WorldWideScience

Sample records for aere

  1. Adverse Event Reporting System (AERS)

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Adverse Event Reporting System (AERS) is a computerized information database designed to support the FDA's post-marketing safety surveillance program for all...

  2. Autopistas y aeródromos

    Directory of Open Access Journals (Sweden)

    Rodríguez, Georges

    1957-11-01

    Full Text Available Estado actual, realización y proyectos de algunas de las pistas de aeródromos y grandes vías de circulación en Francia. El autor se extiende, además, en algunas consideraciones de ejecución, características específicas y maquinaria auxiliar potente.

  3. Using AER to Improve Teacher Education

    Science.gov (United States)

    Ludwig, Randi R.

    2013-06-01

    In many ways, the astronomy education community is uniquely poised to influence pre-service and in-service teacher preparation. Astro101 courses are among those most commonly taken to satisfy general education requirements for non-science majors, including 9-25% education majors (Deming & Hufnagel, 2001; Rudolph et al. 2010). In addition, the astronomy community's numerous observatories and NASA centers engage in many efforts to satisfy demand for in-service teacher professional development (PD). These efforts represent a great laboratory in which we can apply conclusions from astronomy education research (AER) studies in particular and science education research (SER) in general. Foremost, we can work to align typical Astro101 and teacher PD content coverage to heavily hit topics in the Next Generation Science Standards (http://www.nextgenscience.org/) and utilize methods of teaching those topics that have been identified as successful in AER studies. Additionally, we can work to present teacher education using methodology that has been identified by the SER community as effective for lasting learning. In this presentation, I will highlight some of the big ideas from AER and SER that may be most useful in teacher education, many of which we implement at UT Austin in the Hands-on-Science program for pre-service teacher education and in-service teacher PD.

  4. AER synthetic generation in hardware for bio-inspired spiking systems

    Science.gov (United States)

    Linares-Barranco, Alejandro; Linares-Barranco, Bernabe; Jimenez-Moreno, Gabriel; Civit-Balcells, Anton

    2005-06-01

    Address Event Representation (AER) is an emergent neuromorphic interchip communication protocol that allows for real-time virtual massive connectivity between huge number neurons located on different chips. By exploiting high speed digital communication circuits (with nano-seconds timings), synaptic neural connections can be time multiplexed, while neural activity signals (with mili-seconds timings) are sampled at low frequencies. Also, neurons generate 'events' according to their activity levels. More active neurons generate more events per unit time, and access the interchip communication channel more frequently, while neurons with low activity consume less communication bandwidth. When building multi-chip muti-layered AER systems it is absolutely necessary to have a computer interface that allows (a) to read AER interchip traffic into the computer and visualize it on screen, and (b) convert conventional frame-based video stream in the computer into AER and inject it at some point of the AER structure. This is necessary for test and debugging of complex AER systems. This paper addresses the problem of converting, in a computer, a conventional frame-based video stream into the spike event based representation AER. There exist several proposed software methods for synthetic generation of AER for bio-inspired systems. This paper presents a hardware implementation for one method, which is based on Linear-Feedback-Shift-Register (LFSR) pseudo-random number generation. The sequence of events generated by this hardware, which follows a Poisson distribution like a biological neuron, has been reconstructed using two AER integrator cells. The error of reconstruction for a set of images that produces different traffic loads of event in the AER bus is used as evaluation criteria. A VHDL description of the method, that includes the Xilinx PCI Core, has been implemented and tested using a general purpose PCI-AER board. This PCI-AER board has been developed by authors, and uses

  5. Estudio de impacto ambiental de un aeródromo

    Directory of Open Access Journals (Sweden)

    Gómez Orea, Domingo

    1996-04-01

    Full Text Available Airports and aerodromes are transport infrastructures which, apart from contributing to the mobility of people and goods, favor social development, since they promote new activities, stimulate local initiatives and reassess bordering areas. This article presents a synthesis of the Environmental Impact Study of a future aerodrome, whose design project is way at present. The aerodrome is submitted to the EIA administrative procedure due to the currently applicable specific legislation: R.D. 1302/86. The technical document submitted for study is the special plan of the aerodrome. One of the basic criteria in the conception of airports and private airfields is the compatibility with the habitability of the environment as well as with the ecological and landscape conditions. This criteria should play a part in the orientation of the runways, trajectory of the taking off and landing maneuvers..., even in the location and design og the parking spaces, hangars and other facilities. This idea suggests the design be conceived with environmental-friendly sensibility, right from the initial stages, without leaving the responsibility of this issue to the environmental study impact. The present study has its own style of approaching the dissemination, consisting of the idea that the reader will find the methodological aspects more useful than the technical data which are of consequence only in the handling of the different project stages. The aspects which are also considered important for the reader are those which allowed the team of editors to form their criteria on the issues of expenses, environmental benefits of the design, its acceptability, etc. The methodology applied is a classical one, in accordance with the requirements of the EIA regulations.

    Los aeropuertos y aeródromos son infraestructuras de transporte que, además de contribuir a la movilidad de las personas y mercancías, fomentan el desarrollo porque promocionan nuevas

  6. Time-recovering PCI-AER interface for bio-inspired spiking systems

    Science.gov (United States)

    Paz-Vicente, R.; Linares-Barranco, A.; Cascado, D.; Vicente, S.; Jimenez, G.; Civit, A.

    2005-06-01

    Address Event Representation (AER) is an emergent neuromorphic interchip communication protocol that allows for real-time virtual massive connectivity between huge number neurons located on different chips. By exploiting high speed digital communication circuits (with nano-seconds timings), synaptic neural connections can be time multiplexed, while neural activity signals (with mili-seconds timings) are sampled at low frequencies. Also, neurons generate 'events' according to their activity levels. More active neurons generate more events per unit time, and access the interchip communication channel more frequently, while neurons with low activity consume less communication bandwidth. When building multi-chip muti-layered AER systems it is absolutely necessary to have a computer interface that allows (a) to read AER interchip traffic into the computer and visualize it on screen, and (b) inject a sequence of events at some point of the AER structure. This is necessary for testing and debugging complex AER systems. This paper presents a PCI to AER interface, that dispatches a sequence of events received from the PCI bus with embedded timing information to establish when each event will be delivered. A set of specialized states machines has been introduced to recovery the possible time delays introduced by the asynchronous AER bus. On the input channel, the interface capture events assigning a timestamp and delivers them through the PCI bus to MATLAB applications. It has been implemented in real time hardware using VHDL and it has been tested in a PCI-AER board, developed by authors, that includes a Spartan II 200 FPGA. The demonstration hardware is currently capable to send and receive events at a peak rate of 8,3 Mev/sec, and a typical rate of 1 Mev/sec.

  7. Fusion Welding of AerMet 100 Alloy

    Energy Technology Data Exchange (ETDEWEB)

    ENGLEHART, DAVID A.; MICHAEL, JOSEPH R.; NOVOTNY, PAUL M.; ROBINO, CHARLES V.

    1999-08-01

    A database of mechanical properties for weldment fusion and heat-affected zones was established for AerMet{reg_sign}100 alloy, and a study of the welding metallurgy of the alloy was conducted. The properties database was developed for a matrix of weld processes (electron beam and gas-tungsten arc) welding parameters (heat inputs) and post-weld heat treatment (PWHT) conditions. In order to insure commercial utility and acceptance, the matrix was commensurate with commercial welding technology and practice. Second, the mechanical properties were correlated with fundamental understanding of microstructure and microstructural evolution in this alloy. Finally, assessments of optimal weld process/PWHT combinations for cotildent application of the alloy in probable service conditions were made. The database of weldment mechanical properties demonstrated that a wide range of properties can be obtained in welds in this alloy. In addition, it was demonstrated that acceptable welds, some with near base metal properties, could be produced from several different initial heat treatments. This capability provides a means for defining process parameters and PWHT's to achieve appropriate properties for different applications, and provides useful flexibility in design and manufacturing. The database also indicated that an important region in welds is the softened region which develops in the heat-affected zone (HAZ) and analysis within the welding metallurgy studies indicated that the development of this region is governed by a complex interaction of precipitate overaging and austenite formation. Models and experimental data were therefore developed to describe overaging and austenite formation during thermal cycling. These models and experimental data can be applied to essentially any thermal cycle, and provide a basis for predicting the evolution of microstructure and properties during thermal processing.

  8. Microbiota aeróbia conjuntival nas conjuntivites adenovirais

    Directory of Open Access Journals (Sweden)

    Nakano Eliane Mayumi

    2002-01-01

    Full Text Available Objetivos: Estudar a microbiota aeróbica conjuntival em pacientes com quadro clínico de conjuntivite viral aguda. Método: Trinta pacientes entre 18 e 40 anos portadores de conjuntivite adenoviral e 30 pacientes sem a doença foram submetidos à colheita de material da conjuntiva para cultura. Os portadores de conjuntivite adenoviral foram submetidos ao exame até 3 dias após o início dos sintomas. As culturas foram realizadas utilizando-se os meios de ágar-sangue e ágar-chocolate. Pacientes em uso de medicação tópica ou sistêmica, usuários de lentes de contato e aqueles com doença ocular prévia ou doença sistêmica foram excluídos. Resultados: Houve positividade significantemente maior das culturas de conjuntiva nos pacientes com conjuntivite adenoviral (33,3%, sendo Haemophylus influenzae em 50% e Streptococcus pneumoniae em 50% quando comparados ao grupo controle (6,6% - Staphylococcus coagulase negativo. O grupo de pacientes com conjuntivite e que apresentaram culturas positivas, não diferiu em nenhum dos critérios clínicos analisados do grupo com culturas negativas. Conclusão: Pacientes com conjuntivite adenoviral apresentaram maior freqüência de exames de cultura de amostra de conjuntiva positivas quando comparados aos controles normais. Os pacientes com conjuntivite adenoviral com cultura positiva apresentaram evolução clínica semelhante aos pacientes com cultura negativa. Os agentes isolados na microbiota conjuntival no grupo com conjuntivite foram diferentes do observado no grupo normal. Porém o resultado das culturas não apresentou correlação com a evolução clínica.

  9. dackel acts in the ectoderm of the zebrafish pectoral fin bud to maintain AER signaling.

    Science.gov (United States)

    Grandel, H; Draper, B W; Schulte-Merker, S

    2000-10-01

    Classical embryological studies have implied the existence of an apical ectodermal maintenance factor (AEMF) that sustains signaling from the apical ectodermal ridge (AER) during vertebrate limb development. Recent evidence suggests that AEMF activity is composed of different signals involving both a sonic hedgehog (Shh) signal and a fibroblast growth factor 10 (Fgf10) signal from the mesenchyme. In this study we show that the product of the dackel (dak) gene is one of the components that acts in the epidermis of the zebrafish pectoral fin bud to maintain signaling from the apical fold, which is homologous to the AER of tetrapods. dak acts synergistically with Shh to induce fgf4 and fgf8 expression but independently of Shh in promoting apical fold morphogenesis. The failure of dak mutant fin buds to progress from the initial fin induction phase to the autonomous outgrowth phase causes loss of both AER and Shh activity, and subsequently results in a proximodistal truncation of the fin, similar to the result obtained by ridge ablation experiments in the chicken. Further analysis of the dak mutant phenotype indicates that the activity of the transcription factor engrailed 1 (En1) in the ventral non-ridge ectoderm also depends on a maintenance signal probably provided by the ridge. This result uncovers a new interaction between the AER and the dorsoventral organizer in the zebrafish pectoral fin bud.

  10. A massa gorda de risco afeta a capacidade aeróbia de jovens adolescentes

    Directory of Open Access Journals (Sweden)

    Luís Massuça

    2013-12-01

    Full Text Available OBJETIVO: Estudar o comportamento do sexo e os efeitos da idade e da massa gorda sobre a capacidade aeróbia de jovens adolescentes. MÉTODOS: Os 621 estudantes do ensino secundário participantes no estudo (14 aos 17 anos; feminino: n = 329, idade, 15,84 ± 0,92 anos; masculino: n = 292, idade, 15,82 ± 0,87 anos foram avaliados em duas categorias: morfologia (altura, peso e % massa gorda - %MG e aptidão física (capacidade aeróbia. As medições antropométricas foram realizadas de acordo com o protocolo descrito por Marfell-Jones e a %MG foi calculada por bioimpedância. A avaliação da capacidade aeróbia foi realizada com o teste aeróbio de corrida - PACER, e VO2máx relativo foi calculado utilizando a equação de Léger. Os resultados das avaliações foram classificados de acordo com os valores normativos das tabelas de referência da bateria de testes FITNESSGRAM® As técnicas estatísticas utilizadas foram: 1 cálculo de frequências; 2 teste t de Student para amostras independentes; e 3 ANOVA two-way seguida do teste post-hoc HSD de Bonferroni. RESULTADOS: 1 existem diferenças significativas entre sexos no que se refere à %MG e ao VO2máx; 2 durante a adolescência, o VO2máx estabiliza nos rapazes e sofre um declínio nas moças; 3 independentemente do sexo, a classe de %MG e a idade cronológica têm um efeito significativo sobre a capacidade aeróbia; e 4 em jovens adolescentes, com %MG de risco, a redução da %MG para níveis saudáveis parece resultar na melhoria da capacidade aeróbia. CONCLUSÃO: O impacto da %MG na capacidade aeróbia, reforça a importância da educação física escolar na promoção da saúde cardiovascular.

  11. Lesiones deportivas en gimnasia aeróbica de competición

    OpenAIRE

    Zabala, Paula

    2014-01-01

    Los estudios referidos a lesiones deportivas ayudan a diseñar programas de prevención sobre las mismas. Se realizó una investigación descriptiva transversal sobre lesiones asociadas a la gimnasia aeróbica de competición. Objetivo: Identificar cuáles son las características del entrenamiento y su relación con la aparición de lesiones deportivas en gimnastas de nivel elite e integrantes de la selección argentina 2014 de gimnasia aeróbica de competición. Establecer tipología y áreas más afect...

  12. Articulated Entity Relationship (AER Diagram for Complete Automation of Relational Database Normalization

    Directory of Open Access Journals (Sweden)

    P. S. Dhabe

    2010-05-01

    Full Text Available In this paper an Articulated Entity Relationship (AER diagram is proposed, which is an extension of EntityRelationship (ER diagram to accommodate the Functional Dependency (FD information as its integral partfor complete automation of normalization. In current relational databases (RDBMS automation ofnormalization by top down approach is possible using ER diagram as an input, provided the FD informationis available independently, meanwhile, through user interaction. Such automation we call partial andconditional automation. To avoid this user interaction, there is a strong need to accommodate FDinformation as an element of ER diagram itself. Moreover, ER diagrams are not designed by taking intoaccount the requirements of normalization. However, for better automation of normalization it must be anintegral part of conceptual design (ER Diagram. The prime motivation behind this paper to design a systemthat need only proposed AER diagram as a sole input and normalize the database up to a given normal formin one go. This would allow more amount of automation than the current approach. Such automation we callas total and unconditional automation, which is better and complete in true sense. As the proposed AERdiagram is designed by taking in to account the normalization process, normalization up to Boyce CoddNormal Form (BCNF becomes an integral part of conceptual design. Additional advantage of AER diagramis that any modifications (addition, deletion or updation of attributes made to the AER diagram willautomatically be reflected in its FD information. Thus description of schema and FD information isguaranteed to be consistent. This cannot be assured in current approach using ER diagrams, as schema andFD information are provided to the system at two different times, separately.

  13. U.S. AMCOMs Activities for TTCP AER/WPN High Speed Strike Action Group 27

    Science.gov (United States)

    2016-11-01

    Suite 1204, Arlington, VA 22202-4302, and to the Office of Management and Budget, Paperwork Reduction Project (0704-0188), Washington, DC 20503 1...Engineering Center (AMRDEC) Aerodynamic Technology Branch is collaborating with The Technical Cooperation Program (TTCP) Aerospace Systems Group (AER...Conventional Weapons Technology Group (WPN) Technical Panel (TP) 5 to develop a high speed, airbreathing strike cruise missile. This effort is

  14. El entrenamiento aeróbico mejora las mediciones ergométricas en enfermos cardiovasculares

    OpenAIRE

    Flores, C; P. Sanz; D. Ansorena

    2010-01-01

    OBJETIVO: estudiar la evolución en el estado de salud cardiovascular de pacientes cardiópatas y/o con factores de riesgo cardiovascular sometidos a un programa supervisado de actividad física aeróbica. MÉTODOS: se seleccionó un total de 56 voluntarios varones de edades entre los 38 y 73 años, con algún tipo de factor de riesgo cardiovascular. Los sujetos fueron clasificados en 4 grupos de acuerdo a sus características: grupo control (personas sin especial patología cardíaca, pero ...

