cell polarity (PCP). The addition of Wnt5a to cultured embryonic limbs restored the expression of AER markers and its stratification. Conversely, the inhibition of the PCP molecule c-jun N-terminal kinase caused a loss of AER marker expression. In vitro, the addition of Wnt5a on mixed primary cultures of embryonic ectoderm and mesenchyme was able to confer re-polarization. We conclude that the Dlx-related ectrodactyly defect is associated with the loss of basoapical and PCP, due to reduced Wnt5a expression and that the restoration of the Wnt5a level is sufficient to partially reverts AER misorganization and dysmorphology. PMID:26685160

  17. The apical ectodermal ridge of the mouse model of ectrodactyly Dlx5;Dlx6−/− shows altered stratification and cell polarity, which are restored by exogenous Wnt5a ligand

    Science.gov (United States)

    Conte, Daniele; Garaffo, Giulia; Lo Iacono, Nadia; Mantero, Stefano; Piccolo, Stefano; Cordenonsi, Michelangelo; Perez-Morga, David; Orecchia, Valeria; Poli, Valeria; Merlo, Giorgio R.

    2016-01-01

    The congenital malformation split hand/foot (SHFM) is characterized by missing central fingers and dysmorphology or fusion of the remaining ones. Type-1 SHFM is linked to deletions/rearrangements of the DLX5–DLX6 locus and point mutations in the DLX5 gene. The ectrodactyly phenotype is reproduced in mice by the double knockout (DKO) of Dlx5 and Dlx6. During limb development, the apical ectodermal ridge (AER) is a key-signaling center responsible for early proximal–distal growth and patterning. In Dlx5;6 DKO hindlimbs, the central wedge of the AER loses multilayered organization and shows down-regulation of FGF8 and Dlx2. In search for the mechanism, we examined the non-canonical Wnt signaling, considering that Dwnt-5 is a target of distalless in Drosophila and the knockout of Wnt5, Ryk, Ror2 and Vangl2 in the mouse causes severe limb malformations. We found that in Dlx5;6 DKO limbs, the AER expresses lower levels of Wnt5a, shows scattered β-catenin responsive cells and altered basolateral and planar cell polarity (PCP). The addition of Wnt5a to cultured embryonic limbs restored the expression of AER markers and its stratification. Conversely, the inhibition of the PCP molecule c-jun N-terminal kinase caused a loss of AER marker expression. In vitro, the addition of Wnt5a on mixed primary cultures of embryonic ectoderm and mesenchyme was able to confer re-polarization. We conclude that the Dlx-related ectrodactyly defect is associated with the loss of basoapical and PCP, due to reduced Wnt5a expression and that the restoration of the Wnt5a level is sufficient to partially reverts AER misorganization and dysmorphology. PMID:26685160

  18. Avaliação ergoespirométrica em atleta paraolímpico de esqui alpino: estudo de caso = Cardiopulmonary exercise test on a treadmill for a paralympic alpine skiing athlete: case study

    Directory of Open Access Journals (Sweden)

    Vinagre, Nelson Alexandre Campos

    2012-01-01

    Conclusões: O esquiador pôde responder ao procedimento de diferentes cargas durante o teste. No teste aplicado o atleta tem que aprender a gerenciar sua resistência, força e capacidades coordenativas. A avaliação da capacidade aeróbica poderá ajudar o desempenho durante o treinamento e competições, visto que os atletas devem dividir sua atenção com uma gama de exigências que juntas são atendidas em grande parte pelo sistema aeróbio

  19. A Defense of RBC:Understanding the Puzzling Effects of Technology Shocks

    OpenAIRE

    Yi Wen; Pengfei Wang

    2008-01-01

    The research led by Gali (AER 1999) and Basu et al. (AER 2006) raises two important questions regarding the validity of the RBC theory: (i) How important are technology shocks in explaining the business cycle? (ii) Do impulse responses to technology shocks found in the data reject the assumption of flexible prices? This paper argues that the conditional impulse responses of the U.S. economy to technology shocks are not grounds to reject the notion that technology shocks are the main driving f...

  20. Understanding the puzzling effects of technology shocks

    OpenAIRE

    Pengfei Wang; Yi Wen

    2007-01-01

    The research led by Gali (AER 1999) and Basu et al. (AER 2006) raises two important questions regarding the validity of the RBC theory: (i) How important are technology shocks in explaining the business cycle? (ii) Do impulse responses to technology shocks found in the data reject the assumption of flexible prices? This paper argues that the conditional impulse responses of the U.S. economy to technology shocks are not grounds to reject the notion that technology shocks are the main driving f...

  1. Measurement and ALE3D Simulation of Violence in a Deflagration Experiment With LX-10 and Aermet-100 Alloy

    Energy Technology Data Exchange (ETDEWEB)

    Knap, J; McClelland, M A; Maienschein, J L; Howard, W M; Nichols, A L; deHaven, M R; Strand, O T

    2006-06-22

    We describe the results of a Scaled-Thermal-Explosion-eXperiment (STEX) for LX-10 (94.7 % HMX, 5.3 % Viton A) confined in an AerMet 100 (iron-cobalt-nickel alloy) tube with reinforced end caps. The experimental measurements are compared with predictions of an Arbitrary-Lagrangian-Eulerian (ALE3D) computer model. ALE3D is a three-dimensional multi-physics computer code capable of solving coupled equations describing thermal, mechanical and chemical behavior of materials. In particular, we focus on the processes linked to fracture and fragmentation of the AerMet tube driven by the LX-10 deflagration.

  2. Modelado de sistemas de inteligencia ambiental para el entrenamiento de las cualidades físicas

    OpenAIRE

    Gaeta, Eugenio

    2012-01-01

    En un ejercicio no extenuante la frecuencia cardíaca (FC) guarda una relación lineal con el consumo máximo de oxígeno (V O2max) y se suele usar como uno de los parámetros de referencia para cuantificar la capacidad del sistema cardiovascular. Normalmente la frecuencia cardíaca puede remplazar el porcentaje de V O2max en las prescripciones básicas de ejercicio para la mejora de la resistencia aeróbica. Para obtener los mejores resultados en la mejora de la resistencia aeróbica, el entrenamient...

  3. The Nitrogen Balance of Three Long-term Agroecosystems on a Boreal Soil in Western Canada

    Energy Technology Data Exchange (ETDEWEB)

    Ross, Shirley M.; Izaurralde, Roberto C.; Janzen, H. H.; Robertson, J. A.; Mcgill, William B.

    2008-09-01

    Nitrogen (N) budgets can be used to quantify the flows of N in agroecosystems and to account for differences in losses and retention of N. The objective of our study was to develop 24-year N budgets for three diverse cropping systems on a boreal soil at Breton, Alberta, Canada: AER an agroecological 8-year rotation, with N inputs from legumes [fababean (Vicia faba L.), red clover (Trifolium pratense L.), alfalfa (Medicago sativa L.)] and manure; CF - a continuous perennial grass legume forage system, with N inputs from fertilizer (18 kg N ha-1 yr-1) and white clover (Trifolium repens L.); and CG - a continuous annual grain system, with N fertilizer (90 kg N ha-1 yr-1). We were able to compile detailed N budgets, demonstrate accumulation of soil N, and attribute differences in N flow and permanence to treatment effects. For AER and CG, net inputs almost exactlymatched gains in soil N. The AER system had the highest N flow and the largest net N accumulation. Soil total N mass to 30 cm depth increased in all systems during 1980 2005, but increases were smaller in CG (0.59 Mg N ha-1) than in AER (1.90 Mg N ha-1) and CF (1.63 Mg N ha-1), showing the effect of legumes, perennial species, and manure in the latter systems. The proportion of total N inputs retained as soil N with organic N inputs in AER (44%) was about twice that with synthetic N fertilizer in CG (23%). The CF system had the lowest productivity and the least N loss to the environment (4 kg N ha-1 yr-1, compared to 28 for AER and 24 for CG). The proportion of N inputs lost to the environment was 16% for AER and 24% for CG. In CF, gains of soil N exceeded apparent net N inputs, perhaps because we under-estimated N inputs from clover. Estimate of legume N input was one of the larger sources of uncertainty. The study affirmed the value of N budgets in evaluating agroecosystem performance, and identified AER and CF as productive and sustainable systems due to their minimal reliance on external N inputs and small

  4. Taking care of the energy for tomorrow. Advice to the Minister of Economic Affairs

    International Nuclear Information System (INIS)

    The central question of the Dutch Minister of Economic Affairs to the General Energy Council (AER) is to determine the risks for Europe and the Netherlands with regard to the energy supply security in the long term and what national and European policy must be developed and implemented to reduce those risks, focusing on the different market parties and governments (national and European) and the relation between the supply security and the environment. In particular, the AER should address geopolitical aspects, fuel mix and capacity shortage in the production of electricity

  5. Congenital malformations of the flipper in three West Indian manatees, Trichechus manatus, and a proposed mechanism for development of ectrodactyly and cleft hand in mammals.

    Science.gov (United States)

    Watson, A G; Bonde, R K

    1986-01-01

    Three cases of congenital ectrodactyly of the flipper in the manatee are described, including one case of bilaterally-symmetrical cleft hand. A hypothesis assumes that a defect in the apical ectodermal ridge (AER) in the developing hand plate of the early embryo is the initiating factor in the development of ectrodactylous and cleft hand malformations in man and other mammals. Variations in the site, extent, and time of the AER defect will account for many of the morphologic variations observed in these congenital malformations.

  6. Continuation of the VVER burnup credit benchmark. Evaluation of CB1 results, overview of CB2 results to date, and specification of CB3

    International Nuclear Information System (INIS)

    A calculational benchmark focused on VVER-440 burnup credit, similar to that of the OECD/NEA/NSC Burnup Credit Benchmark Working Group, was proposed on the 96'AER Symposium. Its first part, CB1, was specified there whereas the second part, CB2, was specified a year later, on 97'AER Symposium in Zittau. A final statistical evaluation is presented of CB1 results and summarizes the CB2 results obtained to date. Further, the effect of an axial burnup profile of VVER-440 spent fuel on criticality ('end effect') is proposed to be studied in the CB3 benchmark problem of an infinite array of VVER-440 spent fuel rods. (author)

  7. Annual Energy Review 2010

    Energy Technology Data Exchange (ETDEWEB)

    None

    2011-10-01

    This twenty-ninth edition of the Annual Energy Review (AER) presents the U.S. Energy Information Administration’s (EIA) most comprehensive look at integrated energy statistics. The summary statistics on the Nation’s energy production, consumption, trade, stocks, and prices cover all major energy commodities and all energy-consuming sectors of the U.S. economy from 1949 through 2010. The AER is EIA’s historical record of energy statistics and, because the coverage spans six decades, the statistics in this report are well-suited to long-term trend analysis.

  8. Research in Modeling and Simulation for Airspace Systems Innovation

    Science.gov (United States)

    Ballin, Mark G.; Kimmel, William M.; Welch, Sharon S.

    2007-01-01

    This viewgraph presentation provides an overview of some of the applied research and simulation methodologies at the NASA Langley Research Center that support aerospace systems innovation. Risk assessment methodologies, complex systems design and analysis methodologies, and aer ospace operations simulations are described. Potential areas for future research and collaboration using interactive and distributed simula tions are also proposed.

  9. Graph plotting for RELAP-UK

    International Nuclear Information System (INIS)

    A FORTRAN program for plotting graphs for RELAP-UK is described. The program uses the GHOST graph plotting package and has been implemented on the ICL 4-70 at AEE Winfrith and the IBM 370/168 at AERE Harwell. (author)

  10. PLOTGEOMX: a program for display of a neutron target assembly by means of a GHOST plotting system

    International Nuclear Information System (INIS)

    The program PLOTGEOM has been modified to work on the A.E.R.E., Harwell IBM 370-167 computer using the GHOST graphics package. The control data routine has been altered to permit free format input and the program has been compiled and stored using the extended-H FORTRAN optimising compiler. (author)

  11. Iridescent aerodynamic contrails. The Norderney case of 27 June 2008

    Energy Technology Data Exchange (ETDEWEB)

    Gierens, Klaus; Kaestner, Martina [Deutsches Zentrum fuer Luft- und Raumfahrt, Oberpfaffenhofen (Germany). Inst. fuer Physik der Atmosphaere; Klatt, Dieter [Deutsches Zentrum fuer Luft- und Raumfahrt, Oldenburg (Germany). Inst. fuer Physik der Atmosphaere

    2011-06-15

    An iridescent aerodynamic contrail (AerC) of a 2-engine aircraft flying from Amsterdam to Copenhagen was observed and photographed at Norderney on 27 June 2008, 14:06 UTC. In order to see whether this event was caused by an unusual weather situation we investigate the meteorological situation. It turns out that the situation allows AerC to become visible because it was warm enough and sufficiently moist. The dynamical situation is studied, and it seems that the stable stratification at the flight level of 350 hPa supports the appearance of an AerC. Additionally we investigate the ambient cloudiness where interesting halo features have been displayed in cirrus clouds. We examine the special colours of the Norderney aerodynamic contrail which allows to conclude that the width of the ice crystal size distribution is the factor directly relevant for iridescence, in this case representing a mixture from different growth histories. Finally we present an argumentation that AerC can be differentiated from jet contrails as soon as they display iridescence which requires an angular distance from the sun of less than about 30 . (orig.)

  12. Defect modelling

    International Nuclear Information System (INIS)

    Calculations, drawing principally on developments at AERE Harwell, of the relaxation about lattice defects are reviewed with emphasis on the techniques required for such calculations. The principles of defect modelling are outlined and various programs developed for defect simulations are discussed. Particular calculations for metals, ionic crystals and oxides, are considered. (UK)

  13. AcEST: BP916178 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ribosomal protein S20 OS=Nitrobacter ha... 31 3.3 sp|Q9I2Q2|METH_PSEAE Methionine synthase OS=Pseudomonas a...KGDRDAAIQAMKRAEPE 57 >sp|Q9I2Q2|METH_PSEAE Methionine synthase OS=Pseudomonas aer

  14. Annual energy review 1992

    International Nuclear Information System (INIS)

    This eleventh edition of the Annual Energy Review (AER) presents the Energy Information Administration's historical energy statistics. For most series, statistics are given for every year from 1949 through 1992. Because coverage spans four decades, the statistics in this report are well-suited to tong-term trend analyses. The AER is comprehensive. It covers all major energy activities, including consumption, production, trade, stocks, and prices, all major energy commodities, including fossil fuels and electricity. The AER also presents statistics on some renewable energy sources. For the most part, fuel-specific data are expressed in physical units such as barrels, cubic feet, and short tons. The integrated summary data in Section 1 are expressed in Btu. The Btu values are calculated using the conversion factors in Appendix A. Statistics expressed in Btu are valuable in that they allow for comparisons among different fuels and for the calculation of in the integrated summary statistics such as US consumption of Energy. The AER emphasizes domestic energy statistics

  15. Annual Energy Review, 2008

    Energy Technology Data Exchange (ETDEWEB)

    None

    2009-06-01

    The Annual Energy Review (AER) is the Energy Information Administration's (EIA) primary report of annual historical energy statistics. For many series, data begin with the year 1949. Included are statistics on total energy production, consumption, trade, and energy prices; overviews of petroleum, natural gas, coal, electricity, nuclear energy, renewable energy, and international energy; financial and environment indicators; and data unit conversions.

  16. 4. VIII avati Kuressaare linnuses näitus "Mehed metsast ja mere äärest"

    Index Scriptorium Estoniae

    2004-01-01

    Väljas on Saaremaa, Hiiumaa ja Kihnu iseõppinud kunstnike (Jaan Oad, Aleksander Tarvis, Lembar Linder, Harri Aer, Maido Toll, Karla Krall, Olev Johannes, Voldemar Õun, Alma Õispuu ja Tundmatu) tööd

  17. Nuclear Physics division progress report

    International Nuclear Information System (INIS)

    Work undertaken by the Nuclear Physics Division of AERE, Harwell during 1980 is presented under the headings: (1) Nuclear Data and Technology for Nuclear Power. (2) Nuclear Studies. (3) Applications of Nuclear and Associated Techniques. (4) Accelerator Operation, Maintenance and Development. Reports, publications and conference papers presented during the period are given and members of staff listed. (U.K.)

  18. Improving the toughness of ultrahigh strength steel

    Energy Technology Data Exchange (ETDEWEB)

    Soto, Koji

    2002-08-15

    The ideal structural steel combines high strength with high fracture toughness. This dissertation discusses the toughening mechanism of the Fe/Co/Ni/Cr/Mo/C steel, AerMet 100, which has the highest toughness/strength combination among all commercial ultrahigh strength steels. The possibility of improving the toughness of this steel was examined by considering several relevant factors.

  19. Publii papinii statii thebaidos : Liber Secundus commentario exegetico aesthetique instructus

    NARCIS (Netherlands)

    Mulder, Heine Melle

    1954-01-01

    Interea gelidis Maia satus aliger umbris iussa gerens magni remeat Iovis; undique pigrae ire vetant nubes et turbidus inplicat aer, nec zephyri rapuere gradum, sed foeda silentis aura poli. Styx inde novem circumflua campis, hinc obiecta vias torrentum incendia cludunt. Zie: hoofdstuk 1

  20. Complete Genome Sequences of Aerococcus christensenii CCUG 28831T, Aerococcus sanguinicola CCUG 43001T, Aerococcus urinae CCUG 36881T, Aerococcus urinaeequi CCUG 28094T, Aerococcus urinaehominis CCUG 42038 BT, and Aerococcus viridans CCUG 4311T

    DEFF Research Database (Denmark)

    Carkaci, Derya; Dargis, Rimtas; Nielsen, Xiaohui Chen;

    2016-01-01

    Strains belonging to the genus Aerococcus are causative agents of human and animal infections, including urogenital infections, bacteremia/septicemia, and infective endocarditis. This study reports the first fully closed and complete genome sequences of six type strains belonging to the genus Aer...... Aerococcus using a combination of Illumina HiSeq and PacBio sequencing technologies...

  1. Development and Evaluation of a New Air Exchange Rate Algorithm for the Stochastic Human Exposure and Dose Simulation Model

    Science.gov (United States)

    between-home and between-city variability in residential pollutant infiltration. This is likely a result of differences in home ventilation, or air exchange rates (AER). The Stochastic Human Exposure and Dose Simulation (SHEDS) model is a population exposure model that uses a pro...

  2. "Need to Know" Versus "Spread the Word": Collective Action in the Multi-Player Electronic Mail Game

    NARCIS (Netherlands)

    de Jaegher, K.

    2008-01-01

    As shown by Rubinstein (1989, AER), in the two-player electronic mail game, players are better off if the extent to which they can check each other’s information, check each other’s information about each other’s information, etc., is limited. This paper investigates to what extent this result exten

  3. The Arts and Australian Education: Realising Potential. Australian Education Review No. 58

    Science.gov (United States)

    Ewing, Robyn

    2011-01-01

    Australian Education Review (AER) 58 surveys the international and national research on the role and effect of arts-rich programming in schools and in the broader community, and examines the policies and practices that inhibit or support these initiatives. It puts the case that embedding the Arts in learning would be a powerful catalyst for…

  4. Identification of atypical Aeromonas salmonicida : Inter-laboratory evaluation and harmonization of methods

    DEFF Research Database (Denmark)

    Dalsgaard, Inger; Gudmundsdottir, B.K.; Helgason, S.;

    1998-01-01

    The atypical isolates of Aeromonas salmonicida are becoming increasingly important as the frequency of isolation of bacteria belonging to this group continues to rise. The primary object of this study was to compare and evaluate the results obtained in various laboratories concerning the biochemi......The atypical isolates of Aeromonas salmonicida are becoming increasingly important as the frequency of isolation of bacteria belonging to this group continues to rise. The primary object of this study was to compare and evaluate the results obtained in various laboratories concerning the...... biochemical identification of atypical Aer. salmonicida before and after standardization of media and methods. Five laboratories examined 25 isolates of Aer. salmonicida from diverse fish species and geographical locations including the reference strains of Aer. salmonicida subsp, salmonicida (NCMB 1102) and...... reactions. After standardization, improvement was obtained with the identification; however, disagreement was still observed between the different laboratories. These findings demonstrate the difficulties involved in a proper identification of atypical Aer. salmonicida and also that data presented in the...

  5. Application of robotic principles to laboratory automation

    International Nuclear Information System (INIS)

    The possibility of applying robotic techniques to some laboratory tasks is considered. A low-cost rig was constructed, at AERE Harwell, to examine the performance of a number of low-cost commercial robots. The importance of justifying the costs of introducing robotic systems and the difficulty of analysing the cost-benefit of robotic over mechanical systems is stressed. (UK)

  6. 78 FR 68903 - Dynegy Inc., Illinois Power Holdings, LLC and Illinois Power Holdings II, LLC-Acquisition of...

    Science.gov (United States)

    2013-11-15

    ... IPH II are wholly owned subsidiaries of Dynegy. According to Applicants, Dynegy, a noncarrier holding... Dynegy's wholly owned subsidiary, IPH, will acquire Ameren's subsidiary, Ameren Energy Resources Company... of CWRC is currently owned by AEGC, a wholly owned subsidiary of AER. The stock of JERR is...

  7. Air bubble-induced detachment of positively and negatively charged polystyrene particles from collector surfaces in a parallel-plate flow chamber

    NARCIS (Netherlands)

    Gomez-Suarez, C; Van der Mei, HC; Busscher, HJ

    2000-01-01

    Electrostatic interactions between colloidal particles and collector surfaces were found tcr be important in particle detachment as induced by the passage of air bubbles in a parallel-plate Row chamber. Electrostatic interactions between adhering particles and passing air bubbles, however, a-ere fou

  8. Do time-averaged, whole-building, effective volatile organic compound (VOC) emissions depend on the air exchange rate? A statistical analysis of trends for 46 VOCs in U.S. offices.

    Science.gov (United States)

    Rackes, A; Waring, M S

    2016-08-01

    We used existing data to develop distributions of time-averaged air exchange rates (AER), whole-building 'effective' emission rates of volatile organic compounds (VOC), and other variables for use in Monte Carlo analyses of U.S. offices. With these, we explored whether long-term VOC emission rates were related to the AER over the sector, as has been observed in the short term for some VOCs in single buildings. We fit and compared two statistical models to the data. In the independent emissions model (IEM), emissions were unaffected by other variables, while in the dependent emissions model (DEM), emissions responded to the AER via coupling through a conceptual boundary layer between the air and a lumped emission source. For 20 of 46 VOCs, the DEM was preferable to the IEM and emission rates, though variable, were higher in buildings with higher AERs. Most oxygenated VOCs and some alkanes were well fit by the DEM, while nearly all aromatics and halocarbons were independent. Trends by vapor pressure suggested multiple mechanisms could be involved. The factors of temperature, relative humidity, and building age were almost never associated with effective emission rates. Our findings suggest that effective emissions in real commercial buildings will be difficult to predict from deterministic experiments or models. PMID:26010216

  9. The role of antecedent moisture conditions on flood response

    Science.gov (United States)

    Deng, Yu; Westra, Seth; Lambert, Michael; Lambert, Martin

    2016-04-01

    A catchment's antecedent moisture conditions (AMC) represent the relative wetness of a catchment prior to a flood event. The catchment's moisture content prior to an extreme precipitation event can have a significant influence on overall flood response. This study derives an 'antecedent effect ratio' (AER) metric to describe the importance of a catchment's antecedent moisture content on overall runoff volume. The metric was applied to 211 catchments in Australia using hourly precipitation and streamflow data to identify the difference in flood response between dry and wet AMC. Regional calibration of the antecedent period length was used to estimate the effect ratio for all catchments. The AER was found to vary substantially, with the difference in flood response during wet and dry antecedent conditions up to three times that under median conditions for some sites. Higher AER values were found at latitudes closer to the equator and for catchments with highly seasonal precipitation regimes. Other climatic characteristics (e.g. mean annual precipitation, aridity index) and physical catchment characteristics (e.g. vegetation ratio, soil depth) had lesser influence. To improve the assessment of flood models it is important to have metrics, such as the AER, that can evaluate the contribution of antecedent moisture towards a flood response.

  10. Aerosol optical depth retrieval in the Arctic region using MODIS data over snow

    NARCIS (Netherlands)

    Mei, L.; Xue, Y.; Leeuw, G. de; Hoyningen-Huene, W. von; Kokhanovsky, A.A.; Istomina, L.; Guang, J.; Burrows, J.P.

    2013-01-01

    The Arctic is vulnerable to the long-term transport of aerosols because they affect the surface albedo when particles are deposited on snow and ice. However, aerosol observations for this area are sparse and hence there is considerable uncertainty in the knowledge on the properties of the Arctic aer

  11. The implications of the Irish air travel tax

    NARCIS (Netherlands)

    J. Veldhuis; J. Zuidberg

    2009-01-01

    Aer Lingus, Ryanair and CityJet (the ‘Airlines’) are currently endeavouring to persuade the Irish Government to withdraw the Irish Air Travel Tax (ATT), which has applied to flights out of Ireland since 30 March 2009. The Airlines have commissioned "Amsterdam Aviation Economics" (part of SEO Economi

  12. Long-term prevention of diabetic nephropathy: an audit

    DEFF Research Database (Denmark)

    Schjoedt, K.J.; Hansen, H.P.; Tarnow, L.;

    2008-01-01

    AIMS/HYPOTHESIS: In type 1 diabetic patients with microalbuminuria not receiving antihypertensive treatment, an increase in urinary AER (UAER) of 6-14%/year and a risk of developing diabetic nephropathy (DN) of 3-30%/year have been reported. We audited the long-term effect of blocking the renin...

  13. Workload demand in police officers during mountain bike patrols

    NARCIS (Netherlands)

    Takken, T.; Ribbink, A.; Heneweer, H.; Moolenaar, H.; Wittink, H.

    2009-01-01

    To the authors' knowledge this is the first paper that has used the training impulse (TRIMP) 'methodology' to calculate workload demand. It is believed that this is a promising method to calculate workload in a range of professions in order to understand the relationship between work demands and aer

  14. Aerosol delivery of trail pheromone disrupts red imported fire ant, Solenopsis invicta, foraging

    Science.gov (United States)

    Toxic bait systems are widely used for control of the fire ant, Solenopsis invicta, one of the most aggressive and invasive species in the world. We prepared the trail pheromone Z,E-a-farnesene (91% purity) from isomerised apple extracts and tested disruption of worker trail orientation using an aer...

  15. Single-walled carbon nanotubes as delivery vehicles enhance the immunoprotective effects of a recombinant vaccine against Aeromonas hydrophila.

    Science.gov (United States)

    Gong, Yu-Xin; Zhu, Bin; Liu, Guang-Lu; Liu, Lei; Ling, Fei; Wang, Gao-Xue; Xu, Xin-Gang

    2015-01-01

    To reduce the economic losses caused by diseases in aquaculture industry, more efficient and economic prophylactic measures should be urgently investigated. In this research, the effects of a novel functionalized single-walled carbon nanotubes (SWCNTs) applied as a delivery vehicle for recombinant Aeromonas hydrophila vaccine administration via bath or injection in juvenile grass carp were studied. The results showed that SWCNT as a vector for the recombinant protein aerA, augmented the production of specific antibodies, apparently stimulated the induction of immune-related genes, and induced higher level of survival rate compared with free aerA subunit vaccine. Furthermore, we compared the routes of bath and intramuscular injection immunization by SWCNTs-aerA vaccine, and found that similar antibody levels induced by SWCNTs-aerA were observed in both immunization routes. Meanwhile, a similar relative percentage survival (approximately 80%) was found in both a 40 mg/L bath immunization group, and a 20 μg injection group. The results indicate that functionalized SWCNTs could be a promising delivery vehicle to potentiate the immune response of recombinant vaccines, and might be used to vaccinate juvenile fish by bath administration method.

  16. Oito semanas de treinamento intervalado na doença vascular periférica: um estudo de caso = Eight weeks of interval training on the peripheral vascular disease: a case study

    Directory of Open Access Journals (Sweden)

    Campos, Tiago Pereira

    2015-01-01

    Conclusão: O treinamento intervalado associado ao treinamento de força melhorou a capacidade aeróbia e anaeróbia do paciente, e pode ser uma boa alternativa para o tratamento da doença vascular periférica

  17. Aggregate size and architecture determine biomass activity for one-stage partial nitritation and anammox

    DEFF Research Database (Denmark)

    Vlaeminck, S.; Terada, Akihiko; Smets, Barth F.;

    2010-01-01

    In partial nitritation/anammox systems, aerobic and anoxic ammonium-oxidizing bacteria (AerAOB and AnAOB) remove ammonium from wastewater. In this process, large granular microbial aggregates enhance the performance, but little is known about this type of granulation so far. In this study, aggreg...

  18. 24-hour ambulatory blood pressure and renal disease in young subjects with type I diabetes.

    Science.gov (United States)

    Garg, S K; Chase, H P; Icaza, G; Rothman, R L; Osberg, I; Carmain, J A

    1997-01-01

    Twenty-four hour ambulatory blood pressure (ABP) was evaluated in 150 teenage and young adults with insulin-dependent diabetes mellitus (IDDM) to define high-risk subjects who are likely to develop early diabetic nephropathy. Their age range was 16-28 years with diabetes of 3.5-25.8 years duration. All subjects had office blood pressure (BP) measured, wore an ABP monitor for 24 h, and collected two or more timed urine samples for albumin excretion rates (AERs). Eighty-six subjects had no elevation of AER ( 200 micrograms/min). Age, gender, duration of diabetes, and single office BP readings were similar in the four groups (p > 0.05, logistic regression). All 24-h ABP parameters were significantly higher in subjects with diabetes having AER values greater than 7.6 micrograms/min when compared with healthy age- and gender-matched nondiabetic controls (p 140/90) were significantly related with AERs (p or = 140/90) are associated with diabetic renal disease. PMID:9334907

  19. ALTERAÇÕES DA RESISTÊNCIA AERÓBIA EM JOVENS FUTEBOLISTAS EM UM PERÍODO DE 15 SEMANAS DE TREINAMENTO

    Directory of Open Access Journals (Sweden)

    Juvenilson de Souza

    2008-05-01

    Full Text Available O futebolista, para apresentar uma capacidade técnica e tática superior e consistente, tem que possuir níveis elevados de condicionamento físico, especialmente de resistência aeróbia. Este artigo tem como objetivo estudar as alterações da resistência aeróbia expressa por meio do consumo máximo de oxigênio em jovens futebolistas que foram submetidos a 15 semanas de treinamento. Para tanto, participaram do estudo 37 jovens futebolistas com idade média de 17,15 – 1,18 anos, submetidos a um programa de treinamento de cinco dias por semana, duas vezes por dia, com sessão de treinamento de aproximadamente duas horas. O estudo seguiu a periodização de Matveev (1986 e foi desenvolvido durante o período de preparação. Os futebolistas realizaram o teste YO-YO Intermitente de Resistência proposto por Bangsbo (1996. Os resultados mostraram que as posições de laterais, de meias e de volantes parecem solicitar maior resistência aeróbia. Em relação às alterações da resistência aeróbia (VO2máx, os futebolistas das posições de goleiro e de atacante foram os que apresentaram aumentos significantes; porém os futebolistas de todas as posições de jogo apresentaram melhoras em uma amplitude de 2,19 a 8,60%. Assim, com os resultados desse estudo, pôde-se concluir que 15 semanas de treinamento proporcionaram alterações importantes da resistência aeróbia (VO2máx.

  20. 2型糖尿病患者糖化血红蛋白及尿白蛋白与骨密度变化的关系研究%The Study Of The Relationship Between HbA1c And Urinary Albumin To Bone Mineral Density Changes In Patients With Type 2 Diabetes Mellitus

    Institute of Scientific and Technical Information of China (English)

    陈振新; 朱锋; 林国新; 陈金星

    2015-01-01

    目的:观察2型糖尿病患者血糖水平、糖化血红蛋白(HbA1c)、24小时尿白蛋白排泄率(AER)与骨密度(BMD)的变化的关系.方法:选取2010年01月—2015年01月入住我院的45~75岁2型糖尿病患者82例及随机选取的正常人群20例为对照组,分别对其血糖、HbA1c、24h尿白蛋白排泄率(AER)、腰椎和股骨颈BMD及相关生化指标等进行检测.将糖尿病患者根据HbA1c300mg/24h为I B组;HbA1c>7%分为Ⅱ组,其中AER300mg/24h为ⅡB组.结果:2型糖尿病组与正常对照组相比,骨密度显著降低(P300mg/24h;GroupⅡHbA1c>7%, GroupⅡA AER300mg/24h.Results Compared with control group, BMD of the group of Type 2 Diabetes mellitus decreased significantly (P<0.05). BMD at the femoral neck in diabetes group ⅡB was significantly lower than that in groupⅠA, groupⅠB and groupⅡA (P<0.05).Conclusions BMD significantly lowers in patients with Type 2 Diabetes mellitus than in controls, BMD of patients with unfulfilled blood sugar control and elevated AER decreased the most significantly than others.

  1. Cause-specific long-term mortality in survivors of childhood cancer in Switzerland: A population-based study.

    Science.gov (United States)

    Schindler, Matthias; Spycher, Ben D; Ammann, Roland A; Ansari, Marc; Michel, Gisela; Kuehni, Claudia E

    2016-07-15

    Survivors of childhood cancer have a higher mortality than the general population. We describe cause-specific long-term mortality in a population-based cohort of childhood cancer survivors. We included all children diagnosed with cancer in Switzerland (1976-2007) at age 0-14 years, who survived ≥5 years after diagnosis and followed survivors until December 31, 2012. We obtained causes of death (COD) from the Swiss mortality statistics and used data from the Swiss general population to calculate age-, calendar year-, and sex-standardized mortality ratios (SMR), and absolute excess risks (AER) for different COD, by Poisson regression. We included 3,965 survivors and 49,704 person years at risk. Of these, 246 (6.2%) died, which was 11 times higher than expected (SMR 11.0). Mortality was particularly high for diseases of the respiratory (SMR 14.8) and circulatory system (SMR 12.7), and for second cancers (SMR 11.6). The pattern of cause-specific mortality differed by primary cancer diagnosis, and changed with time since diagnosis. In the first 10 years after 5-year survival, 78.9% of excess deaths were caused by recurrence of the original cancer (AER 46.1). Twenty-five years after diagnosis, only 36.5% (AER 9.1) were caused by recurrence, 21.3% by second cancers (AER 5.3) and 33.3% by circulatory diseases (AER 8.3). Our study confirms an elevated mortality in survivors of childhood cancer for at least 30 years after diagnosis with an increased proportion of deaths caused by late toxicities of the treatment. The results underline the importance of clinical follow-up continuing years after the end of treatment for childhood cancer. PMID:26950898

  2. Identification of effluent organic matter fractions responsible for low-pressure membrane fouling

    KAUST Repository

    Filloux, Emmanuelle

    2012-11-01

    Anion exchange resin (AER), powder activated carbon (PAC) adsorption and ozonation treatments were applied on biologically treated wastewater effluent with the objective to modify the effluent organic matter (EfOM) matrix. Both AER and PAC led to significant total organic carbon (TOC) removal, while the TOC remained nearly constant after ozonation. Liquid Chromatography-Organic Carbon Detection (LC-OCD) analysis showed that the AER treatment preferentially removed high and intermediate molecular weight (MW) humic-like structures while PAC removed low MW compounds. Only a small reduction of the high MW colloids (i.e. biopolymers) was observed for AER and PAC treatments. Ozonation induced a large reduction of the biopolymers and an important increase of the low MW humic substances (i.e. building blocks).Single-cycle microfiltration (MF) and ultrafiltration (UF) tests were conducted using commercially available hollow fibres at a constant flux. After reconcentration to their original organic carbon content, the EfOM matrix modified by AER and PAC treatments exhibited higher UF membrane fouling compared to untreated effluent; result that correlated with the higher concentration of biopolymers. On the contrary, ozonation which induced a significant degradation of the biopolymers led to a minor flux reduction for both UF and MF filtration tests. Based on a single filtration, results indicate that biopolymers play a major role in low pressure membrane fouling and that intermediate and low MW compounds have minor impact. Thus, this approach has shown to be a valid methodology to identify the foulant fractions of EfOM. © 2012 Elsevier Ltd.