  15. Sistema de Controlo Remoto de Luzes de Aeródromo

    OpenAIRE

    2015-01-01

    Este relatório apresenta o trabalho realizado no âmbito da unidade curricular de Dissertação do Mestrado em Engenharia Electrotécnica e de Computadores – área de especialização de Automação e Sistemas. O trabalho realizado consiste no desenvolvimento de um Sistema de Controlo Remoto de Luzes de Aeródromo (SCRLA) que pode ser aplicado em paralelo aos comandos locais de controlo das luzes de aproximação, pista ou circulação, entre outras, de uma infra-estrutura aeroportuária. O objectivo ...

  16. AerChemMIP: Quantifying the effects of chemistry and aerosols in CMIP6

    Energy Technology Data Exchange (ETDEWEB)

    Collins, W.; Lamarque, Jean-Francois; Schulz, M.; Boucher, Olivier; Eyring, Veronika; Hegglin, Michaela I.; Maycock, Amanda; Myhre, G.; Prather, M.; Shindell, D. T.; Smith, Steven J.

    2017-02-09

    The Aerosol Chemistry Model Intercomparison Project (AerChemMIP) is endorsed by the Coupled-Model Intercomparison Project 6 (CMIP6) and is designed to quantify the climate and air quality impacts of aerosols and chemically-reactive gases. These are specifically near-term climate forcers (NTCFs: tropospheric ozone and aerosols, and their precursors), methane, nitrous oxide and ozone-depleting halocarbons. The aim of AerChemMIP is to answer four scientific questions: 1. How have anthropogenic emissions contributed to global radiative forcing and affected regional climate over th e historical period? 2. How will future policies (on climate, air quality and land use) affect these species and their climate impacts? 3. Can the uncertainties associated with anthropogenic emissions be quantified? 4. Can climate feedbacks occurring through changes in natural emissions be quantified? These questions will be addressed through targeted simulations with CMIP6 climate models that include an interactive representation of tropospheric aerosols and atmospheric chemistry. These simulations build on the CMIP6 Diagnostic, Evaluation and Characterization of Klima (DECK) experiments, the CMIP6 historical simulations, and future projections performed elsewhere in CMIP6, allowing the contributions from aerosols and chemistry to be quantified. Specific diagnostics are requested as part of the CMIP6 data request to evaluate the performance of the models, and to understand any differences in behaviour between them.

  17. AerChemMIP: quantifying the effects of chemistry and aerosols in CMIP6

    Science.gov (United States)

    Collins, William J.; Lamarque, Jean-François; Schulz, Michael; Boucher, Olivier; Eyring, Veronika; Hegglin, Michaela I.; Maycock, Amanda; Myhre, Gunnar; Prather, Michael; Shindell, Drew; Smith, Steven J.

    2017-02-01

    The Aerosol Chemistry Model Intercomparison Project (AerChemMIP) is endorsed by the Coupled-Model Intercomparison Project 6 (CMIP6) and is designed to quantify the climate and air quality impacts of aerosols and chemically reactive gases. These are specifically near-term climate forcers (NTCFs: methane, tropospheric ozone and aerosols, and their precursors), nitrous oxide and ozone-depleting halocarbons. The aim of AerChemMIP is to answer four scientific questions. 1. How have anthropogenic emissions contributed to global radiative forcing and affected regional climate over the historical period? 2. How might future policies (on climate, air quality and land use) affect the abundances of NTCFs and their climate impacts? 3.How do uncertainties in historical NTCF emissions affect radiative forcing estimates? 4. How important are climate feedbacks to natural NTCF emissions, atmospheric composition, and radiative effects? These questions will be addressed through targeted simulations with CMIP6 climate models that include an interactive representation of tropospheric aerosols and atmospheric chemistry. These simulations build on the CMIP6 Diagnostic, Evaluation and Characterization of Klima (DECK) experiments, the CMIP6 historical simulations, and future projections performed elsewhere in CMIP6, allowing the contributions from aerosols and/or chemistry to be quantified. Specific diagnostics are requested as part of the CMIP6 data request to highlight the chemical composition of the atmosphere, to evaluate the performance of the models, and to understand differences in behaviour between them.

  18. Amide-Exchange-Rate-Edited NMR (AERE-NMR) Experiment:A Novel Method for Resolving Overlapping Resonances

    Institute of Scientific and Technical Information of China (English)

    LIU Xue-Hui; LIN Dong-Hai

    2007-01-01

    This paper describes an amide-exchange-rate-edited (AERE) NMR method that can effectively alleviate the problem of resonance overlap for proteins and peptides. This method exploits the diversity of amide proton exchange rates and consists of two complementary experiments: (1) SEA (solvent exposed amide)-type NMR experiments to map exchangeable surface residues whose amides are not involved in hydrogen bonding, and (2) presat-type NMR experiments to map solvent inaccessibly buried residues or nonexchangeable residues located in hydrogen-bonded secondary structures with properly controlled saturation transfer via amide proton exchanges with the solvent. This method separates overlapping resonances in a spectrum into two complementary spectra. The AERE-NMR method was demonstrated with a sample of 15N/13C/2H(70%) labeled ribosome-inactivating protein trichosanthin of 247 residues.

  19. Iniciación educativa a la resistencia aeróbica. (III Canto en carrera: funciones y asignaciones

    Directory of Open Access Journals (Sweden)

    Antonio D. Galera

    2014-03-01

    Full Text Available El autor presenta un conjunto de factores didácticos sistemáticos para la iniciación educativa a la resistencia aeróbica, centrándose en métodos aplicables a la realidad escolar desde una perspectiva sostenible. La doctrina en que se sustenta fue desarrollada por el autor como resultado de su experiencia con un grupo de niños y niñas que participaron en un programa escolar de educación física cooperativa, uno de cuyos contenidos maestros era el desarrollo de la resistencia aeróbica. Los criterios de aplicación didáctica están contemplados desde el ámbito escolar, de primaria o de secundaria, si bien pueden adaptarse a otros ámbitos, como el entrenamiento a cualquier edad, actividades de tiempo libre, etc. El autor concluye su exposición doctrinal y presenta repertorios de cantos escolares aplicables a su propuesta de interrelación disciplinar entre educación física y educación musical para la iniciación educativa a la resistencia aeróbica desde una perspectiva sostenible.

  20. Stressed Heat Affected Zone Simulations of AerMet 100 Alloy

    Energy Technology Data Exchange (ETDEWEB)

    Puskar, Joseph D.; Smith, Mark F.

    1999-08-03

    AerMet 100 is a high strength, high fracture toughness alloy designed for use in aerospace applications. In previous work the welding behavior of this alloy has been evaluated, and it has been shown that a softened region in the heat-affected zone (HAZ) is a principal feature of the weld zone. A model for this softening, based on classical theories of precipitate coarsening and isothermal softening data, was developed and found to provide a reasonable description for weld thermal cycle simulation (Gleeble) experiments. Recent work has shown, however, that softening in real welds is not always well predicted by this model, so that additional effects, which are not captured in conventional Gleeble thermal cycle simulations must be addressed. In particular, the stresses associated with real weld HAZ's may modify the softening kinetics. In the current work, Gleeble simulations in both stress-free and stressed conditions have been conducted and the kinetics compared. The accuracy of the thermal model predictions have also been considered regarding their impact on estimated hardness values.

  1. The Vitamin B12-Dependent Photoreceptor AerR Relieves Photosystem Gene Repression by Extending the Interaction of CrtJ with Photosystem Promoters

    Science.gov (United States)

    Fang, Mingxu

    2017-01-01

    ABSTRACT Purple nonsulfur bacteria adapt their physiology to a wide variety of environmental conditions often through the control of transcription. One of the main transcription factors involved in controlling expression of the Rhodobacter capsulatus photosystem is CrtJ, which functions as an aerobic repressor of photosystem genes. Recently, we reported that a vitamin B12 binding antirepressor of CrtJ called AerR is required for anaerobic expression of the photosystem. However, the mechanism whereby AerR regulates CrtJ activity is unclear. In this study, we used a combination of next-generation sequencing and biochemical methods to globally identify genes under control of CrtJ and the role of AerR in controlling this regulation. Our results indicate that CrtJ has a much larger regulon than previously known, with a surprising regulatory function under both aerobic and anaerobic photosynthetic growth conditions. A combination of in vivo chromatin immunoprecipitation-DNA sequencing (ChIP-seq) and ChIP-seq and exonuclease digestion (ChIP-exo) studies and in vitro biochemical studies demonstrate that AerR forms a 1:2 complex with CrtJ (AerR-CrtJ2) and that this complex binds to many promoters under photosynthetic conditions. The results of in vitro and in vivo DNA binding studies indicate that AerR-CrtJ2 anaerobically forms an extended interaction with the bacteriochlorophyll bchC promoter to relieve repression by CrtJ. This is contrasted by aerobic growth conditions where CrtJ alone functions as an aerobic repressor of bchC expression. These results indicate that the DNA binding activity of CrtJ is modified by interacting with AerR in a redox-regulated manner and that this interaction alters CrtJ’s function. PMID:28325764

  2. Effects of tempering process on properties and microstructure of AerMet340 steel%回火工艺对 AerMet340钢性能和微观组织的影响

    Institute of Scientific and Technical Information of China (English)

    黄顺喆; 厉勇; 王春旭; 刘宪民; 田志凌

    2015-01-01

    The effects of tempering temperature and time on the mechanical properties and microstructure of a secondary hardening ultra-high strength steel AerMet340 were investigated by means of mechanical test, SEM, TEM and XRD respectively.The results show that the tempering curve of AerMet340 steel presents secondary hardening phenomenon obviously, and the tempering process to obtain the best properties is tempered at 482 ℃ for 5 h and then air cooled.The peak values of tensile strength and yield strength are 2460 MPa and 2061 MPa, corresponding to the peak temperature respectively of 450 ℃ and 468 ℃.When tempered at lower temperatures, AerMet340 steel is mainly composed of tempered martensite andε-carbides.When tempered above 468 ℃, the wee acicular M2 C carbides precipitate with distributing of dispersion in matrix, which is one of the main reasons for the high strength of the steel.Moreover, with tempering temperature rising, the contents of Fe, Cr and Mo, as the main components of M2 C carbides, increase significantly, which makes the lattice constant of M2 C change and the precipitates are divorced from a coherent relationship with the matrix gradually.%采用力学性能测试、SEM、TEM、XRD等试验方法研究了回火温度和时间对二次硬化型超高强度钢AerMet340的力学性能及微观组织的影响。结果表明,AerMet340钢的回火曲线呈现明显的二次硬化现象,获得最佳综合性能的回火工艺为482℃×5 h空冷;抗拉强度、规定塑性延伸强度峰值分别为2460 MPa、2061 MPa,对应的回火温度分别为450、468℃;在低温回火时,AerMet340钢主要由回火马氏体和ε-碳化物组成,高于468℃回火时,基体中弥散分布着细小针状M2 C碳化物,这是该钢获得高强韧性的主要原因之一;随着回火温度的上升,合金碳化物M2 C的主要合金成分Fe、Cr、Mo含量明显升高,使得M2 C的晶格常数发生变化,并逐渐脱离了与基体的共格关系。

  3. Influência da aptidão aeróbia no running anaerobic sprint test (RAST

    Directory of Open Access Journals (Sweden)

    Vitor Luiz de Andrade

    2013-09-01

    Full Text Available O objetivo do estudo foi verificar a possível influência de diferentes níveis de aptidão aeróbia (VO2MAX sobre os parâmetros do running anaerobic sprint test (RAST. Para isso, 38 indivíduos (Idade = 18,1±2,5 anos, Estatura = 173±1 cm e Massa corporal = 65,1±6,5 kg foram classificados em dois grupos, baixa e elevada aptidão aeróbias (GBA: n=22 e GEA: n=16. O VO2MAX foi determinado por um esforço incremental em esteira rolante até a exaustão voluntária. O RAST foi composto de seis esforços máximos de 35m separados por 10s de intervalo passivo. O VO2MAX foi significativamente diferente entre os grupos (GBA = 51,7±1,9 mL.kg-1.min-1; GEA = 58,6±3,1 mL.kg-1.min-1. A potência média (PM foi significativamente superior no grupo GBA (552,7±132,1 W em relação ao grupo GEA (463,6±132,8 W. O impulso (ImP foi significativamente correlacionado com o VO2MAX no GEA. Pode-se concluir que há um indicativo que o metabolismo aeróbio exerce uma influência na realização do RAST.

  4. Treinamento aeróbico melhora a capacidade funcional de pacientes em hemodiálise crônica

    OpenAIRE

    Henrique,Diane Michela Nery; Reboredo, Maycon de Moura; Chaoubah, Alfredo; Paula,Rogério Baumgratz de

    2010-01-01

    FUNDAMENTO: Na população geral, a prática regular de exercícios físicos se associa à melhora da capacidade funcional e à redução de eventos cardiovasculares. Já em portadores de doença renal crônica, uma população com significativo comprometimento da capacidade funcional e elevadas taxas de mortalidade cardiovascular, poucos estudos avaliam os efeitos da atividade física. OBJETIVO: Avaliar o efeito do treinamento aeróbico durante as sessões de hemodiálise, sobre a capacidade funcional e a pre...

  5. Avaliação da biodegradabilidade aeróbia de efluentes vinícolas

    OpenAIRE

    Almeida, Elsa Raquel Lages

    2008-01-01

    O presente trabalho pretendeu analisar a biodegradabilidade aeróbia de efluentes vinícolas e a aplicação prática do reactor do tipo Sequencing Batch Reactor (SBR) no tratamento desses efluentes. Os ensaios de biodegradabilidade realizados ao efluente permitiram avaliar a capacidade de degradação da matéria orgânica existente na sua composição. Os testes realizados demonstraram que, para todas as condições aplicadas, foram obtidas taxas de remoção de CQO acima dos 90%, após a...

  6. Ioga versus atividade aeróbia: efeitos sobre provas espirométricas e pressão inspiratória máxima

    OpenAIRE

    Godoy,Dagoberto Vanoni de; Bringhenti,Raquel Longhi; Severa,Andréa; Gasperi,Ricardo de; Poli,Leonardo Vieira

    2006-01-01

    OBJETIVO: Esclarecer se, em indivíduos saudáveis, a prática de ioga pode modificar a pressão inspiratória máxima e os índices espirométricos quando comparada com a prática de ginástica aeróbia. MÉTODOS: Ensaio clínico controlado. Foram alocados consecutivamente 31 voluntários hígidos, formando-se dois grupos: um que praticou ginástica aeróbia (n = 15) e outro que praticou ioga (n = 16). Os indivíduos do primeiro grupo serviram como controles e praticaram ginástica aeróbia em duas sessões sema...

  7. Microbiota mesófila aeróbia contaminante do leite UHT

    Directory of Open Access Journals (Sweden)

    Juliana Ramos Pereira

    2013-10-01

    Full Text Available A produção nacional de leite tratado por ultra-alta temperatura (UHT em 2011 foi de 5,81 bilhões de litros, representando assim 78% do leite fluido consumido no Brasil. O presente trabalho teve como objetivo estudar a contaminação por aeróbios mesófilos (AM em leite UHT, verificando o atendimento a padrões microbiológicos legais, classificando os grupos encontrados segundo suas características morfo-tintoriais e discutindo a metodologia de enumeração determinada pela Instrução Normativa 62 do Ministério da Agricultura, Pecuária e Abastecimento (MAPA. Das 60 amostras estudadas, 23 (38,3% apresentaram resultados acima do padrão de 100 UFC/mL estabelecido pela IN 370 do MAPA para micro-organismos AM. Quando o Bacillus sporothermodurans foi considerado, as contagens máximas aumentaram 71,2% nas amostras integrais e 31,0% nas amostras desnatadas. Considerando-se as maiores diluições semeadas em que se obteve crescimento, foi possível o isolamento de 462 colônias de AM que, na coloração de Gram representaram 64,3% de bactérias Gram positivas e 9,5%, de bactérias Gram negativas. Fungos filamentosos e leveduras somaram 26,2%. Entre os Gram positivos predominaram cocos, B. sporothermodurans e, outros bacilos. Entre os Gram negativos predominaram os cocobacilos e os bacilos. Como as amostras representam lotes de leite UHT de importantes marcas do sul do país, os resultados demonstram que 11 das 15 marcas estudadas apresentaram excesso de AM, quando comparadas com o parâmetro legal. Os grupos de microrganismos presentes, sobretudo os Gram negativos que são sensíveis à temperatura, indicam possíveis falhas no processamento e/ou contaminação pós-processamento.

  8. Efeitos do treinamento físico aeróbio sobre o sistema renina angiotensina cardíaco e sistêmico de ratos obesos

    OpenAIRE

    Diego Lopes Mendes Barretti

    2010-01-01

    Introdução: A obesidade bem como um aumento da ativação do sistema renina angiotensina cardíaco estão profundamente envolvidos com o desenvolvimento de doenças cardiovasculares. Por outro lado, o treinamento físico aeróbio, previne o desenvolvimento da obesidade e reduz o sistema renina angiotensina cardíaco em algumas patologias. Dessa forma, nosso objetivo foi de investigar se a obesidade e sua associação com o treinamento físico aeróbio alteram os componentes do sistema renina angiotensina...

  9. Uncertainties in modelling Mt. Pinatubo eruption with 2-D AER model and CCM SOCOL

    Science.gov (United States)

    Kenzelmann, P.; Weisenstein, D.; Peter, T.; Luo, B. P.; Rozanov, E.; Fueglistaler, S.; Thomason, L. W.

    2009-04-01

    Large volcanic eruptions may introduce a strong forcing on climate. They challenge the skills of climate models. In addition to the short time attenuation of solar light by ashes the formation of stratospheric sulphate aerosols, due to volcanic sulphur dioxide injection into the lower stratosphere, may lead to a significant enhancement of the global albedo. The sulphate aerosols have a residence time of about 2 years. As a consequence of the enhanced sulphate aerosol concentration both the stratospheric chemistry and dynamics are strongly affected. Due to absorption of longwave and near infrared radiation the temperature in the lower stratosphere increases. So far chemistry climate models overestimate this warming [Eyring et al. 2006]. We present an extensive validation of extinction measurements and model runs of the eruption of Mt. Pinatubo in 1991. Even if Mt. Pinatubo eruption has been the best quantified volcanic eruption of this magnitude, the measurements show considerable uncertainties. For instance the total amount of sulphur emitted to the stratosphere ranges from 5-12 Mt sulphur [e.g. Guo et al. 2004, McCormick, 1992]. The largest uncertainties are in the specification of the main aerosol cloud. SAGE II, for instance, could not measure the peak of the aerosol extinction for about 1.5 years, because optical termination was reached. The gap-filling of the SAGE II [Thomason and Peter, 2006] using lidar measurements underestimates the total extinctions in the tropics for the first half year after the eruption by 30% compared to AVHRR [Rusell et. al 1992]. The same applies to the optical dataset described by Stenchikov et al. [1998]. We compare these extinction data derived from measurements with extinctions derived from AER 2D aerosol model calculations [Weisenstein et al., 2007]. Full microphysical calculations with injections of 14, 17, 20 and 26 Mt SO2 in the lower stratosphere were performed. The optical aerosol properties derived from SAGE II

  10. 77 FR 13592 - AER NY-Gen, LLC; Eagle Creek Hydro Power, LLC, Eagle Creek Water Resources, LLC, Eagle Creek Land...

    Science.gov (United States)

    2012-03-07

    ... Energy Regulatory Commission AER NY-Gen, LLC; Eagle Creek Hydro Power, LLC, Eagle Creek Water Resources... Power, LLC, Eagle Creek Water Resources, LLC, and Eagle Creek Land Resources, LLC (transferees) filed an...) 805-1469. Transferees: Mr. Bernard H. Cherry, Eagle Creek Hydro Power, LLC, Eagle Creek...

  11. 75 FR 27332 - AER NY-Gen, LLC; Eagle Creek Hydro Power, LLC; Eagle Creek Water Resources, LLC; Eagle Creek Land...

    Science.gov (United States)

    2010-05-14

    ... Energy Regulatory Commission AER NY-Gen, LLC; Eagle Creek Hydro Power, LLC; Eagle Creek Water Resources... Creek Hydro Power, LLC, Eagle Creek Water Resources, LLC, and Eagle Creek Land Resources, LLC.... For the transferee: Mr. Paul Ho, Eagle Creek Hydro Power, LLC, Eagle Creek Water Resources, LLC,...

  12. Niveles de intensidad de la música durante un torneo de resistencia aeróbica en Costa Rica Music intensity levels during an aerobics endurance tournament in Costa Rica

    OpenAIRE

    Yamileth Chacón Araya; José Moncada Jiménez

    2008-01-01

    El propósito del presente artículo es describir los niveles de ruido generados en una competencia de resistencia aeróbica y se analizan las posibles implicaciones para la salud de la contaminación por ruido. La danza aeróbica es un modo de ejercicio que se ha extendido por todo el mundo, con el fin de posibilitar la práctica de una actividad física que combina música y movimiento. Al incluir el elemento musical en las clases de danza aeróbica, se expone a las personas que practican esta modal...

  13. Treinamento aeróbio não altera pressão arterial de mulheres menopausadas e com síndrome metabólica

    Directory of Open Access Journals (Sweden)

    Aluísio Henrique Rodrigues de Andrade Lima

    2012-11-01

    Full Text Available FUNDAMENTO: A Hipertensão arterial (HA é uma condição tanto agravante quanto agravada pela Síndrome Metabólica (SM. A menopausa pode tornar o tratamento da hipertensão mais difícil porque é uma condição que favorece a piora nos componentes da SM. Embora existam evidências de que o treinamento com exercícios físicos reduza a pressão arterial, se as condições da menopausa e da SM afetam os benefícios induzidos pelo exercício é algo ainda não evidenciado. OBJETIVO: Comparar os efeitos do treinamento aeróbio na pressão arterial entre mulheres com SM não menopausadas e menopausadas. MÉTODOS: Foram recrutadas 44 mulheres divididas em quatro grupos experimentais: controle não menopausada (CNM: 39,5 ± 1,1 anos, n = 11; controle menopausada (CM: 54,9 ± 1,7 anos, n = 12; aeróbio não menopausada (ANM: 43,1 ± 2,1 anos, n = 11 e aeróbio menopausada (AM: 52,1 ± 1,6 anos, n = 10. Os grupos de exercício realizaram treinamento aeróbio durante três meses, cinco vezes por semana, com intensidade entre 60% e 70% da frequência cardíaca de reserva. A pressão arterial de repouso e a resposta pressórica clínica após 60 minutos de exercício foram medidas antes e após o período treinamento. O teste de ANOVA de dois fatores foi usado, considerando p 0,05. CONCLUSÃO: Três meses de treinamento aeróbio melhora componentes da SM, mas não altera a pressão arterial de repouso, nem a resposta pressórica aguda após uma sessão de exercício aeróbio em mulheres com SM.

  14. A pessoa idosa, sua família e a hipertensão arterial: cuidados num Programa de Treinamento Físico Aeróbio

    Directory of Open Access Journals (Sweden)

    Camila Fabiana Rossi Squarcini

    2011-08-01

    Full Text Available Estudo objetivou avaliar a pressão arterial e a dimensão morfológica de pessoas idosas, antes e após um programa de exercício físico aeróbio, junto com familiar cuidador. Os resultados demonstraram que a prática do exercício aeróbio regular junto com a família diminuiu a pressão arterial das pessoas idosas hipertensas. A família se mostrou co-participante das atividades físicas, e não apenas “cobrou a participação” dos idosos, sendo esta uma estratégia cuidativa em nível primário para o sistema de saúde.

  15. Influência do exercício aeróbio na renina de portadores de hipertensão arterial com sobrepeso

    OpenAIRE

    Martinelli, Bruno; Barrile,Silvia Regina; Arca, Eduardo Aguilar; Franco, Roberto Jorge da Silva; Martin, Luis Cuadrado [UNESP

    2010-01-01

    FUNDAMENTO: A atividade do sistema renina-angiotensina-aldosterona tem relação direta com sobrepeso e sedentarismo, e essas variáveis se associam à hipertensão arterial (HA). O exercício aeróbio propicia melhor controle da pressão arterial (PA) por agir nos mecanismos da regulação pressórica, dentre eles, a atividade de renina plasmática (ARP). OBJETIVO: Avaliar a influência do exercício aeróbio sobre ARP em portadores de HA com sobrepeso. MÉTODOS: Foram avaliados níveis pressóricos, bioquími...

  16. Influência do treinamento aeróbio e anaeróbio na massa de gordura corporal de adolescentes obesos

    OpenAIRE

    Fernandez, Ana Cláudia [UNIFESP; Mello,Marco Túlio De; Tufik, Sérgio; Castro,Paula Morcelli de; Fisberg, Mauro

    2004-01-01

    O objetivo deste estudo foi verificar as influências do exercício aeróbio e anaeróbio na composição corporal de adolescentes obesos do sexo masculino. A amostra foi constituída de 28 adolescentes com idades entre 15 e 19 anos, que apresentavam obesidade grave. Os voluntários foram distribuídos aleatoriamente em três grupos: grupo I: exercício anaeróbio; grupo II: exercício aeróbio; e grupo III: controle. O grupo I realizou treinamento intervalado em cicloergômetro que consistiu de 12 "tiros" ...

  17. Hipotensão pós-exercício aeróbio e resistido em indivíduos com lesão medular

    OpenAIRE

    Seron, Bruna Barboza; Goessler,Karla Fabiana; Durigan,Julia Zoccolaro; Dourado,Antonio Carlos; Polito,Marcos Doerdelein; GREGUOL,Márcia

    2014-01-01

    O objetivo deste estudo foi analisar a hipotensão pós-exercício (HPE) aeróbio e resistido em cinco indivíduos com lesão medular torácica do sexo masculino e fisicamente ativos (28.6±6.2 anos; 57.4±13.2 kg; 1.71±0.04 m; VO2pico: 29.46±4.3 ml/kg/min). Primeiramente os participantes realizaram exercício aeróbio tocando a cadeira de rodas por 30 minutos em intensidade de 50-70% da frequência cardíaca de reserva. Após 48-72 horas, realizaram a sessão de exercício resistido, com 3 séries de 12 repe...

  18. Etileno e peróxido de hidrogênio na formação de aerênquima em milho tolerante a alagamento intermitente

    Directory of Open Access Journals (Sweden)

    Marinês Ferreira Pires

    2015-09-01

    Full Text Available Resumo:O objetivo deste trabalho foi avaliar o papel do etileno e do peróxido de hidrogênio (H2O2 na formação do aerênquima em ciclos de seleção genética da cultivar de milho BRS 4154, sob alagamento. Plantas dos ciclos C1 e C18 foram submetidas a alagamento por 7 dias, com coleta das raízes aos 0 (controle, sem alagamento, 1 e 7 dias. Foram analisados: a expressão gênica das enzimas ACC sintase (ACS, ACC oxidase (ACO, dismutase do superóxido (SOD e peroxidase do ascorbato (APX; a produção de etileno e o conteúdo de H2O2; a atividade da enzima ACO; e a proporção de aerênquima no córtex. Não houve expressão de ACS e ACO. Houve variação na atividade de ACO e na produção de etileno. A expressão da SOD foi maior em plantas C1 e a da APX, em C18, com redução aos 7 dias. O conteúdo de H2O2 não diferiu entre os tratamentos. A proporção de aerênquima aumentou com o tempo, tendo sido maior em plantas C18 e relacionada à taxa de formação do aerênquima. O tempo de alagamento e o nível de tolerância do ciclo de seleção influenciam a produção do etileno. A expressão da APX indica maior produção de H2O2 no início do alagamento.

  19. VLSI implementation of a 2.8 Gevent/s packet based AER interface with routing and event sorting functionality

    Directory of Open Access Journals (Sweden)

    Stefan eScholze

    2011-10-01

    Full Text Available State-of-the-art large scale neuromorphic systems require sophisticated spike event communication between units of the neural network. We present a high-speed communication infrastructure for a waferscale neuromorphic system, based on application-specific neuromorphic communication ICs in an FPGA-maintained environment. The ICs implement configurable axonal delays, as required for certain types of dynamic processing or for emulating spike based learning among distant cortical areas. Measurements are presented which show the efficacy of these delays in influencing behaviour of neuromorphic benchmarks. The specialized, dedicated AER communication in most current systems requires separate, low-bandwidth configuration channels. In contrast, the configuration of the waferscale neuromorphic system is also handled by the digital packet-based pulse channel, which transmits configuration data at the full bandwidth otherwise used for pulse transmission. The overall so-called pulse communication subgroup (ICs and FPGA delivers a factor 25-50 more event transmission rate than other current neuromorphic communication infrastructures.

  20. Influência do treinamento aeróbio e anaeróbio na massa de gordura corporal de adolescentes obesos Influencia del entrenamiento aeróbico y anaeróbico en la masa grasa corporal de adolescentes obesos Influence of the aerobic and anaerobic training on the body fat mass in obese adolescents

    OpenAIRE

    2004-01-01

    O objetivo deste estudo foi verificar as influências do exercício aeróbio e anaeróbio na composição corporal de adolescentes obesos do sexo masculino. A amostra foi constituída de 28 adolescentes com idades entre 15 e 19 anos, que apresentavam obesidade grave. Os voluntários foram distribuídos aleatoriamente em três grupos: grupo I: exercício anaeróbio; grupo II: exercício aeróbio; e grupo III: controle. O grupo I realizou treinamento intervalado em cicloergômetro que consistiu de 12 "tiros" ...

  1. Mejora de defensas antioxidantes mediante ejercicio aeróbico en mujeres con síndrome metabólico

    Directory of Open Access Journals (Sweden)

    Manuel Rosety-Rodríguez

    2012-02-01

    Full Text Available En la actualidad se acepta que el daño oxidativo juega un papel esencial en la patogénesis del síndrome metabólico. Estudios recientes proponen al daño oxidativo como diana terapéutica frente al síndrome metabólico. Precisamente nuestro objetivo fue mejorar el estatus total antioxidante (TAS de mujeres con síndrome metabólico mediante ejercicio aeróbico. Participaron voluntariamente 100 mujeres con síndrome metabólico de acuerdo con los criterios del National Cholesterol Educational Program (Adult-Treatment-Panel-III distribuidas aleatoriamente en grupo experimental (n = 60 y control (n = 40. El grupo experimental desarrolló un programa de entrenamiento aeróbico sobre tapiz rodante de intensidad ligera/moderada de 12 semanas (5 sesiones/semana. La determinación del TAS plasmático se realizó mediante espectrofotometría utilizando kits comercializados por Randox Lab. Este protocolo fue aprobado por un Comité de Etica Institucional. Tras completar el programa de entrenamiento se incrementó significativamente el TAS (0.79 ± 0.05 vs.1.01 ± 0.03 mmol/l; p = 0.027. No hubo cambios en grupo control. El ejercicio aeróbico de intensidad ligera/moderada aumenta las defensas antioxidantes en mujeres con síndrome metabólico. Son necesarios futuros estudios longitudinales para conocer su impacto en la evolución clínica.

  2. Increased Uptake of HCV Testing through a Community-Based Educational Intervention in Difficult-to-Reach People Who Inject Drugs: Results from the ANRS-AERLI Study.

    Directory of Open Access Journals (Sweden)

    Perrine Roux

    Full Text Available The community-based AERLI intervention provided training and education to people who inject drugs (PWID about HIV and HCV transmission risk reduction, with a focus on drug injecting practices, other injection-related complications, and access to HIV and HCV testing and care. We hypothesized that in such a population where HCV prevalence is very high and where few know their HCV serostatus, AERLI would lead to increased HCV testing.The national multisite intervention study ANRS-AERLI consisted in assessing the impact of an injection-centered face-to-face educational session offered in volunteer harm reduction (HR centers ("with intervention" compared with standard HR centers ("without intervention". The study included 271 PWID interviewed on three occasions: enrolment, 6 and 12 months. Participants in the intervention group received at least one face-to-face educational session during the first 6 months.The primary outcome of this analysis was reporting to have been tested for HCV during the previous 6 months. Statistical analyses used a two-step Heckman approach to account for bias arising from the non-randomized clustering design. This approach identified factors associated with HCV testing during the previous 6 months.Of the 271 participants, 127 and 144 were enrolled in the control and intervention groups, respectively. Of the latter, 113 received at least one educational session. For the present analysis, we selected 114 and 88 participants eligible for HCV testing in the control and intervention groups, respectively. In the intervention group, 44% of participants reported having being tested for HCV during the previous 6 months at enrolment and 85% at 6 months or 12 months. In the control group, these percentages were 51% at enrolment and 78% at 12 months. Multivariable analyses showed that participants who received at least one educational session during follow-up were more likely to report HCV testing, compared with those who did not

  3. Efeito do treinamento físico aeróbio para pessoas idosas com diabetes mellitus e seus familiares cuidadores

    Directory of Open Access Journals (Sweden)

    Luzia Wilma Santana da Silva

    2011-08-01

    Full Text Available Estudo objetivou avaliar o efeito de um Programa de treinamento físico aeróbio para pessoas idosas com Diabetes mellitus tipo 2. Pesquisa quali-quantitativa, realizada no município de Jequié, BA; em 2010, constituída por 15 sujeitos mais seus familiares. Os resultados demonstraram que o programa foi eficaz na melhora da saúde, no controle da diabete, na motivação dos participantes para a atividade física em conjunto com a família e no tratamento não-farmacológico da doença.