  3. The NS1 glycoprotein can generate dramatic antibody-enhanced dengue viral replication in normal out-bred mice resulting in lethal multi-organ disease.

    Directory of Open Access Journals (Sweden)

    Andrew K I Falconar

    Full Text Available Antibody-enhanced replication (AER of dengue type-2 virus (DENV-2 strains and production of antibody-enhanced disease (AED was tested in out-bred mice. Polyclonal antibodies (PAbs generated against the nonstructural-1 (NS1 glycoprotein candidate vaccine of the New Guinea-C (NG-C or NSx strains reacted strongly and weakly with these antigens, respectively. These PAbs contained the IgG2a subclass, which cross-reacted with the virion-associated envelope (E glycoprotein of the DENV-2 NSx strain, suggesting that they could generate its AER via all mouse Fcγ-receptor classes. Indeed, when these mice were challenged with a low dose (<0.5 LD₅₀ of the DENV-2 NSx strain, but not the NG-C strain, they all generated dramatic and lethal DENV-2 AER/AED. These AER/AED mice developed life-threatening acute respiratory distress syndrome (ARDS, displayed by diffuse alveolar damage (DAD resulting from i dramatic interstitial alveolar septa-thickening with mononuclear cells, ii some hyperplasia of alveolar type-II pneumocytes, iii copious intra-alveolar protein secretion, iv some hyaline membrane-covered alveolar walls, and v DENV-2 antigen-positive alveolar macrophages. These mice also developed meningo-encephalitis, with greater than 90,000-fold DENV-2 AER titers in microglial cells located throughout their brain parenchyma, some of which formed nodules around dead neurons. Their spleens contained infiltrated megakaryocytes with DENV-2 antigen-positive red-pulp macrophages, while their livers displayed extensive necrosis, apoptosis and macro- and micro-steatosis, with DENV-2 antigen-positive Kuppfer cells and hepatocytes. Their infections were confirmed by DENV-2 isolations from their lungs, spleens and livers. These findings accord with those reported in fatal human "severe dengue" cases. This DENV-2 AER/AED was blocked by high concentrations of only the NG-C NS1 glycoprotein. These results imply a potential hazard of DENV NS1 glycoprotein-based vaccines

  4. [Effects of diet and aerobic or anaerobic exercises on eating disorders].

    Science.gov (United States)

    Martinez-Rodriguez, Alejandro

    2014-10-19

    Introducción: Actividades físicas de larga duración, con predominio aeróbico, requieren una práctica deportiva extensiva y continuada para obtener mejoras en el rendimiento. Mientras que las actividades anaeróbicas, requieren de un volumen de entrenamiento menor, aunque a intensidades más elevadas para alcanzar un buen estado de forma deportiva. La disminución del porcentaje graso dentro de la composición corporal, tanto de deportes aeróbicos como anaeróbicos, es una cuestión presente, sobretodo en estos último tiempos. Conseguir un adecuado estado nutricional, con estrategias inadecuadas, puede originar la aparición de trastornos de la conducta alimentaria. Objetivo: determinar las diferencias existentes entre dos grupos de deportistas en función de la práctica de deportes aeróbicos o anaeróbicos, en cuanto a la presencia de desórdenes alimentarios, adherencia a dieta baja en grasa y actividad física. Método: En este estudio participaron 206 sujetos varones entrenados que cumplimentaron los cuestionarios de actividad física en el tiempo libre de Minnesota abreviado, EAT-26 y Predimed de “Adherencia a dieta baja en grasa”. Resultados: Los deportistas que practican deportes aeróbicos muestran mayores puntuaciones en la mayoría de las subescalas y en el resultado total del cuestionario EAT-26. A mayor número de sesiones de práctica en deportes aeróbicos, aparecen puntuaciones superiores en el Control Oral. Dentro de esta población, el consumo de suplementos incrementa significativamente las puntuaciones del EAT-26 y la predisposición a un TCA, al igual que los planes de entrenamientos muy estrictos. Discusión: Los deportistas que practican deportes de corte más aeróbico parecen mostrar una mayor predisposición a la presencia de un TCA.

  5. Nitrogen removal and microbial characteristics in CANON biofilters fed with different ammonia levels.

    Science.gov (United States)

    Liang, Yuhai; Li, Dong; Zhang, Xiaojing; Zeng, Huiping; Yang, Zhuo; Cui, Shaoming; Zhang, Jie

    2014-11-01

    The nitrogen removal performance and microbial characteristics of four completely autotrophic nitrogen removal over nitrite (CANON) biofilters were investigated. These four reactors were simultaneously seeded from a stable CANON biofilter with a seeding ratio of 1:1, which were fed with different ammonia levels. Results suggested that with the ammonia of 200-400 mg L(-1), aerobic ammonia-oxidizing bacteria (AerAOB) and anaerobic ammonia-oxidizing bacteria (AnAOB) could perform harmonious work. The bioactivity and population of the two groups of bacteria were both high, which then resulted in excellent nitrogen removal, while too low or too high ammonia would both lead to worse performance. When ammonia was too high, the bioactivity, biodiversity and population of AerAOB all decreased and then resulted in the lowest nitrogen removal. Nitrosomonas and Candidatus Brocadia were detected as predominant functional microbes in all the four reactors. Finally, strategies for treating sewage with different ammonia levels were proposed.

  6. Waste management policy and strategies for all waste types and disposal options and international co-operation - Bangladesh perspective

    International Nuclear Information System (INIS)

    In Bangladesh, LILW radioactive wastes are generated from operation and maintenance of nuclear installations: Research Reactor, Radioisotope Production Laboratory, Neutron Generator, hot facilities, application/use of radiation sources (RS) in medicine, research, agriculture, industry. The radioactive wastes arising are described in this paper. The national policy concerning radioactive wastes and the activities being performed by the Health Physics and Radioactive Waste Management Unit of AERE, Savar, are outlined. BAEC has a perspective plan (2001-2010) to establish a pilot-scale near-surface waste repository for short-lived LILW. The factors being studied are presented, covering: general site description within the AERE campus; geology, hydrology and rivers; seismicity; surface drainage and ground water table; climate and meteorology; transportation and communication; demography and nearby facilities; vegetation; water and power supply; background radiation, nearest township; natural environment, land and water usage; dispersion of radioactive materials through groundwater; engineered feature. (author)

  7. Development of a computer code for neutronic calculations of a hexagonal lattice of nuclear reactor using the flux expansion nodal method

    Directory of Open Access Journals (Sweden)

    Mohammadnia Meysam

    2013-01-01

    Full Text Available The flux expansion nodal method is a suitable method for considering nodalization effects in node corners. In this paper we used this method to solve the intra-nodal flux analytically. Then, a computer code, named MA.CODE, was developed using the C# programming language. The code is capable of reactor core calculations for hexagonal geometries in two energy groups and three dimensions. The MA.CODE imports two group constants from the WIMS code and calculates the effective multiplication factor, thermal and fast neutron flux in three dimensions, power density, reactivity, and the power peaking factor of each fuel assembly. Some of the code's merits are low calculation time and a user friendly interface. MA.CODE results showed good agreement with IAEA benchmarks, i. e. AER-FCM-101 and AER-FCM-001.

  8. Aggregate Size and Architecture Determine Microbial Activity Balance for One-Stage Partial Nitritation and Anammox

    DEFF Research Database (Denmark)

    Vlaeminck, S.E.; Terada, Akihiko; Smets, Barth F.;

    2010-01-01

    Aerobic ammonium-oxidizing bacteria (AerAOB) and anoxic ammonium-oxidizing bacteria (AnAOB) cooperate in partial nitritation/anammox systems to remove ammonium from wastewater. In this process, large granular microbial aggregates enhance the performance, but little is known about granulation so far......AOB abundance and the activity balance for the different aggregate sizes and (ii) to relate aggregate morphology, size distribution, and architecture putatively to the inoculation and operation of the three reactors. A nitrite accumulation rate ratio (NARR) was defined as the net aerobic nitrite production rate...... divided by the anoxic nitrite consumption rate. The smallest reactor A, B, and C aggregates were nitrite sources (NARR, > 1.7). Large reactor A and C aggregates were granules capable of autonomous nitrogen removal (NARR, 0.6 to 1.1) with internal AnAOB zones surrounded by an AerAOB rim. Around 50% of the...

  9. ultrastructural study of limb bud development in green turtles chelonia mydas

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    morphological changes during the embryonic development of limbs of the green turtle,chelonia mydas,were studied during the entire period of incubation,using transmission and scanning electron microscopy (tem and sem).limb buds were first observed at stage 2.at that stage,the tip was covered with an apical ectodermal ridge (aer) which began to regress at stage 6.associated with aer was the presence of the mesenchymal cells which,consequently,differentiated into muscles,cartilage and bones.the gross features of the skeletal development appeared as a condensation of the cartilaginous structures in the proximal distal region of the limbs.the primordial digits were gradually enclosed by hard keratinized webbed skin.the increase in rate of ossification and skin pigmentation was correlated with the growth of the limbs.the development of the limbs was closely related to the transitional appearance of mucus secretion from the epidermis.

  10. Sulfate-reducing bacteria from the Arabian Sea - their distribution in relation to thiosulfate-oxidising and heterotrophic bacteria

    Digital Repository Service at National Institute of Oceanography (India)

    LokaBharathi, P.A.; Chandramohan, D.

    and surface waters. We also examined their occurrence relative to certain sulfur-oxidizing bacteria (aer obic and anaerobic Thiobacillus-like) and to aerobic and anaerobic heterotrophs. Attempts have also been made to establish the generic affinity of... observations together with cell morphology and pigment characteristics were used to identify the isolates to the generic level (Table 5). Strains resembling Desulfomonas, Desulfovibrio. Desulfobacter and De- 626 BULLETIN OF MARINE SClENCE. VOL 47. NO.3. 1990...

  11. Consumer Confidence, News and Consumption Stimulation

    OpenAIRE

    Guo, Xinqiang; Xu, Zhiwei

    2009-01-01

    In the Chinese urban data, there is a stronger relationship between consumer behavior (measured by consumption income ratio or cy ratio) and consumer confidence (measured by Consumer Confidence Index or CCI), which implies expectation about the future plays an important role in domestic demand. In our paper, a structural VAR method (based on Beaudry&Portier 2006 AER) is employed to identify the news shock about three markets including housing, education and medical care. We also extract the c...

  12. original papers : Project evaluation and organizational form

    OpenAIRE

    Thomas Gehrig; Pierre Regibeau; Kate Rockett

    2000-01-01

    In situations of imperfect testing and communication, as suggested by Sah and Stiglitz (AER, 1986), organizational forms can be identified with different rules of aggregating evaluations of individual screening units. In this paper, we discuss the relative merits of polyarchical organizations versus hierarchical organizations in evaluating cost-reducing R&D projects when individual units' decision thresholds are fully endogenous. Contrary to the results of Sah and Stiglitz, we find that the r...

  13. A new look at old data – a simple model for estimating deposition based on a statistical reassessment of global fallout data

    OpenAIRE

    Palsson, S.E.; Howard, B.J.; Bergan, T; J. Paatero; Isaksson, M.; Nielsen, S P

    2011-01-01

    Atmospheric testing of nuclear weapons began in 1945 and came largely to an end in 1963. Extensive monitoring was done on the global fallout from these tests. The Environmental Measurements Laboratory (EML) in the US had a global network as well as the UK Atomic Energy Research Establishment (AERE / Harwell). There were also comprehensive national networks such as operated by the Risø National Laboratory in Denmark. Early analysis of the data showed correlation of deposition with precipita...

  14. Statin-associated muscular and renal adverse events: data mining of the public version of the FDA adverse event reporting system.

    Directory of Open Access Journals (Sweden)

    Toshiyuki Sakaeda

    Full Text Available OBJECTIVE: Adverse event reports (AERs submitted to the US Food and Drug Administration (FDA were reviewed to assess the muscular and renal adverse events induced by the administration of 3-hydroxy-3-methylglutaryl coenzyme A (HMG-CoA reductase inhibitors (statins and to attempt to determine the rank-order of the association. METHODS: After a revision of arbitrary drug names and the deletion of duplicated submissions, AERs involving pravastatin, simvastatin, atorvastatin, or rosuvastatin were analyzed. Authorized pharmacovigilance tools were used for quantitative detection of signals, i.e., drug-associated adverse events, including the proportional reporting ratio, the reporting odds ratio, the information component given by a Bayesian confidence propagation neural network, and the empirical Bayes geometric mean. Myalgia, rhabdomyolysis and an increase in creatine phosphokinase level were focused on as the muscular adverse events, and acute renal failure, non-acute renal failure, and an increase in blood creatinine level as the renal adverse events. RESULTS: Based on 1,644,220 AERs from 2004 to 2009, signals were detected for 4 statins with respect to myalgia, rhabdomyolysis, and an increase in creatine phosphokinase level, but these signals were stronger for rosuvastatin than pravastatin and atorvastatin. Signals were also detected for acute renal failure, though in the case of atorvastatin, the association was marginal, and furthermore, a signal was not detected for non-acute renal failure or for an increase in blood creatinine level. CONCLUSIONS: Data mining of the FDA's adverse event reporting system, AERS, is useful for examining statin-associated muscular and renal adverse events. The data strongly suggest the necessity of well-organized clinical studies with respect to statin-associated adverse events.

  15. Mehed metsast ja mere äärest... / Kersti Mäestu

    Index Scriptorium Estoniae

    Mäestu, Kersti

    2005-01-01

    Sigrid Saarepi kureeritud rändnäitus "Mehed metsast ja mere äärest" Kuressaare linnuse keldrikorruse näitusesaalis 4. VIII-19. IX 2004, Kondase keskuses Viljandis 28. X 2004-30. I 2005, Pärnu Uue Kunsti Muuseumis 20. II-31. III 2005. Osalevad Saaremaa, Hiiumaa ja Kihnu saare rahvakunstnikud Jaan Oad, Aleksander Tarvis, Lembar Linder, Harri Aer, Maido Toll, Karla Krall, Olev Johannes, Voldemar Õun ja Tundmatu

  16. Genetic Background of Escherichia coli and Extended-spectrum β-Lactamase Type

    OpenAIRE

    Branger, Catherine; Zamfir, Oana; Geoffroy, Sabine; Laurans, Geneviève; Arlet, Guillaume; Thien, Hoang Vu; Gouriou, Stéphanie; Picard, Bertrand; Denamur, Erick

    2005-01-01

    To assess the implication of the genetic background of Escherichia coli strains in the emergence of extended-spectrum-β-lactamases (ESBL), 55 TEM-, 52 CTX-M-, and 22 SHV-type ESBL-producing clinical isolates involved in various extraintestinal infections or colonization were studied in terms of phylogenetic group, virulence factor (VF) content (pap, sfa/foc, hly, and aer genes), and fluoroquinolone resistance. A factorial analysis of correspondence showed that SHV type, and to a lesser extent...

  17. Nuclear electronic instrument systems using the Harwell 6000 series

    International Nuclear Information System (INIS)

    This report describes some of the more recent equipment designed by the Systems Instrumentation Unit (AERE, Harwell), in the Harwell 6000 modular format. The units include: Laboratory Instruments (alpha monitors, beta-gamma detectors, spectrometers, automatic sample changer systems, automated counting laboratory systems, low power systems). Environmental Monitors (nuclear plant monitor, air monitor, sea bed monitor). Process Instruments (plutonium waste control, x-ray fluorescence monitor, process monitor, beam current monitor, effluent monitors). (U.K.)

  18. Urinary Liver-Type Fatty Acid–Binding Protein and Progression of Diabetic Nephropathy in Type 1 Diabetes

    OpenAIRE

    Panduru, Nicolae M; Forsblom, Carol; Saraheimo, Markku; Thorn, Lena; Bierhaus, Angelika; Humpert, Per M.; Groop, Per-Henrik; ,

    2013-01-01

    OBJECTIVE Diabetic nephropathy (DN) has mainly been considered a glomerular disease, although tubular dysfunction may also play a role. This study assessed the predictive value for progression of a tubular marker, urinary liver-type fatty acid–binding protein (L-FABP), at all stages of DN. RESEARCH DESIGN AND METHODS At baseline, 1,549 patients with type 1 diabetes had an albumin excretion rate (AER) within normal reference ranges, 334 had microalbuminuria, and 363 had macroalbuminuria. Patie...

  19. Long-term risk of cardiovascular disease after treatment for aggressive non-Hodgkin lymphoma.

    Science.gov (United States)

    Moser, Elizabeth C; Noordijk, Evert M; van Leeuwen, Flora E; le Cessie, Saskia; Baars, Joke W; Thomas, José; Carde, Patrice; Meerwaldt, Jacobus H; van Glabbeke, Martine; Kluin-Nelemans, Hanneke C

    2006-04-01

    Cardiovascular disease frequently occurs after lymphoma therapy, but it is common in the general population too. Therefore, risk estimation requires comparison to population-based rates. We calculated risk by standardized incidence ratios (SIRs) and absolute excess risks (AERs) per 10,000 person-years based on general population rates (Continuous Morbidity Registry Nijmegen) in 476 (Dutch and Belgian) patients with aggressive non-Hodgkin lymphoma (NHL) treated with at least 6 cycles of doxorubicin-based chemotherapy in 4 European Organization for Research on Treatment of Cancer (EORTC) trials (1980-1999). Cumulative incidence of cardiovascular disease, estimated in a competing risk model, was 12% at 5 years and 22% at 10 years (median follow-up, 8.4 years). Risk of chronic heart failure appeared markedly increased (SIR, 5.4; 95% CI, 4.1-6.9) with an AER of 208 excess cases per 10 000 person-years, whereas risk of coronary artery disease matched the general population (SIR, 1.2; 95% CI, 0.8-1.8; AER, 8 per 10 000 person-years). Risk of stroke was raised (SIR, 1.8; 95% CI, 1.1-2.4; AER, 15 per 10 000 person-years), especially after additional radiotherapy (> 40 Gy). Preexisting hypertension, NHL at young age, and salvage treatment increased risk of all cardiovascular events; the effect of radiotherapy was dose dependent. In conclusion, patients are at long-term high risk of chronic heart failure after NHL treatment and need therefore life-long monitoring. In contrast, risk of coronary artery disease appeared more age dependent than treatment related.

  20. Underreporting of Hemorrhagic and Thrombotic Complications of Pharmaceuticals to the U.S. Food and Drug Administration: Empirical Findings for Warfarin, Clopidogrel, Ticlopidine, and Thalidomide from the Southern Network on Adverse Reactions (SONAR)

    OpenAIRE

    Moore, Thomas J.; Bennett, Charles L.

    2012-01-01

    The U.S. Food and Drug Administration's (FDA) Adverse Event Reporting System (AERS), familiarly known as “MedWatch,” is the nation's primary tool for postmarket pharmaceutical safety surveillance. This system relies on adverse events voluntarily reported by health care providers and consumers either directly to the FDA or to drug manufacturers, which are required to prepare and forward the information to the agency. Little is known about how frequently adverse events are reported. Previous es...

  1. Širdies ir kraujagyslių sistemos funkcinių rodiklių kaita paros ir aerobikos pratybų metu

    OpenAIRE

    Bardauskienė, Sandra

    2005-01-01

    Dynamics of cardiovascular indices during the 24 hours and exercise training session in aerobics SUMMARY Objects: The aim of this study was to assess the peculiarities in functioning of cardiovascular system during 24 hours and aerobic exercise session. Goals: 1) to monitor the functioning of cardiovascular system during 24 hours. 2) to assess the dynamic of ECG parameters during 24 hours and aerobic exercise. 3) to compare the variability of ECG parameters during 24 hours and aer...

  2. Starter kültür kullanılarak üretilen hıyar turşularında biyojen amin oluşumu üzerine araştırma

    OpenAIRE

    TURGUT, Zeynep

    2006-01-01

           Abstract

    In this study, cucumber pickle was produced by spontaneous fermentation or using Lactobacillus plantarum 11B as starter culture, then amount of biogenic amines, whichwere produced during fermentation, was determined by High Performance LiquidChromatography (HPLC). Additionally, on certain days during fermentation,enumeration of total mesophilic aer...

  3. Harwell emergency handbook

    International Nuclear Information System (INIS)

    The Harwell Laboratory Emergency Handbook 1987 contains emergency procedures to deal with any incident which might occur at AERE Harwell involving radioactive or toxic material releases. The Handbook gives details of the duties of members of the Site Emergency Organization and other key members of staff, the methods by which incidents are controlled, the communication links and liaison arrangements with other organizations and the possible consequences and actions that may be needed following an emergency. (UK)

  4. ORGANIC FARMING BY VERMICULTURE: PRODUCING CHEMICAL-FREE, NUTRITIVE AND HEALTH PROTECTIVE FOOD FOR THE SOCIETY

    OpenAIRE

    Sinha, Rajiv

    2012-01-01

    Vermicompost produced from ''organic wastes'' are scientifically proving to be an ''extraordinary powerful growth promoters and protectors ''for crops (5-7 times over other bulky organic fertilizers and 20-40% higher over chemical fertilizers). They are rich in NKP, micronutrients, beneficial soil microbes like ''nitrogen-fixing'' and ''phosphate solubilizing'' bacteria, ''mycorrhizal fungi'', humus and growth hormones -auxins, gibberellins and cytokinins. It has very high ''porosity'', ''aer...

  5. Techniques for measuring aerosol attenuation using the Central Laser Facility at the Pierre Auger Observatory

    OpenAIRE

    PIERRE AUGER Collaboration; Abreu, P; Pastor, Sergio

    2013-01-01

    The Pierre Auger Observatory in Malargue, Argentina, is designed to study the properties of ultra-high energy cosmic rays with energies above 10(18) eV. It is a hybrid facility that employs a Fluorescence Detector to perform nearly calorimetric measurements of Extensive Air Shower energies. To obtain reliable calorimetric information from the FD, the atmospheric conditions at the observatory need to be continuously monitored during data acquisition. In particular, light attenuation due to aer...

  6. Implementation of GNASH and auxiliary codes on the Harwell CRAY-1

    International Nuclear Information System (INIS)

    The report describes a version of the preequilibrium, statistical nuclear-model code GNASH which has been implemented, along with a set of small auxiliary codes, on the CRAY-1 at AERE Harwell. GNASH provides a flexible tool for calculating cross sections, isomer ratios and emission spectra. A detailed description of the current user input is provided along with a full listing of the actual FORTRAN code, as modified for this implementation. (author)

  7. Predicting how People Play Games: a Simple Dynamic Model of Choice.

    OpenAIRE

    Sarin, R.; Vahid, F.

    1999-01-01

    We use the model developed in Sarin and Vahid (1999, GEB) to explain the experiments reported in Erev and Roth (1998, AER). The model supposes that players maximize subject to their "beliefs" which are non-probabilistic and scalar-valued. They are intended to describe the payoffs the players subjectively assess they will obtain from a strategy. In an earlier paper (Sarin and Vahid (1997) we showed that the model predicted behaviour in repeated coordination games remarkably well, and better th...

  8. Concentrations and emissions of gasoline and other vapors from residential vehicle garages

    Science.gov (United States)

    Batterman, Stuart; Hatzivasilis, Gina; Jia, Chunrong

    High concentrations of airborne volatile organic compounds (VOCs) may be present in residential garages due to emissions from vehicles, lawnmowers, storage containers, and many other items stored in the garage. VOC emissions will ultimately be transported into ambient air and, if the garage is attached to a residence or other building, into living spaces. This study reports on VOC concentrations and emissions at 15 residential garages in Michigan that varied in type, size, use and other characteristics. VOCs were measured in garages and in outside air using 4-day passive sampling, thermal desorption, and GC-MS analysis. Effective air exchange rates (AERs) were determined using a perfluorocarbon tracer gas and the constant injection method. A modeling analysis shows the effect of time-varying ventilation. To estimate temporal and spatial variability, concentrations were measured on 7 subsequent occasions at multiple locations in one garage. This garage was well-mixed, and the temporal variation in AERs and concentrations was modest. Across the 15 garages, 36 different VOCs in garage air, and 20 in ambient air, were quantified. Source groups identified and attributed to garage emissions included evaporated gasoline, solvents, paints, oils, and cleaners. Concentrations of gasoline-related VOCs in most garages were high, e.g., benzene levels reached 159 μg m -3 in one garage. TVOC emissions per garage averaged 3.0±4.1 g day -1, and AERs averaged 0.77±0.51 h -1. VOC concentrations and AERs were not strongly correlated to observed house, garage or meteorological factors, but appeared largely dependent on occupant activities (opening of the garage door) and VOC sources present. This study quantifies the importance of attached garages as VOC sources, and the results are significant for understanding and mitigating indoor exposures, and for estimating emissions for source inventory purposes.

  9. Clonazepam Treatment of Pathologic Childhood Aerophagia with Psychological Stresses

    OpenAIRE

    Hwang, Jin-Bok; Kim, Jun Sik; Ahn, Byung Hoon; Jung, Chul-Ho; Lee, Young Hwan; Kam, Sin

    2007-01-01

    The treatment of pathologic aerophagia has rarely been discussed in the literature. In this retrospective study, the authors investigated the effects of clonazepam on the management of pathologic childhood aerophagia (PCA) with psychological stresses (PS), but not with mental retardation. Data from 22 consecutive PCA patients with PS (aged 2 to 10 yr), who had been followed up for over 1 yr, were reviewed. On the basis of videolaryngoscopic views, the authors observed that the pathologyof aer...

  10. Pós-tratamento de efluente nitrificado da parboilização de arroz utilizando desnitrificação em reator UASB Post-treatment a nitrified parboilized rice wastewater using denitrification in UASB reactor

    Directory of Open Access Journals (Sweden)

    Loraine Andre Isoldi

    2005-12-01

    Full Text Available Um sistema combinado reator UASB-reator aeróbio foi utilizado para a remoção de nitrogênio total e DQO de efluente de parboilização de arroz. O experimento foi realizado em reatores de bancada, com volumes de 4 L (UASB e 3,6 L (reator aeróbio. Os parâmetros de operação pH, temperatura, alcalinidade e concentração de ácidos voláteis foram monitorados durante o período experimental. Para o reator aeróbio de mistura completa, foi determinada, também, a concentração de oxigênio dissolvido. O sistema combinado reator UASB-reator aeróbio apresentou uma eficiência de remoção de carbono de 84% e uma eficiência de remoção de nitrogênio total Kjeldahl de 83%. O sistema proposto, nas condições experimentais, demonstrou ser adequado para remoção, simultânea, de DQO e de compostos oxidados de nitrogênio, em reator UASB.An UASB-aerobic reactor system was used for the removal of total nitrogen and COD of effluent from industries of parboilized rice. The experiment was performed in reactors with volumes of 4 L (UASB reactor and 3,6 L (aerobic reactor, respectevely. Temperature, pH, alkalinity and volatile acids concentration were monitored during the experiment. Dissolved oxygen concentration was determined for the aerobic reactor. The UASB-aerobic reactor system showed 84% carbon removal efficiency and 83% total Kjeldahl nitrogen removal efficiency. This system was able to remove, efficiently, COD and nitrogen in an UASB reactor.

  11. The Distribution of Firm Start-Up Size Across Geographic Space

    OpenAIRE

    Audretsch, David B.; Tamvada, Jagannadha Pawan

    2008-01-01

    A growing body of literature shows that geographic location plays an important role in influencing economic phenomena. Despite the renewed interest in economic geography, the existing literature on the firm size distribution (FSD) has ignored the impact of geographic location. A wave of recent studies has examined the determinants and evolution of FSD (Cabral and Mata, 2003; Angelini and Generale 2008, AER) and a component of this literature has focused on the size of the new firm start-ups. ...

  12. Energetics of high-speed running: integrating classical theory and contemporary observations.

    Science.gov (United States)

    Weyand, Peter G; Bundle, Matthew W

    2005-04-01

    We hypothesized that the anaerobic power and aerobic power outputs during all-out runs of any common duration between 10 and 150 s would be proportional to the maximum anaerobic (E(an-max)) and aerobic powers (E(aer-max)) available to the individual runner. Seventeen runners who differed in E(an-max) and E(aer-max) (5 sprinters, 5 middle-distance runners, and 7 long distance runners) were tested during treadmill running on a 4.6 degrees incline. E(an-max) was estimated from the fastest treadmill speed subjects could attain for eight steps. E(aer-max) was determined from a progressive, discontinuous, treadmill test to failure. Oxygen deficits and rates of uptake were measured to assess the respective anaerobic and aerobic power outputs during 11-16 all-out treadmill runs that elicited failure between 10 and 220 s. We found that, during all-out runs of any common duration, the relative anaerobic and aerobic powers utilized were largely the same for sprint, middle-distance, and long-distance subjects. The similar fractional utilization of the E(an-max) and E(aer-max) available during high-speed running 1) provides empirical values that modify and advance classic theory, 2) allows rates of anaerobic and aerobic energy release to be quantified from individual maxima and run durations, and 3) explains why the high-speed running performances of different event specialists can be accurately predicted (R(2) = 0.97; n = 254) from two direct measurements and the same exponential time constant.

  13. The 'materials balance approach' to pollution: its origin, implications and acceptance

    OpenAIRE

    Pethig, Rüdiger

    2003-01-01

    In their seminal paper on "production, consumption and externalities" (AER, 1969), Ayres and Kneese initiated a research program on comprehensive analysis and management of residuals and pollution based on two pillars: the study of the residuals-generating materials flow subject to the mass balance principle and the concept of pervasive (pollution) externality. The present paper aims at (i) recalling the origin of that program, (ii) sheding some light on its principal implications from today'...

  14. Conserved Residues in the HAMP Domain Define a New Family of Proposed Bipartite Energy Taxis Receptors▿

    OpenAIRE

    Elliott, Kathryn T; Igor B Zhulin; Stuckey, Jeanne A.; DiRita, Victor J.

    2008-01-01

    HAMP domains, found in many bacterial signal transduction proteins, generally transmit an intramolecular signal between an extracellular sensory domain and an intracellular signaling domain. Studies of HAMP domains in proteins where both the input and output signals occur intracellularly are limited to those of the Aer energy taxis receptor of Escherichia coli, which has both a HAMP domain and a sensory PAS domain. Campylobacter jejuni has an energy taxis system consisting of the domains of A...

  15. Molecular detection and antimicrobial resistance of Aeromonas from houseflies (Musca domestica) in Iran

    OpenAIRE

    Davood Ommi; Seyed Mohammadreza Hashemian; Elahe Tajbakhsh; Faham Khamesipour

    2015-01-01

    ABSTRACT Objective. This study aimed to report the molecular detection and antimicrobial resistance of Aeromonas among houseflies (Musca domestica) in Shahrekord and Isfahan provinces of Iran. Materials and methods. Flies were caught from household kitchens, cattle farms, animal hospitals, human hospitals, slaughter house and poultry farms and put in collection separate sterile tubes. Isolation was accomplished by culture of flies in alkaline peptone water followed by identification with Aer...

  16. CFD Simulation of Thermal-Hydraulic Benchmark V1000CT-2 Using ANSYS CFX

    OpenAIRE

    Thomas Höhne

    2009-01-01

    Plant measured data from VVER-1000 coolant mixing experiments were used within the OECD/NEA and AER coupled code benchmarks for light water reactors to test and validate computational fluid dynamic (CFD) codes. The task is to compare the various calculations with measured data, using specified boundary conditions and core power distributions. The experiments, which are provided for CFD validation, include single loop cooling down or heating-up by disturbing the heat transfer in the steam gene...

  17. Careful dealing with the introduction of market operations with regard to vital infrastructural utilities

    International Nuclear Information System (INIS)

    The introduction of a liberalized market in e.g. the sectors for the supply of natural gas and electricity, public transport, telecommunications and cable networks appears to be much more complex than expected. The Dutch Advisory Council for Transport, Public Works and Water Management and the General Energy Council (AER) presented a brochure in which they express their opinion that the present political and administrative culture hinder the process of change

  18. Metabolic Engineering of Escherichia coli for Production of Mixed-Acid Fermentation End Products

    OpenAIRE

    Andreas Hartmut Förster; Johannes eGescher

    2014-01-01

    Mixed-acid fermentation end products have numerous applications in biotechnology. This is probably the main driving force for the development of multiple strains that are supposed to produce individual end products with high yields. The process of engineering Escherichia coli strains for applied production of ethanol, lactate, succinate, or acetate was initiated several decades ago and is still ongoing. This review follows the path of strain development from the general characteristics of aer...

  19. Airborne Multi AXis DOAS instrument and measurements of two-dimensional tropospheric trace gas distributions

    OpenAIRE

    Heue, Klaus-Peter

    2005-01-01

    The Airborne Multi AXis DOAS instrument was developed and successfully operated during four measurement campaigns. Depending on the purpose the instrument was installed on two different aeroplanes flying either close to the tropopause or in the mixing layer. In a detailed sensitivity study the possibilities of the measurements were investigated. For a qualitatively good observation of tropospheric trace gases (e.g. NO2 and HCHO) additional information about the mixing layer height and the aer...

  20. Dynamic Fracture Simulations of Explosively Loaded Cylinders

    Energy Technology Data Exchange (ETDEWEB)

    Arthur, Carly W. [Univ. of California, Davis, CA (United States). Dept. of Civil and Environmental Engineering; Goto, D. M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2015-11-30

    This report documents the modeling results of high explosive experiments investigating dynamic fracture of steel (AerMet® 100 alloy) cylinders. The experiments were conducted at Lawrence Livermore National Laboratory (LLNL) during 2007 to 2008 [10]. A principal objective of this study was to gain an understanding of dynamic material failure through the analysis of hydrodynamic computer code simulations. Two-dimensional and three-dimensional computational cylinder models were analyzed using the ALE3D multi-physics computer code.