  4. Increased Uptake of HCV Testing through a Community-Based Educational Intervention in Difficult-to-Reach People Who Inject Drugs: Results from the ANRS-AERLI Study

    Science.gov (United States)

    Roux, Perrine; Rojas Castro, Daniela; Ndiaye, Khadim; Debrus, Marie; Protopopescu, Camélia; Le Gall, Jean-Marie; Haas, Aurélie; Mora, Marion; Spire, Bruno; Suzan-Monti, Marie; Carrieri, Patrizia

    2016-01-01

    Aims The community-based AERLI intervention provided training and education to people who inject drugs (PWID) about HIV and HCV transmission risk reduction, with a focus on drug injecting practices, other injection-related complications, and access to HIV and HCV testing and care. We hypothesized that in such a population where HCV prevalence is very high and where few know their HCV serostatus, AERLI would lead to increased HCV testing. Methods The national multisite intervention study ANRS-AERLI consisted in assessing the impact of an injection-centered face-to-face educational session offered in volunteer harm reduction (HR) centers (“with intervention”) compared with standard HR centers (“without intervention”). The study included 271 PWID interviewed on three occasions: enrolment, 6 and 12 months. Participants in the intervention group received at least one face-to-face educational session during the first 6 months. Measurements The primary outcome of this analysis was reporting to have been tested for HCV during the previous 6 months. Statistical analyses used a two-step Heckman approach to account for bias arising from the non-randomized clustering design. This approach identified factors associated with HCV testing during the previous 6 months. Findings Of the 271 participants, 127 and 144 were enrolled in the control and intervention groups, respectively. Of the latter, 113 received at least one educational session. For the present analysis, we selected 114 and 88 participants eligible for HCV testing in the control and intervention groups, respectively. In the intervention group, 44% of participants reported having being tested for HCV during the previous 6 months at enrolment and 85% at 6 months or 12 months. In the control group, these percentages were 51% at enrolment and 78% at 12 months. Multivariable analyses showed that participants who received at least one educational session during follow-up were more likely to report HCV testing

  5. Prevención de lesiones en deportistas de gimnasia aeróbica mediante ecuaciones de regresión logística

    OpenAIRE

    Abalo Nuñez, Maria Del Rocio

    2011-01-01

    El deporte está asociado inevitablemente a la aparición de lesiones (Hinrichs, 1999). La práctica de actividad física produce ganancias en la salud, pero no hay que pasar por alto la necesidad de reducir el riesgo de lesiones deportivas que se producen mediante programas de prevención (Bahr y Maehlum, 2007). El objetivo principal del estudio fue prevenir las lesiones en la Gimnasia Aeróbica y para ello hemos analizado por un lado, determinadas variables antropométricas y morfoconstitucion...

  6. Hipotensão pós-exercício aeróbio: uma revisão sistemática

    OpenAIRE

    Casonatto,Juliano; Polito,Marcos Doederlein

    2009-01-01

    Diversos estudos investigaram os efeitos hipotensores após uma sessão de exercício aeróbio em humanos. No entanto, vários aspectos permanecem obscuros em relação à hipotensão pós-exercício (HPE), uma vez que diversas variáveis podem influenciar a resposta hipotensora, como intensidade, duração, tipo de exercício, estado clínico, faixa etária, etnia, sexo e estado de treinamento. Nesse sentido, o objetivo do presente estudo foi revisar sistematicamente a literatura, relacionando as principais ...

  7. Consumo de oxigênio pós-exercícios de força e aeróbio: efeito da ordem de execução

    OpenAIRE

    Lira, Fábio Santos; Oliveira,Rodrigo da Silva Fermino de; Julio, Ursula Ferreira; Franchini, Emerson

    2007-01-01

    O treinamento concorrente é uma estratégia que vem sendo utilizada na intenção de maximizar o gasto energético tanto durante quanto após o exercício por meio do EPOC (excesso do consumo de oxigênio pós-exercício). No entanto, pouco se sabe sobre a influência da ordem de execução sobre o EPOC. O objetivo do presente estudo foi verificar a influência do tipo (aeróbio, força e concorrente) e da ordem (aeróbio + força ou força + aeróbio) do exercício sobre o EPOC. A amostra foi constituída por oi...

  8. Entrenamiento de la capacidad aeróbica por medio de la terapia acuática en niños con parálisis cerebral tipo diplejía espás´tica

    OpenAIRE

    Nandy Fajardo-López; Fabiola Moscoso-Alvarado

    2014-01-01

    Antecedentes. La parálisis cerebral tipo diplejía espática genera cambios en el sistema cardiovascular que afectan la capacidad aeróbica. La terapia acuática es una estrategia terapéutica óptima tanto para el manejo de la población como para el entrenamiento de la capacidad aeróbica, por las respuestas fisiológicas que genera y porque brinda la facilidad de generar mayores cargas al sistema cardiovascular con menores riesgos que en tierra. Objetivo. Identificar las características que debe te...

  9. Treinamento físico aeróbio previne à hipertrofia cardíaca patológica e melhora a função diastólica em ratos Zucker obesos

    OpenAIRE

    Barretti, Diego Lopes Mendes; Carmo,Everton Crivoi do; Rosa, Kaleizu Teodoro; Irigoyen, Maria Claudia Costa; Oliveira, Edilamar Menezes

    2011-01-01

    A obesidade é uma patologia diretamente relacionada com o desenvolvimento de doenças cardiovasculares. Por outro lado, o treinamento físico aeróbio atenua o desenvolvimento da obesidade e promove benefícios cardíacos em obesos. Dessa forma, nosso objetivo foi investigar se a obesidade altera a função cardíaca e se sua associação com o treinamento físico aeróbio promove melhora na função cardíaca em ratos Zucker obesos. Os ratos Zucker foram divididos da seguinte forma: grupo magro (GM), grupo...

  10. Exercício físico aeróbio, resistido e combinado: efeitos na pressão arterial em indivíduos hipertensos

    Directory of Open Access Journals (Sweden)

    Julia Spanhol da Silva

    2014-07-01

    Full Text Available Objetivo: analisar possíveis efeitos na pressão arterial de três sujeitos hipertensos, a partir da aplicação de três tipos de exercícios: aeróbio, resistido e combinado. Método: o estudo de caso utilizou, como instrumento, equipamento manual de verificação de pressão arterial, monitor de frequência cardíaca Polar, ficha de anotações da pressão arterial e frequência cardíaca. Os sujeitos analisados realizaram as atividades em academia do município de Passo Fundo-RS. Resultados e considerações finais: na PAS e na PAD, o exercício que obteve efeito hipotensor foi o resistido e na FC, o treinamento que obteve melhor resposta hipotensora foi também o treino resistido, seguido do treinamento combinado, em que o treinamento aeróbio apenas diminuiu seus valores de desvio padrão. Para tanto, conclui-se que, para estes indivíduos participantes do estudo, o melhor treinamento e os melhores resultados foram alcançados pelo treinamento resistido.

  11. Resistance and uptake of cadmium by yeast, Pichia hampshirensis 4Aer, isolated from industrial effluent and its potential use in decontamination of wastewater.

    Science.gov (United States)

    Khan, Zaman; Rehman, Abdul; Hussain, Syed Z

    2016-09-01

    Pichia hampshirensis 4Aer is first ever used yeast for the bioremediation of environmental cadmium (Cd(+2)) which could maximally remove 22 mM/g and 28 mM/g Cd(+2) from aqueous medium at lab and large scales, respectively. The biosorption was found to be the function of temperature, pH of solution, initial Cd(+2) concentration and biomass dosage. Competitive biosorption was investigated in binary and multi-metal system which indicated the decrease in Cd(+2) biosorption with increasing the competitive metal ions attributed to their higher electronegativity and larger radius. FTIR analysis revealed the active participation of amide and carbonyl moieties in Cd(+2) adsorption confirmed by EDX analysis. Electron micrographs summoned further surface adsorption and increased cell size due to intracellular Cd(+2) accumulation. Cd(+2) was the causative agent of some metal binding proteins as well as prodigious increase in glutathione and other non-protein thiols levels which is the crucial for the yeast to thrive oxidative stress generated by Cd(+2). Our experimental data were consistent with Langmuir as well as Freundlich isotherm models. The yeast obeyed pseudo second order kinetic model which makes it an effective biosorbent for Cd(+2). High bioremediation potential and spontaneity and feasibility of the process make P. hampshirensis 4Aer an impending foundation for green chemistry to exterminate environmental Cd(+2).

  12. Avaliação da biotratabilidade do efluentede branqueamento de polpa celulósicapor processos aeróbios e anaeróbios

    Directory of Open Access Journals (Sweden)

    Míriam Cristina Santos Amaral

    2013-09-01

    Full Text Available Os efluentes da planta de branqueamento da produção de pasta celulósica apresentam, além de elevadas concentrações de matéria orgânica em termos de Demanda Química de Oxigênio (DQO e Demanda Bioquímica de Oxigênio (DBO e cor, compostos com elevada toxicidade, o que torna o tratamento destes efluentes problemático. O objetivo do presente artigo é avaliar a biotratabilidade dos efluentes de branqueamento ácido e alcalino de polpa celulósica kraft por processos aeróbios e anaeróbios por meio da caracterização, utilizando parâmetros convencionais e coletivos. Os resultados de DQO inerte, biodegradabilidade aeróbia e anaeróbia, distribuição de massas molares, produtos microbianos solúveis e substâncias poliméricas extracelulares indicaram a baixa biotratabilidade dos efluentes

  13. Big Data in AER

    Science.gov (United States)

    Kregenow, Julia M.

    2016-01-01

    Penn State University teaches Introductory Astronomy to more undergraduates than any other institution in the U.S. Using a standardized assessment instrument, we have pre-/post- tested over 20,000 students in the last 8 years in both resident and online instruction. This gives us a rare opportunity to look for long term trends in the performance of our students during a period in which online instruction has burgeoned.

  14. Potência atada na máxima fase estável de lactato e índices do desempenho aeróbio de nado

    Directory of Open Access Journals (Sweden)

    Dalton Müller Pessôa Filho

    2014-10-01

    Full Text Available INTRODUÇÃO: A perspectiva do nado atado constituir um contexto válido para a avaliação aeróbia de nadadores foi investigada no presente estudo. OBJETIVO: Analisar a relação entre a potência em máxima fase estável de lactato no nado atado (PAtadaMFEL com seu respectivo índice em nado desimpedido (velocidade em MFEL, vMFEL e com outros índices da aptidão aeróbia e desempenho de nado crawl. MÉTODOS: Dez nadadores (16,6 ± 1,4 anos foram submetidos às estimativas de: (a PAtadoCrítica (transformação da assíntota do modelo carga-tempo limite hiperbólico, CargaCríticaAtada, (b PAtadaMFEL e vMFEL (3 ou 4 esforços de 30 minutos entre 95 a 105% da Carga CríticaAtada e entre 85 a 95% da velocidade máxima nos 400 m, respectivamente, (c teste progressivo (79-100% da v400m, com incrementos de 3% para a determinação da velocidade no ponto de inflexão (vPI, e (d testes de desempenho nas distâncias de 400 (v400m, 800 (v800m e 1500 (v1500m metros. Os coeficientes de Pearson e de variância analisaram as correlações entre os parâmetros aeróbios e destes com o desempenho. O teste de Bland-Altman foi utilizado para analisar a concordância entre as concentrações de lactato nas avaliações aeróbias. RESULTADOS: O valor de PAtadaMFEL (89,2 ± 15,1 W apresentou potencial similar de explicação da variância nos desempenhos em v400m (1,29 ± 0,11 m.s-1, R2 = 0,700, v800m (1,23 ± 0,12 m.s-1, R2 = 0,770 e v1500m (1,21 ± 0,12 m.s-1, R2 = 0,698 tal como vMFEL (1,17 ± 0,11 m.s-1 e vPI (1,19 ± 0,11 m.s-1. As concentrações de lactato sanguíneo em PAtadaMFEL, vMFEL e vPI não diferem entre si e distribuíram-se dentro dos limites de concordância. CONCLUSÃO: Pode-se concluir que a aplicação de MFEL em nado atado mostrou-se válida e promissora para a avaliação aeróbia de nadadores.

  15. Exercício aeróbico agudo restaura a concentração de triptofano em cérebro de ratos com hiperfenilalaninemia

    Directory of Open Access Journals (Sweden)

    Priscila Nicolao Mazzola

    2012-10-01

    Full Text Available INTRODUÇÃO: A fenilcetonúria (PKU é caracterizada pela deficiência da enzima fenilalanina hidroxilase, causando acúmulo de fenilalanina. O diagnóstico precoce e a subordinação à dieta pobre em fenilalanina são importantes para prevenir os efeitos prejudiciais da hiperfenilalaninemia. Não aderir estritamente à dieta provoca, entre outros efeitos, um desequilíbrio entre os aminoácidos neutros que usam o mesmo transportador da fenilalanina na barreira hematoencefálica, causando, então, a diminuição da entrada de triptofano, o precursor de serotonina no cérebro. Esse neurotransmissor tem sido implicado na regulação dos estados de humor, sendo sua alta produção ligada à fadiga central em indivíduos submetidos a exercício prolongado. O exercício físico aumenta os níveis de triptofano livre no sangue, o que facilita seu influxo no cérebro, podendo, portanto, ser útil nos estados hiperfenilalaninêmicos. OBJETIVO: Avaliar se o exercício aeróbico é capaz de normalizar as concentrações de triptofano no cérebro de ratos com hiperfenilalaninemia. MÉTODOS: Trinta e dois ratos foram separados nos grupos sedentário (Sed e exercício (Exe, e cada um deles subdividido em controle (SAL e hiperfenilalaninemia (PKU. A hiperfenilalaninemia foi induzida pela administração de alfa-metilfenilalanina e fenilalanina durante três dias, enquanto os grupos SAL receberam salina. Os grupos Exe realizaram uma sessão de exercício aeróbico com duração de 60min e velocidade de 12m.min-1. RESULTADOS: A concentração de triptofano no cérebro nos grupos PKU foi significativamente menor que nos grupos SAL, tanto Sed como Exe, compatível com a condição hiperfenilalaninêmica. O exercício aumentou a concentração cerebral de triptofano comparada aos animais sedentários. O achado mais interessante foi que a concentração cerebral de triptofano no grupo ExePKU não foi diferente do SedSAL. CONCLUSÃO: Os resultados indicam um

  16. Atividade do sistema antioxidante e desenvolvimento de aerênquima em raízes de milho 'Saracura' Antioxidant system activity and aerenchyma formation in 'Saracura' maize roots

    Directory of Open Access Journals (Sweden)

    Fabricio José Pereira

    2010-05-01

    Full Text Available Este trabalho teve como objetivo avaliar a influência de sucessivos ciclos de seleção do milho 'Saracura' na atividade das enzimas do sistema antioxidante, e a relação dessas enzimas com a capacidade dessa variedade em desenvolver aerênquima. Sementes de 18 ciclos de seleção intercalados do milho 'Saracura' e da cultivar BR 107, sensível à hipoxia, foram semeadas em vasos e em casa de vegetação. As plantas foram submetidas ao alagamento intermitente de dois em dois dias. As amostras de raízes foram coletadas após 60 dias e analisaram-se as atividades das enzimas peroxidase do guaiacol, peroxidase do ascorbato e catalase, além da capacidade das plantas de cada ciclo desenvolverem aerênquima. Ao longo dos ciclos, as plantas apresentaram modificações na atividade das enzimas, com aumento na de peroxidase do ascorbato e diminuição na de catalase e de peroxidase do guaiacol. Observou-se, ainda, maior capacidade de desenvolver aerênquima nos últimos ciclos de seleção. A redução na atividade das enzimas do sistema antioxidante parece estar relacionada a um desbalanço na decomposição de H2O2.This work aimed to assess the influence of successive selection cycles in 'Saracura' maize on the enzyme activity of the antioxidant system and the relationship of these enzymes with the aerenchyma development capacity of this variety. Seeds of 18 intercalated selection cycles of the 'Saracura' maize and of the cultivar BR 107, sensitive to hipoxia, were sown in pots in the greenhouse. Plants were submitted to intermittent soil flooding each two days. After 60 days, the roots were sampled and analysis were done for the guaiacol peroxidase, ascorbate peroxidase, and catalase activities and for the capacity of the plants of each cycle to develop aerenchyma. The plants showed modifications in enzyme activity along the cycles, increasing the ascorbate peroxidase activity and decreasing the catalase and guaiacol peroxidase ones. A greater

  17. Aptidão aeróbia e amplitude dos domínios de intensidade de exercício no ciclismo

    Directory of Open Access Journals (Sweden)

    Renato Aparecido Corrêa Caritá

    2013-08-01

    Full Text Available INTRODUÇÃO: A determinação dos domínios de intensidade de exercício tem importantes implicações na prescrição do treino aeróbio e na elaboração de delineamentos experimentais. OBJETIVO: Analisar os efeitos do nível de aptidão aeróbia sobre a amplitude dos domínios de intensidade de exercício durante o ciclismo. MÉTODOS: Doze ciclistas (CIC, 11 corredores (COR e oito indivíduos não treinados (NT foram submetidos aos seguintes protocolos em diferentes dias: 1 teste progressivo para determinação do limiar de lactato (LL, consumo máximo de oxigênio (VO2máx e sua respectiva intensidade (IVO2máx; 2 três testes de carga constante até a exaustão a 95, 100 e 110% IVO2máx para a determinação da potência crítica (PC; 3 testes até a exaustão para determinar a intensidade superior do domínio severo (Isup. As amplitudes dos domínios (moderado pesado severo < Isup foram expressas como percentual da Isup (VO2. RESULTADOS: A amplitude do domínio moderado foi similar entre CIC (52 ± 8% e COR (47 ± 4% e significantemente maior no CIC em relação ao NT (41 ± 7%. O domínio pesado foi significantemente menor no CIC (17 ± 6% em relação ao COR (27 ± 6% e NT (27 ± 9%. Em relação ao domínio severo não foram encontradas diferenças significantes entre os CIC (31 ± 7%, COR (26 ± 5% e NT (31 ± 7%. CONCLUSÃO: O domínio pesado de exercício é mais sensível a mudanças determinadas pelo nível de aptidão aeróbia, existindo a necessidade de que se atenda ao princípio da especificidade do movimento, quando se pretende obter um elevado grau de adaptação fisiológica.

  18. Treinamento aeróbico prévio à compressão nervosa: análise da morfometria muscular de ratos

    Directory of Open Access Journals (Sweden)

    Elisangela Lourdes Artifon

    2013-02-01

    Full Text Available INTRODUÇÃO: Ciatalgia origina-se da compressão do nervo isquiático e implica em dor, parestesia, diminuição da força muscular e hipotrofia. O exercício físico é reconhecido na prevenção e reabilitação de lesões, porém quando em sobrecargas pode aumentar o risco de lesões e consequente déficit funcional. OBJETIVO: Avaliar efeitos de treinamento aeróbico prévio a modelo experimental de ciatalgia em relação a parâmetros morfométricos dos músculos sóleos de ratos. MATERIAIS E MÉTODOS: 18 ratos divididos em três grupos: simulacro (mergulho, 30 segundos; exercício regular (natação, dez minutos diários; e treinamento aeróbico progressivo (natação em tempos progressivos de dez a 60 minutos diários. Ao final de seis semanas de exercício, os ratos foram submetidos ao modelo experimental da ciatalgia. No terceiro dia após a lesão, foram eutanasiados e tiveram seus músculos sóleos dissecados, pesados e preparados para análise histológica. Variáveis analisadas: peso muscular, área de secção transversa e diâmetro médio das fibras musculares. RESULTADOS: Observou-se diferença estatisticamente significativa para todos os grupos quando se comparou músculo controle e aquele submetido à lesão isquiática. A análise intergrupos não apresentou diferença estatisticamente significativa para nenhuma das variáveis analisadas. CONCLUSÃO: Tanto o exercício físico regular quanto o treinamento aeróbico não produziram efeitos preventivos ou agravantes às consequências musculares da inatividade funcional após ciatalgia.

  19. Efectos del ejercicio aeróbico interválico, combinado con entrenamiento de fuerza y de la restricción calórica, sobre la composición corporal de ratas obesas

    Directory of Open Access Journals (Sweden)

    I. Coll-Risco

    2017-03-01

    Conclusiones: Tanto el programa de ejercicio aeróbico interválico, combinado con entrenamiento de fuerza desarrollado, como la restricción calórica, fueron eficaces, mejorando la composición corporal de ratas obesas, pero el ejercicio lo hizo en mayor magnitud.

  20. Capacidade aeróbica em crianças e adolescentes com asma intermitente e persistente leve no período intercrises

    OpenAIRE

    Moraes,Eliane Zenir Corrêa de; Trevisan,Maria Elaine; Baldisserotto,Sérgio de Vasconcellos; Portela,Luiz Osório Cruz

    2012-01-01

    OBJETIVO: Aferir a capacidade aeróbica de crianças e adolescentes com diagnóstico de asma brônquica intermitente leve ou persistente leve no período intercrises. MÉTODOS: Foram estudadas 33 crianças e adolescentes com diagnóstico clínico recente de asma leve intermitente e asma leve persistente, no período intercrises, e 36 crianças e adolescentes saudáveis. Foram realizadas avaliação clínica, avaliação do nível basal do nível de atividade física, espirometria antes e após o uso de broncodila...

  1. Plan motivacional para la realización de Actividad Física y Salud a través de la resistencia aeróbica

    OpenAIRE

    2014-01-01

    El siguiente trabajo de fin de grado muestra el análisis de la resistencia aeróbica motivacional como modo de actividad física saludable en la edad escolar a través de una unidad didáctica destinada a la intervención educativa en el colegio Ignacio Martín Baró durante el año académico 2013/2014. Lo pretendido con este trabajo es fomentar la práctica de actividad física saludable y con ello la adquisición de nuevos hábitos, que mejoren la vida de los alumnos. El objetivo principal es que...

  2. Influência do treinamento aeróbio nos mecanismos fisiopatológicos da hipertensão arterial sistêmica

    Directory of Open Access Journals (Sweden)

    Francisco Luciano Pontes Júnior

    2010-12-01

    Full Text Available O objetivo da presente revisão foi discutir as principais influências do exercício aeróbio nos mecanismos fisiopatológicos da hipertensão sistêmica. A hipotensão pós-exercício (HPE resulta de uma redução persistente na resistência vascular periférica (RVP, mediada pelo sistema nervoso autônomo e por substâncias vasodilatadoras. A diminuição da pressão arterial com o treinamento crônico ocorre pela diminuição da RVP e do débito cardíaco em repouso, por meio da redução da atividade neural simpática e do aumento da sensibilidade barorreflexa. Além disso, o exercício crônico pode promover redução da concentração de catecolaminas, melhora do perfil metabólico, afetar a atividade funcional do endotélio vascular e promover mudanças positivas na composição corporal. Desse modo, a inclusão do exercício físico aeróbio é fortemente recomendada como estratégia não farmacológica para o tratamento da hipertensão, não apenas pelo efeito benéfico na pressão arterial, bem como na redução de fatores de risco cardiovasculares.

  3. Efecto de una intervención ACT sobre la resistencia aeróbica y evitación experiencial en marchistas

    Directory of Open Access Journals (Sweden)

    María Clara Rodríguez Salazar

    2015-12-01

    Full Text Available El presente estudio tuvo como propósito identificar el efecto de la intervención en Terapia de Aceptación y Compromiso (ACT sobre la resistencia aeróbica y conducta de evitación experiencial en un grupo de marchistas de Bogotá. Se utilizó un diseño pretest-postest con grupo control. La muestra estuvo compuesta por diez marchistas de ambos sexos, con un promedio de edad de 16.70 y un rango entre los 15 y 20 años de edad, pertenecientes a la Liga de Atletismo de Bogotá. Se eligieron por conveniencia. Se emplearon como instrumentos de medición el test de los 3000 m y el Cuestionario de Aceptación Acción (AAQ. La intervención en ACT se realizó en cuatro sesiones en las que se desarrollaron los contenidos definidos por los autores de la intervención (Wilson y Luciano, 2002. Para el análisis de los datos, se empleó estadística no paramétrica a través de la prueba U de Mann-Whitney. Los resultados señalan una mayor resistencia aeróbica en la prueba de los 3000 m en el postest del grupo experimental con respecto al grupo control, así como una mayoraceptación de los eventos internos negativos.

  4. Influência do treinamento aeróbio e anaeróbio na massa de gordura corporal de adolescentes obesos Influencia del entrenamiento aeróbico y anaeróbico en la masa grasa corporal de adolescentes obesos Influence of the aerobic and anaerobic training on the body fat mass in obese adolescents

    Directory of Open Access Journals (Sweden)

    Ana Cláudia Fernandez

    2004-06-01

    Full Text Available O objetivo deste estudo foi verificar as influências do exercício aeróbio e anaeróbio na composição corporal de adolescentes obesos do sexo masculino. A amostra foi constituída de 28 adolescentes com idades entre 15 e 19 anos, que apresentavam obesidade grave. Os voluntários foram distribuídos aleatoriamente em três grupos: grupo I: exercício anaeróbio; grupo II: exercício aeróbio; e grupo III: controle. O grupo I realizou treinamento intervalado em cicloergômetro que consistiu de 12 "tiros" de 30" com máxima força e velocidade, pedalando com carga alta (0,8% do massa corporal x 25 watts e recuperação ativa de 3'; o grupo II realizou treinamento aeróbio em cicloergômetro pedalando com carga relativa ao limiar ventilatório por 50 minutos. Já o terceiro grupo funcionou como controle, sem atividade física. Todos os grupos tiveram orientação nutricional e o período de intervenção foi de 12 semanas (três meses. Os voluntários realizaram densitometria óssea com análise da composição corporal (DEXA e avaliações médicas e de aptidão física. Quando comparados os períodos inicial e final de intervenção foram observadas reduções nas variáveis massa corporal, IMC, na massa de gordura corporal total e de membros inferiores e na percentagem de gordura corporal de tronco nos grupos de exercício. Diferenças foram observadas entre os grupos I e III para os deltas percentuais de massa de gordura corporal total e de membros inferiores e na percentagem de gordura de membros inferiores. Os dados sugerem que o exercício físico, tanto aeróbio como anaeróbio, aliado à orientação nutricional, promove maior redução ponderal, quando comparado com a orientação nutricional somente, e que, neste estudo, o exercício anaeróbio foi mais eficiente para promover a diminuição da gordura corporal e da percentagem de gordura e o exercício aeróbio foi mais eficaz no sentido de preservar e/ou aumentar a massa magra e a

  5. Método de Cuckow para la calibración de aerómetros : diseño y puesta a punto del equipo

    Directory of Open Access Journals (Sweden)

    Joselaine Cáceres

    2011-05-01

    Full Text Available El método utilizado en el Laboratorio Tecnológico del Uruguay (LATU para calibración de aerómetros es el “Método de Cuckow para calibración de aerómetros utilizando agua adicionada con un tensoactivo como fluido patrón”. En este método se usa un tensoactivo para bajar la tensión superficial del agua destilada utilizada como fluido patrón y se verifica que la variación en la densidad de la misma, producto del agregado del tensoactivo, contribuye en forma despreciable a la incertidumbre del método y puede ser contemplada dentro de la incertidumbre aceptada para la densidad del agua destilada. Se planificó una estrategia para bajar la incertidumbre de calibración del método; para ello se diseñó un recipiente con un sistema de termostatización con recirculación de agua por camisa, lo que aporta estabilidad térmica al sistema. Se utilizóagitación mecánica para favorecer la termostatización y evitar gradientes de densidad asociados a inhomogeneidad en la temperatura. También se realizaron mejoras en el sistema de ajuste de la lectura y formación del menisco. Luego de estas mejoras se validó nuevamente el método y se demostró que se alcanza la meta propuesta de disminuir las incertidumbres de calibración, estando en condiciones de aplicarlo a calibración de aerómetros de precisión. En el presente artículo se detallan las consideraciones realizadas en el diseño y puesta a punto del equipo mejorado, fundamentalmente el recipiente y el sistema de termostatización. Se plantea la construcción del recipiente a partir de tubos de vidriodisponibles en el mercado, bajando así sus costos.AbstracThe method used in Laboratorio Tecnológico del Uruguay (LATU for hydrometers calibration is the “Cuckow method for hydrometers calibration using water added with a surfactant as a standard”. A surfactant is used to decrease the surface tension of distilated water used as a standar and is verified that the density variation

  6. Aspectos relacionados com a otimização do treinamento aeróbio para o alto rendimento Related aspects of aerobic training optimization for high performance

    Directory of Open Access Journals (Sweden)

    Mariana Fernandes Mendes de Oliveira

    2010-02-01

    Full Text Available O objetivo deste trabalho foi apresentar recomendações visando à otimização do treinamento aeróbio, a partir do conhecimento dos índices de aptidão funcional e seus mecanismos fisiológicos. Em atletas altamente treinados, a precisão na elaboração do treinamento pode ser o meio mais seguro para a melhora do rendimento, pois nesses indivíduos é comum a carga de treinamento oscilar entre o estimulo insuficiente e o aparecimento do excesso de treinamento. Existe, portanto, uma variedade muito grande de fatores que devem ser considerados na elaboração de um programa de treinamento. O entendimento dos mecanismos de fadiga e das respostas fisiológicas associadas às diferentes durações e intensidades de exercício é essencial para uma correta elaboração das sessões de treinamento. Além disso, treinos intervalados de alta intensidade são imprescindíveis para melhora de rendimento em atletas altamente treinados, porém, é recomendado que ele seja realizado após um razoável período de recuperação das sessões de treino anteriores. Assim, o contato entre o atleta e o treinador é importante para um planejamento cuidadoso dos períodos de recuperação antes da ocorrência de fadiga excessiva. O treinador deveria arquivar um histórico das cargas de treino e recuperações, aprendendo com a própria experiência os tipos de cargas que podem ser toleradas individualmente. Entre os fatores que podem afetar o rendimento aeróbio, o planejamento de um aquecimento apropriado e as condições ambientais adversas são aspectos muito importantes. Após reunir todas essas informações, é possível elaborar as bases do treinamento (frequência, volume, intensidade e recuperação visando melhora contínua do rendimento aeróbio.The objective of this work was to present recommendations aiming the aerobic training optimization, from the knowledge of the indexes of functional fitness and their physiological mechanisms. Concerning highly

  7. Efeito do treinamento aeróbio e do treinamento anaeróbio na expressão de citocinas e de transportador de glicose GLUT4 no tecido muscular esquelético de ratos obesos

    OpenAIRE

    2010-01-01

    Durante a obesidade ocorre aumento de ácidos graxos livres na circulação e, conseqüentemente aumento do conteúdo de proteínas com efeitos negativos na sinalização da insulina. Objetivo: Avaliar o efeito do treinamento aeróbio na modulação de RNAm de GLUT4, TNF-a e SOCS3 em tecidos musculares esqueléticos e a sensibilidade à insulina periférica de ratos obesos por dieta hiperlipídica. Métodos: Ratos obesos por dieta hiperlipídica foram submetidos ao protocolo de treinamento aeróbio. A sensibil...

  8. Efeito do exercício aeróbio moderado em gestantes com sobrepeso avaliado através de teste de exercício submáximo : um ensaio clínico randomizado

    OpenAIRE

    Iracema Sousa Athayde Schneider Santos

    2002-01-01

    Objetivo: Avaliar os efeitos de um programa de exercício aeróbio sobre o condicionamento cardiorrespiratório em gestantes hígidas, de baixo risco, com sobrepeso. Métodos: 92 mulheres gestantes com sobrepeso (índice de massa corporal 26-31kg/m2), idade ≥ 20 anos, idade gestacional ≤ 20 semanas, com ausência de diabetes e hipertensão, foram alocadas aleatoriamente para realizar exercício aeróbio três vezes por semana com uma hora de duração ou para realizar sessões de relaxamento no grupo contr...