  1. DLX5, FGF8 and the Pin1 isomerase control ΔNp63α protein stability during limb development: a regulatory loop at the basis of the SHFM and EEC congenital malformations

    OpenAIRE

    Restelli, Michela; Lopardo, Teresa; Lo Iacono, Nadia; Garaffo, Giulia; Conte, Daniele; Rustighi, Alessandra; Napoli, Marco; Del Sal, Giannino; Perez-Morga, David; Costanzo, Antonio; Merlo, Giorgio Roberto; Guerrini, Luisa

    2014-01-01

    Ectrodactyly, or Split-Hand/Foot Malformation (SHFM), is a congenital condition characterized by the loss of central rays of hands and feet. The p63 and the DLX5;DLX6 transcription factors, expressed in the embryonic limb buds and ectoderm, are disease genes for these conditions. Mutations of p63 also cause the ectodermal dysplasia–ectrodactyly–cleft lip/palate (EEC) syndrome, comprising SHFM. Ectrodactyly is linked to defects of the apical ectodermal ridge (AER) of the developing limb buds. ...

  2. Elasticity of substitution between clean and dirty energy inputs: A macroeconomic perspective

    OpenAIRE

    Papageorgiou, Chris; Saam, Marianne; Schulte, Patrick

    2013-01-01

    Recently Acemolgu, Aghion, Bursztyn and Hemous (AER 2012) formulated a model in which a high macroeconomic elasticity of substitution between clean and dirty production represents a crucial condition for green growth. Until now it has never been systematically estimated. Using a novel panel of cross-country sectoral data, we formulate specifications of nested CES production functions that allow to estimate a special case of this parameter: the elasticity of substitution between clean and dirt...

  3. Experimental studies on particle emissions from cruising ship, their characteristic properties, transformation and atmospheric lifetime in the marine boundary layer

    OpenAIRE

    Petzold, A.; Hasselbach, J.; P. Lauer; Baumann, R.; Franke, K.; Gurk, C.; H. Schlager; Weingartner, E.

    2007-01-01

    Particle emissions from ship engines and their atmospheric transformation in the marine boundary layer (MBL) were investigated in engine test bed studies and in airborne measurements of expanding ship plumes. During the test rig studies, detailed aerosol microphysical and chemical properties were measured in the exhaust gas of a serial MAN B&W seven-cylinder four-stroke marine diesel engine under various load conditions. The emission studies were complemented by airborne aer...

  4. Indoor environmental quality in French dwellings and building characteristics

    Science.gov (United States)

    Langer, Sarka; Ramalho, Olivier; Derbez, Mickaël; Ribéron, Jacques; Kirchner, Severine; Mandin, Corinne

    2016-03-01

    A national survey on indoor environmental quality covering 567 residences in mainland France was performed during 2003-2005. The measured parameters were temperature, relative humidity, CO2, and the indoor air pollutants: fourteen individual volatile organic compounds (VOC), four aldehydes and particulate matter PM10 and PM2.5. The measured indoor concentrations were analyzed for correlations with the building characteristics: type of dwelling, period of construction, dwelling location, type of ventilation system, building material, attached garage and retrofitting. The median night time air exchange rate (AER) for all dwellings was 0.44 h-1. The night time AER was higher in apartments (median = 0.49 h-1) than in single-family houses (median = 0.41 h-1). Concentration of formaldehyde was approximately 30% higher in dwellings built after 1990 compared with older ones; it was higher in dwellings with mechanical ventilation and in concrete buildings. The VOC concentrations depended on the building characteristics to various extents. The sampling season influenced the majority of the indoor climate parameters and the concentrations of the air pollutants to a higher degree than the building characteristics. Multivariate linear regression models revealed that the indoor-outdoor difference in specific humidity, a proxy for number of occupants and their indoor activities, remained a significant predictor for most gaseous and particulate air pollutants. The other strong predictors were outdoor concentration, smoking, attached garage and AER (in descending order).

  5. Predominantly vegetarian diet in patients with incipient and early clinical diabetic nephropathy: effects on albumin excretion rate and nutritional status.

    Science.gov (United States)

    Jibani, M M; Bloodworth, L L; Foden, E; Griffiths, K D; Galpin, O P

    1991-12-01

    Several studies have suggested that dietary protein quality may be an important determinant in the natural history of renal disease. We have therefore studied the effects of a predominantly vegetarian diet in eight patients with Type 1 diabetes mellitus and an albumin excretion rate (AER) in excess of 30 micrograms min-1. The AER was measured after an 8-week run-in period on the patient's usual diet, and again after 8 weeks of a predominantly vegetarian diet in which the proportion of vegetable protein was supplemented in order to minimize the reduction in total dietary protein intake. The median fractional albumin clearance fell during the study from an initial value of 188 x 10(-+) (range 58-810 x 10(-4)) at the end of the run-in period to 87 x 10(-4) (23-829 x 10(-4)) at the end of the period on low animal protein diet (difference 79 x 10(-4) (95% Cl 9-149 x 10(-4)), p less than 0.05). The AER then returned to values similar to those obtained at the beginning of the study after a further 8 weeks in those patients returning to their usual diet. No significant changes in blood glucose control or in arterial pressure were observed. A predominantly vegetarian diet may therefore have important beneficial effects on diabetic nephropathy without the need for a heavily restricted total protein intake.

  6. Annual Energy Review 2011

    Energy Technology Data Exchange (ETDEWEB)

    Fichman, Barbara T. [USDOE Energy Information Administration (EIA), Washington, DC (United States)

    2012-09-01

    The Annual Energy Review (AER) is the U.S. Energy Information Administration's (EIA) primary report of annual historical energy statistics. For many series, data begin with the year 1949. Included are statistics on total energy production, consumption, trade, and energy prices; overviews of petroleum, natural gas, coal, electricity, nuclear energy, and renewable energy; financial and environment indicators; and data unit conversions. Publication of this report is required under Public Law 95–91 (Department of Energy Organization Act), Section 205(c), and is in keeping with responsibilities given to the EIA under Section 205(a)(2), which states: “The Administrator shall be responsible for carrying out a central, comprehensive, and unified energy data and information program which will collect, evaluate, assemble, analyze, and disseminate data and information....” The AER is intended for use by Members of Congress, Federal and State agencies, energy analysts, and the general public. EIA welcomes suggestions from readers regarding the content of the AER and other EIA publications.

  7. Annual Energy Review 1997

    Energy Technology Data Exchange (ETDEWEB)

    Seiferlein, Katherine E. [USDOE Energy Information Administration (EIA), Washington, DC (United States)

    1998-07-01

    The Annual Energy Review (AER) presents the Energy Information Administration’s historical energy statistics. For many series, statistics are given for every year from 1949 through 1997. The statistics, expressed in either physical units or British thermal units, cover all major energy activities, including consumption, production, trade, stocks, and prices, for all major energy commodities, including fossil fuels, electricity, and renewable energy sources. Publication of this report is in keeping with responsibilities given to the Energy Information Administration (EIA) in Public Law 95–91 (Department of Energy Organization Act), which states, in part, in Section 205(a)(2) that: “The Administrator shall be responsible for carrying out a central, comprehensive, and unified energy data and information program which will collect, evaluate, assemble, analyze, and disseminate data and information....” The AER is intended for use by Members of Congress, Federal and State agencies, energy analysts, and the general public. EIA welcomes suggestions from readers regarding data series in the AER and in other EIA publications.

  8. Acoustically enhanced remediation of contaminated soils and ground water. Volume 1

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-10-01

    The Phase 1 laboratory bench-scale investigation results have shown that acoustically enhanced remediation (AER) technology can significantly accelerate the ground water remediation of non-aqueous phase liquids (NAPLs) in unconsolidated soils. The testing also determined some of the acoustic parameters which maximize fluid and contaminant extraction rates. A technology merit and trade analysis identified the conditions under which AER could be successfully deployed in the field, and an analysis of existing acoustical sources and varying methods for their deployment found that AER technology can be successfully deployed in-situ. Current estimates of deployability indicate that a NAPL plume 150 ft in diameter can be readily remediated. This program focused on unconsolidated soils because of the large number of remediation sites located in this type of hydrogeologic setting throughout the nation. It also focused on NAPLs and low permeability soil because of the inherent difficult in the remediation of NAPLs and the significant time and cost impact caused by contaminated low permeability soils. This overall program is recommended for Phase 2 which will address the technology scaling requirements for a field scale test.

  9. Collaborative Research: The Influence of Cloud Microphysics and Radiation on the Response of Water Vapor and Clouds to Climate Change

    Energy Technology Data Exchange (ETDEWEB)

    Dr. Kerry Emanuel; Michael J. Iacono

    2011-06-28

    Uncertainties in representing the atmospheric water cycle are major obstacles to an accurate prediction of future climate. This project focused on addressing some of these uncertainties by implementing new physics for convection and radiation into the NCAR climate model. To better understand and eventually better represent these processes, we modified CAM3.5 to use the convection and cloud schemes developed by the Massachusetts Institute of Technology (MIT) and the RRTMG rapid radiation code for global models developed by Atmospheric and Environmental Research, Inc. (AER). The impact of the new physics on the CAM3.5 simulation of convection on diurnal and intra-seasonal scales, intra-seasonal oscillations and the distribution of water vapor has been investigated. The effect of the MIT and AER physics also has been tested in the Weather Research and Forecasting (WRF) regional forecast model. It has been found that the application of the AER radiation and MIT convection produces significant improvements in the modeled diurnal cycle of convection, especially over land, in the NCAR climate model. However, both the standard CAM3.5 (hereinafter STD) and the modified CAM3.5 with the new physics (hereinafter MOD) are still unable to capture the proper spectrum and propagating characteristics of the intra-seasonal oscillations (ISOs). The new physics methods modify, but do not substantially improve, the distribution of upper tropospheric water vapor relative to satellite measurements.

  10. Annual Energy Review 1993

    Energy Technology Data Exchange (ETDEWEB)

    1994-07-14

    This twelfth edition of the Annual Energy Review (AER) presents the Energy Information Administration`s historical energy statistics. For most series, statistics are given for every year from 1949 through 1993. Because coverage spans four and a half decades, the statistics in this report are well-suited to long-term trend analyses. The AER is comprehensive. It covers all major energy activities, including consumption, production, trade, stocks, and prices, for all major energy commodities, including fossil fuels and electricity. The AER also presents Energy Information Administration (EIA) statistics on some renewable energy sources. EIA estimates that its consumption series include about half of the renewable energy used in the United States. For a more complete discussion of EIA`s renewables data, see p. xix, ``Introducing Expanded Coverage of Renewable Energy Data Into the Historical Consumption Series.`` Copies of the 1993 edition of the Annual Energy Review may be obtained by using the order form in the back of this publication. Most of the data in the 1993 edition also are available on personal computer diskette. For more information about the diskettes, see the back of this publication. In addition, the data are available as part of the National Economic, Social, and Environmental Data Bank on a CD-ROM. For more information about the data bank, contact the US Department of Commerce Economics and Statistics Administration, on 202-482-1986.

  11. Annual Energy Review 2000

    Energy Technology Data Exchange (ETDEWEB)

    Seiferlein, Katherine E. [USDOE Energy Information Administration (EIA), Washington, DC (United States)

    2001-08-01

    The Annual Energy Review (AER) presents the Energy Information Administration’s historical energy statistics. For many series, statistics are given for every year from 1949 through 2000. The statistics, expressed in either physical units or British thermal units, cover all major energy activities, including consumption, production, trade, stocks, and prices, for all major energy commodities, including fossil fuels, electricity, and renewable energy sources. Publication of this report is required under Public Law 95–91 (Department of Energy Organization Act), Section 205(c), and is in keeping with responsibilities given to the Energy Information Administration under Section 205(a)(2), which states: “The Administrator shall be responsible for carrying out a central, comprehensive, and unified energy data and information program which will collect, evaluate, assemble, analyze, and disseminate data and information....” The AER is intended for use by Members of Congress, Federal and State agencies, energy analysts, and the general public. EIA welcomes suggestions from readers regarding data series in the AER and in other EIA publications.

  12. Mixed-effects Poisson regression analysis of adverse event reports: the relationship between antidepressants and suicide.

    Science.gov (United States)

    Gibbons, Robert D; Segawa, Eisuke; Karabatsos, George; Amatya, Anup K; Bhaumik, Dulal K; Brown, C Hendricks; Kapur, Kush; Marcus, Sue M; Hur, Kwan; Mann, J John

    2008-05-20

    A new statistical methodology is developed for the analysis of spontaneous adverse event (AE) reports from post-marketing drug surveillance data. The method involves both empirical Bayes (EB) and fully Bayes estimation of rate multipliers for each drug within a class of drugs, for a particular AE, based on a mixed-effects Poisson regression model. Both parametric and semiparametric models for the random-effect distribution are examined. The method is applied to data from Food and Drug Administration (FDA)'s Adverse Event Reporting System (AERS) on the relationship between antidepressants and suicide. We obtain point estimates and 95 per cent confidence (posterior) intervals for the rate multiplier for each drug (e.g. antidepressants), which can be used to determine whether a particular drug has an increased risk of association with a particular AE (e.g. suicide). Confidence (posterior) intervals that do not include 1.0 provide evidence for either significant protective or harmful associations of the drug and the adverse effect. We also examine EB, parametric Bayes, and semiparametric Bayes estimators of the rate multipliers and associated confidence (posterior) intervals. Results of our analysis of the FDA AERS data revealed that newer antidepressants are associated with lower rates of suicide adverse event reports compared with older antidepressants. We recommend improvements to the existing AERS system, which are likely to improve its public health value as an early warning system. PMID:18404622

  13. Characterization of CetA and CetB, a bipartite energy taxis system in Campylobacter jejuni.

    Science.gov (United States)

    Elliott, Kathryn T; Dirita, Victor J

    2008-09-01

    The energy taxis receptor Aer, in Escherichia coli, senses changes in the redox state of the electron transport system via an flavin adenine dinucleotide cofactor bound to a PAS domain. The PAS domain (a sensory domain named after three proteins Per, ARNT and Sim, where it was first identified) is thought to interact directly with the Aer HAMP domain to transmit this signal to the highly conserved domain (HCD) found in chemotaxis receptors. An apparent energy taxis system in Campylobacter jejuni is composed of two proteins, CetA and CetB, that have the domains of Aer divided between them. CetB has a PAS domain, while CetA has a predicted transmembrane region, HAMP domain and the HCD. In this study, we examined the expression of cetA and cetB and the biochemical properties of the proteins they encode. cetA and cetB are co-transcribed independently of the flagellar regulon. CetA has two transmembrane helices in a helical hairpin while CetB is a peripheral membrane protein tightly associated with the membrane. CetB levels are CetA dependent. Additionally, we demonstrated that both CetA and CetB participate in complexes, including a likely CetB dimer and a complex that may include both CetA and CetB. This study provides a foundation for further characterization of signal transduction mechanisms within CetA/CetB. PMID:18631239

  14. A comparative study between all-electron scalar relativistic calculation and all-electron calculation on the adsorption of hydrogen molecule onto small gold clusters

    Indian Academy of Sciences (India)

    Xiang-Jun Kuang; Xin-Qiang Wang; Gao-Bin Liu

    2013-03-01

    A comparative study between all-electron relativistic (AER) calculation and all-electron (AE) calculation on the H2 molecule adsorption onto small gold clusters has been performed. Compared with the corresponding AuH2 cluster obtained by AE method, the AuH2 cluster obtained by AER method has much shorter Au-H bond-length, much longer H-H distance, larger binding energy and adsorption energy, higher vertical ionization potentials (VIP), greater charge transfer, higher vibrational frequency of Au-H mode and lower vibrational frequency of H-H mode. The delocalization of the highest occupied molecular orbital (HOMO) and the lowest unoccupied molecular orbital (LUMO) for AuH2 cluster obtained by AER method is obvious. All these characteristics suggest that the scalar relativistic effect might strengthen the Au-H bond and weaken the H-H bond. It is believed that the scalar relativistic effect is favourable to the H2 molecule adsorption onto small gold cluster and the reactivity enhancement of H2 molecule. It may be one of the reasons why the dissociative adsorptions take place in some AuH2 clusters. With increasing size of AuH2 clusters, the influence of scalar relativistic effect becomes more significant. Some further studies focused on the influence of scalar relativistic effect on the adsorption behaviour of other small molecules onto gold clusters are necessary in the future.

  15. Modeling Population Exposures to Pollutants Emitted from Natural Gas Cooking Burners

    Energy Technology Data Exchange (ETDEWEB)

    Lobscheid, Agnes; Singer, Brett C.; Klepeis, Neil E.

    2011-06-01

    We developed a physics-based data-supported model to investigate indoor pollutant exposure distributions resulting from use of natural gas cooking appliances across households in California. The model was applied to calculate time-resolved indoor concentrations of CO, NO2 and formaldehyde resulting from cooking burners and entry with outdoor air. Exposure metrics include 1-week average concentrations and frequency of exceeding ambient air quality standards. We present model results for Southern California (SoCal) using two air-exchange scenarios in winter: (1) infiltration-only, and (2) air exchange rate (AER) sampled from lognormal distributions derived from measurements. In roughly 40percent of homes in the SoCal cohort (N=6634) the 1-hour USEPA NO2 standard (190 ?g/m3) was exceeded at least once. The frequency of exceeding this standard was largely independent of AER assumption, and related primarily to building volume, emission rate and amount of burner use. As expected, AER had a more substantial impact on one-week average concentrations.

  16. Annual Energy Review 2009

    Energy Technology Data Exchange (ETDEWEB)

    Fichman, Barbara T. [USDOE Energy Information Administration (EIA), Washington, DC (United States)

    2010-08-01

    The Annual Energy Review (AER) is the U.S. Energy Information Administration's (EIA) primary report of annual historical energy statistics. For many series, data begin with the year 1949. Included are statistics on total energy production, consumption, trade, and energy prices; overviews of petroleum, natural gas, coal, electricity, nuclear energy, renewable energy, and international energy; financial and environment indicators; and data unit conversions. Publication of this report is required under Public Law 95–91 (Department of Energy Organization Act), Section 205(c), and is in keeping with responsibilities given to the EIA under Section 205(a)(2), which states: “The Administrator shall be responsible for carrying out a central, comprehensive, and unified energy data and information program which will collect, evaluate, assemble, analyze, and disseminate data and information....” The AER is intended for use by Members of Congress, Federal and State agencies, energy analysts, and the general public. EIA welcomes suggestions from readers regarding the content of the AER and other EIA publications.

  17. Annual Energy Review 2005

    Energy Technology Data Exchange (ETDEWEB)

    Seiferlein, Katherine E. [USDOE Energy Information Administration (EIA), Washington, DC (United States)

    2006-07-01

    The Annual Energy Review (AER) is the Energy Information Administration's (EIA) primary report of annual historical energy statistics. For many series, data begin with the year 1949. Included are data on total energy production, consumption, and trade; overviews of petroleum, natural gas, coal, electricity, nuclear energy, renewable energy, international energy, as well as financial and environment indicators; and data unit conversion tables. Publication of this report is required under Public Law 95–91 (Department of Energy Organization Act), Section 205(c), and is in keeping with responsibilities given to the EIA under Section 205(a)(2), which states: “The Administrator shall be responsible for carrying out a central, comprehensive, and unified energy data and information program which will collect, evaluate, assemble, analyze, and disseminate data and information....” The AER is intended for use by Members of Congress, Federal and State agencies, energy analysts, and the general public. EIA welcomes suggestions from readers regarding data series in the AER and in other EIA publications.

  18. Annual Energy Review 2004

    Energy Technology Data Exchange (ETDEWEB)

    Seiferlein, Katherine E. [USDOE Energy Information Administration (EIA), Washington, DC (United States)

    2005-08-01

    The Annual Energy Review (AER) is the Energy Information Administration's (EIA) primary report of annual historical energy statistics. For many series, data begin with the year 1949. Included are data on total energy production, consumption, and trade; overviews of petroleum, natural gas, coal, electricity, nuclear energy, renewable energy, international energy, as well as financial and environment indicators; and data unit conversion tables. Publication of this report is required under Public Law 95–91 (Department of Energy Organization Act), Section 205(c), and is in keeping with responsibilities given to the EIA under Section 205(a)(2), which states: “The Administrator shall be responsible for carrying out a central, comprehensive, and unified energy data and information program which will collect, evaluate, assemble, analyze, and disseminate data and information....” The AER is intended for use by Members of Congress, Federal and State agencies energy analysts, and the general public. EIA welcomes suggestions from readers regarding data series in the AER and in other EIA publications.

  19. Annual Energy Review 2006

    Energy Technology Data Exchange (ETDEWEB)

    Seiferlein, Katherine E. [USDOE Energy Information Administration (EIA), Washington, DC (United States)

    2007-06-01

    The Annual Energy Review (AER) is the Energy Information Administration's (EIA) primary report of annual historical energy statistics. For many series, data begin with the year 1949. Included are data on total energy production, consumption, and trade; overviews of petroleum, natural gas, coal, electricity, nuclear energy, renewable energy, international energy, as well as financial and environment indicators; and data unit conversion tables. Publication of this report is required under Public Law 95–91 (Department of Energy Organization Act), Section 205(c), and is in keeping with responsibilities given to the EIA under Section 205(a)(2), which states: “The Administrator shall be responsible for carrying out a central, comprehensive, and unified energy data and information program which will collect, evaluate, assemble, analyze, and disseminate data and information....” The AER is intended for use by Members of Congress, Federal and State agencies, energy analysts, and the general public. EIA welcomes suggestions from readers regarding data series in the AER and in other EIA publications.

  20. Training intensities for aerobic exercise determined on untrained healthy men.

    Directory of Open Access Journals (Sweden)

    Miura,Mochiyoshi

    1995-04-01

    Full Text Available The purpose of this study was to determine the aerobic training intensity from the maximal and submaximal running exercise in 21 untrained adult men. To accomplish this, we evaluated the relationship between physiological (oxygen intake and heart rate and physical parameters (running speed of training intensity, and determined the training intensity at the submaximal exercise. Oxygen intake and heart rate were measured by a treadmill test. The maximal oxygen intake (VO2 max, and the aerobic threshold (AerT and anaerobic threshold (AT were measured to determine respiratory gas exchange. Running capacity was measured by a 12-min running and treadmill test. For the maximal exercise, there was a significant correlation (r = 0.88, P < 0.01 between VO2 max and 12-min running distance (speed. In addition, the oxygen intake and heart rate at AerT and AT in the submaximal exercise were linearly correlated with running speed. Three levels of training intensity at the submaximal exercise were termed: light, moderate, and heavy. Since AerT was the lower limit intensity and AT was the upper limit, we took the middle of their values as the moderate intensity. The end point for the determination of the training intensity at the submaximal exercise was estimated to be 85% VO2 max and 180 beats.min-1.

  1. Network regulation and regulatory institutional reform: Revisiting the case of Australia

    International Nuclear Information System (INIS)

    It is well-understood that the success of liberalizing the electricity supply industry depends crucially on the quality and design of the regulatory and institutional framework. This paper analyses the regulatory arrangements that underpin the work of the Australian Energy Regulator (AER). These arrangements are contrasted with the regulatory structure of electricity provision in Norway. A key difference between the reform processes in the two countries relates to the lack of privatization in Norway and the co-existence of private and publicly owned generators and distributors in Australia. This comparative analysis allows us to make several recommendations to improve regulatory arrangements in Australia. These include greater independence for the AER, better coordination among regulatory institutions, greater use of benchmarking analysis, greater customer involvement, and improving market transparency and privatization of government-owned corporations. However, the success of privatization will hinge upon the effectiveness of the regulatory environment. - Highlights: • Rising electricity prices and network costs is of great concern in Australia. • Flaws in the existing regulatory environment and economic efficiency exist. • The AER should be provided with adequate resources (financial and staff experts) and discretion. • Robust benchmarking techniques should be adopted in the incentive regulation framework for cost efficiency. • Privatization of the state-owned assets also remains an option

  2. Early Urinary Markers of Diabetic Kidney Disease: A Nested Case-Control Study From the Diabetes Control and Complications Trial (DCCT)

    Science.gov (United States)

    Kern, Elizabeth O; Erhard, Penny; Sun, Wanjie; Genuth, Saul; Weiss, Miriam F

    2010-01-01

    Background Urinary markers were tested as predictors of macroalbuminuria or microalbuminuria in type 1 diabetes. Study Design Nested case:control of participants in the Diabetes Control and Complications Trial (DCCT) Setting & Participants Eighty-seven cases of microalbuminuria were matched to 174 controls in a 1:2 ratio, while 4 cases were matched to 4 controls in a 1:1 ratio, resulting in 91 cases and 178 controls for microalbuminuria. Fifty-five cases of macroalbuminuria were matched to 110 controls in a 1:2 ratio. Controls were free of micro/macroalbuminuria when their matching case first developed micro/macroalbuminuria. Predictors Urinary N-acetyl-β-D-glucosaminidase, pentosidine, AGE fluorescence, albumin excretion rate (AER) Outcomes Incident microalbuminuria (two consecutive annual AER > 40 but 300 mg/day) Measurements Stored urine samples from DCCT entry, and 1–9 years later when macroalbuminuria or microalbuminuria occurred, were measured for the lysosomal enzyme, N-acetyl-β-D-glucosaminidase, and the advanced glycosylation end-products (AGEs) pentosidine and AGE-fluorescence. AER and adjustor variables were obtained from the DCCT. Results Sub-microalbuminuric levels of AER at baseline independently predicted microalbuminuria (adjusted OR 1.83; p<.001) and macroalbuminuria (adjusted OR 1.82; p<.001). Baseline N-acetyl-β-D-glucosaminidase independently predicted macroalbuminuria (adjusted OR 2.26; p<.001), and microalbuminuria (adjusted OR 1.86; p<.001). Baseline pentosidine predicted macroalbuminuria (adjusted OR 6.89; p=.002). Baseline AGE fluorescence predicted microalbuminuria (adjusted OR 1.68; p=.02). However, adjusted for N-acetyl-β-D-glucosaminidase, pentosidine and AGE-fluorescence lost predictive association with macroalbuminuria and microalbuminuria, respectively. Limitations Use of angiotensin converting-enzyme inhibitors was not directly ascertained, although their use was proscribed during the DCCT. Conclusions Early in type 1 diabetes

  3. Pallidal Deep Brain Stimulation Improves Higher Control of the Oculomotor System in Parkinson's Disease.

    Science.gov (United States)

    Antoniades, Chrystalina A; Rebelo, Pedro; Kennard, Christopher; Aziz, Tipu Z; Green, Alexander L; FitzGerald, James J

    2015-09-23

    The frontal cortex and basal ganglia form a set of parallel but mostly segregated circuits called cortico-basal ganglia loops. The oculomotor loop controls eye movements and can direct relatively simple movements, such as reflexive prosaccades, without external help but needs input from "higher" loops for more complex behaviors. The antisaccade task requires the dorsolateral prefrontal cortex, which is part of the prefrontal loop. Information flows from prefrontal to oculomotor circuits in the striatum, and directional errors in this task can be considered a measure of failure of prefrontal control over the oculomotor loop. The antisaccadic error rate (AER) is increased in Parkinson's disease (PD). Deep brain stimulation (DBS) of the subthalamic nucleus (STN) has no effect on the AER, but a previous case suggested that DBS of the globus pallidus interna (GPi) might. Our aim was to compare the effects of STN DBS and GPi DBS on the AER. We tested eye movements in 14 human DBS patients and 10 controls. GPi DBS substantially reduced the AER, restoring lost higher control over oculomotor function. Interloop information flow involves striatal neurons that receive cortical input and project to pallidum. They are normally silent when quiescent, but in PD they fire randomly, creating noise that may account for the degradation in interloop control. The reduced AER with GPi DBS could be explained by retrograde stimulation of striatopallidal axons with consequent activation of inhibitory collaterals and reduction in background striatal firing rates. This study may help explain aspects of PD pathophysiology and the mechanism of action of GPi DBS. Significance statement: Parkinson's disease causes symptoms including stiffness, slowness of movement, and tremor. Electrical stimulation of specific areas deep in the brain can effectively treat these symptoms, but exactly how is not fully understood. Part of the cause of such symptoms may be impairments in the way information flows

  4. 有氧运动加弹力带对正常高值血压人群血压及心血管病危险因素的干预

    Institute of Scientific and Technical Information of China (English)

    肖瑄; 刘锋; 张亚星; 叶晓琴; 李彬

    2014-01-01

    目的:探讨有氧运动和弹力带对正常高值血压人群血压及心血管病危险因素的影响。方法120例正常高值血压人群随机分为对照组、有氧运动组( AER )和有氧运动加弹力带组( AER+RES ),分别于运动前、运动后24周测量两组身高、体质量、血压( SBP、DBP )、总胆固醇( TC )、三酰甘油( TG )、高密度脂蛋白胆固醇( HDL-C )、低密度脂蛋白胆固醇( LDL-C )、空腹血糖( FPG )、高敏C反应蛋白(hs-CRP)。结果 AER组和AER+RES组SBP、DBP、TG、FPG、hs-CRP较干预前及对照组均有下降,HDL-C升高(P<0.05);AER+RES组DBP、FPG、hs-CRP较AER组显著下降,差异有统计学意义(P<0.05)。而对照组实验前后各指标差异均无统计学意义。结论正常高值血压人群通过24周的有氧运动加弹力带抗阻练习,在血压下降的同时,各种心血管病危险因素也得到控制,表明有氧运动加抗阻练习对预防原发性高血压病及其并发症的发生起到重要作用。%Objective To investigate the effect of aerobic exercise and elastic strap on blood pressure and cardiovascular disease risk fac-tors am ong people w ith high-norm al blood pressure.Methods 120 people w ith high-norm al blood pressure w ere random ly divided into con-trol group ,aerobic exercise group (AER )and aerobic exercise com bined elastic strap group (AER+RES ),and the items such as height,body mass index(BMI),blood pressure(SBP,DBP),total cholesterol(TC),triglyceride(TG),high density lipoprotein cholesterol(HDL-C),low density lipoprotein cholesterin(LDL-C),fasting plasma glucose(FPG),and high-sensitivity C-reactive protein(hs-CRP)were measured before andafte r24weeksexercise intervention.Results Thevalues of SBP,DBP,TG,FPG,andhs-CRPoftheAER group and the AER+RES group decreased com pared to those before the intervention and those of the control group ,w hile the value of HDL-C increased (P<0 .05 ). ThevaluesofDBP、FPG、hs-CRPoftheAER+RESgroupsignificantlyreducedcompardwiththeAER

  5. Are Medications Involved in Vision and Intracrancial Pressure Changes Seen in Spaceflight?

    Science.gov (United States)

    Faust, K. M.; Wotring, V. E.

    2014-01-01

    The Food and Drug Association Adverse Event Reports (FDA AER) from 2009-2011 were used to create a database from millions of known and suspected medication-related adverse events among the general public. Vision changes, sometimes associated with intracranial pressure changes (VIIP), have been noted in some long duration crewmembers. Changes in vision and blood pressure (which can subsequently affect intracranial pressure) are fairly common side effects of medications. The purpose of this study was to explore the possibility of medication involvement in crew VIIP symptoms. Reports of suspected medication-related adverse events may be filed with the Food and Drug Administration (FDA) by medical professionals or consumers. Quarterly compilations of these reports are available for public download. Adverse Event Reporting System (AERS) reports from 1/1/2009- 6/30/2012 were downloaded and compiled into a searchable database for this study. Reports involving individuals under the age of 18 and older than 65 were excluded from this analysis. Case reports involving chronic diseases such as cancer, diabetes, multiple sclerosis and other serious conditions were also excluded. A scan of the medical literature for medication-related VIIP-like adverse events was used to create a list of suspect medications. These medications, as well as certain medications used frequently by ISS crew, were used to query the database. Queries for use of suspected medications were run, and the nature of the symptoms reported in those cases were tabulated. Symptoms searched in the FDA AERS were chosen to include the typical symptoms noted in crewmembers with VIIP. Vision symptoms searched were: visual acuity reduced, visual impairment, and vitreous floaters. Pressure changes included: abnormal sensation in eye, intracranial pressure increased, intraocular pressure increased, optic neuritis, optic neuropathy, and papilloedema. Limited demographic information is included with the FDA AERS; relevant

  6. Effects of quorum sensing system lasR/rhlR gene on the expression of Foxp3, TGF-β1 and IL-10 of lung tissue in tracheal intubation model rat with Pseudomonas aeruginosa biofilm infection

    Directory of Open Access Journals (Sweden)

    Qing-qing XIANG

    2016-03-01

    Full Text Available Objective  To investigate the effects of lasR/rhlR gene on Foxp3, TGF-β1 and IL-10 of lung tissue in rat tracheal intubation model with biofilm infection of Pseudomonas aeruginosa (Ps. aer wild strain (PAO1 and quorum sensing (QS deficient strain (ΔlasRΔrhlR. Methods  Twenty-one SD rats were randomly assigned into 3 groups (7 each: ΔlasRΔrhlR-treated group, PAO1-treated group and sterile control group. Biofilms (BF were cultured in vitro, and the BF coated tube (infected respectively with Ps. aer PAO1 strain, ΔlasRΔrhlR strain, or with asepsis was inserted into the trachea to establish the rat model. The rats were sacrificed on the 7th day after intubation. Colony count of lung tissue homogenate (cfu and lung HE staining were performed, and IL-10 content in bronchoalveolar lavage fluid (BALF, TGF-β1 in lung tissue, and the expression of Foxp3 mRNA in lung cells were determined. Results  The bacterial counts were significantly higher in PAO1 and ΔlasRΔrhlR groups than that in sterile control group, and the counts were obviously higher in PAO1 group (10 400.00±6313.70/g lung tissue than that in ΔlasRΔrhlR group (975.00±559.97/g lung tissue, P<0.05. There was no significant pathological changes in lung tissue in sterile control group, while the bronchi and blood vessels in PAO1 group were infiltrated by a large number of inflammatory cells and complicated with alveolar septum thickening and local abscess and necrosis. The pathological changes were milder in ΔlasRΔrhlR group than in PAO1 group; the expression of Foxp3 mRNA was higher in the two Ps. aer infected groups than that in sterile control group (0.65±0.32, and it was significantly higher in PAO1 group (4.62±1.07 than in ΔlasRΔrhlR group (2.15±1.43, P<0.05. The accumulated optical density value of TGF-β1 was significantly higher in the two Ps. aer infected groups than in sterile control group (3721.66±1412.95, and significantly higher in PAO1 group (65 090.56±33

  7. RELACIÓN ENTRE ESTATUS PONDERAL, NIVEL DE CONDICIÓN FÍSICA Y COMPONENTES DE LA PRESIÓN ARTERIAL EN MUJERES DE ENTRE 18 Y 30AÑOS DE EDAD

    Directory of Open Access Journals (Sweden)

    Ignacio Ortiz-Galeano

    2012-01-01

    Full Text Available Fundamentos: Hasta donde conocemos, la relación entre la obesidad, la capacidad aeróbica y la fuerza muscular con la presión arterial (PA no se ha analizado conjuntamente. Nuestro objetivo fue estimar la relación entre el estatus ponderal y la condición física con los componentes de la PA en mujeres jóvenes. Métodos: Estudio transversal en 407 mujeres de 18-30 años. Se evaluó: peso, talla, índice de masa corporal (IMC, presión arterial sistólica (PAS, diastólica (PAD, media (PAM:PAD+[0,333x(PASPAD], y de pulso (PP: PAS-PAD y condición física (capacidad aeróbica y fuerza muscular. Resultados: La edad media de las participantes fue de 20,1± 4,4 años. La media de la PAS, PAD, PAM y de PP fue respectivamente: en las mujeres con normopeso 108,0±8,9, 67,7±6,7, 81,1±6,8 y 40,3±6,6 mmHg; en las mujeres con obesidad 123,1±8,9, 80,5±6,2, 94,7±6,5 y 42,5±6,2 mmHg; en las que tienen capacidad aeróbica baja 110,9±9,9, 70,5±7,6, 84,0±7,7 y 40,3±7,3 mmHg; y en las que tienen capacidad aeróbica alta 107,4±9,3, 67,0±7,0, 80,4±7,2 y 40,4±6,6 mmHg. La fuerza muscular no se asoció estadísticamente con ninguno de los componentes de PA (p>0,05. En modelos de regresión lineal múltiple la PAS se asoció con el IMC y el índice de fuerza muscular (p= ≤0,05; la PAD y la PAM con el IMC, el índice de fuerza muscular y la capacidad aeróbica (p= ≤0,05; y la PP con el IMC (p= <0,05. Conclusiones: En mujeres jóvenes el IMC y la fuerza muscular mantienen una relación directa con la PA, y la capacidad aeróbica una relación inversa, si bien esta última no se asocia con la PAS ni con la PP.