  9. Pressão arterial e variabilidade de frequência cardíaca após o exercício aeróbio e com pesos realizados na mesma sessão

    OpenAIRE

    Natalia Serra Lovato; Paulo Gomes Anunciação; Marcos Doederlein Polito

    2012-01-01

    OBJETIVO: Verificar o comportamento da PA sistólica (PAS), diastólica (PAD), média (PAM), frequência cardíaca (FC) e a variabilidade da frequência cardíaca (VFC) após sessões de exercício aeróbio e com pesos combinadas em diferentes ordens. MÉTODOS: Nove homens normotensos realizaram aleatoriamente em dias diferentes uma sessão de exercício aeróbio (cicloergômetro; 60% do O2pico; 50 min) seguido pelo exercício com pesos (oito exercícios, três séries de 10-15 repetições, 60% de 1RM) e outra se...

  10. Tratamento de esgoto sanitário de baixa carga utilizando reator compartimentado anaeróbio/aeróbio em escala piloto

    Directory of Open Access Journals (Sweden)

    Julliana Alves da Silva

    Full Text Available RESUMO O objetivo principal da pesquisa foi avaliar o potencial de tratamento de esgoto sanitário de baixa carga orgânica em reator compartimentado anaeróbio/aeróbio (RCAA em escala piloto. O reator, mantido em temperatura ambiente (27ºC a 30ºC, foi implantado no campus da Universidade Estadual Paulista "Júlio de Mesquita Filho" (UNESP (Bauru, SP, Brasil e tratou esgoto sanitário com carga orgânica entre 0,06 e 0,61 kg DQO.d-1. O RCAA é composto de quatro câmaras fisicamente separadas, sendo as três primeiras anaeróbias e a quarta aeróbia, seguidas por decantador laminar. O monitoramento foi realizado durante o período de 203 dias para tempos de detenção hidráulica total (TDH de 33, 22, 16,5 e 8,25 horas. Durante o período experimental, verificou-se remoção média de matéria orgânica, em termos de demanda química de oxigênio total (DQOTotal, de 71 a 82% no sistema completo, com valores elevados de remoção na fase anaeróbia entre 62 e 71%. Em termos de sólidos em suspensão totais (SST, o reator apresentou remoções médias em torno de 90%. Os resultados obtidos nesta pesquisa permitiram um avanço no conhecimento operacional de uma alternativa biotecnológica de baixo custo, com o propósito de diminuir o impacto causado pela geração de esgotos de pequenas comunidades urbanas e rurais que ainda não contam com sistema de tratamento, e ainda possibilitar o reúso do efluente tratado.

  11. Exercício aeróbio reduz a hipertensão arterial de mulheres com Doença de Chagas

    Directory of Open Access Journals (Sweden)

    Wania da Silva Lopes

    2014-04-01

    Full Text Available INTRODUÇÃO: Os portadores de doença de Chagas frequentemente apresentam a hipertensão arterial sistêmica (HAS como a principal comorbidade. Em indivíduos hipertensos com e sem doença de Chagas, o controle de HAS geralmente é medicamentoso. Medidas alternativas de intervenção como o exercício físico aeróbio têm sido preconizadas como a maneira mais efetiva para reduzir os níveis de pressão arterial. OBJETIVO: Avaliar a influência do exercício físico sobre a pressão arterial de mulheres hipertensas com e sem doença de Chagas. MÉTODOS: Dezenove voluntárias divididas nos grupos G1 (nove com doença de Chagas e G2 (dez sem doença de Chagas foram submetidas a um programa de treinamento de 12 semanas, com duração de 30 a 60 minutos duas vezes por semana. A pressão arterial sistólica (PAS, diastólica (PAD e a frequência cardíaca (FC foram avaliadas no pré e pós-esforço no início (T0, após seis (T6 e 12 (T12 semanas. RESULTADOS: Em T6, melhora significativa foi observada na PAS pré e pós-esforço e na PAD pós-esforço, para ambos os grupos. No T12, G1 apresentou melhora significativa para todas as variáveis, exceto FC pós-esforço e G2 para PAS pré e pós-esforço e FC pós-esforço. Não houve diferença significativa entre G1 e G2 para as variáveis estudadas. CONCLUSÃO: O exercício físico aeróbio de baixa intensidade reduz significativamente a pressão arterial de mulheres com doença de Chagas, pode ser realizado com segurança, e insere os pacientes com esta enfermidade na prática rotineira de exercícios.

  12. Measurements and ALE3D Simulations for Violence in a Scaled Thermal Explosion Experiment with LX-10 and AerMet 100 Steel

    Energy Technology Data Exchange (ETDEWEB)

    McClelland, M A; Maienschein, J L; Yoh, J J; deHaven, M R; Strand, O T

    2005-06-03

    We completed a Scaled Thermal Explosion Experiment (STEX) and performed ALE3D simulations for the HMX-based explosive, LX-10, confined in an AerMet 100 (iron-cobalt-nickel alloy) vessel. The explosive was heated at 1 C/h until cookoff at 182 C using a controlled temperature profile. During the explosion, the expansion of the tube and fragment velocities were measured with strain gauges, Photonic-Doppler-Velocimeters (PDVs), and micropower radar units. These results were combined to produce a single curve describing 15 cm of tube wall motion. A majority of the metal fragments were captured and cataloged. A fragment size distribution was constructed, and a typical fragment had a length scale of 2 cm. Based on these results, the explosion was considered to be a violent deflagration. ALE3D models for chemical, thermal, and mechanical behavior were developed for the heating and explosive processes. A four-step chemical kinetics model is employed for the HMX while a one-step model is used for the Viton. A pressure-dependent deflagration model is employed during the expansion. The mechanical behavior of the solid constituents is represented by a Steinberg-Guinan model while polynomial and gamma-law expressions are used for the equation of state of the solid and gas species, respectively. A gamma-law model is employed for the air in gaps, and a mixed material model is used for the interface between air and explosive. A Johnson-Cook model with an empirical rule for failure strain is used to describe fracture behavior. Parameters for the kinetics model were specified using measurements of the One-Dimensional-Time-to-Explosion (ODTX), while measurements for burn rate were employed to determine parameters in the burn front model. The ALE3D models provide good predictions for the thermal behavior and time to explosion, but the predicted wall expansion curve is higher than the measured curve. Possible contributions to this discrepancy include inaccuracies in the chemical models

  13. 项目投资动态评价方法的改进--平均超额回报率法(AER)

    Institute of Scientific and Technical Information of China (English)

    张传洲

    2003-01-01

      在项目投资动态评价中,净现值法(NPV)和内部收益率法(IRR)是两种主要的评价方法,但由于这两种方法在评价过程中使用的指标形式不同,经常造成评价结果不一致.国内有学者对这种不一致进行了协调,但由于计算繁琐,应用与推广受到限制.本文对净现值法(NPV)和内部收益率法(IRR)进行比较分析,提出了使用平均超额回报率法(AER)对内部收益率法(IRR)进行改进的思路,以利于在评价投资项目各种形式方案中使用.……

  14. 项目投资动态评价方法的改进--平均超额回报率法(AER)

    Institute of Scientific and Technical Information of China (English)

    张传洲

    2003-01-01

    @@ 在项目投资动态评价中,净现值法(NPV)和内部收益率法(IRR)是两种主要的评价方法,但由于这两种方法在评价过程中使用的指标形式不同,经常造成评价结果不一致.国内有学者对这种不一致进行了协调,但由于计算繁琐,应用与推广受到限制.本文对净现值法(NPV)和内部收益率法(IRR)进行比较分析,提出了使用平均超额回报率法(AER)对内部收益率法(IRR)进行改进的思路,以利于在评价投资项目各种形式方案中使用.

  15. Redução da pressão arterial, da IMC e da glicose após treinamento aeróbico em idosas com diabete tipo 2

    Directory of Open Access Journals (Sweden)

    Luciana Zaranza Monteiro

    2010-10-01

    Full Text Available FUNDAMENTO: O processo de envelhecimento associa-se ao desenvolvimento de várias doenças, que podem ser amenizadas pela prática de atividades físicas. O treinamento aeróbico é um meio efetivo para manter e melhorar as funções cardiovasculares. Além disso, desempenha um papel fundamental na prevenção e tratamento de diversas doenças crônico-degenerativas, em especial o diabete melito. OBJETIVO: Verificar os efeitos de 13 semanas de treinamento aeróbico sobre a pressão arterial, o índice de massa corpórea e a glicemia em idosas com diabete tipo 2. MÉTODOS: Onze mulheres idosas diabéticas (61,0 ± 9,1 anos de idade, sedentárias, realizaram 13 semanas de treinamento aeróbico, compondo o grupo G2. Onze idosas (60,2 ± 6,8 anos de idade controladas não realizaram exercícios físicos durante a pesquisa, constituindo o grupo-controle (G1. O grupo G1 foi submetido somente a orientações educativas uma vez na semana, e o grupo G2, a caminhadas três vezes na semana. RESULTADOS: Houve redução significativa da glicemia e da pressão arterial diastólica nos dois grupos. Não foram encontradas reduções significativas no IMC após o treinamento aeróbico em ambos os grupos. CONCLUSÃO: Treze semanas de treinamento aeróbico foi suficiente para promover reduções significativas na pressão arterial diastólica e glicemia, portanto, esse tipo de exercício reduz os fatores de risco para doenças cardiovasculares e metabólicas.

  16. Efeitos agudos de diferentes intensidades e volumes de exercício aeróbio sobre as concentrações de triptofano e serotonina em mulheres idosas fisicamente ativas

    Directory of Open Access Journals (Sweden)

    Jônatas de França Barros

    2014-12-01

    Full Text Available O envelhecimento provoca uma diminuição na concentração de serotonina, que por sua vez, pode produzir anormalidades de comportamento como: agressividade, insônia, comportamento suicida ou criminal e perda do desejo sexual. Entretanto, estudos demonstram que o exercício aeróbio parece aumentar agudamente as concentrações de triptofano e serotonina. Por outro lado, não há relatos na literatura de estudos que tenham investigado os efeitos de diferentes intensidades e volumes de exercício aeróbio sobre as concentrações de triptofano e serotonina em mulheres idosas. O objetivo do presente estudo foi verificar os efeitos agudos de diferentes intensidades e volumes de exercício aeróbio sobre as concentrações de triptofano e serotonina em mulheres idosas fisicamente ativas. Para tanto, 49 mulheres idosas (idade entre 60 e 75 anos, fisicamente ativas, foram distribuídas em seis grupos: controle (GC; n = 8 e cinco experimentais: 1 exercício aeróbio realizado a 90% do limiar ventilatório (LV90; n = 8; 2 exercício realizado em intensidade de limiar ventilatório (LV; n = 8, 3 exercício realizado em intensidade relativa a 90% do ponto de compensação respiratório (PCR90; n = 8, todos com duração de 20 min; 4 teste de esforço máximo (Gmáx; n = 8; e 5 exercício realizado em intensidade de limiar ventilatório com duração de 60 min (LV60min; n = 9. Antes e após a realização das sessões de exercícios foram realizadas coletas de sangue venoso para quantificação das concentrações de triptofano e serotonina. Não foram identificadas diferenças significativas (p > 0,05 entre (GC, LV90, LV, PCR90, Gmáx e LV60min e intragrupos (pré e pós nas concentrações de serotonina e triptofano. Em conclusão, sessões agudas de exercício aeróbio realizado em diferentes intensidades e volumes não resultaram em alterações significativas nas concentrações de serotonina e tripotofano em mulheres idosas.

  17. Elaboración de cartas aeronáuticas OACI: planos de obstáculos de aeródromo, a partir de imágenes aéreas digitales de pequeño formato

    Directory of Open Access Journals (Sweden)

    Jorge Prado Molina

    2012-01-01

    Full Text Available Las cartas aeronáuticas y los planos de obstáculos de aeródromo proporcionan información sobre las obstrucciones alrededor del aeropuerto, para que el controlador aéreo y los pilotos cumplan con los procedimientos y limitaciones de su utilización. La seguridad en aviación exige la producción de cartas aeronáuticas actualizadas y precisas, adoptando los estándares de la Organización de Aviación Civil Internacional (OACI. En este artículo se describe la metodología utilizada para generar los planos de obstáculos de cinco aeródromos en México, a partir de imágenes aéreas digitales, obtenidas con cámaras de formato pequeño. A través de dos levantamientos aéreos en cada aeropuerto, a 10 000 y 5 000 pies de altura sobre el nivel del terreno, se generaron dos ortomosaicos cubriendo la zona de influencia de la terminal aérea, el aeródromo y las superficies de aproximación, de ascenso en el despegue, de transición, horizontal interna y cónica. A través de la fotointerpretación de estéreopares se identificó la mayoría de los obstáculos, y con los ortomosaicos se generaron los planos de aeródromo y de obstáculos de aeródromo tipos A, B y C. Mediante receptores satelitales geodésicos se obtuvieron 18 puntos en cada pista, para obtener sus dimensiones y establecer puntos de control terrestre para la formación de los ortomosaicos. A través de detallado trabajo de campo se comprobó la localización y altura de los obstáculos y, finalmente, después de varios procedimientos de revisión por las autoridades aeronáuticas, se concluyó la generación de las cartas OACI al integrar todos los mapas de los aeropuertos, en un sistema de información geográfica (SIG.

  18. Cálcio e o desenvolvimento de aerênquimas e atividade de celulase em plântulas de milho submetidas a hipoxia Calcium and the development of aerenchyma and celulase activity in corn seedlings subjected to hypoxia

    Directory of Open Access Journals (Sweden)

    Bárbara França Dantas

    2001-06-01

    Full Text Available A formação de aerênquimas é conhecida como uma das mais importantes adaptações anatômicas pelas quais as plantas passam quando são submetidas à deficiência de oxigênio. Esse tecido se desenvolve pela ação de enzimas de degradação ou afrouxamento da parede celular. Este trabalho foi conduzido com o objetivo de verificar o desenvolvimento de aerênquima em plântulas de milho cv. Saracura- BRS 4154, submetidas à hipoxia. Associou-se, ao desenvolvimento dessa estrutura, a atividade da celulase. Para tanto, plântulas com 4 dias de idade foram submetidas aos tratamentos de hipoxia, pela imersão em tampão de alagamento, na ausência e presença de cálcio. Após 0, 1, 2, 3 e 4 dias da aplicação dos tratamentos, foram feitos cortes anatômicos na região apical dos coleóptiles e na região intermediária da raiz para a avaliação da formação de aerênquimas, e coletado o material para os ensaios enzimáticos de celulase. A atividade celulase foi medida através de método viscosimétrico. Nas raízes, a formação de aerênquima aumentou logo após a hipoxia e atingiu 50% do total do córtex ao quarto dia de hipoxia. Este órgão apresentou uma área cortical com aerênquima em média sete vezes maior que nos coleóptiles, onde a área de espaços intercelulares atingiu 15% do córtex. A atividade da celulase em coleóptiles e raízes sofreu, inicialmente, um decréscimo devido ao estresse, aumentando em seguida, acompanhando os resultados de aerênquima. Na presença de cálcio o desenvolvimento de aerênquima foi inibido; no entanto, a atividade enzimática foi induzida.Aerenchyma formation is known as one of the most important anatomical adaptations of plants submitted to oxygen shortage. This tissue develops by action of degrading enzymes and resulting in cell wall loosening. This work was conducted with the objective of verifying aerenchyma development in corn seedlings cv. Saracura - BRS 4154, submitted to hypoxia. The

  19. Efecto del ejercicio aeróbico y la estimulación ambiental sobre la reducción de los niveles de ansiedad en el envejecimiento

    Directory of Open Access Journals (Sweden)

    Patricia Sampedro Piquero

    2015-08-01

    Full Text Available El enriquecimiento ambiental (EAM y el ejercicio aeróbico (EJ son intervenciones capaces de reducir la ansiedad durante el envejecimiento, pero poco se sabe acerca de cómo modulan las proyecciones cerebrales hacia el eje hipotálamo-pituitario adrenal (HPA. Estudiamos el efecto de un programa de EAM y de EJ durante 2 meses en ratas Wistar macho de 18 meses de edad asignadas aleatoriamente a tres grupos: control (CO, n=6, EAM (n=8 y EJ (n=8. El programa de ejercicio fue llevado a cabo 15min/día y el grupo EAM fue estabulado en una jaula de grandes dimensiones con diferentes objetos renovados frecuentemente. Mediante la histoquímica de la citocromo c oxidasa (COx estudiamos la actividad metabólica de regiones cerebrales implicadas en la respuesta de ansiedad. El EAM redujo la actividad metabólica de regiones cerebrales implicadas en activar al eje HPA (corteza infralímbica, amígdala basolateral y núcleo paravetricular hipotalámico, (p<0.05. Por otro lado, el EJ aumentó la actividad de regiones implicadas en la inhibición (corteza cingulada, núcleo del lecho de la estría terminal e hipocampo dorsal, (p<0.05. En conclusión, parece que el EAM y el EJ modulan de forma diferente la actividad de regiones cerebrales que proyectan al eje HPA y podrían constituir intervenciones eficaces para reducir los niveles de ansiedad durante el envejecimiento.

  20. Análise da incidência lesional na ginástica aeróbica espanhola de elite

    Directory of Open Access Journals (Sweden)

    Rocío Abalo Núñez

    2013-10-01

    Full Text Available INTRODUÇÃO: A ginástica aeróbica (GA é uma disciplina que possui exigências físicas específicas e treinamento adequado para prevenir ou minimizar a ocorrência de lesões esportivas. OBJETIVO: Analisar a incidência de lesões na GA e a sua vinculação com fatores de treinamento MÉTODO: Realizou-se um estudo em 40 desportistas valencianos com idades compreendidas entre nove e 17 anos. O procedimento de coleta de informações foi através de um questionário de morbidade. A variável dependente foram as lesões durante a temporada 2009-2010 e as variáveis independentes principais foram a carga de treinamento, o material de proteção, superfície de treinamento, gesto técnico e tipo de lesão e zona corporal lesionada. RESULTADOS: As lesões mais reincidentes foram as relacionadas a ligamentos, afetando por igual os membros superior e inferior. A metade das lesões ocorreu após a realização dos saltos, apesar do uso de algum material de proteção, além de terem ocorrido no início da temporada. Relações significativas entre o número de lesões e a experiência, os dias de treinamento e o número de competições (p < 0,05 foram encontradas. CONCLUSÕES: O número de lesões diminuiu enquanto o uso de medidas de proteção, com destaque para as munhequeiras, aumentou. Metade das lesões produziu-se durante o período de aprendizagem técnica de dificuldades.

  1. Método de cuckow para la calibración de aerómetros utilizando agua destilada adicionada con un tensoactivo como fluído patrón

    Directory of Open Access Journals (Sweden)

    Claudia Santo

    2011-04-01

    Full Text Available El método que se propone es un método de fácil aplicación y accesible a los laboratorios a un bajo costo, contando además con una incertidumbre asociada compatible con la calibración de la mayoría de los aerómetros disponibles en el mercado. Se evaluó la influencia del agregado de un tensoactivo al agua destilada saturada en aire en la densidad de la misma a distintas temperaturas. Se utilizó para ello un patrón de volumen, aplicando el método de pesada hidrostática. Se presenta una tabla con los datos relevados, que demuestran que las variaciones pueden ser contempladas dentro de la incertidumbre del valor asignado a la densidad del agua destilada. Se proporciona un listado del equipamiento y materiales necesarios para implementar esta medición, el cual es de bajo costo y uso común en muchos laboratorios, por lo que enmuchos casos no se requiere una inversión extra para la implementación del método. Se detalla a su vez un procedimiento de calibración de aerómetros en estas condiciones. Se presentan datos de validación del método donde se evaluaron los parámetros de validación: reproducibilidad y exactitud. La reproducibilidad se evaluó con repeticiones del mismo aerómetro en distintas condiciones y con distintos operadores y la exactitudse evaluó comparando los datos obtenidos por calibración con este método con los resultados obtenidos en un laboratorio independiente. Se detallan las componentes de incertidumbre del método así como la metodología utilizada para su estimación, demostrándose que las incertidumbres alcanzables por este método permiten la calibración de la mayoría de los aerómetros disponibles en el mercado.

  2. Entrenamiento de la capacidad aeróbica por medio de la terapia acuática en niños con parálisis cerebral tipo diplejía espástica

    Directory of Open Access Journals (Sweden)

    Nandy Fajardo-López

    2013-12-01

    Full Text Available Antecedentes. La parálisis cerebral tipo diplejía espática genera cambios en el sistema cardiovascular que afectan la capacidad aeróbica. La terapia acuática es una estrategia terapéutica óptima tanto para el manejo de la población como para el entrenamiento de la capacidad aeróbica, por las respuestas fisiológicas que genera y porque brinda la facilidad de generar mayores cargas al sistema cardiovascular con menores riesgos que en tierra. Objetivo. Identificar las características que debe tener una propuesta de intervención fisioterapéutica para el entrenamiento de la capacidad aérobica en niños y niñas entre los 8 y los 12 años, con parálisis cerebral tipo diplejía espástica, empleando la terapia acuática. Materiales y métodos. Se desarrolló un estudio de tipo descriptivo-propositivo, en el cual se formuló una propuesta de intervención basada en información recolectada a través de referencias bibliográficas. Resultados. Se presentan en forma de propuesta de intervención, describiendo en detalle las fases del entrenamiento de la capacidad aeróbica, mediante los principios del entrenamiento y la prescripción de ejercicio físico, teniendo en cuenta las respuestas fisiológicas ante la carga, así como las características propias de la población. Conclusión. La parálisis cerebral tipo diplejía espástica, genera cambios en la capacidad aeróbica; por esto, el fisioterapeuta debe incluirla en los procesos de rehabilitación como uno de sus objetivos. Para lograrlo, la terapia acuática es una modalidad de tratamiento óptima, puesto que genera mayor seguridad de movimiento y respuestas fisiológicas favorables en el sistema cardiovascular.

  3. Evaluación del estado nutricional, consumo de macronutrientes y calcio en personas que superan los 40 años con menopausia y andropausia que realicen entrenamientos con sobrecarga y/o aeróbico

    OpenAIRE

    García Gumier, Tobías

    2014-01-01

    La menopausia y andropausia son etapas biológicas en la vida en las cuales hay que tomar recaudos, afrontarlas con alegría y responsabilidad. Es fundamental realizar una adecuada alimentación y un correcto aporte de macro y micro nutrientes, acompañado de actividad física, para evitar problemas óseos y musculares e incluso un estado nutricional poco saludable. Objetivo: Determinar la relación entre la actividad física con sobrecarga y aeróbica, la ingesta de macronutrientes...

  4. Biblioteca de perfis moleculares de bactérias aeróbias formadoras de endósporos obtidos por espectrometria de massa MALDI-TOF, com sistema de qualidade

    OpenAIRE

    Bezerra, Flávia Porto Carreiro Araújo

    2016-01-01

    Bactérias aeróbias formadoras de endósporos (Bafes) possuem a capacidade de se diferenciarem em esporos notavelmente resistentes e apresentarem grande diversidade fisiológica, características que conferem importância ambiental, biotecnológica e sanitária, entre outras. A Coleção de Bafes (CBafes) compreende 154 linhagens (SDF) selvagens de Bafes isoladas do solo do Distrito Federal, Brasil, analisadas segundo abordagem polifásica, que envolve a caracterização fenotípica, genotípica, complemen...

  5. O papel do esteroide anabolizante sobre a hipertrofia e força muscular em treinamentos de resistência aeróbia e de força

    OpenAIRE

    Everton Crivoi do Carmo; Carlos Roberto Bueno Junior; Tiago Fernandes; Diego Barretti; Stéphano Freitas Soares; Natan Daniel da Silva Junior; Marco Carlos Uchida; Patrícia Chakur Brum; Edilamar Menezes de Oliveira

    2011-01-01

    INTRODUÇÃO: Os efeitos dos esteroides anabolizantes (EA) sobre a massa muscular e força são controversos e dependentes do treinamento realizado e das fibras musculares recrutadas. Com isso, o objetivo deste estudo foi avaliar os efeitos da associação de EA ao treinamento de força ou aeróbio sobre a hipertrofia e força muscular. MÉTODOS: Ratos Wistar (42) foram divididos em seis grupos: sedentário (SC, n = 7), sedentário anabolizante (SA, n = 7), treinado natação controle (TNC, n = 7), treinad...

  6. Efectos de un entrenamiento combinado de fuerza de intensidad moderada y aer??bico intenso, sobre la calidad de vida, IGF-I, fuerza y consumo de ox??geno, en mujeres sobrevivientes de c??ncer de mama

    OpenAIRE

    Fern??ndez Ortega, Jairo Alejandro

    2015-01-01

    247 p. El prop??sito del estudio fue determinar los efectos de un programa de ejercicio combinado de fuerza y aer??bico intenso, sobre la calidad de vida (QOL), fatiga, consumo pico de ox??geno, fuerza, e IGF-I, en ocho pacientes sobrevivientes de c??ncer de mama (PSCAM) sometidas a cirug??a, quimioterapia y/o radioterapia y en tratamiento con tamoxifeno. Las pacientes realizaron un programa de entrenamiento de fuerza de intensidad moderada y a??robico intenso, tres veces por semana, duran...

  7. Influência do exercício aeróbio na renina de portadores de hipertensão arterial com sobrepeso Influencia del ejercicio aeróbico en la renina de portadores de hipertensión arterial con sobrepeso Effect of aerobic exercise on plasma renin in overweight patients with hypertension

    Directory of Open Access Journals (Sweden)

    Bruno Martinelli

    2010-07-01

    Full Text Available FUNDAMENTO: A atividade do sistema renina-angiotensina-aldosterona tem relação direta com sobrepeso e sedentarismo, e essas variáveis se associam à hipertensão arterial (HA. O exercício aeróbio propicia melhor controle da pressão arterial (PA por agir nos mecanismos da regulação pressórica, dentre eles, a atividade de renina plasmática (ARP. OBJETIVO: Avaliar a influência do exercício aeróbio sobre ARP em portadores de HA com sobrepeso. MÉTODOS: Foram avaliados níveis pressóricos, bioquímicos e antropométricos pré e pós-treinamento de 16 semanas, três vezes por semana, a 60%-80% da frequência cardíaca máxima. Os dados foram expressos em média ± desvio padrão ou mediana e intervalo interquartílico, e analisados pelo teste "t", Mann-Withney e ANOVA (p FUNDAMENTO: La actividad del sistema renina-angiotensina-aldosterona tiene relación directa con sobrepeso y sedentarismo, y esas variables se asocian a la hipertensión arterial (HA. El ejercicio aeróbico propicia mejor control de la presión arterial (PA por actuar en los mecanismos de la regulación presórica, entre ellos, la actividad de renina plasmática (ARP. OBJETIVO: Evaluar la influencia del ejercicio aeróbico sobre ARP en portadores de HA con sobrepeso. MÉTODOS: Fueron evaluados niveles presóricos, bioquímicos y antropométricos pre y post-entrenamiento de 16 semanas, tres veces por semana, a 60%-80% da frecuencia cardíaca máxima. Los datos fueron expresados en media ± desvío estándar o media e intervalo intercuartílico, y analizados por el teste "t", Mann-Withney y ANOVA (p BACKGROUND: The activity of the renin-angiotensin-aldosterone system (RAAS is directly related to overweight and sedentary lifestyles, both of which are associated with hypertension. Aerobic exercise helps control blood pressure (BP by acting on mechanisms of blood pressure regulation, such as plasma renin activity (PRA. OBJECTIVE: To assess the effect of aerobic exercise on

  8. Índice glicêmico da refeição pré-exercício e metabolismo da glicose na atividade aeróbica

    Directory of Open Access Journals (Sweden)

    Valéria Cristina de Faria

    2014-04-01

    Full Text Available O índice glicêmico (IG é um indicador funcional que pode ser usado para classificar carboidratos de acordo com sua resposta glicêmica e insulinêmica em relação a um alimento conhecido, pão branco ou glicose. No ramo da nutrição esportiva, este é considerado principalmente para compor a refeição pré-exercício, pois afeta diretamente a resposta glicêmica pós-prandial, e dependendo de alguns fatores, tais como o tempo prévio de ingestão, existe o risco de hipoglicemia de rebote durante o exercício. Elucidar, atraves de uma revisão sistematizada, qual estratégia nutricional é a mais adequada empregando refeições de diferentes índices glicêmicos pré-exercício. Foi consultada a base de dados PubMed, utilizando os descritores: aerobic exercise, glicemic index e glycemia, de forma combinada. Foram adotados como critérios de inclusão artigos originais, publicados em inglês nos últimos cinco anos e realizados com humanos, e como critério de exclusão, amostra não saudável e exercício sem predominância aeróbica. Foram selecionados 11 artigos, os quais variavam quanto ao gênero da amostra e seu condicionamento, o tipo de exercício selecionado, assim como sua duração e intensidade, o valor de IG adotado, e o tempo prévio de ingestão alimentar, de 15 minutos a três horas. Pela recorrência de alguns resultados, alimentos de baixo índice glicêmico causam menor alteração glicêmica pós-prandial, o que pode acarretar em um comportamento mais estável ao longo do exercício, tornando-se uma estratégia nutricional mais conservadora para a população em geral.

  9. Betabloqueio com atenolol não reduz potência aeróbia nem muda limiares ventilatórios em hipertensos sedentários

    Directory of Open Access Journals (Sweden)

    Dinoélia Rosa Souza

    2013-10-01

    Full Text Available INTRODUÇÃO: O exercício aeróbio é recomendado para o tratamento da hipertensão. Sua intensidade pode ser prescrita com base na porcentagem da frequência cardíaca máxima (%FCmáx ou no consumo pico de oxigênio (%VO2pico em que os limiares ventilatórios (LV são alcançados. Entretanto, alguns hipertensos que iniciam o treinamento podem estar tomando betabloqueadores, o que pode influenciar esses parâmetros. OBJETIVO: verificar os efeitos do atenolol sobre os LV de hipertensos sedentários. MÉTODOS: Nove voluntários realizaram dois testes ergoespirométricos máximos após quatro semanas de tratamento com atenolol (25 mg administrado por via oral duas vezes por dia e com placebo, administrados em ordem fixa e de forma cega. Durante os testes, a frequência cardíaca (FC, a pressão arterial (PA e o VO2 no repouso, limiar anaeróbio (LA, ponto de compensação respiratória (PCR e pico do esforço foram analisados. RESULTADOS: O VO2 aumentou progressivamente no exercício e seus valores foram semelhantes nos dois tratamentos. A PA sistólica e a FC também aumentaram no exercício, mas seus valores absolutos foram significativamente menores com o atenolol. Porém, o aumento da PA sistólica e da FC no exercício foi semelhante com os dois tratamentos. Assim, o percentual da FCmáx e o percentual do VO2pico em que LA e PCR foram alcançados não diferiram entre o placebo e o atenolol. CONCLUSÃO: O atenolol na dosagem de 50 mg/dia não afetou o percentual do VO2pico e da FCmáx em que os LV são atingidos, o que confirma que a prescrição de intensidade de treinamento com base nessas porcentagens pode ser mantida em hipertensos que recebem betabloqueadores.

  10. Capacidade aeróbia de ratos alimentados com dieta rica em frutose Aerobic capacity of rats fed with fructose rich diet

    Directory of Open Access Journals (Sweden)

    Rodrigo Ferreira de Moura

    2008-10-01

    Full Text Available INTRODUÇÃO: Evidências apontam que a ingestão exacerbada de frutose pode desencadear distúrbios característicos da síndrome metabólica. OBJETIVOS: Analisar os efeitos da ingestão de dieta rica em frutose sobre aspectos metabólicos de ratos da linhagem Wistar. Adicionalmente, verificar a capacidade aeróbia através da identificação da máxima fase estável de lactato (MFEL. MÉTODOS: Dezesseis ratos foram separados em dois grupos de oito animais: a controle, alimentados com dieta balanceada, e b frutose, alimentados com dieta rica em frutose. Foram analisadas a tolerância à glicose (área sob a curva de glicose durante teste de tolerância à glicose, sensibilidade à insulina (taxa de remoção da glicose sérica após sobrecarga exógena de insulina, perfil lipídico sérico e concentração de lactato sanguíneo [lac]s durante exercício na intensidade da MFEL. RESULTADOS: Teste t não pareado (p INTRODUCTION: Evidence points that exacerbated ingestion of fructose may trigger disturbs characteristic of the metabolic syndrome. OBJECTIVES: To analyze the effects of a fructose rich diet on metabolic aspects of Wistar lineage rats. Additionally, to verify the aerobic capacity, through the identification of the maximal lactate steady state (MSSL. PROCEDURES: Sixteen rats were separated in two groups of eight animals: a Control, fed a balanced diet, and b fructose, fed a fructose-rich diet. The glucose tolerance, (area under serum glucose during a glucose tolerance test, insulin sensibility (glucose disappearance rate after exogenous insulin administration, serum lipid profile and blood lactate concentration [lac]b during exercise at MSSL intensity, have been analyzed. RESULTS: Non-paired t test (p<0.05 revealed difference between groups in the area under the curve of glucose and serum triglycerides, no difference in insulin sensibility or in [lac]b was detected, though. One-way ANOVA with Newman Keuls post hoc revealed difference in

  11. Efeitos de diferentes modelos de periodização do treinamento aeróbio sobre parâmetros cardiovasculares, metabólicos e composição corporal de bombeiros militares

    Directory of Open Access Journals (Sweden)

    Anselmo José Perez

    2013-09-01

    Full Text Available O objetivo do estudo foi analisar o efeito de programa de treinamento aeróbio sobre parâmetros cardiovasculares, metabólicos e de composição corporal comparando diferentes periodizações. Sessenta e cinco bombeiros militares/ES (25,9 ± 0,6 anos foram divididos em quatro grupos: controle (Gcon, n = 15 sem tratamento; ondulatório (Gond, n = 18, escalonado (Ges, n = 17, e crescente (Gcres, n = 15, e treinaram 13 semanas, três sessões semanais de 30 minutos e intensidades de 60% a 90% FCmáx. A frequência cardíaca (FC foi controlada em todas as sessões . Antes e após o programa foram realizadas avaliações antropométricas e teste cardiopulmonar (Aerosport TEEM-100. Houve redução no percentual de gordura, bradicardia em repouso e da FC submáxima com aumento do consumo de oxigênio, e redução do duplo produto, da PAD em repouso para os três grupos treinados, sem vantagens adicionais para o Gcres. Esses resultados sugerem que programas de treinamento aeróbio com distribuição de intensidade ao longo das semanas de forma escalonada e/ou ondulatória podem ser mais apropriados para indivíduos não atletas.