  8. Impact of pulmonary vein isolation on atrial vagal activity and atrial electrical remodeling

    Institute of Scientific and Technical Information of China (English)

    Yingxue Dong; Shulong Zhang; Lianjun Gao; Hongwei Zhao; Donghui Yang; Yunlong Xia; Yanzong Yang

    2008-01-01

    Objective Mechanisms of pulmonary vein isolation (PVI) for atrial fibrillation remain controversy.This study aimed to investigate the impact of PVI on vagal modulation to atria.Methods Eighteen adult mongrel dogs under general anesthesia were randomly divided into two groups.Bilateral cervical sympathovagal trunks were decentralized and sympathetic effects was blocked by metoprolol administration.Atrial electrical remodeling (AER) was established by rapid right atrial pacing at the rate of 600 bpm for 30 minutes.PVI was performed in group A.Atrial effective refractory period (ERP),vulnerability window (VW) of atrial fibrillation,and sinus rhythm cycle length (SCL) were measured at baseline and during vagal stimulation before and after atrial rapid pacing with and without PVI at fight atrial appendage (RAA),left atrial appendage (LAA),distal coronary sinus (CSd) and proximal coronary sinus (CSp).Results (1) Effects of PVI on vagal modulation:Shortening of SCL during vagal stimulation decreased significantly after PVI compared with that before PVI in group A (P<0.001).Shortening of ERP during vagal stimulation decreaseed significantly after PVI compared with that before PVI (P<0.05).VW of atrial fibrillation during vagal stimulation decreased significantly after PVI compared with that before PVI (P<0.05).(2) Effects of PVI on AER:shortening of ERP before and after atrial rapid pacing increased significantly at baseline and vagal stimulation in group B compared with that in group A (P<0.05).VW during vagal stimulation increased significantly after atrial rapid pacing in group B (P<0.05).Conclusion PVI attenuates the vagal modulation to the atria,thereby decreases the susceptibility to atrial fibrillation mediated by vagal activity.PVI releases AER,which maybe contributes to the vagal denervation.Our study indicates that PVI not only can eradicate triggered foci but also modify substrates for AF.(J Geriatr Cardiol 2008;5:28-32)

  9. EFFECTS OF TRAINING AND DETRAINING ON GLYCOSYLATED HAEMOGLOBIN, GLYCAEMIA AND LIPID PROFILE IN TYPE-II DIABETICS.

    Science.gov (United States)

    Yuing Farias, Tuillang; Santos-Lozano, Alejandro; Solís Urra, Patricio; Cristi-Montero, Carlos

    2015-10-01

    Objetivo: el propósito del presente estudio fue determinar el efecto del entrenamiento y las consecuencias del desentrenamiento comparando un protocolo de entrenamiento aeróbico (E-Aer) y otro de sobrecarga (E-Sob). Métodos: participaron 30 personas entre 45-50 años de edad con diagnóstico de diabetes mellitus tipo II (DMII) sin tratamiento farmacológico. Fueron aleatorizados a un grupo de E-Aer (65% de su esfuerzo máximo) o a un grupo de E-Sob (protocolo 1 x 2 x 3 al 65% de 1RM). Se midió el peso, el índice de masa corporal, el colesterol total, HDL-C, LDL-C, triglicéridos, glucemia en ayuno y la hemoglobina glucosilada (HbA1C) al inicio, al finalizar las seis semanas de entrenamiento y tras seis semanas de desentrenamiento. Resultados: los resultados indican que ambos protocolos de entrenamiento físico son capaces de inducir modificaciones significativas en el perfil lipídico, la glicemia en ayuno y los niveles de HbA1C; sin embargo, solo el grupo E-Sob demostró mantener los beneficios logrados tras haber interrumpido el programa de entrenamiento en la reducción del LDL-C, HbA1C y en el incremento del HDL-C. Conclusiones: el ejercicio de sobrecarga en personas con DMII influye de manera importante en la salud, efecto que podría mantenerse incluso si se llega a interrumpir a corto plazo el programa de entrenamiento.

  10. Drugs associated with more suicidal ideations are also associated with more suicide attempts.

    Directory of Open Access Journals (Sweden)

    Henry T Robertson

    Full Text Available CONTEXT: In randomized controlled trials (RCTs, some drugs, including CB1 antagonists for obesity treatment, have been shown to cause increased suicidal ideation. A key question is whether drugs that increase or are associated with increased suicidal ideations are also associated with suicidal behavior, or whether drug-induced suicidal ideations are unlinked epiphenomena that do not presage the more troubling and potentially irrevocable outcome of suicidal behavior. This is difficult to determine in RCTs because of the rarity of suicidal attempts and completions. OBJECTIVE: To determine whether drugs associated with more suicidal ideations are also associated with more suicide attempts in large spontaneous adverse event (AE report databases. METHODOLOGY: Generalized linear models with negative binomial distribution were fitted to Food and Drug Administration (FDA Adverse Event (AE Reporting System (AERS data from 2004 to 2008. A total of 1,404,470 AEs from 832 drugs were analyzed as a function of reports of suicidal ideations; other non-suicidal adverse reactions; drug class; proportion of reports from males; and average age of subject for which AE was filed. Drug was treated as the unit of analysis, thus the statistical models effectively had 832 observations. MAIN OUTCOME MEASURES: Reported suicide attempts and completed suicides per drug. RESULTS: 832 drugs, ranging from abacavir to zopiclone, were evaluated. The 832 drugs, as primary suspect drugs in a given adverse event, accounted for over 99.9% of recorded AERS. Suicidal ideations had a significant positive association with suicide attempts (p<.0001 and had an approximately 131-fold stronger magnitude of association than non-suicidal AERs, after adjusting for drug class, gender, and age. CONCLUSIONS: In AE reports, drugs that are associated with increased suicidal ideations are also associated with increased suicidal attempts or completions. This association suggests that drug

  11. Auditory tasks for assessment of sensory function and affective prosody in schizophrenia.

    Science.gov (United States)

    Petkova, Eva; Lu, Feihan; Kantrowitz, Joshua; Sanchez, Jamie L; Lehrfeld, Jonathan; Scaramello, Nayla; Silipo, Gail; DiCostanza, Joanna; Ross, Marina; Su, Zhe; Javitt, Daniel C; Butler, Pamela D

    2014-11-01

    Schizophrenia patients exhibit impairments in auditory-based social cognition, indicated by deficits in detection of prosody, such as affective prosody and basic pitch perception. However, little is known about the psychometric properties of behavioral tests used to assess these functions. The goal of this paper is to characterize the properties of prosody and pitch perception tasks and to investigate whether they can be shortened. The pitch perception test evaluated is a tone-matching task developed by Javitt and colleagues (J-TMT). The prosody test evaluated is the auditory emotion recognition task developed by Juslin and Laukka (JL-AER). The sample includes 124 schizophrenia patients (SZ) and 131 healthy controls (HC). Properties, including facility and discrimination, of each item were assessed. Effects of item characteristics (e.g., emotion) were also evaluated. Shortened versions of the tests are proposed based on facility, discrimination, and/or ability of item characteristics to discriminate between patients and controls. Test-retest reliability is high for patients and controls for both the original and short forms of the J-TMT and JL-AER. Thus, the original as well as short forms of the J-TMT and JL-AER are suggested for inclusion in clinical trials of social cognitive and perceptual treatments. The development of short forms further increases the utility of these auditory tasks in clinical trials and clinical practice. The large SZ vs. HC differences reported here also highlight the profound nature of auditory deficits and a need for remediation. PMID:25214372

  12. Condición física, adiposidad y autoconcepto en adolescentes. Estudio piloto

    Directory of Open Access Journals (Sweden)

    Alejandro Garc\\u00EDa-S\\u00E1nchez

    2013-01-01

    Full Text Available Un alto índice de masa corporal y una baja capacidad aeróbica se asocia con un peor autoconcepto. Se ha observado también que personas obesas pero con buena forma física están físicamente sanos, fenómeno conocido como “fat but fit”. El presente estudio pretende: 1 determinar la relación entre cantidad de grasa corporal y principales componentes de la condición física con el autoconcepto en adolescentes; 2 testar si el fenómeno fat but fit se asocia con un mejor autoconcepto. Un total de 69 adolescentes (14.68 ± 1.36 años participaron en la evaluación de la composición corporal y la condición física (Batería ALPHA-Fitness. La capacidad aeróbica (forma vs. no en forma e índice de masa corporal (normo-peso vs. sobrepeso-obesidad fueron categorizadas usando criterios estándar. Cinco dimensiones del autoconcepto fueron evaluadas mediante el Cuestionario de Autoconcepto Forma 5. La grasa total y central se correlacionó negativamente con el autoconcepto físico, mientras que la condición física (fuerza, velocidad-agilidad y capacidad aeróbica se correlacionó positivamente (p .3. Los resultados confirman la paradoja fat but fit, el sobrepeso se asocia a un peor autoconcepto físico, pero si se tiene una buena forma física los valores de autoconcepto se igualan a los de los adolescentes con normo-peso.

  13. Factors Associated with the Decline of Kidney Function Differ among eGFR Strata in Subjects with Type 2 Diabetes Mellitus

    Directory of Open Access Journals (Sweden)

    Shu Meguro

    2012-01-01

    Full Text Available Introduction. There is no report about risk factors for renal deterioration according to the clinical stage, divided by the estimated glomerular filtration rate (eGFR in type 2 diabetes. Materials and Methods. We evaluated the factors correlated with the annual eGFR decline in 1303 subjects with type 2 diabetes whose eGFR was ≥30 mL/min/1.73 m2. eGFR strata were defined by baseline eGFR value as follows: stratum 1: ≥90, stratum 2: ≥60, <90, and stratum 3: ≥30, <60. Results. The annual eGFR decline was 2.3±5.4 mL/min/1.73 m2 in overall subjects. Multiple linear regression analysis demonstrated that age, male sex, systolic blood pressure, logarithmically transformed albumin excretion rate (AER, eGFR strata, and hemoglobin concentration were significantly correlated with the annual eGFR decline. When stratified by eGFR, the factors that showed a significant correlation were different among eGFR strata. AER was significantly correlated with annual eGFR decline in all eGFR strata. Hemoglobin concentration showed a significant correlation only in the advanced eGFR stratum. Conclusion. The factors correlated with the annual eGFR decline were different among eGFR strata in type 2 diabetes mellitus, and hemoglobin concentration and AER were important factors for renal deterioration, especially in the advanced eGFR stratum.

  14. Performance of selected anion exchange resins for the treatment of a high DOC content surface water.

    Science.gov (United States)

    Humbert, Hugues; Gallard, Hervé; Suty, Hervé; Croué, Jean-Philippe

    2005-05-01

    The objective of this study was first to compare the performance of four strong anion exchange resins (AERs) (MIEX from Orica Pty Ltd, DOWEX-11 and DOWEX-MSA from DOW chemical and IRA-938 from Rohm and Haas) for their application in drinking water treatment (natural organic matter (NOM), mineral anions (nitrate, sulfate and bromide) and pesticide removal) using bench-scale experimental procedures on a high DOC content surface water. The efficiency of MIEX for NOM and mineral anions removal was furthermore evaluated using bench-scale dose-response experiments on raw, clarified and post-ozonated waters. NOM removal was assessed using the measurement of dissolved organic carbon (DOC), UV absorbance at 254 nm (UV254) and the use of high-performance size exclusion chromatography with UV (HPSEC/UV) and fluorescence detection (HPSEC/FLUO). The MIEX and IRA938 anionic resins exhibit a faster removal of NOM and mineral anions compared to the DOWEX11 and MSA AERs. All the resins were found to be very effective with similar performances after 30 to 45 min of contact time. As expected, only limited sorption of atrazine and isoproturon (C0=1 microg/L) occurred with MIEX, DOWEX11 and MSA AERs. MIEX resin proved to be very efficient in eliminating NOM of high-molecular weight but also a large part of the smallest UV absorbing organic compounds which were refractory to coagulation/flocculation treatment. Remaining DOC levels after 30 min of contact with MIEX were found similar in raw water, clarified water and even post-ozonated water implying no DOC benefit can be gained by employing conventional treatment prior to MIEX treatment. Removal of bromide (initial concentration 110 microg/L) was also observed and ranged from 30% to 65% for resin dose increasing from 2 to 8 mL/L. T PMID:15899268

  15. Fuel consumption from vehicles of China until 2030 in energy scenarios

    International Nuclear Information System (INIS)

    Estimation of fuel (gasoline and diesel) consumption for vehicles in China under different long-term energy policy scenarios is presented here. The fuel economy of different vehicle types is subject to variation of government regulations; hence the fuel consumption of passenger cars (PCs), light trucks (Lts), heavy trucks (Hts), buses and motor cycles (MCs) are calculated with respect to (i) the number of vehicles, (ii) distance traveled, and (iii) fuel economy. On the other hand, the consumption rate of alternative energy sources (i.e. ethanol, methanol, biomass-diesel and CNG) is not evaluated here. The number of vehicles is evaluated using the economic elastic coefficient method, relating to per capita gross domestic product (GDP) from 1997 to 2007. The Long-range Energy Alternatives Planning (LEAP) system software is employed to develop a simple model to project fuel consumption in China until 2030 under these scenarios. Three energy consumption decrease scenarios are designed to estimate the reduction of fuel consumption: (i) 'business as usual' (BAU); (ii) 'advanced fuel economy' (AFE); and (iii) 'alternative energy replacement' (AER). It is shown that fuel consumption is predicted to reach 992.28 Mtoe (million tons oil equivalent) with the BAU scenario by 2030. In the AFE and AER scenarios, fuel consumption is predicted to be 734.68 and 600.36 Mtoe, respectively, by 2030. In the AER scenario, fuel consumption in 2030 will be reduced by 391.92 (39.50%) and 134.29 (18.28%) Mtoe in comparison to the BAU and AFE scenarios, respectively. In conclusion, our models indicate that the energy conservation policies introduced by governmental institutions are potentially viable, as long as they are effectively implemented.

  16. BMP-mediated functional cooperation between Dlx5;Dlx6 and Msx1;Msx2 during mammalian limb development.

    Directory of Open Access Journals (Sweden)

    Maxence Vieux-Rochas

    Full Text Available The Dlx and Msx homeodomain transcription factors play important roles in the control of limb development. The combined disruption of Msx1 and Msx2, as well as that of Dlx5 and Dlx6, lead to limb patterning defects with anomalies in digit number and shape. Msx1;Msx2 double mutants are characterized by the loss of derivatives of the anterior limb mesoderm which is not observed in either of the simple mutants. Dlx5;Dlx6 double mutants exhibit hindlimb ectrodactyly. While the morphogenetic action of Msx genes seems to involve the BMP molecules, the mode of action of Dlx genes still remains elusive. Here, examining the limb phenotypes of combined Dlx and Msx mutants we reveal a new Dlx-Msx regulatory loop directly involving BMPs. In Msx1;Dlx5;Dlx6 triple mutant mice (TKO, beside the expected ectrodactyly, we also observe the hallmark morphological anomalies of Msx1;Msx2 double mutants suggesting an epistatic role of Dlx5 and Dlx6 over Msx2. In Msx2;Dlx5;Dlx6 TKO mice we only observe an aggravation of the ectrodactyly defect without changes in the number of the individual components of the limb. Using a combination of qPCR, ChIP and bioinformatic analyses, we identify two Dlx/Msx regulatory pathways: 1 in the anterior limb mesoderm a non-cell autonomous Msx-Dlx regulatory loop involves BMP molecules through the AER and 2 in AER cells and, at later stages, in the limb mesoderm the regulation of Msx2 by Dlx5 and Dlx6 occurs also cell autonomously. These data bring new elements to decipher the complex AER-mesoderm dialogue that takes place during limb development and provide clues to understanding the etiology of congenital limb malformations.

  17. DLX5, FGF8 and the Pin1 isomerase control ΔNp63α protein stability during limb development: a regulatory loop at the basis of the SHFM and EEC congenital malformations.

    Science.gov (United States)

    Restelli, Michela; Lopardo, Teresa; Lo Iacono, Nadia; Garaffo, Giulia; Conte, Daniele; Rustighi, Alessandra; Napoli, Marco; Del Sal, Giannino; Perez-Morga, David; Costanzo, Antonio; Merlo, Giorgio Roberto; Guerrini, Luisa

    2014-07-15

    Ectrodactyly, or Split-Hand/Foot Malformation (SHFM), is a congenital condition characterized by the loss of central rays of hands and feet. The p63 and the DLX5;DLX6 transcription factors, expressed in the embryonic limb buds and ectoderm, are disease genes for these conditions. Mutations of p63 also cause the ectodermal dysplasia-ectrodactyly-cleft lip/palate (EEC) syndrome, comprising SHFM. Ectrodactyly is linked to defects of the apical ectodermal ridge (AER) of the developing limb buds. FGF8 is the key signaling molecule in this process, able to direct proximo-distal growth and patterning of the skeletal primordial of the limbs. In the limb buds of both p63 and Dlx5;Dlx6 murine models of SHFM, the AER is poorly stratified and FGF8 expression is severely reduced. We show here that the FGF8 locus is a downstream target of DLX5 and that FGF8 counteracts Pin1-ΔNp63α interaction. In vivo, lack of Pin1 leads to accumulation of the p63 protein in the embryonic limbs and ectoderm. We show also that ΔNp63α protein stability is negatively regulated by the interaction with the prolyl-isomerase Pin1, via proteasome-mediated degradation; p63 mutant proteins associated with SHFM or EEC syndromes are resistant to Pin1 action. Thus, DLX5, p63, Pin1 and FGF8 participate to the same time- and location-restricted regulatory loop essential for AER stratification, hence for normal patterning and skeletal morphogenesis of the limb buds. These results shed new light on the molecular mechanisms at the basis of the SHFM and EEC limb malformations. PMID:24569166

  18. BMP-mediated functional cooperation between Dlx5;Dlx6 and Msx1;Msx2 during mammalian limb development.

    Science.gov (United States)

    Vieux-Rochas, Maxence; Bouhali, Kamal; Mantero, Stefano; Garaffo, Giulia; Provero, Paolo; Astigiano, Simonetta; Barbieri, Ottavia; Caratozzolo, Mariano F; Tullo, Apollonia; Guerrini, Luisa; Lallemand, Yvan; Robert, Benoît; Levi, Giovanni; Merlo, Giorgio R

    2013-01-01

    The Dlx and Msx homeodomain transcription factors play important roles in the control of limb development. The combined disruption of Msx1 and Msx2, as well as that of Dlx5 and Dlx6, lead to limb patterning defects with anomalies in digit number and shape. Msx1;Msx2 double mutants are characterized by the loss of derivatives of the anterior limb mesoderm which is not observed in either of the simple mutants. Dlx5;Dlx6 double mutants exhibit hindlimb ectrodactyly. While the morphogenetic action of Msx genes seems to involve the BMP molecules, the mode of action of Dlx genes still remains elusive. Here, examining the limb phenotypes of combined Dlx and Msx mutants we reveal a new Dlx-Msx regulatory loop directly involving BMPs. In Msx1;Dlx5;Dlx6 triple mutant mice (TKO), beside the expected ectrodactyly, we also observe the hallmark morphological anomalies of Msx1;Msx2 double mutants suggesting an epistatic role of Dlx5 and Dlx6 over Msx2. In Msx2;Dlx5;Dlx6 TKO mice we only observe an aggravation of the ectrodactyly defect without changes in the number of the individual components of the limb. Using a combination of qPCR, ChIP and bioinformatic analyses, we identify two Dlx/Msx regulatory pathways: 1) in the anterior limb mesoderm a non-cell autonomous Msx-Dlx regulatory loop involves BMP molecules through the AER and 2) in AER cells and, at later stages, in the limb mesoderm the regulation of Msx2 by Dlx5 and Dlx6 occurs also cell autonomously. These data bring new elements to decipher the complex AER-mesoderm dialogue that takes place during limb development and provide clues to understanding the etiology of congenital limb malformations. PMID:23382810

  19. A Study on Optimization Design of the Powertrain of Plug-in Hybrid Electric Vehicle%Plug-in混合动力汽车动力总成优化设计研究

    Institute of Scientific and Technical Information of China (English)

    张博; 李君; 杨世春; 高莹; 尹雪峰

    2009-01-01

    The simulation model for a parallel plug-in hybrid electric vehicle (PHEV) with dual clutch is developed by using forward simulation software PSAT. After the performance constraints of PHEV are defined and the key component costs of its powertrain are analyzed, an optimization on the powertrain of PHEV with different all electric ranges (AER) and different types of power battery is conducted. The results show that the designed capaci-ty of power battery, which mainly dependeds on the AER required, has most effect on the cost of complete vehicle,and as the required AER increases, the desired maximum output power of electric motor rises and the power peak of engine reduces.%应用PSAT前向仿真软件,建立了双离合器式并联PHEV仿真模型.在确定了PHEV整车性能约束条件并对动力总成主要部件进行了成本分析之后,对不同伞电力续驶哩程和动力电池类型的PHEV动力总成进行了优化.结果表明:动力电池设计容量对整车成本影响最大,而它主要取决于所要求的全电力续驶里程;随着所要求的全电力续驶里程的增大,所需电机最大输出功率升高,而发动机最大输出功率则降低.

  20. Gap junction signalling mediated through connexin-43 is required for chick limb development.

    Science.gov (United States)

    Makarenkova, H; Patel, K

    1999-03-15

    During chick limb development the gap junction protein Connexin-43 (Cx43) is expressed in discrete spatially restricted domains in the apical ectodermal ridge (AER) and mesenchyme of the zone of polarising activity. Antisense oligonucleotides (ODNs) were used to investigate the role of Connexin-43 (Cx43) in the development of the chick limb bud. We have used unmodified ODNs in Pluronic F-127 gel, which is liquid at low temperature but sets at room temperature and so remains situated at the point of application. As a mild surfactant, the gel increases antisense ODN penetration and supplies ODNs to the embryo continually for 12-18 h. We have shown a strong decrease in Cx43 protein expression after application of specific antisense oligonucleotides but the abundance of a closely related protein, Connexin-32 (Cx32), was not affected. Application of antisense Cx43 ODNs at stages 8-15 HH before limb outgrowth resulted in dramatic limb phenotypes. About 40% of treated embryos exhibited defects such as truncation of the limb bud, fragmentation into two or more domains, or complete splitting of the limb bud into two or three branches. Molecular analysis of antisense treated embryos failed to detect Shh or Bmp-2 in anterior structures and suggested that extra lobes seen in nicked and split limbs were not a result of establishment of new signalling centres as found after the application of FGF to the flank. However, examination of markers for the AER showed a number of abnormalities. In severely truncated specimens we were unable to detect the expression of either Fgf-4 or Fgf-8. In both nicked and split limbs the expression of these genes was discontinuous. Down-regulation of Cx43 after the antisense application could be comparable to AER removal and results in distal truncation of the limb bud. Taken together these data suggest the existence of a feedback loop between the FGFs and signalling mediated by Cx43.

  1. LOS EFECTOS DE UN PROGRAMA DE ACTIVIDAD FÍSICA AERÓBICA SOBRE EL ESTADO DE ÁNIMO EN MUJERES PREMENOPÁUSICAS [The effects of an aerobic exercise program on the mood states of premenopausal women

    Directory of Open Access Journals (Sweden)

    Almudena Ramírez Balas

    2012-06-01

    Full Text Available La relación entre ejercicio físico y estado de ánimo es cada vez más importante en las investigaciones. La mayoría informa de los beneficios del ejercicio sobre la salud física, y no sobre el estado de ánimo. Este estudio pretende conocer los cambios que provoca un programa de actividad física aeróbica sobre el estado de ánimo en mujeres premenopáusicas. Participaron 20 mujeres premenopáusicas, separadas en 2 grupos: menores de 35 años (n=10 y mayores de 35 años (n=10. Los sujetos fueron sometidos a una valoración del estado de ánimo antes y al final del programa. El programa de intervención duró 5 meses, con una frecuencia de 3 sesiones por semana y una duración de 60 minutos por sesión. La intensidad del ejercicio fue del 60 - 70% de la frecuencia cardíaca máxima de reserva. Los resultados indican mejoras en el vigor y en la angustia en mujeres mayores de 35 años premenopáusicas, mientras que en las menores de 35 años no hubo cambios significativos. El estudio concluye que un programa de actividad física aeróbica basado en la práctica de aeróbic, step y tonificación mejora el estado de ánimo de mujeres mayores de 35 años premenopáusicas.

  2. AcEST: BP915896 [AcEST

    Lifescience Database Archive (English)

    Full Text Available : Swiss-Prot sp_hit_id Q59NY7 Definition sp|Q59NY7|CUE1_CANAL Coupling of ubiqui......done Score E Sequences producing significant alignments: (bits) Value sp|Q59NY7|CUE1_CANAL Coupling...2 OS=Saccharomyces... 30 7.4 sp|A6V1D5|RRF_PSEA7 Ribosome-recycling factor OS=Pseudomonas aer... 29 9.6 >sp|Q59NY7|CUE1_CANAL Couplin

  3. Monitorização do ruído ambiente e laboral na base aérea de Monte Real

    OpenAIRE

    Carreira, Sónia Carin Pereira

    2010-01-01

    Os aeródromos/aeroportos foram, desde sempre, implantados em regiões desocupadas e distantes dos grandes centros urbanos. A construção de infraestruturas básicas transformou esses locais em óptimas opções para a expansão da malha urbana e prospecção imobiliária. O acelerado desenvolvimento dessas regiões, muitas vezes sem a fiscalização necessária por parte das câmaras municipais e juntas de freguesia, acabou por culminar em ocupações desordenadas e ilegais do solo, com edif...

  4. Component sizing optimization of plug-in hybrid electric vehicles

    International Nuclear Information System (INIS)

    Plug-in hybrid electric vehicles (PHEVs) are considered as one of the most promising means to improve the near-term sustainability of the transportation and stationary energy sectors. This paper describes a methodology for the optimization of PHEVs component sizing using parallel chaos optimization algorithm (PCOA). In this approach, the objective function is defined so as to minimize the drivetrain cost. In addition, the driving performance requirements are considered as constraints. Finally, the optimization process is performed over three different all electric range (AER) and two types of batteries. The results from computer simulation show the effectiveness of the approach and the reduction in drivetrian cost while ensuring the vehicle performance.

  5. The inauguration of Modern Subjectivity: Shakespeare’s “lyrical tragedy” Richard II

    Directory of Open Access Journals (Sweden)

    John J. JOUGHIN

    2004-10-01

    Full Text Available During the theorisation of Renaissance studies in the 1980s the focus was on the punctual emergence of the early modern subject circa 1600, the “decisive transitional moment” usually hinging on a reading of Hamlet’s emergent sense of interiority (Aers, “A whisper in the ear of the early modernists” passim. There are of course huge advances in such a reading as it highlights the contingent and created nature of human experience. Post-structuralism usefully isolated the ‘human’ as an invention...

  6. Verification of a neutronic code for transient analysis in reactors with Hex-z geometry

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalez-Pintor, S.; Verdu, G. [Departamento de Ingenieria Quimica Y Nuclear, Universitat Politecnica de Valencia, Cami de Vera, 14, 46022. Valencia (Spain); Ginestar, D. [Departamento de Matematica Aplicada, Universitat Politecnica de Valencia, Cami de Vera, 14, 46022. Valencia (Spain)

    2012-07-01

    Due to the geometry of the fuel bundles, to simulate reactors such as VVER reactors it is necessary to develop methods that can deal with hexagonal prisms as basic elements of the spatial discretization. The main features of a code based on a high order finite element method for the spatial discretization of the neutron diffusion equation and an implicit difference method for the time discretization of this equation are presented and the performance of the code is tested solving the first exercise of the AER transient benchmark. The obtained results are compared with the reference results of the benchmark and with the results provided by PARCS code. (authors)

  7. Identificação de radicais livres e produtos de oxidação de biomoléculas por MS

    OpenAIRE

    Pereira, Ana Luísa dos Reis Pereira

    2006-01-01

    A alteração estrutural de biomoléculas por acção de radicais livres resultantes de processos aeróbios, e mais especificamente em ácidos gordos insaturados, tem sido descrita como tendo um papel preponderante em patologias relacionadas com o envelhecimento. Esta tese tem como objectivo o uso da espectrometria de massa (MS) na identificação e caracterização estrutural de radicais livres de ácidos gordos, nomeadamente no ácido gordo ω-6, e em modelos progressivamente mais compl...

  8. [PHYSICAL ACTIVITY LEVELS, PHYSICAL FITNESS AND SCREE TIME AMONG CHILDREN AND ADOLESCENTS FROM BOGOTÁ, COLOMBIA].

    Science.gov (United States)

    Prieto-Benavides, Daniel Humberto; Correa-Bautista, Jorge Enrique; Ramírez-Vélez, Robinson

    2015-11-01

    Objetivo: examinar la relación entre los niveles de actividad física (AF) de forma objetiva, la condición física (CF) y el tiempo de exposición a pantallas en niños y adolescentes de Bogotá, Colombia. Métodos: estudio descriptivo y transversal, realizado en 149 niños y adolescentes en edad escolar entre 9 y 17 años de Bogotá, Colombia. Los niveles de AF se valoraron con acelerómetro durante siete días. El tipo y tiempo de exposición a pantallas se registró por autorreporte. Se midió el estado de maduración, el peso, la estatura, la circunferencia de cintura/cadera y los pliegues tricipital/ subescapular. La capacidad aeróbica, la fuerza prensil, el salto de longitud y vertical, la velocidad/agilidad y la flexibilidad fueron usados como indicadores de la CF. Resultados: las mujeres clasificadas en la categoría de AF vigorosa mostraron una relación lineal con la capacidad aeróbica (r = 0,366), y una relación inversa con el pliegue tricipital (r = -0,257) y subescapular (r = -0,237), p < 0,05. En varones, los niveles de AF vigorosa se relacionaron con mayores valores de flexibilidad (r = 0,277), mientras que los niveles de AFMV se relacionaron positivamente con la capacidad aeróbica (r = 0,347), p < 0,05. Por último, los escolares que permanecieron menos de 2 h/día frente a pantallas de TV mostraron 1,819 veces de (IC 95% 1,401-2,672) oportunidad para cumplir las recomendaciones de AF. Conclusiones: los escolares que registraron valores de AF moderado y vigoroso de forma objetiva presentaron mejores niveles en la CF, especialmente en la capacidad aeróbica y la flexibilidad, y menores valores en los pliegues cutáneos.

  9. Asynchronous Complex Pipeline Design Based on ARM Instruction Set

    Institute of Scientific and Technical Information of China (English)

    WANG Bing; WANG Qin; PENG Rui-hua; FU Yu-zhuo

    2008-01-01

    This paper proposes an asynchronous complex pipeline based on ARM-V3 instruction set. Muller pipeline structure is used as prototype, and the factors which may affect pipeline performance are analyzed. To balance the difficulty of asynchronous design and performance analysis, both complete asynchronous and partial asynchronous structures aere designed and compared. Results of comparison with the well-Rnown industrial product ARM922T verify that about 30% and 40% performance improvement of the partial and complete asynchronous complex pipelines can be obtained respectively. The design methodologies can also be used in the design of other asynchronous pipelines.

  10. Efecto antioxidante y antimicrobiano de sales de ácidos orgánicos y extractos naturales en filetes de bagre dorado (Brachyplatystoma rousseauxii) refrigerados

    OpenAIRE

    José Vicente Pacheco Guerrero; Elisabetta Tomé; Marisa Guerra; Rosa Raybaudi

    2011-01-01

    En el presente trabajo fueron investigados los efectos del lactato de sodio, acetato de sodio, romero y ajo en soluciones acuosas a 2,5 % sobre la calidad microbiológica y oxidación lipídica en rebanadas de bagre dorado (Brachyplatystoma rousseauxii) almacenadas a 4 ºC. Los resultados mostraron que estas soluciones fueron eficaces (p < 0,05) contra la proliferación de distintas categorías de microorganismos deteriorativos, incluyendo poblaciones aeróbicas y psicrotróficas, Pseudomonas spp., b...

  11. Mean forest volume estimation by high-resolution aerial RGB imagery and digital surface model with Trestima as validation technique

    OpenAIRE

    Rybakov, Georgy

    2015-01-01

    Forests typically cover large areas and are hard to access, which is why it is critical to have reliable and cheap means for their surveying. The more accurate the data is and the cheaper its acquisition is, the higher the efficiency of the surveys (i.e. forest inventories) performed is. Potentially also the efficiency of future forest management operations could be higher. This study considers a remote sensing technique for the mean volume estimation based on a very high-resolution (VHR) aer...

  12. La Necesidad de la Preparación Física en el Baile Flamenco

    Directory of Open Access Journals (Sweden)

    Alfonso Vargas Macías

    2008-06-01

    Full Text Available El baile flamenco requiere grandes exigencias de esfuerzo para su desarrollo, equiparable a deportes de alto nivel. En cambio, los bailaores no dedican a la preparación física la atención suficiente: el trabajo de la resistencia aeróbica junto al fortalecimiento y estiramiento de determinados grupos musculares, deberían ser un mínimo imprescindible de entrenamiento como herramienta para mejorar su nivel físico y como prevención de lesiones.

  13. ADAPTACIÓN DEL BRAIN GYM® AL MEDIO ACUÁTICO: EFECTOS EN LA FUNCIÓN FÍSICA Y COGNITIVA DE LOS ADULTOS MAYORES

    OpenAIRE

    Mª H. Vila; D. Malvido; Ayán, C.; J.M Cancela

    2015-01-01

    Diferentes investigaciones han propuesto que la práctica regular de la actividad física, especialmente el ejercicio aeróbico, se relaciona con beneficios cognitivos (Lautenschlager et al., 2008; Baker et al., 2010). Varios meta-análisis han informado que la actividad física se asocia con mejoras en la atención, velocidad de procesamiento, y la función ejecutiva en los adultos mayores con y sin discapacidades cognitivas (van Uffelen et al., 2008; Smith et al., 2010). Los movimientos empleados ...

  14. Discriminant Models for Word Alignment Modèles discriminants pour l'alignement mot à mot

    Directory of Open Access Journals (Sweden)

    Guillaume Wisniewski

    2010-09-01

    Full Text Available Word alignment aims to link each word of a translated sentence to its related words in the source sentence. Nowadays, Giza++ is the most used word alignment system. This toolkit implements the generative IBM models. Despite its popularity, several limitations remain. We thus propose to address this task using discriminative models (Maximum Entropy and Conditional Random Fields which can easily make use of additional features. These models are evaluated in terms of Alignment Error Rate (AER using two language pairs (French/english and Arabic English. Our results show that discriminant models are well suited for this task and that they can outperform IBM models.

  15. IDENTIDAD URBANA DE LA COMUNA DE HUALPEN Y ALGUNOS DE SUS PRINCIPALES ELEMENTOS URBANO POBLACIONALES

    OpenAIRE

    Alberto Vallette Isla; Carlos Martínez Catalán

    2008-01-01

    La actual comuna de Hualpén, antes de ser creada en el año 2003, se vislumbraba como un gran barrio de la comuna de Talcahuano y se relacionaba su nombre semánticamente como el sector de Hualpencillo. El desarrollo urbanístico de Hualpén, que se inicia a mediados del siglo XX con la instalación del Aeródromo de Hualpencillo como uno de los pocos del país, se puede entender como una sumatoria de asentamientos poblacionales que fueron dispuestos en forma aleatoria en el territorio urbano com...

  16. Agglomeration and the product mix

    OpenAIRE

    Dalvai, Wilfried

    2016-01-01

    Worldwide trade flows are dominated by high-productivity firms, that have a large range of products. Since the product range of firms reflects partly trade flows, it is a source of economic differences in space. In this paper, I analyze the effects of the product mix of firms on agglomeration. I build a theoretical model of multiproduct firms à la Mayer, Melitz, and Ottaviano (2014, AER), expand it with skilled, mobile workers and a spatial equilibrium. I show that a larger product mix of fir...

  17. Signos Vitales de los CDC La actividad física y los adultos con discapacidades (Vital Signs-Physical Activity and Adults with Disabilities)

    Centers for Disease Control (CDC) Podcasts

    2014-05-06

    Este podcast se basa en el informe Signos Vitales de los CDC de mayo del 2014. Los adultos con discapacidades que no hacen actividad física aeróbica tienen un 50 % más de probabilidades de tener enfermedades cardiacas, accidentes cerebrovasculares, diabetes o cáncer. Sepa qué puede hacer para ayudar.  Created: 5/6/2014 by National Center on Birth Defects and Developmental Disabilities (NCBDDD).   Date Released: 5/6/2014.

  18. The Research Productivity of New PhDs in Economics: The Surprisingly High Non-success of the Successful

    OpenAIRE

    John P. Conley; Ali Sina Onder

    2014-01-01

    We study the research productivity of new graduates from North American PhD programs in economics from 1986 to 2000. We find that research productivity drops off very quickly with class rank at all departments, and that the rank of the graduate departments themselves provides a surprisingly poor prediction of future research success. For example, at the top ten departments as a group, the median graduate has fewer than 0.03 American Economic Review (AER)-equivalent publications at year six af...

  19. Retrospectives: Trouble in the Inaugural Issue of the American Economic Review: The Cross/Eaves Controversy

    OpenAIRE

    Ann Mari May; Robert W. Dimand

    2009-01-01

    The papers from the first year of the American Economic Review are included in the Archives of the American Economic Association. While researching the early years of the AEA, Ann Mari May came across a folder marked "Controversies, Criticisms, etc."-which stood out in the midst of a review of AEA minutes and reports. This folder included a bulky file on what AER Editor Davis Rich Dewey would come to refer to as the "Cross/Eaves Controversy"-a controversy that, according to a letter he wrote,...

  20. Effects of engine emissions from high-speed civil transport aircraft: A two-dimensional modeling study, part 2

    Science.gov (United States)

    Ko, Malcolm K. W.; Weisenstein, Debra K.; Sze, Nein Dak; Shia, Run-Lie; Rodriguez, Jose M.; Heisey, Curtis

    1991-01-01

    The AER two-dimensional chemistry-transport model is used to study the effect of supersonic and subsonic aircraft operation in the 2010 atmosphere on stratospheric ozone (O3). The results show that: (1) the calculated O3 response is smaller in the 2010 atmosphere compared to previous calculations performed in the 1980 atmosphere; (2) with the emissions provided, the calculated decrease in O3 column is less than 1 percent; and (3) the effect of model grid resolution on O3 response is small provided that the physics is not modified.

  1. Efectos de una dieta hipocalórica y de un programa de ejercicio físico de corta duración en el perfil lipídico y en la composición corporal de mujeres menopáusicas con sobrepeso

    OpenAIRE

    D. Rojano; G.M. Vargas

    2014-01-01

    Objetivo: Analizar los cambios producidos en la composición corporal y, a nivel bioquímico, sobre el colesterol y los triglicéridos, por un programa de ejercicio físico aeróbico y de fuerza de 6 semanas de duración, acompañado de una dieta hipocalórica, en un grupo de mujeres menopáusicas con sobrepeso. Método: La muestra estaba formada por 18 mujeres en la etapa de la menopausia, 9 de las cuales fueron asignadas aleatoriamente al grupo experimental y las otras 9 al grupo control. Todas pr...

  2. EFECTO DE UN PROGRAMA DE EJERCICIO AERÓBICO Y UN PROGRAMA DE CIRCUITO CON PESAS SOBRE LA CALIDAD DE VIDA, DISNEA Y RESISTENCIA CARDIORRESPIRATORIA EN SUJETOS CON ENFERMEDAD PULMONAR CRÓNICA

    OpenAIRE

    Delgado Acosta Henry; Acuña Corrales Ernesto

    2007-01-01

    El objetivo de este estudio fue determinar el efecto de un programa de ejercicio aeróbico y un programa de circuito con pesas sobre la calidad de vida, disnea y resistencia cardiorrespiratoria en sujetos con Enfermedad Pulmonar Crónica (EPC). Metodología: el programa de rehabilitación se hizo durante ocho semanas, se realizó un pretest y un postest, se cumplió con una sesión semanal presencial, y las otras dos domiciliarias, se tuvo comunicación directa vía telefónica los días que realizab...

  3. EFECTO DE UN PROGRAMA DE EJERCICIO AERÓBICO Y UN PROGRAMA DE CIRCUITO CON PESAS SOBRE LA CALIDAD DE VIDA, DISNEA Y RESISTENCIA CARDIORRESPIRATORIA EN SUJETOS CON ENFERMEDAD PULMONAR CRÓNICA

    Directory of Open Access Journals (Sweden)

    Delgado Acosta Henry

    2007-07-01

    Full Text Available El objetivo de este estudio fue determinar el efecto de un programa de ejercicio aeróbico y un programa de circuito con pesas sobre la calidad de vida, disnea y resistencia cardiorrespiratoria en sujetos con Enfermedad Pulmonar Crónica (EPC. Metodología: el programa de rehabilitación se hizo durante ocho semanas, se realizó un pretest y un postest, se cumplió con una sesión semanal presencial, y las otras dos domiciliarias, se tuvo comunicación directa vía telefónica los días que realizaban el ejercicio en la casa. Instrumentos: el cuestionario St. George Respiratory Questonnaire para medir calidad de vida, la escala de Borg para medir la disnea y el test de caminata de los 6 min. para medir la resistencia cardiorrespiratoria. Sujetos: participaron 38 personas con diagnóstico previo de EPC, 18 hombres y 20 mujeres; 27 sujetos con patología obstructiva y 11 sujetos con restrictiva., con una edad promedio de 69.8 ± 9.34 años, divididos aleatoriamente en dos grupos, uno que realizó ejercicio aeróbico (22 sujetos y otro que ejecutó ejercicio aeróbico y de contrarresistencia con pesas (16 sujetos. Análisis estadístico: ANOVA mixta de cuatro vías (2x2x2x2 para las variables mediciones, sexo, tratamiento y patología. Resultados: se encontraron diferencias significativas entre mediciones para la variable disnea (pre: 7.18 ± 0.69 puntos y post: 4.89 ± 0.68 puntos (F = 228.770; p 0,05, ni interacción entre las variable (p>0,05. Conclusión: la realización de ejercicio físico aeróbico y anaeróbico mejoran el grado de disnea, la calidad de vida y resistencia cardiorrespiratoria en pacientes con EPC.

  4. Estudio del estrés oxidativo en un modelo animal de ejercicio físico: análisis citométrico en mitocondrias aisladas y en leucocitos

    OpenAIRE

    Parra Orenga, Marta

    2015-01-01

    Un incremento en el metabolismo aeróbico durante el ejercicio es una fuente potencial de estrés oxidativo. En el músculo, la mitocondria es una fuente importante de intermediarios reactivos. Para su estudio, se han utilizado el hígado, el músculo de diafragma y el corazón de conejos tipo control sin entrenamiento físico específico, conejos entrenados sometidos a un entrenamiento físico específico y conejos sometidos a una operación simulada. Se han obtenido mitocondrias aisladas para su estud...

  5. Characterization of atypical Aeromonas salmonicida isolates by ribotyping and plasmid profiling

    DEFF Research Database (Denmark)

    Pedersen, Karl; Dalsgaard, Inger; Larsen, J.L.

    1996-01-01

    ) and plasmid profiles. Most epidemiologically unrelated strains had different ribotypes, whereas isolates from the same outbreak were identical. All strains, except one, carried one or more large plasmids (>55 kbp) and all strains, except two, additionally carried one or more smaller plasmids. Many strains...... isolated from the same outbreak showed different plasmid profiles although some plasmids were identical. The results suggest the existence of several atypical Aer, salmonicida. It also seems that ribotypes are stable properties for these bacteria while the plasmids are more labile....

  6. Efectos del envejecimiento en las capacidades físicas: implicaciones en las recomendaciones de ejercicio físico en personas mayores. (Effects of aging on physical fitness: implications in the recommendations of physical activity for older adults.)

    OpenAIRE

    Ana Carbonell Baeza; Aparicio García-Molina, Virginia A.; Manuel Delgado Fernández

    2009-01-01

    Resumen El envejecimiento produce una involución de las capacidades físicas que origina un deterioro del estado físico y una reducción de la funcionalidad personal. Conforme avanza la edad se produce una pérdida de fuerza, un descenso de la capacidad aeróbica y una reducción progresiva no lineal y específica por articulación y movimiento articular de la flexibilidad. Además, los desórdenes de equilibrio son frecuentes en las personas mayores, por lo que el trabajo de flexibilidad y equilibrio...

  7. Evolução do perfil neuromotor e capacidade funcional de mulheres fisicamente ativas de acordo com a idade cronológica Evolución del perfil neuromotor y la capacidad funcional de mujeres fisicamente activas de acuerdo con la edad cronológica Evolution of neuromotor profile and functional capacity of physically active women according to chronological age

    OpenAIRE

    Sandra Mahecha Matsudo; Victor K. R. Matsudo; Turíbio Leite Barros Neto; Timóteo Leandro Araújo

    2003-01-01

    FUNDAMENTOS E OBJETIVO: Poucos estudos longitudinais têm sido feitos em mulheres fisicamente ativas para determinar o impacto do envelhecimento na aptidão física e capacidade funcional. O objetivo deste estudo foi comparar a evolução do perfil neuromotor e capacidade funcional de mulheres ativas no período de um ano, de acordo com a idade cronológica. MÉTODOS: A amostra foi composta por 117 mulheres de 50 a 79 anos de idade (: 65 ± 6,6 anos) participantes de um programa de exercícios aeróbico...

  8. STERN -Educational Benefit for the Space Industry

    OpenAIRE

    Schüttauf, Katharina; Stamminger, Andreas; Lappöhn, Karsten; Ciezki, Helmut; Kitsche, Wolfgang

    2015-01-01

    STERN, the German word for star, is also an acronym for STudentische Experimental-RaketeN. It is a program to provide students with “hands-on” experience in space systems and research. This name was chosen for two reasons. The first reason was to emphasize the idealistic goals of spaceflight providing students with the opportunity to “reach for the stars”. The second and most important one was that the program offers engineering students a practical chance to experience the scope of aer...

  9. Perfil oxidativo de la mujer menopáusica: Papel de los estrógenos en la prevención y tratamiento de las enfermedades Oxidative Profile of the Menopausal Woman: Estrogens´ Rol in the Prevention and Treatment of Diseases

    OpenAIRE

    Carlos Escalante-Gómez; Silvia Quesada-Mora; Fernando Zeledón-Sánchez

    2009-01-01

    El balance entre la producción de radicales libres de oxigeno y el nivel de enzimas antioxidantes es permanentemente regulado por la célula. Las enzimas antioxidantes son esenciales para las células aeróbicas, puesto que mantienen en niveles aceptables las concentraciones de especies químicas conocidas como radicales libres. Durante el climaterio o etapa perimenopáusica, el cuerpo y metabolismo de una mujer cambia de forma importante, y los mecanismos que regulan el estrés oxidativo no son la...

  10. Efecto de la administración de antioxidantes orales en las adaptaciones al ejercicio físico.

    OpenAIRE

    Doménech de Antonio, Elena

    2006-01-01

    RESUMEN Durante el ejercicio físico se producen radicales libres en el interior de la célula muscular. Éstos pueden actuar como señales reguladoras en diversas funciones fisiológicas del músculo, como por ejemplo su fuerza contráctil, su capacidad para generar ATP, etc Se sabe que el entrenamiento aeróbico empleando una determinada frecuencia, intensidad y duración, puede aumentar el contenido mitocondrial entre un 50% y un 100% en un período aproximado de seis semanas. E...

  11. The Influence of Cloud Microphysics and Radiation on the Response of Water Vapor and Clouds to Climate Change

    Energy Technology Data Exchange (ETDEWEB)

    Emanuel, Kerry [Atmospheric and Environmental Research, Inc., Lexington, MA (United States); Iacono, Michael J. [Atmospheric and Environmental Research, Inc., Lexington, MA (United States)

    2010-11-11

    Uncertainties in representing the atmospheric water cycle are major obstacles to the accurate prediction of future climate. This project focused on addressing some of these uncertainties by implementing new physics for convection and radiation into the NCAR Community Atmosphere Model (CAM). To better understand and eventually better represent these processes in this major national climate model, we modified CAM3.5 to use the convection and cloud schemes developed by the Massachusetts Institute of Technology (MIT) and the RRTMG rapid radiation code for global climate models developed by Atmospheric and Environmental Research, Inc. (AER). The impact of the new physics on the CAM3.5 simulation of convection on diurnal and intra-seasonal scales, on intra-seasonal oscillations and on the distribution of water vapor has been investigated. In addition, the MIT and AER physics packages have been incorporated and tested in combination within the Weather Research and Forecasting (WRF) regional forecast model for the purpose of evaluating and improving convective and radiative processes on time scales appropriate to weather simulations. It has been found that the application of the AER radiation and MIT convection produces significant improvements in the modeled diurnal cycle of convection, especially over land, in the NCAR climate model. However, both the standard CAM3.5 and the modified CAM3.5 with the new physics are unable to capture the proper spectrum and propagating characteristics of dynamical intra-seasonal oscillations such as the Madden-Julian Oscillation. In addition, it has been shown that the new physics methods modify, but do not substantially improve, the distribution of upper tropospheric water vapor in CAM as established through the comparison of modeled and observed satellite radiances. This suggests that continuing regional discrepancies in water vapor amounts in the climate model may not be solely related to convective or radiative processes. The major

  12. Caracterização microbiológica e físico-química de leite pasteurizado destinado ao programa do leite no Estado de Alagoas Microbiological and physico-chemical characterization of pasteurized milk for the milk program in the State of Alagoas

    OpenAIRE

    Maria Cristina Delgado da Silva; Juliana Vasconcelos Lyra da Silva; Alécia Cristinne Santos Ramos; Rossana de Oliveira Melo; Juliana Omena Oliveira

    2008-01-01

    Atualmente 17 mini usinas fazem parte do Programa do Leite no estado de Alagoas, e através de um convênio firmado entre o Laboratório de Microbiologia de Alimentos da Universidade Federal de Alagoas e a Cooperativa de Laticínio de Alagoas - CPLA para monitorar a qualidade microbiológica e físico-química de leite pasteurizado tipo C, foram analisadas 348 amostras deste produto e avaliadas quanto à contagem de coliformes a 35 e 45 °C, quanto a bactérias aeróbias mesófilas, bactérias psicrot...

  13. Annual progress report, July 1, 1983-June 30, 1984

    Energy Technology Data Exchange (ETDEWEB)

    1984-01-01

    Research in the Laboratory of Biomolecular and Celluler Sciences deals with proliferation, gene expression and differentiation in normal cells and in cells exposed to pollutants, carcinogens or tumor promoters. The research program of the Laboratory of Environmental Biology presents an integrated approach to studies of the functional interactions of the physical and biotic components of arid land ecosystems. Nuclear Medicine research has focussed on development of positron emission tomography, preparation of short-lived isotopes of oxygen, nitrogen, carbon and fluorine, use of these isotopes to label physiological substrates, tracer studies of cerebral biochemistry and physiology, measurement of regional myocardial fatty acid metabolism and blood flow. (AER)

  14. MINERALIZACIÓN DEL NITRÓGENO DE LA Canavalia ensiformis EN UN SUELO FERRALÍTICO ROJO DE LA HABANA

    OpenAIRE

    Gloria M. Martín; Rivera, R

    2004-01-01

    Para determinar la cantidad de nitrógeno que se libera o inmoviliza durante la descomposición de la Canavalia ensiformis, se ejecutaron dos experimentos en un suelo Ferralítico Rojo. En el primer experimento, llevado a cabo en condiciones de laboratorio, se empleó el método de incubación aeróbica (a temperatura y humedad constantes) y se evaluó la velocidad de mineralización de la Canavalia ensiformis, comparada con dos testigos: el control (suelo) y un tratamiento que recibió 75 ppm N-urea. ...

  15. Infecção bacteriana na leishmaniose cutânea: padrão bacteriano e sensibilidade a antibióticos Bacterial infection in cutaneous leishmaniasis: bacterial pattern and sensitivity to antibiotics

    OpenAIRE

    Eloísa da Graça do Rosário Gonçalves; Stelito Assis dos Reis Filho; Eurípedes Gomes de Oliveira; André Luiz Neves Pareira; Antonio Rafael da Silva; Jackson Maurício Lopes Costa

    2009-01-01

    Foi estudada a flora bacteriana em úlceras leishmanióticas, destacando-se o encontro das espécies aeróbicas Staphylococus aureus e Pseudomonas aeruginosa. O estudo da sensibilidade destas espécies a antibióticos mostrou sensibilidade à vancomicina, à amicacina e ao cloranfenicol em 100% dos isolados testados de Staphylococus aureus e à amicacina, à gentamicina e à tobramicina em 100% dos isolados testados de Pseudomonas aeruginosa. Estas espécies foram, em geral, resistentes às penicilinas e ...

  16. Effects of a strength endurance training program on endurance levels Efectos de un programa de entrenamiento de la fuerza-resistencia sobre los niveles de resistencia

    Directory of Open Access Journals (Sweden)

    J. C. Redondo

    2010-09-01

    Full Text Available

    The purpose of the current study was to determine whether a strength endurance training program of lower limbs isolate can increase endurance levels, both aerobic capacity and aerobic power, in order to adapt the strength training for endurance races. 20 phisically active men participated in the study. They were divided into two groups: control group (GC (n=10 and experimental group (GE (n=10. GE carried out a strength endurance training program for ten weeks. Results obtained showed that this type of training regime was useful to improve the performance in an aerobic endurance test. This could be due to an improvement in aerobic capacity, maximal dynamic strength, explosive strength and reactive strength. Moreover, there was a decrease in fat mass without increase in muscle mass.
    Key Words:  Training, strength endurance, aerobic capacity, anthropometry.

     

    El presente estudio pretende comprobar que el trabajo aislado de la fuerza resistencia en miembros inferiores produce una mejora de los niveles de resistencia, en términos tanto de potencia como de capacidad aeróbica, optimizando así el entrenamiento de la fuerza para pruebas de resistencia de media y larga duración. Para ello, veinte sujetos participaron en el estudio, dividiéndose de forma aleatoria en dos grupos: grupo control (GC (n=10 y grupo experimental (GE (n=10 el cual llevó a cabo un entrenamiento de fuerza resistencia extensivo por intervalos, de diez semanas de duración. Los resultados obtenidos muestran que este tipo de entrenamiento es efectivo para mejorar el rendimiento en una prueba de resistencia aeróbica para sujetos físicamente activos, gracias a la mejora de la capacidad aeróbica, de la fuerza máxima dinámica, elástico explosiva y elástico explosivo reactiva y a la disminución de los niveles de grasa

  17. Padronização de um protocolo experimental de treinamento periodizado em natação utilizando ratos Wistar Standardization of an experimental periodized training protocol in swimming rats

    OpenAIRE

    Gustavo Gomes de Araujo; Marcelo Papoti; Fúlvia de Barros Manchado-Gobatto; Maria Alice Rostom de Mello; Claudio Alexandre Gobatto

    2010-01-01

    Verificar os efeitos de 12 semanas de treinamento periodizado de natação em ratos sobre os valores de glicogênio muscular (GM) e hepático (GH), capacidade aeróbia (LAn) e anaeróbia (Tlim) e creatina quinase (CK). Foram utilizados 70 ratos da linhagem Wistar com 60 dias, adaptados individualmente ao meio líquido por duas semanas. Os animais foram divididos em grupos: controle (GC, n = 40) e periodizado (GP, n = 30); a intensidade do treinamento foi equivalente ao peso corporal do animal (% do ...

  18. Dicty_cDB: Contig-U12264-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available :none) Burkholderia vietnamiensis G4 c... 323 2e-86 CP000086_311( CP000086 |pid... ... 298 9e-79 AL939113_253( AL939113 |pid:none) Streptomyces coelicolor A3(2) co...hkirik*RHLYINYIIIK--- ---QSNKQTNKQIDK**nnnaikilfininsffniinklincelqlpyfysfestgnfqv invetneavlnstlsidlqvllvygstistvsnkpifnlfvsein...tata genomic clo... 56 3e-05 2 >( BJ430083 ) Dictyostelium discoideum cDNA clone:ddv6c06, 3' end, single read. Length = 720 Sco...nstruct Peudomonas aer... 342 3e-92 CP001103_2392( CP001103 |pid:none) Alteromonas macleodii 'Deep eco

  19. La alimentación de los jugadores de baloncesto: peligros nutricionales y microbiológicos

    OpenAIRE

    Santos Badenes, Gemma

    2015-01-01

    El baloncesto tiene unos requerimientos fisiológicos altos que imponen un esfuerzo considerable en las capacidades cardiovasculares y metabólicas de los jugadores. Fisiológicamente, el baloncesto requiere fuerza/resistencia muscular, flexibilidad y energía tanto a nivel de ejercicio aeróbico como anaeróbico. El estudio de la composición corporal es un aspecto muy importante en la valoración del estado nutricional, ya que la distribución de la masa grasa y la masa magra en un individuo puede a...

  20. CB2 result evaluation (VVER-440 burnup credit benchmark)

    International Nuclear Information System (INIS)

    The second portion of the four-piece international calculational benchmark on the VVER burnup credit (CB2) prepared in the collaboration with the OECD/NEA/NSC Burnup Credit Criticality Benchmarks Working Group and proposed to the AER research community has been evaluated. The evaluated results of calculations performed by analysts from Cuba, the Czech Republic, Finland, Germany, Russia, Slovakia and the United Kingdom are presented. The goal of this study is to compare isotopic concentrations calculated by the participants using various codes and libraries for depletion of the VVER-440 fuel pin cell. No measured values were available for the comparison. (author)

  1. Results of the isotopic concentrations of VVER calculational burnup credit benchmark No. 2(CB2)

    International Nuclear Information System (INIS)

    Results of the nuclide concentrations are presented of VVER Burnup Credit Benchmark No. 2(CB2) that were performed in The Nuclear Technology Center of Cuba with available codes and libraries. The CB2 benchmark specification as the second phase of the VVER burnup credit benchmark is summarized. The CB2 benchmark focused on VVER burnup credit study proposed on the 97' AER Symposium. The obtained results are isotopic concentrations of spent fuel as a function of the burnup and cooling time. The depletion point 'ORIGEN2' code and other codes were used for the calculation of the spent fuel concentration. (author)

  2. Aerobic granulation of pure bacterial strain Bacillus thuringiensis

    Institute of Scientific and Technical Information of China (English)

    Sunil S ADAV; Duu-Jong LEE

    2008-01-01

    The objective of this study is to cultivate aer-obic granules by pure bacterial strain, Bacillus thuringien-sis, in a sequencing batch reactor. Stable granules sized 2.0-2.2 mm were formed in the reactor after a five-week cultivation. These granules exhibited excellent settling attributes, and degraded phenol at rates of 1.49 and concentration, respectively. Confocal laser scanning microscopic test results show that Bacillus thuringiensis was distributed over the initial small aggregates, and the outer edge of the granule was away from the core regime in the following stage.

  3. Biorremediación de suelo contaminado con hidrocarburos empleando lodos residuales como fuente alterna de nutrientes

    OpenAIRE

    Adriana MARTÍNEZ-PRADO; Ma. Elena PÉREZ-LÓPEZ; Joaquín PINTO-ESPINOZA; Blanca Amelia GURROLA-NEVÁREZ; Ana Lilia OSORIO-RODRÍGUEZ

    2011-01-01

    En la presente investigación se evaluó el proceso de biorremediación aeróbica de un suelo contaminado con hidrocarburos de petróleo empleando lodos residuales (biosólidos), provenientes de una planta de tratamiento de aguas residuales (PTAR) domésticas de la localidad, como fuente alterna de macro y micronutrientes. La contaminación del suelo fue resultado de derrames accidentales de diesel, aceite y grasas en la unidad minera San Antonio perteneciente al grupo Goldcorp México, ubicada en el ...

  4. Perfusión tisular: consideraciones básicas y clínicas fundamentos de medicina traslacional

    OpenAIRE

    Aldana Díaz, José Luis

    2014-01-01

    La perfusión tisular es un concepto fundamental en fisiología y medicina clínica. Conceptualmente complejo por la inclusión de múltiples procesos que integran fisiología cardiovascular en términos macrohemodinámicos, fisiología del transporte de gases, distribución regional del gasto cardiaco y el flujo sanguíneo capilar, difusión capilar de oxígeno y bioenergética celular. El metabolismo aeróbico y el mantenimiento de la homeostasis dependen de la capacidad del organismo de proporcionar e...

  5. Pré-tratamento anaeróbio de um efluente da indústria alimentar

    OpenAIRE

    Monteiro, Norberto Carlos Oliveira Cruz

    2008-01-01

    O trabalho realizado teve como intuito avaliar a aplicabilidade de um processo biológico anaeróbio como pré-tratamento de um efluente gerado na prensagem de compostos insolúveis de cereais e café de uma fábrica nacional de produtos alimentares. Este efluente devido à sua reduzida biodegradabilidade provoca limitações na eficiência do processo de tratamento biológico aeróbio actualmente existente na ETARI (estação de tratamento de águas residuais industriais). Nesse sentido f...

  6. The stratigraphy of Mars

    Science.gov (United States)

    Tanaka, Kenneth L.

    1986-01-01

    A global stratigraphy of Mars was developed from a global geologic map series derived from Viking images; the stratigraphy is composed of three maps. A new chronostratigraphic classification system which consists of lower, middle, and upper Noachian, Hesperian, and Amazonian systems is described. The crater-density boundaries of the chronostratigraphic units and the absolute ages of the Martian epochs aer estimated. The relative ages of major geologic units and featues are calculated and analyzed. The geologic history of Mars is summarized on the maps in terms of epochs.

  7. Primeros registros de bacterias marinas heterótrofas y hongos aislados de los arrecifes que bordean la plataforma SW de Cuba.

    OpenAIRE

    Miravet, M. E.; Enríquez, D.; Lugioyo, G.M.; Delgado, Y.; R. Núñez; Cabrera, H.; Martí, J.

    2003-01-01

    Se registran por primera vez para los arrecifes de la plataforma SW cubana, la presencia de 5 géneros y 16 especies de bacterias heterótrofas aeróbicas y 15 géneros de hongos, de los cuales, 7 se identificaron hasta especie. Los géneros Bacillus sp. (bacteria) y Aspergillus sp. (hongo) resultaron los más cosmopolitas de todos los géneros encontrados, predominando en las aguas y sedimentos de todos los arrecifes estudiados. Del total de cepas aisladas la mayor diversidad de géne...

  8. Environmental monitoring in emergency situations

    International Nuclear Information System (INIS)

    This manual gives technical guidance on emergency monitoring procedures to those who would have to assess the situation after an accident leading to the uncontrolled release of radioactive substances to the environment. Its aim is to draw attention to the important factors that should be considered in formulating emergency plans. The seven annexes contain inventories of fission products and possible releases; dispersion, deposition and dose-exposure relationships for airborne releases; α-, β- and γ-radiation surveys; information on sample collection and field evaluation; and brief descriptions of the environmental monitoring procedures adopted in previous emergencies (Windscale 1957, AERE Harwell 1961 and NRTS Idaho 1961).

  9. Impact of differences in line parameter databases on methane retrieval through radiative transfer calculation

    Science.gov (United States)

    Yamada, A.; Saitoh, N.; Shiomi, K.; Kuze, A.

    2015-12-01

    The thermal infrared (TIR) band of Thermal and Near-infrared Sensor for Carbon Observation Fourier Transform Spectrometer (TANSO-FTS) onboard Greenhouse Gases Observing Satellite (GOSAT) observes CH4 profile at wavenumber range from 1210 cm-1 to 1360 cm-1 including CH4 ν4 band. The current retrieval algorithm (V1.0) uses LBLRTM v12.1 with AER v3.1 line database to calculate optical depth. The purpose of this study is to compare several line parameter databases to assess their impact on CH4 retrieval: HITRAN2004 database, HITRAN2008 database, AER v3.2 database, and HITRAN2012 database (Rothman et al. 2005, 2009, and 2013. Clough et al., 2005). The CH4 line parameters of AER v3.1 and v3.2 databases are based on HITRAN2008 and it updates until May 2009 with line mixing parameters. The line strengths are almost the same between HITRAN2008 and HITRAN2012 in the CH4 ν4 band, although their line centers are shifted about 0.002 cm-1 (Brown et al., 2013). We used LBLRTM v12.2 to calculate optical depth of each layer with wavenumber resolution of 0.0034 cm-1 (Clough et al., 2005). Then we calculated forward radiance spectra and convoluted them with sinc function. At 1247.8 cm-1 where there exist three relatively strong CH4 absorption lines (1247.705 cm-1, 1247.823 cm-1, and 1247.842 cm-1), no H2O interference, and small N2O interference, the differences in calculated brightness temperatures between HITRAN2008 and HITRAN2004, between HITRAN2008 and AER v3.2, and between HITRAN2012 and HITRAN2008 were 0.002 K, 0.4 K, and 0.06 K, respectively. These differences may affect CH4 retrieval. In wavenumber range from 1210 cm-1 to 1360 cm-1, several H2O line parameters were updated from HITRAN2008 to HITRAN2012. These updates could also affect on CH4 retrieval through simultaneous retrieval with H2O at CH4 ν4 band.

  10. Quantification of Biodegradation: Applied Example on Oil Seeps in Armàncies Fm, Southeastern Pyrenees

    OpenAIRE

    Permanyer, Albert; Caja, Miguel Ángel

    2005-01-01

    La presencia de petróleo expulsado directamente de la roca madre de la Formación Armàncies, constituye un caso único para el estudio de los procesos de biodegradación aeróbica en petróleo. El estado de degradación bacteriana es moderado y está principalmente limitado a la alteración de n-alcanos, isoprenoides y algunos aromáticos. La cuantificación ha sido realizada mediante el contenido en sulfuro y con los marcadores moleculares de la fracción aromática. Los resultados obtenidos...

  11. Avaliação de biofertilizantes, extratos vegetais e diferentes substâncias alternativas no manejo de tripes em cebola em sistema orgânico.

    OpenAIRE

    Paulo A. de S. Gonçalves; Werner, Hernandes; João F. Debarba

    2004-01-01

    Avaliou-se substâncias alternativas no manejo de tripes (Thrips tabaci Lind.), em cebola, cv, Crioula, no sistema orgânico. Os experimentos foram conduzidos na EPAGRI, Ituporanga (SC). Os períodos entre transplante e colheita foram de 11/09/1996 a 10/01/1997 e 13/08/1997 a 11/12/1997. O delineamento foi de blocos ao acaso com 8 tratamentos em 1996 e 12 tratamentos em 1997 e quatro repetições. Em 1996 os tratamentos incluíram o biofertilizante anaeróbico 50%, biofertilizante aeróbico 5%, sulfa...

  12. Avaliação de biofertilizantes, extratos vegetais e diferentes substâncias alternativas no manejo de tripes em cebola em sistema orgânico Evaluation of biofertilizers, plant extracts, and some alternative substances to manage onion thrips in organic agriculture system

    OpenAIRE

    Paulo A. de S. Gonçalves; Hernandes Werner; João F. Debarba

    2004-01-01

    Avaliou-se substâncias alternativas no manejo de tripes (Thrips tabaci Lind.), em cebola, cv, Crioula, no sistema orgânico. Os experimentos foram conduzidos na EPAGRI, Ituporanga (SC). Os períodos entre transplante e colheita foram de 11/09/1996 a 10/01/1997 e 13/08/1997 a 11/12/1997. O delineamento foi de blocos ao acaso com 8 tratamentos em 1996 e 12 tratamentos em 1997 e quatro repetições. Em 1996 os tratamentos incluíram o biofertilizante anaeróbico 50%, biofertilizante aeróbico 5%, sulfa...

  13. Proceedings of the seventeenth Symposium of Atomic Energy Research, Vol. II

    International Nuclear Information System (INIS)

    The present volume contains 83 papers, presented on the eleventh Symposium of Atomic Energy Research, held in Yalta, Ukraine, 23-29 September 2007. The papers are presented in their original form, i. e. no corrections or modifications were carried out. The content of this volume is divided into thematic groups: Fuel Management, Spectral and Core Calculations, Core Surveillance and Monitoring, CFD Analysis, Reactor Dynamics Thermal Hydraulics and Safety Analysis, Physical Problems of Spent Fuel Decommissioning and Radwaste, Actinide Transmutation and Spent Fuel Disposal, Core Operation, Experiments and Code Validation, History of TIC/AER - according to the presentation sequence on the Symposium (Author)

  14. The Passing on Defence Aviated Into State Aid Law

    DEFF Research Database (Denmark)

    Ølykke, Grith Skovgaard

    2015-01-01

    The two annotated judgments concern the aftermath of a differentiated taxation on travelling, which was implemented in breach of the free movement provisions in the Treaties. Airlines (Aer Lingus and Ryanair) who were identified as beneficiaries of the advantage arising from being subject...... to the low level of taxation, contested the Commission’s calculation of the amount to be recovered. The General Court found for the applicants and stated that the Commission should limit itself to ordering recovery of the advantage actually retained by the airlines, taking into account the competitive...

  15. Nucleation and growth of sulfate aerosol in coal-fired power plant plumes: sensitivity to background aerosol and meteorology

    OpenAIRE

    Stevens, R G; J. R. Pierce; Brock, C. A.; M. K. Reed; J. H. Crawford; J. S. Holloway; Ryerson, T. B.; L. G. Huey; Nowak, J. B.

    2011-01-01

    New-particle formation in the plumes of coal-fired power plants and other anthropogenic sulfur sources may be an important source of particles in the atmosphere. It remains unclear, however, how best to reproduce this formation in global and regional aerosol models with grid-box lengths that are 10 s of kilometers and larger. The predictive power of these models is thus limited by the resultant uncertainties in aerosol size distributions. In this paper, we focus on sub-grid sulfate aer...

  16. Desarrollo de aplicaciones de comunicaciones inalámbricas en sistemas de monitorización estructural desarrollados en aeronáutica.

    OpenAIRE

    Guillén Medina, Carlos Paul

    2013-01-01

    Los Sistemas de SHM o de monitorización de la integridad estructural surgen ante la necesidad de mejorar los métodos de evaluación y de test no destructivos convencionales. De esta manera, se puede tener controlado todo tipo de estructuras en las cuales su correcto estado o funcionamiento suponga un factor crítico. Un Sistema SHM permite analizar una estructura concreta capturando de manera periódica el estado de la integridad estructural, que en este proyecto se ha aplicado a estructuras aer...

  17. Annual Energy Review 2001

    Energy Technology Data Exchange (ETDEWEB)

    Seiferlein, Katherine E. [USDOE Energy Information Administration (EIA), Washington, DC (United States)

    2002-11-01

    The Annual Energy Review (AER) is a statistical history of energy activities in the United States. It documents trends and milestones in U.S. energy production, trade, storage, pricing, and consumption. Each new year of data that is added to the time series—which now reach into 7 decades—extends the story of how Americans have acquired and used energy. It is a story of continual change as the Nation's economy grew, energy requirements expanded, resource availability shifted, and interdependencies developed among nations.

  18. The apical ectodermal ridge of the mouse model of ectrodactyly Dlx5;Dlx6 −/− shows altered stratification and cell polarity, which are restored by exogenous Wnt5a ligand

    OpenAIRE

    Conte, Daniele; Garaffo, Giulia; Lo Iacono, Nadia; Mantero, Stefano; Piccolo, Stefano; Cordenonsi, Michelangelo; Perez-Morga, David; Orecchia, Valeria; Poli, Valeria; Merlo, Giorgio R.

    2015-01-01

    The congenital malformation split hand/foot (SHFM) is characterized by missing central fingers and dysmorphology or fusion of the remaining ones. Type-1 SHFM is linked to deletions/rearrangements of the DLX5–DLX6 locus and point mutations in the DLX5 gene. The ectrodactyly phenotype is reproduced in mice by the double knockout (DKO) of Dlx5 and Dlx6. During limb development, the apical ectodermal ridge (AER) is a key-signaling center responsible for early proximal–distal growth and patterning...

  19. Dicty_cDB: Contig-U08229-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Peudomonas aer... 37 0.17 CP000614_1782( CP000614 |pid:none) Burkholderia vietnam...86415_2146( AM286415 |pid:none) Yersinia enterocolitica subsp. ... 107 1e-22 CR954246_1369( CR954246 |pid:no...h storage of neutral fats ... 44 4.5 1 ( BD323288 ) Low-adenosine antisense oligonucleotide, it...s comp... 44 4.5 1 ( BD323284 ) Low-adenosine antisense oligonucleotide, its comp... 44 4.5 1 ( AX925616 ) ...nces; 5,674,871 total letters Score E Sequences producing significant alignments: (bits) Value Conti

  20. Influência da maturação sexual no limiar de lactato em jogadoras de futebol Influence of sexual maturation in lactate threshold in female soccer players

    OpenAIRE

    Ana Lucia Anauate Nicolao; André Pedrinelli; Paulo Sérgio Martino Zogaib; Rogério Orbetelli; Turíbio Leite de Barros Neto

    2010-01-01

    Os limiares de lactato são utilizados para a avaliação da capacidade aeróbia em diferentes idades. Estudos demonstram que crianças e adolescentes apresentam menores concentrações sanguíneas de lactato [La], para mesma carga de esforço, do que adultos. Existem evidências de que isto está relacionado ao desenvolvimento maturacional das mesmas. OBJETIVO: Verificar a associação entre a maturação sexual e o limiar de lactato de atletas de futebol de 12 a 15 anos de idade. MÉTODO: A amostra foi do ...

  1. Evolução do perfil neuromotor e capacidade funcional de mulheres fisicamente ativas de acordo com a idade cronológica

    OpenAIRE

    Matsudo Sandra Mahecha; Matsudo Victor K.R.; Barros Neto Turíbio Leite de; Araújo Timóteo Leandro de

    2003-01-01

    FUNDAMENTOS E OBJETIVO: Poucos estudos longitudinais têm sido feitos em mulheres fisicamente ativas para determinar o impacto do envelhecimento na aptidão física e capacidade funcional. O objetivo deste estudo foi comparar a evolução do perfil neuromotor e capacidade funcional de mulheres ativas no período de um ano, de acordo com a idade cronológica. MÉTODOS: A amostra foi composta por 117 mulheres de 50 a 79 anos de idade (: 65 ± 6,6 anos) participantes de um programa de exercícios aeróbico...

  2. Simulation, Design and Analysis of Air-Breathing Combined-Cycle Engines for High Speed Propulsion

    OpenAIRE

    Fernández Villacé, Víctor

    2013-01-01

    Desde la aparición del turborreactor, el motor aeróbico con turbomaquinaria ha demostrado unas prestaciones excepcionales en los regímenes subsónico y supersónico bajo. No obstante, la operación a velocidades superiores requiere sistemas más complejos y pesados, lo cual ha imposibilitado la ejecución de estos conceptos. Los recientes avances tecnológicos, especialmente en materiales ligeros, han restablecido el interés por los motores de ciclo combinado. La simulación numérica de estos nuevos...

  3. Cystatin C and collagen type IV in diagnostics of chronic kidney disease in type 2 diabetic patients

    Directory of Open Access Journals (Sweden)

    Vadim Valer'evich Klimontov

    2015-03-01

    Full Text Available AimTo compare kidney disease markers: glomerular filtration rate (GFR, calculated upon creatinine and cystatin C, urinary cystatin C, collagen type IV and albumin in type 2 diabetic patients with normal and moderately reduced renal function.Materials and methods56 patients, aged 43–70 years, and 16 healthy controls, aged 40-72 years, were included in the study. GFR was calculated by equations based on creatinine (CKD-EPIcreat, cystatin C (CKD-EPIcys or both markers (CKD-EPIcreat-cys. Serum and urinary cystatin C was measured by immunoturbidimetric method, urinary albumin, albumin excretion rate (AER and collagen type IV excretion was determined by ELISA. The body composition was investigated in 24 patients by dual-energy X-ray absorptiometry.ResultsIn diabetic patients serum cystatin C level correlated positively with age (r=0.37, GFR calculated by CKD-EPIcreat (r=-0.43 and fat mass percentage (r=0.55. There was a positive correlation between GFR calculated by the CKD-EPIcys and GFR by CKD-EPIcreat (r=0.48. In multiple regression analysis the percentage of body fat influenced the GFR calculated by CKD-EPIcys or CKD-EPIcreat-cys. No correlation between urinary cystatin C and serum cystatin C level, GFR and AER was found. Collagen type IV excretion was increased in patients with decreased GFR, compared to those with normal GFR (p=0.002. Urinary collagen type IV correlated with both GFR and AER (r=-0.28 and r=0.47.ConclusionThe measurement of serum cystatin C with calculation of GFR by CKD-EPIcys and CKD-EPIcreat-cys, in addition to the CKD-EPIcreat, increases the accuracy of CKD diagnostics in type 2 diabetic patients. However, obesity and particularly body fat mass affect the results of estimation of GFR based on cystatin C. The increase in urinary collagen type IV, but not in cystatin C excretion, is related to GFR decline and AER elevation in these patients.

  4. Efectos de una dieta hipocalórica y de un programa de ejercicio físico de corta duración en el perfil lipídico y en la composición corporal de mujeres menopáusicas con sobrepeso

    Directory of Open Access Journals (Sweden)

    D. Rojano

    2014-09-01

    Conclusión: Los resultados obtenidos sugieren que la combinación de un programa de ejercicio físico aeróbico y de fuerza de 6 semanas de duración y una dieta hipocalórica en mujeres menopáusicas con sobrepeso, provoca mejoras significativas en la composición corporal y una tendencia hacia la mejora del perfil lipídico, lo que puede repercutir positivamente en la calidad de vida.

  5. Base aérea de Zaragoza

    Directory of Open Access Journals (Sweden)

    Editorial, Equipo

    1958-03-01

    Full Text Available De acuerdo con un plan previsto por la acción gubernamental conjunta entré los Estados Unidos y España, se ha procedido a la modernización, ampliación y reforma de los aeródromos, civil y militar, que se habían construido previamente en Zaragoza, y del nuevo aeródromo de Torrejón. Para la descripción de estas obras y de sus principales características técnicas y funcionales, nos hemos visto ayudados generosamente por el Departamento de la Marina de los Estados Unidos, a través de don Agustín Iglesia, ingeniero afecto a este servicio en España, y por don R. Sellmer, Director de Relaciones Públicas de la conocida empresa constructora Brown-Raymond-Walsh, que constituye un potente grupo de contratistas de reconocido prestigio en los Estados Unidos.

  6. Comparison of the Respiratory Metabolism of Juvenile Litopenaeus vannamei Cultured in Seawater and Freshwater

    Institute of Scientific and Technical Information of China (English)

    DING Sen; WANG Fang; DONG Shuanglin; LI Ying

    2014-01-01

    Litopenaeus vannamei, a euryhaline species, can be cultured at a wide range of salinities. The emergence of freshwater pond-culture of L. vannamei is an important prelude to the continued development of shrimp culture in China. In this study, we com-pared the respiratory metabolism of juvenile L. vannamei cultured in freshwater and saltwater by measuring their oxygen consump-tion rate (OCR), ammonium-type nitrogen excretion rate (AER) and pyruvate kinase (PK) and lactate dehydrogenase (LDH) activi-ties at different molting stages in order to physiecologically characterize juvenile L. vannamei under freshwater conditions. The re-sults showed that OCR was significantly higher in saltwater than in freshwater at all stages of molting cycle. However, variation of OCR among molting stages in saltwater was similar with that in freshwater, and the highest OCR was observed at post-molting stage. At all stages of molting cycle, AER was significantly higher in freshwater than in saltwater, and the highest was observed at post-molting stage. The activity of PK was significantly higher in saltwater than in freshwater. Conversely, the activity of LDH was higher in freshwater than in saltwater in general. Significant variation of PK and LDH activities in molting cycle was observed in saltwater and freshwater. The results indicated that aerobic metabolism of juvenile L. vannamei was more active in saltwater than in freshwater;while its protein metabolism was more active in freshwater than in saltwater.

  7. Comparison of the respiratory metabolism of juvenile Litopenaeus vannamei cultured in seawater and freshwater

    Science.gov (United States)

    Ding, Sen; Wang, Fang; Dong, Shuanglin; Li, Ying

    2013-11-01

    Litopenaeus vannamei, a euryhaline species, can be cultured at a wide range of salinities. The emergence of freshwater pond-culture of L. vannamei is an important prelude to the continued development of shrimp culture in China. In this study, we compared the respiratory metabolism of juvenile L. vannamei cultured in freshwater and saltwater by measuring their oxygen consumption rate (OCR), ammonium-type nitrogen excretion rate (AER) and pyruvate kinase (PK) and lactate dehydrogenase (LDH) activities at different molting stages in order to physiecologically characterize juvenile L. vannamei under freshwater conditions. The results showed that OCR was significantly higher in saltwater than in freshwater at all stages of molting cycle. However, variation of OCR among molting stages in saltwater was similar with that in freshwater, and the highest OCR was observed at post-molting stage. At all stages of molting cycle, AER was significantly higher in freshwater than in saltwater, and the highest was observed at post-molting stage. The activity of PK was significantly higher in saltwater than in freshwater. Conversely, the activity of LDH was higher in freshwater than in saltwater in general. Significant variation of PK and LDH activities in molting cycle was observed in saltwater and freshwater. The results indicated that aerobic metabolism of juvenile L. vannamei was more active in saltwater than in freshwater; while its protein metabolism was more active in freshwater than in saltwater.

  8. Nano-polyplex based on oleoyl-carboxymethy-chitosan (OCMCS) and hyaluronic acid for oral gene vaccine delivery.

    Science.gov (United States)

    Liu, Ya; Wang, Fang-Qin; Shah, Zeana; Cheng, Xiao-Jie; Kong, Ming; Feng, Chao; Chen, Xi-Guang

    2016-09-01

    Here we described nano-polyplexes (NPs) made of oleoyl-carboxymethy-chitosan (OCMCS)/hyaluronic acid (HA) as novel potential carriers for oral gene vaccines delivery. Aerolysin gene (aerA) of Aeromonas hydrophila as microbial antigen was efficiently loaded to form OCMCS-HA/aerA (OHA) NPs. OHA NPs performed the optimal parameters, i.e. smallest (154.5±9.4nm), positive charged (+7.9±0.5mV) and monodispersed system with the N/P ratio of 5 and OCMCS/HA weight ratio of 4. Upon the introduction of HA, OHA NPs was beneficial for the DNA release in intestinal environments in comparison to OA NPs. The mean fluorescence intensity detected in Caco-2 cells incubated with OHA NPs was about 2.5-fold higher than that of OA NPs; however, it decreased significantly in the presence of excess free HA. The OHA NPs and OA NPs decreased the transepithelial electric resistance (TEER) of Caco-2 monolayers obviously and induced increasing the apparent permeability coefficient (Papp) of DNA by 5.45-6.09 folds compared with free DNA. Significantly higher (Pvaccination. PMID:27236511

  9. Laboratory {open_quotes}proof of principle{close_quotes} investigation for the acoustically enhanced remediation technology

    Energy Technology Data Exchange (ETDEWEB)

    Iovenitti, J.L.; Spencer, J.W. Jr.; Hill, D.G. [Weiss Associates, Emergyville, CA (United States)] [and others

    1995-10-01

    Weiss Associates is conducting a three phase program investigating the systematics of using acoustic excitation fields (AEFs) to enhance the in-situ remediation of contaminated soil and ground water under both saturated and unsaturated conditions: Phase I - Laboratory Scale Parametric Investigation; Phase II - Technology Scaling Study; and Phase III - Large Scale Field Tests. Phase I, the subject of this paper, consisted primarily of a laboratory proof of principle investigation. The field deployment and engineering viability of acoustically enhanced remediation (AER) technology was also examined. Phase II is a technology scaling study addressing the scale up between laboratory size samples on the order of inches, and the data required for field scale testing, on the order of hundreds of feet. Phase III will consist of field scale testing at an non-industrialized, non-contaminated site and at a contaminated site to validate the technology. Summarized herein are the results of the Phase I {open_quotes}proof-of-principle{close_quotes} investigation, and recommendations for Phase H. A general overview of AER technology along with the plan for the Phase I investigation was presented.

  10. Progress report on SYVAC chemical speciation modelling studies during 1983/4

    International Nuclear Information System (INIS)

    This report summarises progress made on the SYVAC (System Variability Analysis program) chemical speciation project during 1983-4. Chemical speciation is defined and its importance in the SYVAC approach to Radioactive Waste Management is discussed. Computer modelling of chemical equilibria is described and the two programs presently operational at UWIST - SOLMNQ and MINEQL - are compared and discussed in detail. In view of the shortcomings of the databases supplied with these programs, a new database of equilibrium constants has been compiled containing 483 aqueous species and 329 solid phases, including data for the radionuclides uranium, plutonium, americium, neptunium and thorium. The collaborative work with AERE, Harwell, is reported. A leaching experiment carried out at Harwell has been modelled using the chemical speciation programs. The results for uranium, plutonium, americium and neptunium, are presented. However, the experimental data provided by AERE is insufficient for accurate simulations. Chemical speciation studies relating to specific sites require accurate characterisation of the groundwater, i.e. chemical composition, Eh and pH. In the absence of such information, preliminary studies have been made using an average granite groundwater. The results of these studies are presented and include solubility and speciation plots for uranium, plutonium, thorium and neptunium. The future aims of the project are discussed. (author)

  11. Amiodarone-Associated Optic Neuropathy: A Critical Review

    Science.gov (United States)

    Passman, Rod S.; Bennett, Charles L.; Purpura, Joseph M.; Kapur, Rashmi; Johnson, Lenworth N.; Raisch, Dennis W.; West, Dennis P.; Edwards, Beatrice J.; Belknap, Steven M.; Liebling, Dustin B.; Fisher, Mathew J.; Samaras, Athena T.; Jones, Lisa-Gaye A.; Tulas, Katrina-Marie E.; McKoy, June M.

    2011-01-01

    Although amiodarone is the most commonly prescribed antiarrhythmic drug, its use is limited by serious toxicities, including optic neuropathy. Current reports of amiodarone associated optic neuropathy identified from the Food and Drug Administration's Adverse Event Reporting System (FDA-AERS) and published case reports were reviewed. A total of 296 reports were identified: 214 from AERS, 59 from published case reports, and 23 from adverse events reports for patients enrolled in clinical trials. Mean duration of amiodarone therapy before vision loss was 9 months (range 1-84 months). Insidious onset of amiodarone associated optic neuropathy (44%) was the most common presentation, and nearly one-third were asymptomatic. Optic disc edema was present in 85% of cases. Following drug cessation, 58% had improved visual acuity, 21% were unchanged, and 21% had further decreased visual acuity. Legal blindness (< 20/200) was noted in at least one eye in 20% of cases. Close ophthalmologic surveillance of patients during the tenure of amiodarone administration is warranted. PMID:22385784

  12. Effect of liquid municipal biosolid application method on tile and ground water quality.

    Science.gov (United States)

    Lapen, D R; Topp, E; Edwards, M; Sabourin, L; Curnoe, W; Gottschall, N; Bolton, P; Rahman, S; Ball-Coelho, B; Payne, M; Kleywegt, S; McLaughlin, N

    2008-01-01

    This study examined bacteria and nutrient quality in tile drainage and shallow ground water resulting from a fall land application of liquid municipal biosolids (LMB), at field application rates of 93,500 L ha(-1), to silt-clay loam agricultural field plots using two different land application approaches. The land application methods were a one-pass AerWay SSD approach (A), and surface spreading plus subsequent incorporation (SS). For both treatments, it took between 3 and 39 min for LMB to reach tile drains after land application. The A treatment significantly (p Kjeldahl N (TKN), NH(4)-N, Total P (TP), PO(4)-P, E. coli., and Clostridium perfringens. E. coli contamination resulting from application occurred to at least 2.0-m depth in ground water, but was more notable in ground water immediately beneath tile depth (1.2 m). Treatment ground water concentrations of selected nutrients and bacteria for the study period ( approximately 46 d) at 1.2-m depth were significantly higher in the treatment plots, relative to control plots. The TKN and TP ground water concentrations at 1.2-m depth were significantly (p 0.1) treatment differences for the bacteria. For the macroporous field conditions observed, pre-tillage by equipment such as the AerWay SSD, will reduce LMB-induced tile and shallow ground water contamination compared to surface spreading over non-tilled soil, followed by incorporation.

  13. ASPECTOS DIFERENCIALES EN LA IMAGEN CORPORAL Y LA AUTODESCRIPCIÓN DE LA FORMA FÍSICA EN MUJERES SEDENTARIAS VS. MUJERES ACTIVAS DEPORTIVAMENTE

    Directory of Open Access Journals (Sweden)

    F. Arbinaga Ibarzábal

    2010-10-01

    Full Text Available

     

    Se analizan las relaciones entre imagen corporal y autodescripción física en mujeres que practican danza aeróbica de forma amateur frente a un grupo de mujeres sedentarias.
    La muestra se compuso de 112 mujeres activas deportivamente y 51 mujeres sedentarias.
    Los resultados al “Body Shape Questionnaire” (B.S.Q indican que no se presentan diferencias significativas entre las mujeres sedentarias y las mujeres activas. Del conjunto de la muestra, el 18,4% de las mujeres presentaría problemas con la imagen corporal; siendo en las sedentarias el 19,6% y en las activas el 17,9%. Al valorar los resultados en el “Physical Self-Description Questionnaire” (P.S.D.Q, las mujeres sedentarias puntúan por debajo de las activas en todos los factores salvo en el de fuerza.
    Palabras Clave: imagen corporal, forma física, aeróbic, mujer, sedentarias.

  14. Results of the isotopic concentrations of VVER calculational burnup credit benchmark no. 2(cb2

    International Nuclear Information System (INIS)

    The characterization of the irradiated fuel materials is becoming more important with the Increasing use of nuclear energy in the world. The purpose of this document is to present the results of the nuclide concentrations calculated Using Calculation VVER Burnup Credit Benchmark No. 2(CB2). The calculations were Performed in The Nuclear Technology Center of Cuba. The CB2 benchmark specification as the second phase of the VVER burnup credit benchmark is Summarized in [1]. The CB2 benchmark focused on VVER burnup credit study proposed on the 97' AER Symposium [2]. It should provide a comparison of the ability of various code systems And data libraries to predict VVER-440 spent fuel isotopes (isotopic concentrations) using Depletion analysis. This phase of the benchmark calculations is still in progress. CB2 should be finished by summer 1999 and evaluated results could be presented on the next AER Symposium. The obtained results are isotopic concentrations of spent fuel as a function of the burnup and Cooling time. The depletion point ORIGEN2[3] code was used for the calculation of the spent Fuel concentration. The depletion analysis was performed using the VVER-440 irradiated fuel assemblies with in-core Irradiation time of 3 years, burnup of the 30000 mwd/TU, and an after discharge cooling Time of 0 and 1 year. This work also comprises the results obtained by other codes[4].

  15. Separation of Aeruginosin-865 from Cultivated Soil Cyanobacterium (Nostoc sp.) by Centrifugal Partition Chromatography combined with Gel Permeation Chromatography.

    Science.gov (United States)

    Cheel, José; Minceva, Mirjana; Urajová, Petra; Aslam, Rabya; Hrouzek, Pavel; Kopecký, Jiří

    2015-10-01

    Aeruginosin-865 was isolated from cultivated soil cyanobacteria using a combination of centrifugal partition chromatography (CPC) and gel permeation chromatography. The solubility of Aer-865 in different solvents was evaluated using the conductor-like screening model for real solvents (COSMO-RS). The CPC separation was performed in descending mode with a biphasic solvent system composed of water-n-BuOH-acetic acid (5:4:1, v/v/v). The upper phase was used as a stationary phase, whereas the lower phase was employed as a mobile phase at a flow rate of 10 mL/min. The revolution speed and temperature of the separation column were 1700 rpm and 25 degrees C, respectively. Preparative CPC separation followed by gel permeation chromatography was performed on 50 mg of crude extract yielding Aer-865 (3.5 mg), with a purity over 95% as determined by HPLC. The chemical identity of the isolated compound was confirmed by comparing its spectroscopic data (UV, HRESI-MS, HRESI-MS/MS) with those of an authentic standard and data available in the literature. PMID:26669111

  16. DIAGNÓSTICO DAS CONDIÇÕES HIGIÊNICOSANITÁRIAS DE UM BANCO DE LEITE HUMANO NA CIDADE DE SÃO LUÍS, MA, BRASIL

    Directory of Open Access Journals (Sweden)

    Viraneide Marques de ALMEIDA

    2012-01-01

    Full Text Available Avaliaram-se as condições higiênico-sanitá- rias de amostras de leite humano de um Banco de Leite Humano (BLH na cidade de São Luís - MA, por meio da análise de 50 amostras de Leite Humano (LH in natura. Realizou-se contagem de bactérias aeróbias mesófilas viá- veis, Coliformes a 35ºC e a 45°C, Staphylococcus coagulase positiva e Salmonella sp. Realizaram-se no BLH seis vistorias com preenchimento de ficha de avaliação, contendo nove atributos para obtenção de informações sobre as condições higiênicas do local e seus procedimentos. Em nenhuma das amostras de leite foi constatada a presença de Salmonella sp. e Coliformes a 45°C, entretanto foi observada a presença de micro-organismos do grupo Coliformes a 35ºC, Staphylococcus coagulase positiva e bactérias aeró- bias mesófilas viáveis. Constatou-se por meio das vistorias que o referido BLH apresentou 92,60% de conformidade aos requisitos higiênico-sanitários analisados.

  17. A Neuro-Inspired Spike-Based PID Motor Controller for Multi-Motor Robots with Low Cost FPGAs

    Directory of Open Access Journals (Sweden)

    Anton Civit-Balcells

    2012-03-01

    Full Text Available In this paper we present a neuro-inspired spike-based close-loop controller written in VHDL and implemented for FPGAs. This controller has been focused on controlling a DC motor speed, but only using spikes for information representation, processing and DC motor driving. It could be applied to other motors with proper driver adaptation. This controller architecture represents one of the latest layers in a Spiking Neural Network (SNN, which implements a bridge between robotics actuators and spike-based processing layers and sensors. The presented control system fuses actuation and sensors information as spikes streams, processing these spikes in hard real-time, implementing a massively parallel information processing system, through specialized spike-based circuits. This spike-based close-loop controller has been implemented into an AER platform, designed in our labs, that allows direct control of DC motors: the AER-Robot. Experimental results evidence the viability of the implementation of spike-based controllers, and hardware synthesis denotes low hardware requirements that allow replicating this controller in a high number of parallel controllers working together to allow a real-time robot control.

  18. Cystatin C用于评估2型糖尿病患者早期肾脏损伤

    Institute of Scientific and Technical Information of China (English)

    张晓宇; 朱雪明

    2005-01-01

    目的探讨血清Cystatin C对2型糖原病患者早期肾脏损伤的诊断价值,并与传统的肌酐指标进行比较.方法对34例2型糖尿病患者按白蛋白排泄率(AER)分成三组.A组:AER200μg/min,为大量白蛋白尿组.同时测定三组的Cystatin C和血清肌酐.结果 A、B、C三组的Cystatin C和肌酐水平分别为0.73 mg/L、79.6μmol/L;1.17 mg/L、86.2μmol/L;1.43 mg/L、105.6μmol/L.B组Cystatin C水平显著高于A组 (P0.05):C组Cystatin C、肌酐水平均显著高于B组(P<0.001).结论血清Cystatin C是诊断2型糖尿病患者早期肾脏损伤的敏感指标,比肌酐更加灵敏.

  19. IMPACT OF STARVATION ON SURVIVAL, MEAT CONDITION AND METABOLISM OF CHLAMYS FARRERI

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    The effects of 60-day starvation on survival rate, condition index (CI), changes of nutrient composition of different tissues, respiration and excretion of scallop Chlamys farreri were studied in laboratory from Oct. 17 to Dec. 15,1997. Two groups (control and starvation with 200 individuals each) were cultured in two 2 m3 tanks, with 31 to 32 salinity water at 17℃. Starvation effects were measured after 10, 20, 40 and 60 days. There was no mass mortality of scallops of the two tanks and survival rates of the control and starvation groups were 93.5% and 92.0%, respectively. Starvation had strong effect on the meat condition of the scallops, especially after 10 days; when relative lipid percentage dropped sharply while relative protein percentage increased. The impact of starvation on the oxygen consumption rate (OCR) and the ammonia-N excretion rate (AER) was obvious. The OCR increased rapidly after 10 days but decreased after 20 days. The AER increased after 10 days and 20 days, but decreased obviously from 20 to 40 days. The O:N ratios varied to different degrees, and minimized after 20 days. The low O:N ratios implied that the protein was the main material for the metabolism of C. farreri.

  20. Efeito do treinamento físico na pressão arterial de adolescentes com obesidade Efecto del entrenamiento físico en la presión arterial de adolescentes con obesidad Effect of physical training on the blood pressure of adolescents with obesity

    Directory of Open Access Journals (Sweden)

    Breno Quintella Farah

    2012-12-01

    Full Text Available OBJETIVO: Descrever, por meio de uma revisão sistemática, os efeitos do treinamento físico sobre a pressão arterial em adolescentes com obesidade. FONTES DE DADOS: Recorreu-se à revisão sistemática de ensaios clínicos randomizados que analisaram o efeito do treinamento físico sobre a pressão arterial de adolescentes obesos, publicados em periódicos indexados nas bases de dados PubMed/Medline, Lilacs, SciELO e ISI Web of KnowledgeSM. Foram incluídos os estudos que avaliaram adolescentes publicados até 2010, e que possuíam Grupo Controle. SÍNTESE DOS DADOS: Oito estudos atenderam aos critérios de inclusão. Dois deles utilizaram exercícios de força combinados com aeróbios, enquanto seis empregaram apenas os aeróbios. Cinco estudos utilizaram intervenções complementares, sendo a nutricional a mais frequente. Quatro estudos observaram redução da pressão arterial sistólica no Grupo Exercício comparado ao Controle. Nesses quatro estudos, além da redução da pressão arterial, notou-se diminuição da massa corpórea. Todos aqueles que verificaram redução da pressão arterial utilizaram 12 a 24 semanas de exercícios aeróbios, três a seis sessões semanais, com duração de 50 a 90 minutos e intensidade entre 55 e 75% da frequência cardíaca máxima. CONCLUSÕES: O efeito do treinamento físico na pressão arterial de adolescentes obesos é controverso. A redução da pressão arterial parece ocorrer com programas de treinamento aeróbios que promovam também a redução da massa corpórea.OBJETIVO: Describir, mediante una revisión sistemática, los efectos del entrenamiento físico sobre la presión arterial en adolescentes con obesidad. FUENTES DE DATOS: Se recurrió a la revisión sistemática de ensayos clínicos aleatorios que analizaron el efecto del entrenamiento físico sobre la presión arterial de adolescentes obesos, publicados en periódicos indexados en las bases de datos PubMed/MedLine, LILACS, SciELO e

  1. Cambio en azúcares fermentables en la remolacha azucarera almacenada en atmósferas aerobia y anaerobia para la producción de etanol

    Directory of Open Access Journals (Sweden)

    Juan Manuel Vargas Ramírez

    2014-06-01

    Full Text Available Los métodos de almacenamiento de largo plazo son necesarios para preservar los azúcares fermentables en la remolacha y permitir el funcionamiento exitoso a lo largo del año en las plantas procesadoras para la obtención de etanol. Se estudió el almacenamiento anaeróbico de la remolacha azucarera como una alternativa al almacenamiento convencional en pilas a la intemperie utilizado actualmente en fábricas de azúcar de remolacha. Los resultados experimentales indican una pérdida de <15% en el total de los azúcares fermentables en la remolacha azucarera almacenada anaeróbicamente durante 14 semanas a 4 °C. Después de 14 semanas de almacenamiento, 99 ± 4% de los azúcares fermentables iniciales fueron preservados en la remolacha almacenada en condiciones aeróbicas a 4 °C. El almacenamiento aeróbico y anaeróbico de remolacha azucarera a 25 ° C conserva 82 ± 9 y 48 ± 11% del contenido de azúcar fermentable, respectivamente. Los azúcares fermentables y etanol en exudados contribuyeron insignificantemente (<3% para el rendimiento del etanol global de remolacha azucarera después del almacenamiento.

  2. Creation of a protective pulmonary bioshield against inhaled organophosphates using an aerosolized bioscavenger.

    Science.gov (United States)

    Rosenberg, Yvonne J; Fink, James B

    2016-06-01

    In addition to the global use of organophosphate (OP) pesticides for agriculture, OP nerve agents and pesticides have been employed on battlefields and by terrorists (e.g., a recent sarin attack in Syria). These occurrences highlight the need for an effective countermeasure against OP exposure. Human butyrylcholinesterase (HuBChE) is a leading candidate, but injection of the high doses required for protection present pharmacokinetic challenges. An aerosolized recombinant form (aer-rHuBChE) that can neutralize inhaled OPs at the portal of entry has been assessed for its efficacy in protecting macaques against respiratory toxicity following inhalation exposure to the pesticide paraoxon (aer-Px). While protection in macaques has been demonstrated using the MicroSprayer® delivery device, administration to humans will likely employ a vibrating mesh nebulizer (VMN). Compared to the 50-70% lung deposition achieved in adult humans with a VMN, deposition in macaques is <5%, an initial major obstacle to demonstrating protection. Such problems have been partly overcome by using a more efficient modified VMN and proportionally higher doses, which together generate an effective rHuBChE pulmonary bioshield and protect against high levels of inhaled Px. PMID:27371808

  3. Indoor air quality in the Swedish housing stock and its dependence on building characteristics

    DEFF Research Database (Denmark)

    Langer, Sarka; Bekö, Gabriel

    2013-01-01

    Data from a recent Swedish survey on the status of the housing stock and indoor air quality were placed in the public domain by the Swedish National Board of Housing, Building and Planning in 2011. The available parameters included the year of construction, dwelling location, type of ventilation...... system, temperature, relative humidity, air exchange rate (AER), and concentrations of nitrogen dioxide (NO2), formaldehyde and Total Volatile Organic Compounds (TVOC) from 157 single-family houses and 148 apartments. The median AER was lower in the single-family houses than in apartments (0.33h-1 vs. 0.......47h-1). The majority of houses (80%) did not comply with the building code that requires 0.5 air changes per hour. The median concentrations in single-family houses and apartments were 6.0 and 10μg/m3, respectively, for NO2, 22 and 13μg/m3 for formaldehyde, and 236 and 143μg/m3 for TVOC. All...

  4. Status of Spent Fuel Management in Korea

    International Nuclear Information System (INIS)

    Spent fuel generated from nuclear power plants are currently stored in At Reactor water pools. Total spent fuel storage capacity of AERE facilities of 9 nuclear units is about 2,500 MTC. About 500 MTC of spent fuel has been discharged from the reactor since 1980. Existing AERE storage capacity of spent fuel will lose its reserve capacity in the middle of 1990's. Therefore the countermeasure for securing additional storage capacity of spent fuel should be sought. 'Wait and See' was our country's policy for management of spent fuel. But the safe containment and disposal of spent fuel have become much important and imminent issue in Korea now. As a result, Atomic Energy Act was amended in May, 1986. By this amendment, government will take the responsibility of spent fuel management. The Korea Advanced Energy Research Institute will be authorized to carry out the spent fuel management and the related R and D activities. As interim measure for spent fuel management, AFSR facility will be constructed. Spent fuel will be transported to the AFSR facility from the middle of 1990s, and will be stored for some time period. 'Wait and See' is still considered to be more appropriate option for a long-term fuel management plan in Korea, because the introduction of FBRF in this century seems not possible

  5. Hipotensão pós-exercício em indivíduos hipertensos: uma revisão Hipotensión post-ejercicio en individuos hipertensos: una revisión A review on post-exercise hypotension in hypertensive individuals

    Directory of Open Access Journals (Sweden)

    Paulo Gomes Anunciação

    2011-05-01

    Full Text Available Após uma sessão de exercícios físicos, pode ocorrer hipotensão pós-exercício (HPE. Esse efeito possui elevada relevância clínica em hipertensos. Embora a literatura reporte vários estudos sobre o tema, ainda falta uma análise sobre o estado da arte, considerando-se os diferentes tipos de exercícios. Assim, o objetivo deste estudo foi verificar, por meio de uma revisão na literatura, a relação entre o exercício aeróbio e o resistido na HPE em hipertensos. Para tanto, realizaram-se buscas nas bases Scielo e Medline, considerando os estudos em inglês e a amostra de humanos adultos hipertensos os principais critérios de inclusão. Foram encontrados 126 estudos. Porém, fizeram parte das análises 32 artigos, dos quais cinco envolveram o exercício resistido, e 27, o exercício aeróbio. Sobre o exercício resistido, embora os estudos utilizassem modelos diferentes de prescrição, houve HPE principalmente no ambiente laboratorial. Após o exercício aeróbio, observou-se HPE por maiores períodos de tempo. Contudo, ocorrem conflitos sobre a melhor intensidade e duração para a prescrição dessa atividade. Portanto, aparentemente, ocorrem maiores reduções na pressão arterial após o exercício aeróbio em comparação com o exercício resistido em hipertensos. Não obstante, para maiores conclusões, são necessários estudos que acompanhem a pressão arterial de forma ambulatorial.Después de una sesión de ejercicios físicos, puede ocurrir hipotensión post-ejercicio (HPE. Ese efecto posee una elevada relevancia clínica en los hipertensos. Aunque la literatura reporte varios estudios sobre el tema, todavía nos queda realizar un análisis más profundo teniendo en cuenta los diferentes tipos de ejercicios.Por tanto, el objetivo de este estudio fue verificar, por medio de una revisión en la literatura, la relación entre el ejercicio aeróbico y el resistido en la HPE en hipertensos. Para eso se realizaron búsquedas en

  6. [Effect of training intensity on the fat oxidation rate].

    Science.gov (United States)

    Ulloa, David; Feriche, Belén; Barboza, Paola; Padial, Paulino

    2014-01-01

    Introducción: El ejercicio físico es un importante modulador de la máxima tasa de oxidación de grasas (MFO). Sin embargo, en la relación MFO-ejercicio, las zonas de transición metabólica en la prescripción del ejercicio no son consideradas. Objetivo: Conocer el efecto del entrenamiento en diferentes zonas de transición metabólica sobre la cinética de la MFO y su localización (Fatmax) en jóvenes varones activos. Método: 97 varones fueron distribuidos en 4 grupos homogéneos, 3 experimentales y un grupo control (GC). Cada grupo experimental participó en 8 semanas de entrenamiento administrado de forma continua a intensidad de umbral aeróbico o VT1 (CCVT1), interválica en umbral anaeróbico o VT2 (ITVT2), y en potencia aeróbica máxima o VO2max (ITVO2max). Antes y después del tratamiento los sujetos fueron testados en sendas pruebas con control de gases espirados para determinar el VO2max, VT1 y VT2, y la MFO (calorimetría indirecta) y Fatmax. Resultados: Los resultados muestran un incremento (entre 16,49 y 18,51%; p.

  7. Experience and challenges on safeguards practices and approaches for BAEC 3 MW TRIGA Mk-II research reactor and other establishment of Bangladesh

    International Nuclear Information System (INIS)

    Bangladesh is deeply committed to nuclear non-proliferation. Signing and accesses to different unilateral protocols, agreements and treaties like Nuclear Non-Proliferation Treaty (NPT), Comprehensive Test Ban Treaty (CTBT), Safeguards Agreements, Nuclear Cooperation Agreements with the USA and other countries etc. are the manifestations of such commitment. The first of such agreements, the NPT was signed in August 1979. Subsequently a bilateral agreement entitled 'Safeguards Agreements' was signed with the International Atomic Energy Agency (IAEA) in June 1982. This provides for international verification of facilities and balancing of nuclear materials and the facility, TRIGA Mark-II Research Reactor Facility of Bangladesh Atomic Energy Commission (BAEC) is inspected physically by the IAEA Safeguards Inspectors on an annual basis. For this purpose, a subsidiary arrangement was made with the IAEA, which had defined the scope of such verification. Bangladesh has also signed a Nuclear Cooperation Agreement with the USA on September 17, 1981, which facilitated export of nuclear technology from USA to Bangladesh. Bangladesh also signed another bilateral agreement entitled 'Protocol Additional to the Safeguards Agreements' with the IAEA in March 30, 2001. This protocol till to-date is the highest level of verification under the non-proliferation regime. The commitment of Bangladesh to non-proliferation is adequately reflected in this document. IAEA would decide on the modalities, frequency and scope of conducting its verification program on the basis of the declaration. Bangladesh signed the CTBT in October 1996. The Treaty was ratified in March 2000. This is a manifestation of Bangladesh's potential nuclear capabilities and by signing this Bangladesh has adequately and convincingly reiterated its commitment to the international community about its peaceful intentions. Atomic Energy Research Establishment (AERE) is the largest R and D establishment of the BAEC. It is

  8. ESTUDO DA EFICIÊNCIA DA PASTEURIZAÇÃO DA POLPA DE TAPEREBÁ (SPONDIAS MOMBIN

    Directory of Open Access Journals (Sweden)

    C. T. R. M. BASTOS

    2008-12-01

    Full Text Available

    O taperebá (Spondias mombim é uma pequena drupa elipsóide, de cor amarelo alaranjado, com casca fi na que pode ser facilmente rompida, tornando o fruto susceptível à contaminação por ação de agentes externos. Estudou-se a pasteurização da polpa de taperebá, visando estabelecer condições simples e efi cientes de conservação a temperatura ambiente. Parâmetros microbiológicos (enumeração de microrganismos mesófílos aeróbios e pesquisa de coliformes a 45°C, químicos (teor de vitamina C, enzimáticos (atividade da peroxidase – POD e colorimétricos (colorimetria tristimulus foram utilizados como variáveis de resposta. Em bancada, foram testados diferentes tempos (1 a 300 s e temperaturas (70ºC a 90ºC de tratamento térmico, não tendo sido observado efeito estatisticamente signifi cativo (p < 0,05 sobre as contagens de microrganismos mesófi los aeróbios, coliformes a 45°C e sobre a cor da polpa. Em escala piloto, realizou-se a pasteurização da polpa a 85°C por 3 minutos, sendo avaliados parâmetros de qualidade do produto durante 14 dias de manutenção a 40°C, sob iluminação artifi cial, e realizados testes sensoriais. A redução da contagem de microrganismos mesófi los aeróbios e coliformes a 45°C, para níveis aceitáveis pela legislação brasileira, a manutenção da cor e os índices de aceitação da polpa confi rmaram a efi ciência do tratamento térmico. Não se observou atividade da POD na polpa pasteurizada, devendo o controle de qualidade do produto ser feito com base nos parâmetros microbiológicos e de cor da polpa.

  9. BLOOD PRESSURE IN HYPERTENSIVE WOMEN AFTER AEROBICS AND HYDROGYMNASTICS SESSIONS.

    Science.gov (United States)

    Loiola Souto, Adriana; Moreira Lima, Luciana; Aparecida Castro, Eliane; Peixoto Veras, Renato; Segheto, Wellington; Camargos Zanatta, Thaís; Aparecida Doimo, Leonice

    2015-08-01

    Introducción: la práctica regular de ejercicios ha sido recomendada como conducta importante en el control de la presión arterial. En los últimos años se ha demostrado que una sola sesión de ejercicio físico puede disminuir la presión arterial comparada a los niveles del periodo pre-ejercicio, convirtiéndose en una terapia no farmacológica efectiva para el tratamiento de la hipertensión. Objetivo: analizar el comportamiento de la presión arterial post-ejercicio en mujeres hipertensas controladas tras la realización de una sesión de gimnasia acuática y una sesión de gimnasia aeróbica. Métodos: participaron en el estudio 12 mujeres mayores con edad de 65 ± 3.6 años y practicantes de actividad física por un periodo superior a dos meses. La presión arterial fue medida durante 60 minutos tras el final de cada clase. Este procedimiento fue realizado cada 5 minutos tras el esfuerzo hasta el vigésimo minuto de la recuperación, seguido de mediciones cada 10 minutos hasta el sexagésimo minuto. Fue utilizado el test T-Student para la comparación de los promedios y fue adoptado un nivel de significación del 5%. Resultados: los promedios de hipotensión encontrados durante la recuperación tras la clase de gimnasia acuática no fueron significativamente diferentes comparados con los promedios obtenidos en el pre-ejercicio (p = 0,260). Sin embargo, en la sesión de gimnasia aeróbica la diferencia entre esos valores fue estadísticamente significativa (p valores de presión arterial sistólica alcanzados en la recuperación para gimnasia acuática (120 mmHg) y gimnasia aeróbica (106 mmHg) también fueron significativamente diferentes (p valores y mayor duración del efecto hipotensor.

  10. PRODUCCIÓN DE AGUA ELECTROLIZADA PARA ELIMINACIÓN DE MICROORGANISMOS EN LECHUGA

    Directory of Open Access Journals (Sweden)

    Gustavo Adolfo Chaves

    2004-06-01

    Full Text Available Se llevó a cabo la construcción de una celda electrolítica para la producción de agua electrolizada oxidante (EO, observando constantemente su pH y contenido de cloro residual. La eficacia del agua EO (14ppm de cloro residual y pH 2.7±0.2 fue evaluada con la cepa de Escherichia coli ATCC 25922 (Experimentos “in vitro” y carga microbiana de lechuga (recuento de bacterias mesófilas aeróbios, NMP coliformes y coliformes termotolerantes, hongos y levaduras. Después de obtener un inóculo de E. coli de 9 horas (fase estacionaria, 63 X 10 11UFC/ml, este fue sometido a tratamiento con agua EO en diferentes tiempos de exposición (0, 2, 5, 10, 15, 20min para luego hacer recuentos en placa. Para el análisis microbiológico in vivo se sumergieron 10 gramos de lechuga en 200ml de agua EO a diferentes tiempos de acción (0, 2, 5, 10, 15, 20min. Posterior a esto serealizaron pruebas microbiológicas de estos ensayos (Recuento de mesófilos aeróbios, número mas probable de coliformes totales, coliformes termotolerantes y recuento de hongos y levaduras. Los ensayos in vitro arrojaron datos que comprueban la acción microbicida del agua EO sobre el inoculo sometido a tratamiento durante 20 minutos, reduciendo en 11.34 Unidades Logarítmicas (UL los recuen-tos de E. coli.La experimentación con la lechuga mostró reducciones en el NMP de coliformes totales y termotolerantes que pasaron de >2400 NMP a <3 NMP, descenso de 4.16 UL para los recuentos de mesófilos aeróbios(Recuento inicial de 57 X 105 UFC/g y 3.95 UL para los de hongos y levaduras (recuento inicial de 89 X 103; luego del tratamiento con agua EO durante 20 min. Se demostró que la utilización de agua EO sobre lechuga contaminada tiene efecto microbicida estadísticamente significativo (p=0.0001, permitiendo de esta manera utilizar esta agua para el proceso de lavado y desinfección de las lechugas.

  11. Efeitos do exercicio agudo sobre biomarcadores sericos de ratos diabeticos

    Directory of Open Access Journals (Sweden)

    Fabio Milioni

    2014-01-01

    Full Text Available INTRODUÇÃO: As respostas ao exercício agudo dos biomarcadores, como a fosfatase alcalina (FA e a creatina quinase (CK séricas têm sido pouco investigadas em ratos diabéticos. OBJETIVOS: Verificar os efeitos do exercício físico aeróbio agudo sobre as concentrações de CK e FA, bem como, avaliar o estado hídrico em ratos diabéticos experimentais. MATERIAIS E MÉTODOS Foram utilizados ratos Wistar machos, adultos jovens, distribuídos em dois grupos: diabéticos (DA e controles (CA. O diabetes foi induzido por meio da administração de aloxana monoidratado Sigma(r (32 mg/kg de peso corporal. Duas semanas após confirmação do diabetes, ambos os grupos foram submetidos a uma sessão aguda de natação por 30 min, com carga aeróbia (4,5 % do peso corporal. Foram avaliados: glicose, hematócrito, CK, FA, albumina e a cinética de lactato durante o exercício por meio de coletas 25 µL de sangue da cauda dos animais, nos minutos 0, 10, 20 e 30 de exercício. RESULTADOS: ANOVA de dois fatores para medidas repetidas e o teste post hoc de Tukey apontaram diminuição significativa dos valores de glicemia após o exercício para o grupo DA, aumento significativo de CK pós-exercício para o grupo DA, aumento significativo de hematócrito para ambos os grupos após exercício e manutenção da FA após exercício para o grupo DA. CONCLUSÃO: O exercício agudo aeróbio foi eficiente no controle dos níveis glicêmicos de ratos diabéticos. Entretanto, deve ser aplicado com cautela, pois induziu altos valores de CK, sugerindo possíveis lesões teciduais.

  12. A INFLUÊNCIA DO TREINAMENTO RESISTIDO E AERÓBIO EM FORMA DE CIRCUIT TRAINING NO CONTROLE GLICÊMICO DO DIABETES TIPO I: ESTUDO DE CASO

    Directory of Open Access Journals (Sweden)

    Marcos Tadeu Grzelczak

    2012-01-01

    Full Text Available O diabetes Mellitus é uma doença que pode desencadear uma série de complicações, desde problemas renais, hipertensão até cegueira e amputações. O exercício é normalmente indicado para portadores de diabetes, auxiliando no controle da doença, aumentando a sensibilidade à insulina, estabilizando as taxas de glicose no sangue auxiliando no controle de peso e redução das doses de insulina. Este estudo teve por objetivo analisar a influência do treinamento de musculação ou treinamento resistido,sendo desenvolvido em forma de circuito com treinamento aeróbio durante as seções, no controle da glicemia de um diabético tipo 1 (insulino dependente. A amostra foi composta por um homem de 27 anos portador de Diabetes Mellitus tipo1, insulino dependente a 4 anos. O programa de exercícios teve duração de 90dias e consistiu de um Circuit Training de musculação(contrações dinâmicas em séries únicas de 30 repetições e aeróbio (intensidade60% a 80% da frequência cardíaca máxima, foi aplicada na estatística descritiva.Foi observado diminuição da média glicêmica de 209,3 mg/dl no inicio do treinamentopara 122,4 mg/dl, ao final do estudo, uma diminuição de 41,52 % em relação a média inicial. Observou-se diminuição dos níveis de HbA1c de 7,10% para 5,02%. Neste sentido o treinamento de musculação e aeróbio em Circuit Training demonstrou ser uma opção salutar para o controle glicêmico de portadores de diabetes tipo1.

  13. [Egg intake and cardiovascular risk factors in adolescents: role of physical activity; the HELENA study].

    Science.gov (United States)

    Soriano-Maldonado, A; Cuenca-García, M; Moreno, L A; González-Gross, M; Leclercq, C; Androutsos, O; Guerra-Hernández, E J; Castillo, M J; Ruiz, J R

    2013-01-01

    Introducción: Las enfermedades cardiovasculares (ECVs) suponen la principal causa de morbi-mortalidad en los países occidentales. El incremento del colesterol plasmático se ha relacionado con el desarrollo de ECV. El huevo, por su alto contenido en colesterol, ha sido indirectamente relacionado con el riesgo de desarrollar ECVs. Objetivo: Examinar la asociación entre ingesta de huevo y factores de riesgo cardiovascular en adolescentes, estudiando si dicha relación está influenciada por la actividad física. Método: Se estudiaron 380 adolescentes pertenecientes al estudio HELENA (HEalthy Lifestyle in Europe by Nutrition in Adolescence). La ingesta de alimentos se estimó mediante anamnesis nutricional de dos días no consecutivos. Se midieron indicadores de adiposidad, perfil lipídico, glucosa, insulina, resistencia a la insulina, tensión arterial y capacidad aeróbica. Se calculó un índice integrado de riesgo cardiovascular (IRCV) como medida del perfil cardiovascular global. La actividad física se midió mediante acelerometría. Se examinó el desarrollo madurativo. El estatus socioeconómico y consumo de tabaco se obtuvieron mediante cuestionario. La asociación entre ingesta de huevo y factores de riesgo de ECV se examinó mediante un modelo de regresión multinivel ajustado por factores de confusión. Resultados: La ingesta de huevo no se asoció con perfil lipídico, nivel de adiposidad, tensión arterial, resistencia a la insulina, capacidad aeróbica o IRCV (todos P > 0,05). Esta falta de asociación no estuvo influenciada por el nivel de actividad física. Conclusiones: Estos resultados sugieren que no existe asociación entre ingesta de huevo y perfil lipídico, adiposidad, resistencia a la insulina, tensión arterial, capacidad aeróbica o el IRCV en adolescentes. La actividad física no influencia dicha falta de asociación.

  14. Dosimetry requirements in support of an in-reactor radiation chemistry programme

    International Nuclear Information System (INIS)

    Reactors are now used as radiation sources in a wide range of studies. In some, the changes observed result from the interaction of the irradiated material with only one type of radiation present in the reactor; in others, a number of different radiations may produce the observed effect. In any investigation of the effects of radiation on matter, it is necessary to know the spectrum of the radiation used. This information should be available in the form of the variation of photon or particle flux density with photon or particle energy. The amount of change observed in an irradiated material will always be the product of the radiation flux density and an interaction function, integrated over the radiation spectrum. The nature of this interaction function will vary with the type of study being performed. The radiation spectra in reactors are complex in form and cover wide ranges of photon and particle energies. Given sufficient information about the fission reaction, and about the geometry and materials of construction of a reactor, it is possible, in principle, to calculate the spectra of the reactor radiations. It is then possible, in principle, to calculate the rates of production of change in irradiated materials. In this paper the conventions used in radiation chemistry are discussed. This is followed by a discussion of the various types of calorimeters which can be used for dosimetry, with some remarks about their limitations. The reasons for choosing an isothermal-type calorimeter for the work at the Atomic Energy Research Establishment (AERE) are given, followed by a description of the construction, characteristics, and calibration of the calorimeters in use. It is shown that under the proper conditions these calorimeters measure the ideal absorbed dose-rate, or kerma rate. By the use of three calorimeters, as described, containing respectively graphite, anthracene, and an empty can, measurements were made of the dose rates in graphite and in anthracene, and

  15. Long-Term Effects of a Very Low Carbohydrate Compared With a High Carbohydrate Diet on Renal Function in Individuals With Type 2 Diabetes: A Randomized Trial.

    Science.gov (United States)

    Tay, Jeannie; Thompson, Campbell H; Luscombe-Marsh, Natalie D; Noakes, Manny; Buckley, Jonathan D; Wittert, Gary A; Brinkworth, Grant D

    2015-11-01

    To compare the long-term effects of a very low carbohydrate, high-protein, low saturated fat (LC) diet with a traditional high unrefined carbohydrate, low-fat (HC) diet on markers of renal function in obese adults with type 2 diabetes (T2DM), but without overt kidney disease.One hundred fifteen adults (BMI 34.6 ± 4.3 kg/m, age 58 ± 7 years, HbA1c 7.3 ± 1.1%, 56 ± 12 mmol/mol, serum creatinine (SCr) 69 ± 15 μmol/L, glomerular filtration rate estimated by the Chronic Kidney Disease Epidemiology Collaboration formula (eGFR 94 ± 12 mL/min/1.73 m)) were randomized to consume either an LC (14% energy as carbohydrate [CHO diet combined with supervised exercise training (60 min, 3 day/wk) for 12 months. Body weight, blood pressure, and renal function assessed by eGFR, estimated creatinine clearance (Cockcroft-Gault, Salazar-Corcoran) and albumin excretion rate (AER), were measured pre- and post-intervention.Both groups achieved similar completion rates (LC 71%, HC 65%) and reductions in weight (mean [95% CI]; -9.3 [-10.6, -8.0] kg) and blood pressure (-6 [-9, -4]/-6[-8, -5] mmHg), P ≥ 0.18. Protein intake calculated from 24 hours urinary urea was higher in the LC than HC group (LC 120.1 ± 38.2 g/day, 1.3 g/kg/day; HC 95.8 ± 27.8 g/day, 1 g/kg/day), P diet effect. Changes in SCr (LC 3 [1, 5], HC 1 [-1, 3] μmol/L) and eGFR (LC -4 [-6, -2], HC -2 [-3, 0] mL/min/1.73 m) did not differ between diets (P = 0.25). AER decreased independent of diet composition (LC --2.4 [-6, 1.2], HC -1.8 [-5.4, 1.8] mg/24 h, P = 0.24); 6 participants (LC 3, HC 3) had moderately elevated AER at baseline (30-300 mg/24 h), which normalized in 4 participants (LC 2, HC 2) after 52 weeks.Compared with a traditional HC weight loss diet, consumption of an LC high protein diet does not adversely affect clinical markers of renal function in obese adults with T2DM and no preexisting kidney disease.

  16. DETERMINAÇÃO DA QUALIDADE DO MEL

    Directory of Open Access Journals (Sweden)

    CRISPIN HUMBERTO GARCIA-CRUZ

    2009-07-01

    Full Text Available

    RESUMO: Foi determinada a qualidade do mel por meio da realização de análises microbiológicas e químicas de vinte amostras de mel (100% de consumo imediato comercializadas no varejo por pequenos apicultores e feirantes da região de São José do Rio Preto, Estado de São Paulo. Foi realizada a contagem de bactérias aeróbias termófilas; contagem de bolores e leveduras e a pesquisa de Salmonella sp. Os resultados das análises microbiológicas das amostras de mel mostraram que as contagens de bactérias aeróbias mesófilas variaram de 0,5 x 101 a 2,2 x 102 UFC/g; já as contagens de bactérias aeróbias termófilas variaram de 0,5 x 101 a 1,4 x 102 UFC/g. Foi detectada a presença de salmonella sp, em apenas uma das amostras analisadas (5%, não atendendo, portanto, ao padrão de ausência em 25g de amostra. Com relação às análises químicas verificou-se que a média da acidez titulável foi de 2,28% (v/p com variação de 1,19% a 3,33% (v/p. De acordo com os resultados obtidos 40% das amostras foram classificadas como mel de mesa e 60% como mel industrial. A análise global dos resultados revelou a adição de glicose comercial em algumas amostras analisadas. PALAVRAS-CHAVE: Mel; qualidade; microbiologia; análise.

  17. Analysis of Left Ventricular Functional Parameters in Normal Korean Subjects by ECG Gated Blood Pool Scan

    International Nuclear Information System (INIS)

    The demand for refinement in noninvasive and quantitative assessment of left ventricular (LU) function is increasing. To assess normal values of left ventricular functional parameters during both systole and diastole by scintigraphic method using computerized triple-head gamma camera and to evaluate correlations between these parameters. ECG gated blood pool scan with 99mTc-Human serum albumin was performed in 94 normal Korean subjects. Ejection fraction (EF), systolic parameters [peak emptying rate (PER), average emptying rate (AER), time to peak emptying rate (TPER)], and diastolic parameters [peak filling rate (PFR), average filling rate (AFR), time to peak filling rate (TPFR)] were obtained by analysis of LV time-activity curve, the correlation of these parameters to the age and sex, and the correlation between these parameters were evaluated. 1) Mean value of ejection fraction in study subjects was 59.6 ± 5.25% and showed no significant correlation to age (r=0.08) and sex but showed most pronounced correlation to PFR (r=0.46, p<0.001), PER (r=0.41, p<0.001), AFR (r=0.34, p<0.001) and AER (r=0.28, p<0.01). 2) Mean values of systolic parameters were as follows: PER=3.22 + 0.50 end-diastolic volume/sec, AER =2.22 + 0.45 end-diastolic volume/sec, TPER=103.5 + 29.30 msec. They showed no significant correlation to age and sex. 3) Mean values of diastolic parameters were as follows: PFR=2.71+0.51 end-diastolic volume/sec, AFR=1.830.44 end-diastolic volume/sec, TPFR=132.1 + 33.45 msec. They showed strong correlation to age (r=-0/70, -0.64, 0.37, p<0.001). Left ventricular functional parameters in normal Korean subjects were obtained reliably by computerized scintigraphic method and may be applied to the evaluation of cardiac function in diseased patients.

  18. Treinamento aerobio e resistido, qualidade de vida e capacidade funcional de hipertensas

    Directory of Open Access Journals (Sweden)

    Thais Inacio Rolim Povoa

    2014-01-01

    Full Text Available INTRODUÇÃO: Pacientes hipertensos podem apresentar comprometimento da qualidade de vida (QV e da qualidade de vida relacionada à saúde (QVRS, tanto pela hipertensão arterial (HA, quanto pelos eventuais efeitos adversos do tratamento. Exercícios físicos, aeróbios e resistidos, melhoram a performance cardiorrespiratória e neuromuscular, mas há poucas evidências sobre seus efeitos na QV, QVRS e capacidade funcional (CF em mulheres hipertensas. OBJETIVO: Avaliar e comparar os efeitos dos treinamentos aeróbio e resistido sobre a QV, QVRS e a capacidade funcional em hipertensas. MÉTODOS: Ensaio clínico randomizado, cego, com total de 18 sessões de exercícios. Foram incluídas mulheres hipertensas sob tratamento medicamentoso, não participantes de programas de exercícios, com 50 anos de idade ou mais, que não apresentaram arritmias e/ou alterações isquêmicas em teste ergométrico (protocolo de Bruce. A amostra foi randomizada como segue: grupo aeróbio (GA (n = 21 e grupo resistido (GR (n = 20. Intensidade GA: leve a moderada (Escala de Borg adaptada; GR: até 50-65% de 1 RM. Duas séries com 12 a 15 repetições. Antes e após a intervenção foram aplicados os questionários WHOQOL-bref (QV e SF-36 (QVRS e realizado o teste de caminhada de 6 minutos (TC6` para avaliar a CF. Estatística: testes Shapiro-Wilk, t de Student, Fisher, U de Mann-Whitney e Wilcoxon. Nível de significância: p 0,05. Após a intervenção houve melhora significativa em todos os domínios do WHOQOL-bref no GA e no GR houve melhora no domínio aspectos físicos. No SF-36, constatou-se melhora significativa em sete de oito domínios tanto no GA quanto no GR. Capacidade funcional: verificou-se melhora nos dois grupos (p < 0,001. CONCLUSÃO: Os dois tipos de treinamento melhoraram a QV e a CF e, dependendo dos objetivos estabelecidos, ambos podem ser eficazes.

  19. Ingesta de huevo y factores de riesgo cardiovascular en adolescentes; papel de la actividad física: Estudio HELENA

    Directory of Open Access Journals (Sweden)

    A. Soriano-Maldonado

    2013-06-01

    Full Text Available Introducción: Las enfermedades cardiovasculares (ECVs suponen la principal causa de morbi-mortalidad en los países occidentales. El incremento del colesterol plasmático se ha relacionado con el desarrollo de ECV. El huevo, por su alto contenido en colesterol, ha sido indirectamente relacionado con el riesgo de desarrollar ECVs. Objetivo: Examinar la asociación entre ingesta de huevo y factores de riesgo cardiovascular en adolescentes, estudiando si dicha relación está influenciada por la actividad física. Método: Se estudiaron 380 adolescentes pertenecientes al estudio HELENA (HEalthy Lifestyle in Europe by Nutrition in Adolescence. La ingesta de alimentos se estimó mediante anamnesis nutricional de dos días no consecutivos. Se midieron indicadores de adiposidad, perfil lipídico, glucosa, insulina, resistencia a la insulina, tensión arterial y capacidad aeróbica. Se calculó un índice integrado de riesgo cardiovascular (IRCV como medida del perfil cardiovascular global. La actividad física se midió mediante acelerometría. Se examinó el desarrollo madurativo. El estatus socioeconómico y consumo de tabaco se obtuvieron mediante cuestionario. La asociación entre ingesta de huevo y factores de riesgo de ECV se examinó mediante un modelo de regresión multinivel ajustado por factores de confusión. Resultados: La ingesta de huevo no se asoció con perfil lipídico, nivel de adiposidad, tensión arterial, resistencia a la insulina, capacidad aeróbica o IRCV (todos P > 0,05. Esta falta de asociación no estuvo influenciada por el nivel de actividad física. Conclusiones: Estos resultados sugieren que no existe asociación entre ingesta de huevo y perfil lipídico, adiposidad, resistencia a la insulina, tensión arterial, capacidad aeróbica o el IRCV en adolescentes. La actividad física no influencia dicha falta de asociación.

  20. Explosively driven facture and fragmentation of metal cylinders and rings

    Energy Technology Data Exchange (ETDEWEB)

    Goto, D; Becker, R C; Orzechowski, T J; Springer, H K; Sunwoo, A J; Syn, C K

    2007-01-03

    Cylinders and rings fabricated from AerMet{reg_sign} 100 alloy and AISI 1018 steel have been explosively driven to fragmentation in order to determine the fracture strains for these materials under plane strain and uniaxial stress conditions. The phenomena associated with the dynamic expansion and subsequent break up of the cylinders are monitored with high-speed diagnostics. In addition, complementary experiments are performed in which fragments from the explosively driven cylinder are recovered and analyzed to determine the statistical distribution associated with the fragmentation process as well as to determine failure mechanisms. The data are used to determine relevant coefficients for the Johnson-Cook (Hancock-McKenzie) fracture model. Metallurgical analysis of the fragments provides information on damage and failure mechanisms.

  1. Investigation of the fracture and fragmentation of explosively driven rings and cylinders

    Energy Technology Data Exchange (ETDEWEB)

    Goto, D M; Becker, R C; Orzechowski, T J; Springer, H K; Sunwoo, A J; Syn, C K

    2007-04-18

    Cylinders and rings fabricated from AerMet{reg_sign} 100 alloy and AISI 1018 steel have been explosively driven to fragmentation in order to determine the fracture strains for these materials under plane strain and uniaxial stress conditions. The phenomena associated with the dynamic expansion and subsequent break up of the cylinders are monitored with high-speed diagnostics. In addition, complementary experiments are performed in which fragments from the explosively driven cylinders are recovered and analyzed to determine the statistical distribution associated with the fragmentation process as well as to determine failure mechanisms. The data are used to determine relevant coefficients for the Hancock-McKenzie (Johnson-Cook) fracture model. Metallurgical analysis of the fragments provides information on damage and failure mechanisms.

  2. An Industrial Organisation to get Reactivity in Space Equipment Developments

    Science.gov (United States)

    Heranger, Ch.

    2004-10-01

    With a development phase launched in spring, a delivery of 60 flight models and a QR beginning 2004, the 200N FCV development sets a record in the European space business in terms of development duration. The success of this program owes to the co-operation EADS Space Transportation tied with small companies since some years. In order to adapt to ever-shorter development cycles, EADS Space Transportation propulsion equipment business line has developed industrial ties with small companies, namely AER in France. This article will present the reasons for such an industrial alliance, then the actual work share and organisation of the 200N program used as an example of such a cooperation. Finally, the key successes of this development along with a performance description of the 200N valve will be presented.

  3. The UK chemical nuclear data library: a summary of the data available in ENDF/B format

    International Nuclear Information System (INIS)

    The UK Chemical Nuclear Data Committee files have been considerably revised and extended. The files now embrace: fission yields (C31), fission product decay data (UKFPDD-2), activation product decay data (UKPADD-1), and heavy element decay data (UKHEDD-1). The fission yield data is based on Crouch's third round of adjustment and includes yields to isometric states. The decay data files include data on half-life, decay modes, branching ratios and alpha, beta and gamma radiation energies and intensities. The data have all been recommended by the UK Chemical Nuclear Data Committee for use in the UK reactor programme; they are stored on magnetic tape at AERE Harwell, AEE Winfrith and CEGB Berkeley Nuclear Laboratories. (author)

  4. Segurança e eficácia do treinamento físico na insuficiência renal crônica Safety and accuracy of physical training in chronic renal insufficiency

    OpenAIRE

    Cláudio Spínola Najas; Flávio Danilo Mungo Pissulin; Francis Lopes Pacagnelli; Gustavo Navarro Betônico; Igor Costa Almeida; José Alberto Neder

    2009-01-01

    A doença renal crônica acarreta alterações em todos os sistemas corporais. Os pacientes cursam com marcada redução do condicionamento cardiorrespiratório, alterações musculares, reduzida performance física e pior qualidade de vida. A atividade física tem sido cada vez mais utilizada como forma de tratamento para essa população. Programas de treinamento físico aeróbio e/ou resistidos de moderada ou baixa intensidade no período interdialítico e durante a hemodiálise têm sido utilizados. Entreta...

  5. Annual Energy Review 2007

    Energy Technology Data Exchange (ETDEWEB)

    Seiferlein, Katherine E. [USDOE Energy Information Administration (EIA), Washington, DC (United States)

    2008-06-01

    The Annual Energy Review (AER) is the Energy Information Administration's (EIA) primary report of annual historical energy statistics. For many series, data begin with the year 1949. Included are data on total energy production, consumption, and trade; overviews of petroleum, natural gas, coal, electricity, nuclear energy, renewable energy, international energy, as well as financial and environment indicators; and data unit conversion tables. Publication of this report is required under Public Law 95–91 (Department of Energy Organization Act), Section 205(c), and is in keeping with responsibilities given to the EIA under Section 205(a)(2), which states: “The Administrator shall be responsible for carrying out a central, comprehensive, and unified energy data and information program which will collect, evaluate, assemble, analyze, and disseminate data and information....”

  6. Generation cost frontier analysis, dynamic market adjustment, and strategic gaming: Integrated tools for benchmarking, competitive market analysis, and strategy formulation under conditions of uncertainty in the transition to a competitive electricity market

    International Nuclear Information System (INIS)

    The authors describe a three dimensional frontier consisting of: spending, availability/reliability, and utilization/heat rate. To determine optimal behavior in a future deregulated market, one must also find the optimal adjustment path from present to long-run frontier operation, and the optimal strategic action/response as determined by game theory. One can also perform more limited optimizations along either the two dimensional spending/reliability or spending/utilization frontiers. Although the authors mainly discuss optimizing existing domestic plants, frontier analysis could easily be applied to an electric producer's plants or acquisition targets internationally. Efficient operation saves money even in countries where electric markets are still regulated and can also confer indirect environmental benefits. AER is also applying these frontier analysis and game theory techniques to environmental decision-making, specifically to environmental retrofit decisions

  7. Integral Study of Atrazine Behaviour in Field Lysimeters in Argentinean Humid Pampas Soils Estudio Integral del Comportamiento de Atrazina en Lisímetros de Campo en Suelos de la Pampa Húmeda Argentina

    Directory of Open Access Journals (Sweden)

    Susana Hang

    2010-03-01

    Full Text Available Atrazine behavior during crop maize (Zea mays L. production in soils of Argentine humid pampas was investigated. Lysimeters (3.3 x 3.3 x 1.4 m with a Typic Argiudoll (Pergamino and others with a Typic Hapludoll (Junín were monitored for drainage water content and atrazine concentrations in soil and water. Soil profiles were sampled in four depths in three dates, and water drainage pooled in four periods. Most of atrazine loss in drainage occurred within 30 d of atrazine application being 0.13% and 0.03% of the total atrazine applied for Pergamino and Junín, respectively. Under laboratory conditions half-life average in both profiles was 16 d. Atrazine extractable residues (AER in lysimeters showed differences in quantity and distribution between both profiles. Extractable residues were 25.7 (Pergamino and 69.4 g ha-1 (Junín. At the 30th day of application, AER represented 25% of total AER in Junín and 88% in Pergamino in the first 30 cm. Occurrence of preferential flow through the Bt horizon (Pergamino may explain differences detected. High proportion of AER in Junín profile suggests low atrazine affinity and should be followed through time in order to evaluate actual stability of these residues and if they constitute a potential risk for aquifers.Se estudió el comportamiento de atrazina durante el ciclo de un cultivo de maíz (Zea mays L. en suelos de la pampa húmeda Argentina. Se monitoreó el total de agua drenada y la concentración de atrazina en suelo y agua, mediante el uso de seis lisímetros (3.3 x 3.3 x 1.4 m tres de ellos llenados con un Argiudoll Típico (Pergamino y otros tres con un Hapludoll Típico (Junín. Se tomaron muestras de cuatro horizontes en cada perfil de suelo en tres fechas y el agua drenada se agrupó en cuatro períodos. La mayor parte de las pérdidas de atrazina en el drenaje ocurrieron dentro de los primeros 30 días desde la aplicación de atrazina. Los porcentajes recuperados respecto de la cantidad

  8. Patterning mechanisms controlling digit development

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Vertebrate digits are essential structures for movement,feeding and communication.Specialized regions of the developing limb bud including the zone of polarizing activity(ZPA),the apical ectodermal ridge(AER),and the non-ridge ectoderm regulate the patterning of digits.Although a series of signaling molecules have been characterized as patterning signals from the organizing centers,the delicate cellular and molecular mechanisms that interpret how these patterning signals control the detailed digit anatomy remain unclear.Recent studies from model organisms and human hand malformations provide new insights into the mechanisms regulating this process.Here,we review the current understanding of the genetic networks governing digit morphogenesis.

  9. Structure of Concatenated HAMP Domains Provides a Mechanism for Signal Transduction

    Energy Technology Data Exchange (ETDEWEB)

    Airola, Michael V.; Watts, Kylie J.; Bilwes, Alexandrine M.; Crane, Brian R. (Cornell); (Lorma Linda U)

    2010-08-23

    HAMP domains are widespread prokaryotic signaling modules found as single domains or poly-HAMP chains in both transmembrane and soluble proteins. The crystal structure of a three-unit poly-HAMP chain from the Pseudomonas aeruginosa soluble receptor Aer2 defines a universal parallel four-helix bundle architecture for diverse HAMP domains. Two contiguous domains integrate to form a concatenated di-HAMP structure. The three HAMP domains display two distinct conformations that differ by changes in helical register, crossing angle, and rotation. These conformations are stabilized by different subsets of conserved residues. Known signals delivered to HAMP would be expected to switch the relative stability of the two conformations and the position of a coiled-coil phase stutter at the junction with downstream helices. We propose that the two conformations represent opposing HAMP signaling states and suggest a signaling mechanism whereby HAMP domains interconvert between the two states, which alternate down a poly-HAMP chain.

  10. UNITATE DE ALIMENTARE CU ENERGIE PENTRU SERE INDUSTRIALE

    OpenAIRE

    Şit, Mihail; Şit, Boris

    2014-01-01

    Scopul lucrării este de a elabora un sistem eficient de alimentare cu energie pentru serele industriale unde este necesară menţinerea strictă a temperaturii şi umiditaţii dorite. Serele sunt destinate pentru cultivarea plantelor pe tot parcursul anului. A fost elaborat complexul: "pompă de căldură cu motorul cu gaz apă-aer"generator electric" (pentru utilizarea în timpul sezonului de încălzire), precum şi "pompă de căldură cu motor cu gaz apă-aer”cooler evaporativ generator electric" pentru a...

  11. Sistemas de Compostaje para el Tratamiento de Alperujo Composting Systems for Olive Residues Treatment

    OpenAIRE

    María T Varnero; Karina Galleguillos; Ronald Rojas

    2011-01-01

    Se evaluaron cuatro sistemas de compostaje durante 140 días para el tratamiento aeróbico del alperujo: T1 con pilas 100% alperujo y volteo manual, T2 con pilas 100% alperujo y aireación forzada, T3 con pilas 75% alperujo y 25% chips de poda y volteo manual, y T4 con pilas 75% alperujo y 25% chips de poda con aireación forzada combinada con volteo manual. Los tratamientos con el agente estructurante (T3 y T4) alcanzaron la etapa termofílica al séptimo día; en cambio, T1 y T2 a los veintiún día...

  12. Astronomy Education Review: A Five-Year Progress Report

    Science.gov (United States)

    Fraknoi, Andrew; Wolff, S.

    2006-12-01

    For the last five years, we have been publishing (with support from NOAO, NASA, the AAS, and the ASP) an on-line journal/magazine called Astronomy Education Review, focusing on astronomy and space-science education and outreach. It can be found at: http://aer.noao.edu This project, the first of its kind in our field, has made it possible to elaborate, encourage, and support -in one convenient location -the literature of astronomy education research, together with discussions of some of the key issues that professionals in the field are grappling with. (In this sense, the journal resembles Science or Nature.) We present statistics about the 164 papers and articles published in the first nine issues of the journal and about its international readership. We also discuss the future plans for this publication and the role that the AAS community can play in supporting it.

  13. Efeitos do exercício físico durante a hemodiálise em indivíduos com insuficiência renal crônica: uma revisão Effects of physical exercise during hemodialysis in patients with chronic renal insufficiency: a literature review

    Directory of Open Access Journals (Sweden)

    Regina Márcia Faria de Moura

    2008-01-01

    Full Text Available As principais alterações observadas em indivíduos com insuficiência renal crônica são anemia, hipertensão arterial sistêmica e atrofia muscular, que levam à baixa capacidade aeróbica e perda de força muscular. Assim, parte do tratamento desses indivíduos consiste em programas de exercício físico. O objetivo desta revisão da literatura foi documentar os efeitos agudos e as adaptações crônicas, cardiovasculares e musculares em indivíduos no estágio final da doença renal, submetidos a programas de exercício físico durante a hemodiálise. Foram selecionados artigos científicos nas bases eletrônicas Medline, Lilacs e PEDro, assim como no acervo de periódicos da biblioteca da Faculdade de Medicina da UFMG. Foram analisados 13 artigos envolvendo exercício físico aeróbico associado ou não a fortalecimento muscular durante a hemodiálise, variando quanto à intensidade, freqüência e duração da intervenção. A maioria demonstrou que exercícios físicos realizados durante a hemodiálise promovem efeitos benéficos na melhora da capacidade aeróbica, força muscular e no controle dos fatores de risco cardiovasculares, auxiliando a remoção dos solutos durante a hemodiálise. Embora o tema seja ainda pouco explorado, a literatura disponível evidencia benefícios do exercício durante a hemodiálise sobre a capacidade aeróbica e força muscular dos pacientes.Main alterations seen in patients with chronic renal insufficiency are anemia, systemic arterial hypertension, and muscular atrophy, which lead to low aerobic capacity and loss of muscle strength. Hence part of these patients treatment consists in programs of physical exercise. The purpose of this literature review was to assess muscle and cardiovascular acute effects and chronic adaptations in end-stage renal disease patients submitted to physical exercise during hemodialysis. After browsing through Medline, Lilacs and PEDro databases, as well as searching for

  14. Efeito da cinza de biomassa na dinâmica do C e N do solo de uma plantação de pinus pinaster Wood ash effects on C and N dynamics of a soil from a pinus pinaster plantation

    OpenAIRE

    Maria Xesús Gómez-Rey; Manuel Madeira; João Coutinho; Ernesto Vasconcelos

    2010-01-01

    Estudou-se, através de incubação aeróbia, o efeito da aplicação de cinza de biomassa florestal nas características químicas e na actividade microbiana de um Arenossolo de um povoamento de Pinus pinaster Ait. As doses de cinza aplicadas foram de 0, 4, e 8 g kg-1 solo, sob forma pulverulenta ou peletizada, e na presença ou ausência de fertilizante azotado. A aplicação de cinza sob forma pulverulenta aumentou rápida e significativamente os valores de pH e os teores de bases de troca e de P extra...

  15. Music of the Spheres: Astronomy-Inspired Music as an EPO Tool

    Science.gov (United States)

    Fraknoi, A.

    2008-06-01

    In doing public programs, getting audiences to think about astronomy in the wider culture, or just having some fun with a class or museum group, it's useful to have them brainstorm about all the pieces of music they can identify that have an astronomical connection. We have found over 100 pieces of classical and popular music that draw their inspiration from serious astronomy (and not just the use of a single astronomical term). These include three rock songs about black holes, operas about Einstein and Kepler, an electronic piece in which the players are asked to expand like the universe, and many more. We also highlight several astronomers and physicists who perform science music and discuss how anyone can use music to catch audience interest. The full list of pieces and more information is available at: \\url{http://aer.noao.edu/cgi-bin/article.pl?id=193}.

  16. Chemical Production using Fission Fragments

    International Nuclear Information System (INIS)

    Some reactor design considerations of the use of fission recoil fragment energy for the production of chemicals of industrial importance have been discussed previously in a paper given at the Second United Nations International Conference on the Peaceful Uses of Atomic Energy [A/Conf. 15/P.76]. The present paper summarizes more recent progress made on this topic at AERE, Harwell. The range-energy relationship for fission fragments is discussed in the context of the choice of fuel system for a chemical production reactor, and the experimental observation of a variation of chemical effect along the length of a fission fragment track is described for the irradiation of nitrogen-oxygen mixtures. Recent results are given on the effect of fission fragments on carbon monoxide-hydrogen gas mixtures and on water vapour. No system investigated to date shows any outstanding promise for large-scale chemical production. (author)

  17. High-Resolution Respirometry for Metabolic Profiling of Acute Rat Hippocampal Slices

    OpenAIRE

    Henriques, Tiago André Ferreira

    2013-01-01

    Ainda existem muitas questões por responder no campo da bioenergética cerebral e a questão de quais são os substratos que normalmente abastecem o metabolismo cerebral ainda não foi resolvida. Em particular, não é claro se a preferência por substratos é diferente entre neurónios e astrócitos, se essa preferência muda durante períodos de aumento da atividade neuronal ou se a via metabólica primária para metabolizar esse substrato é a glicólise aeróbia ou o ciclo dos ácidos tricar...

  18. Data mining for signal detection of adverse event safety data.

    Science.gov (United States)

    Chen, Hung-Chia; Tsong, Yi; Chen, James J

    2013-01-01

    The Adverse Event Reporting System (AERS) is the primary database designed to support the Food and Drug Administration (FDA) postmarketing safety surveillance program for all approved drugs and therapeutic biologic products. Most current disproportionality analysis focuses on the detection of potential adverse events (AE) involving a single drug and a single AE only. In this paper, we present a data mining biclustering technique based on the singular value decomposition to extract local regions of association for a safety study. The analysis consists of collection of biclusters, each representing an association between a set of drugs with the corresponding set of adverse events. Significance of each bicluster can be tested using disproportionality analysis. Individual drug-event combination can be further tested. A safety data set consisting of 193 drugs with 8453 adverse events is analyzed as an illustration. PMID:23331228

  19. Efeitos de três modalidades de atividade física na capacidade funcional de idosos Efectos de tres modalidades de actividad física en la capacidad funcional de adultos mayores Effects of three methods of physical activity in functional ability of elderly

    OpenAIRE

    Deisy Terumi Ueno; Sebastião Gobbi; Camila Vieira Ligo Teixeira; Émerson Sebastião; Alexandre Konig Garcia Prado; José Luiz Riani Costa; Lilian Teresa Bucken Gobbi

    2012-01-01

    O objetivo do presente estudo foi analisar e comparar os efeitos de três modalidades de atividade física: atividade física geral, dança e musculação, na capacidade funcional de idosos. A amostra foi composta por 94 idosos com idade média de 64,06 ± 7,38 anos, que participavam do PROFIT. Para a avaliação foi utilizada a bateria de testes da AAHPERD, da qual se obtém os níveis de flexibilidade, coordenação, agilidade e equilíbrio dinâmico, resistência de força e resistência aeróbia geral, antes...

  20. Efeitos do treinamento físico sobre a resistência mecânica do terço proximal do fêmur de ratos Effects of physical training on the mechanical resistance of rat femur proximal thirds

    Directory of Open Access Journals (Sweden)

    Andreo Fernando Aguiar

    2010-01-01

    Full Text Available OBJETIVO: Analisar o comportamento mecânico do terço proximal do fêmur de ratos submetidos ao treinamento aeróbio e resistido crônicos. MÉTODOS: Ratos Wistar machos (80 dias, 300 a 350 g foram divididos em 3 grupos (n=8 por grupo: Treinamento aeróbio/8 semanas (TA, Treinamento resistido/8 semanas (TR e controle/8 semanas (CO. Ao término do período de treinamento os animais foram sacrificados e o fêmur direito coletado. Para análise do comportamento mecânico do fêmur foram realizados ensaios de flexo-compressão. RESULTADOS: O treinamento resistido ocasionou redução significante da força máxima (Fmáx do fêmur. Por outro lado, promoveu um aumento (23,7% relevante, porém não significante, da deformação da força máxima (DFmáx. O treinamento aeróbio não afetou a Fmáx, porém promoveu uma redução (26,6% considerável, também não significante, da DFmáx. CONCLUSÕES: Os resultados demonstram que o treinamento resistido e aeróbio, promoveram redução da Fmáx e da DFmáx óssea, respectivamente. Os dados evidenciam uma ação diferencial de ambos os modelos de treinamento físico sobre as propriedades mecânicas do fêmur de ratos.OBJECTIVE: To analyze the mechanical behavior of rat femur proximal thirds submitted to chronic aerobic and resistance training. METHODS: Male Wistar rats (80 days of age, weighing 300 to 350 g were divided into 3 groups (n=8 per group: control (CO, aerobic training (TA and resistance training (TR. At the end of the training, the animals were euthanized and the right femur was collected. Flexion-compression tests were carried out to analyze the mechanical behavior of the femurs. RESULTS: The resistance training promoted a significant reduction in maximum force (Fmáx of the femur. However, it also promoted a relevant increase (23.7%, though without statistical significance, in maximum force deformation (DFmáx. The aerobic training did not affect maximum force, however, it caused a

  1. Tolerância ao esforço em ratos com estenose aórtica e disfunção ventricular diastólica e/ou sistólica Exercise tolerance in rats with aortic stenosis and ventricular diastolic and/or systolic dysfunction

    OpenAIRE

    Olga Castro Mendes; Mario Mateus Sugizaki; Dijon Salomé Campos; Ricardo Luiz Damatto; André Soares Leopoldo; Ana Paula Lima-Leopoldo; Vilmar Baldissera; Carlos Roberto Padovani; Katashi Okoshi; Antonio Carlos Cicogna

    2012-01-01

    FUNDAMENTO: A Tolerância ao Esforço Físico (TEF) é uma medida de condicionamento cardiorrespiratório. A capacidade aeróbica é reduzida na Insuficiência Cardíaca (IC), embora não haja dados disponíveis sobre esse parâmetro em animais com disfunção ventricular e sem sinais de IC. OBJETIVO: Avaliar a TEF em ratos com disfunção ventricular diastólica isolada ou associada com disfunção sistólica induzida pela Estenose da Aorta ascendente (EAo). MÉTODOS: Ratos Wistar machos jovens (20-30 dias de id...

  2. Exposición intermitente a altitud simulada y ejercicio para la recuperación del daño muscular: células madre circulantes y ajustes hemorreológicos en ratas entrenadas

    OpenAIRE

    Núñez Espinosa, Cristian

    2015-01-01

    La hipótesis general de este trabajo se basa en que un protocolo de hipoxia hipobárica intermitente (IHH) combinada con ejercicio aeróbico ligero en normoxia, puede tener un efecto beneficioso en la regeneración de musculatura esquelética dañada y contribuir a una recuperación más rápida en este tipo de lesiones. Sin embargo, el conocido efecto hematopoyético de la exposición a hipoxia y del ejercicio, y el consiguiente aumento de hematocrito, podrían afectar a la dinámica del aporte de oxíge...

  3. The improvement and evaluation of a laser interferometer for the absolute measurement of ultrasonic displacements in the frequency range up to 15 MHz

    International Nuclear Information System (INIS)

    This report describes the application of a laser interferometer to the absolute calibration of hydrophones in the frequency range 0.5 to 15 MHz. The interferometer, previously developed and improved at AERE Harwell, has now been assessed in terms of its performance characteristics. The optimum experimental arrangement and method of calibration has been defined and corrections for various effects which influence the measurement have been studied experimentally and theoretically. The reproducibility of the method is approximately 1% and the estimated systematic uncertainty ranges from 2.1% at 0.5 MHz to 6.3% at 15 MHz. A hydrophone has been calibrated using the interferometer and using two other methods, and the results are in agreement to within the estimated uncertainties

  4. Recomendações práticas para a ingestão de líquidos em lutador

    Directory of Open Access Journals (Sweden)

    Edmar Ciro José Brito

    2012-04-01

    Full Text Available Diversos trabalhos estudaram estratégias de reposição hídrica para modalidades aeróbicas, como o ciclismo e a corrida. No entanto, pouco se pesquisou até o momento sobre estratégias de reposição hídrica em lutadores. Este trabalho tem por objetivo apresentar os efeitos benéficos da reposição hidro energética e propor estratégias para lutadores. São apontadas recomendações para a hidratação antes, durante e depois de cada atividade e específicas para as modalidades.

  5. Recomendações práticas para a ingestão de líquidos em lutador http://dx.doi.org/10.15601/1983-7631/rt.v1n0p107-113

    Directory of Open Access Journals (Sweden)

    Edmar Ciro José Brito

    2012-04-01

    Full Text Available Diversos trabalhos estudaram estratégias de reposição hídrica para modalidades aeróbicas, como o ciclismo e a corrida. No entanto, pouco se pesquisou até o momento sobre estratégias de reposição hídrica em lutadores. Este trabalho tem por objetivo apresentar os efeitos benéficos da reposição hidro energética e propor estratégias para lutadores. São apontadas recomendações para a hidratação antes, durante e depois de cada atividade e específicas para as modalidades.Palavras-chave: artes marciais; desidratação; desempenho

  6. Methodologies for 2011 economic reports

    DEFF Research Database (Denmark)

    Nielsen, Rasmus

    STECF’s Expert Working Group 11-03 convened in Athens (28th March – 1st April, 2011) to discuss and seek agreement on the content, indicators, methodologies and format of the 2011 Annual Economic Reports (AER) on the EU fishing fleet, the fish processing and the aquaculture sectors. Proposals...... for improved contents and the overall structure were discussed. Templates for the national and EU overview chapters for the EU the fish processing and the aquaculture sectors were produced. Indicators for the EU fishing fleet and fish processing reports were reviewed; new indicators for the fish processing...... and the aquaculture sector reports were proposed. And topics of special interest were proposed for all three reports....

  7. Perdas de silagens de cana-de-açúcar tratadas com aditivos químicos e bacterianos Losses evaluation of the sugar cane silage treated with chemical and microbial additives

    Directory of Open Access Journals (Sweden)

    Gustavo Rezende Siqueira

    2007-12-01

    Full Text Available Objetivou-se avaliar silagens de cana-de-açúcar tratadas com aditivos químicos (uréia 1,5%; benzoato de sódio 0,1%; ou hidróxido de sódio (NaOH 1% na matéria natural combinados ou não com inoculantes (Propionibacterium acidipropionici + Lactobacillus plantarum ou Lactobacillus buchneri. Foram avaliadas 12 silagens: uma controle, sem inoculante e sem aditivo químico; três sem inoculante, mas com um dos aditivos; uma com P. acidipropionici + L. plantarum, sem aditivo químico; três com P. acidipropionici + L. plantarum e um dos aditivos; uma com L. buchneri, sem aditivo químico; e três com L. buchneri e um dos aditivos. Os dados foram analisados em esquema fatorial 4 × 3 com três repetições para cada tratamento. Foram determinadas as perdas ocorridas durante o processo fermentativo nas formas de gases e de efluentes e a recuperação da MS. Durante a exposição aeróbia, determinaram-se a recuperação da MS e a estabilidade aeróbia medida pela variação da temperatura. A associação de L. buchneri e NaOH reduziu as perdas por gases e efluentes e elevou a recuperação da MS. No período após abertura, destacou-se a atuação do benzoato de sódio em manter o pH com variação de apenas 0,1 unidade em cinco dias de exposição aeróbia e dos inoculantes L. buchneri e P. acidipropionici + L. plantarum em prolongar o tempo para elevação da temperatura de 34 horas nas silagens controle para 54 e 50 horas, respectivamente. A ensilagem de cana-de-açúcar requer a inclusão de algum aditivo eficiente no controle das perdas quantitativas durante a fermentação e a exposição aeróbia.The experiment was carried out to evaluate sugar cane silage treated with chemical additive: urea 1.5%, sodium benzoate 0.1%, and sodium hydroxide 1.0% on the wet basis, associated with Propionibacterium acidipropionici + Lactobacillus plantarum and Lactobacillus buchneri, plus control silage in a factorial scheme 4 x 3, with three replications

  8. Shock—Boundary Layer Interaction Control,Predictions Using a Viscous—Inviscid Interaction Procedure and a Navier—Stokes Solver

    Institute of Scientific and Technical Information of China (English)

    G.Simandirakis; B.Bouras; 等

    1997-01-01

    The present contribution describes two prediction methods for flows around transonic airfoils,including shock control devices.The whole work was done in the frame of the European Shock Control Investigation Project EUROSHOCK-AER-2,and the global objective was the improvement of the flight performance,in transonic speed,in terms of cruise speed,fuel consumption and exhaust emissions for both laminar and turbulent wings,More specifically the Passive control of shock/boundary layer interaction,whereby pary of the solid surface of the airfoil is replaced by a porous surface over a shallow cavity,has been shown to be a means of improving the aerodynamic characteristics of supercritical airfoils.

  9. Promoción de la salud en adolescentes mediante un programa de intervención de mejora de la condición física y del estilo de vida

    Directory of Open Access Journals (Sweden)

    Eva Clemente Bosch

    2012-12-01

    Full Text Available Dado que el estilo de vida se condiciona en gran medida durante la adolescencia, es una etapa clave para la promoción de estilos de vida saludables, tales como el incremento de la actividad física y la mejora de la condición física. El objetivo de este estudio ha sido conocer el nivel de práctica de actividad física habitual en adolescentes y analizar su influencia en la salud, especialmente cardiovascular. Así como, diseñar y llevar a cabo un programa de intervención de mejora de la condición física y del estilo de vida en esta misma población. Se evaluó, pre-intervención, nivel de práctica de actividad física y tiempo dedicado a actividades sedentarias, mediante cuestionario; y pre- y posintervención, presión arterial y frecuencia cardiaca en reposo, mediante tensiómetro digital; composición corporal, mediante antropometría (peso, talla, pliegues cutáneos y perímetros corporales y la condición física orientada a la salud, mediante ocho pruebas para medir diferentes capacidades (resistencia aeróbica, fuerza y resistencia muscular, flexibilidad y velocidad-agilidad. A partir de las anteriores, se calculó Índice de masa corporal, porcentaje de grasa, masa libre de grasa y capacidad aeróbica. Concluimos que el nivel de práctica de actividad física de los adolescentes residentes en el área metropolitana de Valencia es bajo, asociándose los chicos a un nivel de práctica muy superior al de las chicas (57,6 % de chicos y 14 % de chicas cumplen las recomendaciones al respecto; datos que son preocupantes por las repercusiones que puedan tener en la salud. El sexo tiene una alta influencia en los hábitos de práctica de actividad física, por lo que se debería tener muy en cuenta a la hora de diseñar y llevar a cabo programas de intervención. Los adolescentes que practican más actividad física tienen mayor probabilidad de presentar mejor salu-d cardiovascular y la prevalencia de adolescentes que posee una

  10. In-progress X-ray Flare Forecasting

    Science.gov (United States)

    Balasubramaniam, K. S.; Winter, L. M.

    2015-12-01

    Solar X-ray flares release intense amounts of radiation and can be associated with subsequent changes in the geomagnetic field as well as a large influx of solar energetic particles. From analyses of 50,000 flares detected with the NOAA GOES satellites over the past 40 years, Winter & Balasubramaniam (2015) introduced a flare phase diagram where X-ray observables indicating flare temperature and background solar activity levels can be used to separate flares of different peak flux. We present results from adapting this method into a real-time forecast tool. Real-time GOES X-ray observations are used to predict expected flare class, with updates made every 1-minute. KSB, in part by the Air Force Office of Scientific Research on "the Physics of Coupled Flares and CME Systems". LM was supported by AER, and in part by a contract supported by AFRL/RV

  11. Avaliação da porosidade e placa férrica de raízes de arroz cultivado em hipoxia Evaluation of porosity and iron plaque on rice roots grown under hypoxia

    OpenAIRE

    Marquel Jonas Holzschuh; Humberto Bohnen; Ibanor Anghinoni

    2010-01-01

    A alta difusividade do oxigênio em diversos materiais dificulta a criação e, ou, manutenção de um ambiente livre de O2. As técnicas utilizadas são pouco eficientes na exclusão do O2 e, portanto, não expressam a condição do solo alagado. Os objetivos deste trabalho foram desenvolver um método para obtenção de raízes em condição de hipoxia e avaliar a placa férrica e a formação de aerênquima no arroz. Foi criada uma condição de hipoxia semelhante à do solo alagado em tanques de 50 L, explorando...

  12. The transformation suppressor gene Reck is required for postaxial patterning in mouse forelimbs

    Directory of Open Access Journals (Sweden)

    Mako Yamamoto

    2012-03-01

    The membrane-anchored metalloproteinase-regulator RECK has been characterized as a tumor suppressor. Here we report that mice with reduced Reck-expression show limb abnormalities including right-dominant, forelimb-specific defects in postaxial skeletal elements. The forelimb buds of low-Reck mutants have an altered dorsal ectoderm with reduced Wnt7a and Igf2 expression, and hypotrophy in two signaling centers (i.e., ZPA and AER that are essential for limb outgrowth and patterning. Reck is abundantly expressed in the anterior mesenchyme in normal limb buds; mesenchyme-specific Reck inactivation recapitulates the low-Reck phenotype; and some teratogens downregulate Reck in mesenchymal cells. Our findings illustrate a role for Reck in the mesenchymal-epithelial interactions essential for mammalian development.

  13. RENDIMIENTO Y RECUPERACIÓN AGUDA EN CORREDORES DE RESISTENCIA

    Directory of Open Access Journals (Sweden)

    D. A. Boullosa

    2010-09-01

    Full Text Available

     

    RESUMEN

    Dieciséis corredores de fondo bien entrenados fueron evaluados en dos días diferentes mediante la prueba de carrera en pista de la Universidad de Montreal (UMTT y el tiempo límite a la velocidad aeróbica máxima (Tlim. Se examinó la respuesta de la frecuencia cardiaca y la lactatemia en la recuperación aguda (andando. La frecuencia cardiaca máxima fue diferente entre los dos días de valoración (p = 0,001, resultando superior en el UMTT respecto del Tlim. La recuperación de la frecuencia cardiaca en el primer minuto (RFC1 correlacionó con la velocidad aeróbica máxima (r = 0,611 y r = 0,615, p = 0,012; en el UMTT y el Tlim, respectivamente, correlacionando además los dos valores de RFC1 entre sí  (r = 0,824; p = 0,000. La diferencia en la lactatemia entre la finalización y el minuto diez de la recuperación fue estadísticamente significativa sólo después del UMTT (p = 0,013. Se concluye que: 1 fue hallada una relación moderada entre la recuperación cardiaca y la velocidad aeróbica máxima en corredores de resistencia; 2 la frecuencia cardiaca máxima obtenida en una prueba incremental en el campo es superior a la alcanzada en una prueba de tipo rectangular; 3 el descenso significativo de la lactatemia a los 10 min sólo se observó después del UMTT, lo que sugiere una influencia del protocolo de carrera en este parámetro.
    Palabras Clave: frecuencia cardiaca, lactato, recuperación, velocidad aeróbica máxima

     

    ABSTRACT

    Sixteen well-trained endurance runners were evaluated in two different days with the Université de Montréal Track Test (UMTT, and the time limit at maximum aerobic

  14. Caracterização microbiológica de lixiviados gerados por resíduos sólidos domiciliares e de serviços de saúde da cidade do Rio de Janeiro Microbiological characterization of leachate from domestic and hospital solid wastes from Rio de Janeiro city

    OpenAIRE

    Carlos Augusto Machado da Costa e Silva; Juacyara Carbonelli Campos; João Alberto Ferreira; Marco Antônio Lemos Miguel; Bianca Ramalho Quintaes

    2011-01-01

    O presente trabalho consistiu na caracterização microbiológica de lixiviados gerados a partir de resíduos sólidos de serviços de saúde e domiciliares para subsidiar a discussão do tratamento e disposição final diferenciados para os resíduos sólidos de serviços de saúde. Foram analisados: coliformes totais e termotolerantes; Escherichia coli, Enterococos, Salmonella e outras enterobactérias; Pseudomonas aeruginosa, bactérias heterotróficas aeróbias mesófilas, análise da suscetibilidade aos ant...

  15. Tratamento de águas residuárias de suinocultura em reatores anaeróbios de fluxo ascendente com manta de lodo (uasb) em dois estágios seguidos de reator operado em batelada sequencial (RBS) Swine wastewater treatment in upflow anaerobic sludge blanket reactor (uasb) in two-stages followed by sequencing batch reactor (SBR)

    OpenAIRE

    Roberto A. de Oliveira; Adriana M. de Santana

    2011-01-01

    Neste trabalho, avaliou-se o desempenho de dois reatores anaeróbios de fluxo ascendente com manta de lodo (UASB), em série, seguidos de um reator operado em batelada sequencial (RBS) com etapa aeróbia, no tratamento de águas residuárias de suinocultura. O sistema de tratamento anaeróbio em dois estágios foi alimentado com águas residuárias de suinocultura com concentrações médias de sólidos suspensos totais (SST), de 4.427 a 16.425 mg L-1 . As cargas orgânicas volumétricas (COV) aplicadas no ...

  16. Efecto del ejercicio físico basado en el juego en la leucemia linfocítica aguda

    OpenAIRE

    González García, Laura Ximena; Escobar Zabala, Paola Andrea

    2012-01-01

    Objetivo: Establecer el efecto de un programa de ejercicio físico (EF) basado en el juego sobre el Síndrome de Desacondicionamiento Físico (SDF) de niños con Leucemia Linfocítica Aguda (LLA) entre 5-12 años. Materiales y Métodos: Se realizó un estudio cuasi-experimental con la participación de siete niños tratados por LLA en el Instituto Nacional de Cancerología (INC). Se hizo una evaluación inicial de los determinantes de la condición física (capacidad aeróbica, fuerza muscular, flexibil...

  17. Evaluation of Fatigue Crack Growth and Fracture Properties of Cryogenic Model Materials

    Science.gov (United States)

    Newman, John A.; Forth, Scott C.; Everett, Richard A., Jr.; Newman, James C., Jr.; Kimmel, William M.

    2002-01-01

    The criteria used to prevent failure of wind-tunnel models and support hardware were revised as part of a project to enhance the capabilities of cryogenic wind tunnel testing at NASA Langley Research Center. Specifically, damage-tolerance fatigue life prediction methods are now required for critical components, and material selection criteria are more general and based on laboratory test data. The suitability of two candidate model alloys (AerMet 100 and C-250 steel) was investigated by obtaining the fatigue crack growth and fracture data required for a damage-tolerance fatigue life analysis. Finally, an example is presented to illustrate the newly implemented damage tolerance analyses required of wind-tunnel model system components.

  18. Study and optimization of the operation of an industrial WWTP

    OpenAIRE

    Azenha, Cátia Sofia Ribeiro

    2012-01-01

    O presente trabalho tem como objetivo a otimização do funcionamento de uma ETAR industrial, para tratamento de águas residuais resultantes da produção de biodiesel. A ETAR industrial em estudo engloba dois processos de tratamento: tratamento físico-químico através da utilização de uma unidade DAF e, tratamento biológico aeróbio por lamas ativadas. Ao longo deste estudo vários parâmetros físico-químicos foram analisados em particular sólidos totais, sólidos suspensos voláteis, carência quím...

  19. Comportamento da produção de espécies reativas de oxigênio em miocárdio de ratos submetidos a treinamento de baixa intensidade em diferentes temperaturas Behavior of oxygen reactive species production in myocardium of rats submitted to low intensity training under different temperatures

    OpenAIRE

    Jayme Netto Jr.; Domingo Marcolino Braile; Rúbens Cecchini; Antonio Carlos Cicogna; Flávia Alessandra Guarnier; Carlos Marcelo Pastre; Silvio Assis de Oliveira Jr.; Mário Sugisaki; Eliane Cristina Pastre

    2007-01-01

    INTRODUÇÃO: A prática de exercício físico proporciona aumento da produção de espécies reativas de oxigênio (ERO) resultantes do metabolismo aeróbio e, gera uma quantidade significativa de calor, em conseqüência da produção de energia, resultando em sobrecarga orgânica. A associação entre ERO e exercício, e entre exercício e variações da temperatura ambiente têm sido estudadas, contudo, há escassez de informações que considere a associação entre produção de radicais livres no miocárdio e ativi...

  20. Finite Element Modeling of the Inertia Friction Welding of Dissimilar High-Strength Steels

    Science.gov (United States)

    Bennett, C. J.; Attallah, M. M.; Preuss, M.; Shipway, P. H.; Hyde, T. H.; Bray, S.

    2013-11-01

    Finite element (FE) process modeling of inertia friction welding between dissimilar high-strength steels, AerMet® 100 and SCMV, has been carried out using the DEFORM™-2D (v10.0) software. This model was validated against experimental data collected for a test weld performed between the materials; this included process data such as upset and rotational velocities as well as thermal data collected during the process using embedded thermocouples. The as-welded hoop residual stress from the FE model was also compared with experimental measurements taken on the welded component using synchrotron X-ray and neutron diffraction techniques. The modeling work considered the solid-state phase transformations which occur in the steels, and the trends in the residual stress data were well replicated by the model.