  12. Perfil lipídico e glicêmico de ratos treinados em exercício aeróbio ou anaeróbio e suplementados com maltodextrina

    Directory of Open Access Journals (Sweden)

    Cátia Fernandes Leite

    2013-03-01

    Full Text Available OBJETIVO: verificar as alterações no perfil lipídico e glicêmico de ratos treinados, suplementados com maltodextrina. MATERIAIS E MÉTODOS: o protocolo de treinamento consistiu de 8 semanas de natação em padrão contínuo (60min.dia-1 ou intermitente (2 períodos de 30min, com intervalo de 10min, com sobrecargas correspondentes a 5% e 10% do peso corporal, respectivamente. Durante 37 dias os animais foram suplementados com uma dose diária de 0,48g.kg-1 de maltodextrina dissolvida em água ou receberam água pura. RESULTADOS: o exercício aeróbio ocasionou aumento significativo no nível glicêmico. Os exercícios e a maltodextrina não causaram alterações no perfil lipídico. CONCLUSÃO: o exercício aeróbio proporcionou elevação no nível glicêmico, não causando hipoglicemia.

  13. Microbiota bacteriana aeróbia da conjuntiva de doadores de córnea Aerobic bacterial microbiota of the conjunctiva of cornea donors

    Directory of Open Access Journals (Sweden)

    Paula Fontana Lorenzini

    2007-03-01

    Full Text Available OBJETIVOS: Determinar a microbiota bacteriana aeróbia da conjuntiva de doadores de córnea e seu padrão de suscetibilidade a antibióticos; verificar o número de córneas utilizadas para transplante e a média de tempo de preservação em solução preservante com gentamicina e estreptomicina; traçar o perfil dos doadores e receptores de córnea. MÉTODOS: Espécimes clínicos foram colhidos de saco inferior da conjuntiva de ambos os olhos, de 40 doadores de córnea. As amostras foram inoculadas em ágar sangue azida, ágar chocolate e ágar MacConkey e o antibiograma foi realizado pelo método de Kirby-Bauer. RESULTADOS: A freqüência de cultura positiva da conjuntiva de doadores de córnea foi de 72,5%, sendo que Gram-positivos totalizaram 81,6% e apenas 18,4% das amostras foram identificadas como Gram-negativos. Vancomicina inibiu 100% dos Gram-positivos, ao passo que a sensibilidade dos Gram-negativos à gentamicina foi de 53,8% e à estreptomicina foi de 30%. O sexo masculino predominou entre os doadores e receptores, a média de tempo entre o óbito e a enucleação foi de 2h e a de preservação em solução preservante com gentamicina e estreptomicina foi de 7 dias. Neoplasia e mais de uma causa associada foram as causas de óbito mais freqüentes. O ceratocone foi a principal indicação para transplante (51,7%. CONCLUSÕES: Staphylococcus coagulase negativo foi o microrganismo com o maior número de isolamentos, apresentando sensibilidade variada aos antimicrobianos. A quantidade de córneas utilizadas para transplante foi bastante inferior em relação ao total de captações. O perfil dos doadores e receptores de córnea mostrou-se heterogêneo para grande parte das variáveis analisadas.PURPOSE: To determine aerobic bacterial microbiota of the conjunctiva of cornea donors and its patterns of susceptibility to antibiotics; verify the number of corneas used for transplant and the average time of preservation in solutions with

  14. O grau de melhora na função das células progenitoras endoteliais derivadas da medula óssea é dependente do volume de treinamento físico aeróbio

    Directory of Open Access Journals (Sweden)

    Tiago Fernandes

    2013-08-01

    Full Text Available INTRODUÇÃO: A angiogênese muscular esquelética induzida pelo treinamento físico aeróbio (TF é determinante na melhora da capacidade aeróbia. Entre os fatores envolvidos, as células progenitoras endoteliais (CPE derivadas da medula óssea são descritas por promoverem o reparo vascular e a angiogênese. Embora o papel do TF sobre os parâmetros das CPE tenha sido investigado, pouco se conhece sobre os efeitos de diferentes volumes de TF sobre a função das CPE da medula óssea, alterações metabólicas e capilarização muscular. OBJETIVO: Testar a hipótese de que o TF melhore a função das CPE da medula óssea, acompanhada por maior capilarização e capacidade oxidativa muscular dependentes do aumento de volume de TF. MÉTODOS: Vinte e uma ratas Wistar foram divididas em três grupos: sedentário controle (SC, treinado protocolo 1 (P1, treinado protocolo 2 (P2. P1: o treinamento de natação consistiu de 60 min, 1x/dia, cinco dias/semana/10 semanas, com 5% de sobrecarga corporal. P2: o mesmo de P1 até a oitava semana, na nona semana os animais treinaram 2x/dia e na 10ª semana 3x/dia. RESULTADOS: O TF promoveu bradicardia de repouso, aumento da tolerância ao esforço, do consumo de oxigênio de pico e da atividade da enzima citrato sintase muscular no grupo P1, sendo estas adaptações mais exacerbadas no grupo P2, indicando que a condição aeróbia foi mais proeminente com este TF. O TF melhorou a função das CPE da medula óssea em P1, sendo ainda maior esta resposta no grupo P2. Em paralelo, observa-se também um aumento no número de capilares dependentes do volume de TF. CONCLUSÃO: Estes resultados sugerem que a medula óssea como o principal reservatório de CPE é influenciada por diferentes volumes de TF, sendo possivelmente responsável pelo maior rendimento físico observado mediante uma maior mobilização endógena de CPE, participantes ativas no processo de angiogênese muscular induzido pelo TF.

  15. Efeitos do exercício aeróbio durante a hemodiálise em pacientes com doença renal crônica: uma revisão da literatura

    Directory of Open Access Journals (Sweden)

    Joseane Böhm

    2012-06-01

    Full Text Available INTRODUÇÃO: Pacientes com doença renal crônica (DRC têm capacidade física e funcional reduzida quando comparados à população geral. O tratamento hemodialítico torna as atividades desses pacientes restritas, favorecendo o estilo de vida sedentário e a limitação funcional. Pacientes em hemodiálise (HD são menos ativos, apresentam baixa tolerância ao exercício e alto descondicionamento físico. Em virtude dessas alterações, têm sido propostos programas de exercício físico que visam não somente ao tratamento dos sinais clínicos da doença, mas de suas repercussões na função e na qualidade de vida. OBJETIVOS: Realizar uma revisão da literatura sobre os efeitos do exercício físico em pacientes portadores de DRC submetidos a programas de exercício aeróbio em cicloergômetro para membros inferiores durante a HD. MÉTODOS: Foram realizadas consultas às bases de dados Medline, PubMed, Scielo, Embase e ScienceDirect. RESULTADOS: Analisaram-se 14 estudos experimentais randomizados controlados, considerando o período de realização da intervenção na HD, a intensidade e a frequência do exercício, a duração da intervenção e os principais resultados. CONCLUSÃO: Os estudos demonstraram que exercícios aeróbios realizados durante a HD promovem a melhora da capacidade aeróbia e o condicionamento físico, além de redução da fadiga e ansiedade, melhora da capilarização muscular e pressão arterial de repouso, aumento no tempo de duração dos exercícios e melhora na depuração da ureia.

  16. Efectos del ejercicio aeróbico en los niveles de ansiedad y depresión en las personas seropositivas para la infección por el Virus de Inmunodeficiencia Humana (VIH

    Directory of Open Access Journals (Sweden)

    Adriana Carvajal Sancho

    2001-07-01

    Full Text Available Se ha sugerido que existe una relación entre el estrés psicológico, la progresión de la infección por el Virus de Inmunodeficiencia Humana (VIH y la calidad de vida de estas personas. Algunos de los factores psicosociales que podrían afectar la progresión de la infección son la presencia de depresión y niveles altos de ansiedad. Los factores psicosociales y de comportamiento son modificables, y aparentemente es posible mejorar la calidad de vida y prolongar la sobrevida de las personas seropositivas para el VIH o con Sida por medio de una intervención psicosocial. La progresión de la infección está acompañada con el aumento de los niveles de ansiedad y depresión en esta población. La depresión y ansiedad no solo son capaces de alterar factores psicosociales (ej. apatía, autoestima, deseos de suicidio, sino que podrían estar directamente relacionados con síntomas 'de la infección, la fatiga y discapacidades físicas. Una de las terapias sugeridas para disminuir la presencia de ansiedad y depresión en la población seropositiva al VIH ha sido el ejercicio aeróbico. En la población general, el ejercicio aeróbico de intensidad moderada tiene el potencial de aliviar la ansiedad, depresión, estado de ánimo y restaurar la función inmune. Los estudios en los que se ha investigado el efecto del ejercicio aeróbico en personas con el VIH en parámetros como la ansiedad y depresión aún no son consistentes. Sin embargo, existe suficiente información experimental que indica que el ejercicio podría ser un tratamiento alternativo para mejorar la calidad de vida de esta población.

  17. Aerobic bacteria, Chlamydia trachomatis, Pneumocystis carinii and Cytomegalovirus as agents of severe peneumonia in small infants Bactérias aeróbias, Chlamydia trachomatis, Pneumocystis carinii e Cytomegalovirus: agentes causadores de pneumonia grave em pequenos lactentes

    Directory of Open Access Journals (Sweden)

    Bernardo Ejzenberg

    1996-02-01

    Full Text Available The authors studied 58 infants hospitalized for pneumonia in a semi-intensive care unit. Age ranged from 1 complete to 6 incomplete months. The infants were sent from another hospital in 20 cases and from home in a further 38. Pulmonary involvement, which was alveolar in 46 cases and interstitial in 12, was bilateral in 31 children. The investigation was carried out prospectively on the etiological agents associated with respiratory infection to look for evidence of aerobic bacteria (blood cultures, Chlamydia trachomatis and Cytomegalovirus (serology, and Pneumocystis carinii (direct microscopy of tracheal aspirated material. The following infectious agents were diagnosed in 21 children (36.2%: Aerobic bacteria (8, Chlamydia trachomatis (5, Pneumocystis carinii (3, Cytomegalovirus (3, Cytomegalovirus and Chlamydia trachomatis (1, Aerobic bacteria and Cytomegalovirus (1. Seven cases of infection by Chlamydia trachomatis and/or Cytomegalovirus were diagnosed out of the 12 cases with pulmonary interstitial involvement.Os autores estudaram prospectivamente 58 lactentes internados por pneumonia em unidade semi-intensiva. A idade foi limitada entre 1 mês completo e 6 meses incompletos. A procedência das crianças foi de outro hospital em 20 casos e domiciliar em 38. O acometimento pulmonar era alveolar em 46 casos, intersticial em 12 e bilateral em 31 crianças. Foram pesquisados agentes etiológicos associados à infecção respiratória dos lactentes jovens: Bactérias aeróbias (Hemoculturas, Chlamydia trachomatis e Cytomegalovirus (sorologia, e Pneumocystis carinii (microscopia direta do aspirado traqueal. Foram diagnosticadas infecções em 21 crianças (36,2%: Bactérias aeróbias (8, Chlamydia trachomatis (5, Cytomegalovirus (3, Pneumocystis carinii (3, Cytomegalovirus e Chlamydia trachomatis (1, Bactéria aeróbia e Cytomegalovirus (1. Foram diagnosticadas 7 infecções por Chlamydia trachomatis e/ou Cytomegalovirus entre as 12 crianças com

  18. Efeitos da terapia laser de baixa intensidade associada ao exercício aeróbio no reparo de tenotomia do tendão de aquiles de ratos diabéticos

    OpenAIRE

    Oliveira, Anderson Rodrigues de

    2016-01-01

    Diabetes Mellitus (DM) é um grupo de doenças caracterizada por anormalidades metabólicas e complicações crônicas. A hiperglicemia característica dessa doença produz glicosilação de proteínas e consequente acúmulo de produtos finais da glicosilação em vários tecidos humanos, entre eles, o tendão. O exercício aeróbio (EA) e a terapia laser de baixa intensidade (TLBI) têm sido utilizados no manejo de tendinopatias em indivíduos com ou sem DM. Objetivo: O objetivo desse estudo é observar o efeito...

  19. O bloqueio da síntese do óxido nítrico promove aumento da hipertrofia e da fibrose cardíaca em ratos submetidos a treinamento aeróbio

    OpenAIRE

    Souza, Hugo Celso Dutra de; Penteado,Daniel Martins Dias; Martin-Pinge,Marli Cardoso; Barbosa Neto,Octávio; Teixeira,Vicente de Paula Antunes; Blanco,João Henrique Dutra; Silva, Valdo José Dias da

    2007-01-01

    OBJETIVO: O presente estudo avaliou as adaptações teciduais cardíacas em ratos submetidos a treinamento aeróbio, após o bloqueio da síntese de óxido nítrico (NO). MÉTODOS: Os animais (n = 48) foram divididos em quatro grupos: sedentários (grupo CONTROLE), hipertensos após administração de Ng-nitro-L-arginina metil éster durante sete dias (grupo L-NAME), treinados por meio de natação durante oito semanas (grupo TREINADO) e treinados e tratados com L-NAME na última semana (grupo TREINADO L-NAME...

  20. Efeito do treinamento físico de membros superiores aeróbio de curta duração no deficiente físico com hipertensão leve

    OpenAIRE

    Haddad Sandra; Silva Paulo Roberto Santos; Pereira Barretto Antonio Carlos; Ferraretto Ivan

    1997-01-01

    OBJETIVO: Verificar as alterações provocadas pelo treinamento físico (TF), com membros superiores (MMSS), em condição aeróbia de curta duração, sobre variáveis dos sistemas cardiovascular e metabólico. MÉTODOS: Foram estudados 11 deficientes físicos (DF) paraplégicos, com média de idade de 59 anos, sendo 7 homens e 4 mulheres, com lesão de T9 a T11 e grau leve de hipertensão arterial sistêmica (HAS). Os DF foram avaliados antes e após 12 semanas de um programa de TF supervisionado de MMSS, po...

  1. Efeito do treinamento aeróbio nos níveis de homocisteína em indivíduos diabéticos do tipo 2

    Directory of Open Access Journals (Sweden)

    Alexandre de Souza e Silva

    2015-08-01

    Full Text Available INTRODUÇÃO: Os programas de treinamento aeróbio têm demonstrado bons resultados no controle das variáveis de risco cardiovascular em indivíduos diabéticos; no entanto, os efeitos nos níveis de homocisteína não estão claros. Objetivo: Analisar os efeitos do treinamento aeróbio nos níveis plasmáticos de homocisteína e fatores de risco cardiovascular em indivíduos diabéticos do tipo 2.MÉTODOS: Participaram do estudo 15 mulheres com diabetes do tipo 2 e média de idade 68,86 ± 11,2 anos. Todos os indivíduos da amostra foram submetidos a um teste de avaliação do consumo máximo de oxigénio (VO2máx seguindo o protocolo de Bruce, avaliação da pressão arterial e avaliação antropométrica. Foi também efetuada uma coleta de 10 ml de sangue (veia antecubital em jejum de no mínimo 12 horas. O plasma foi separado e processado para posterior análise da concentração de homocisteína (mmol/l, colesterol total (mg/dl, lipoproteína de muito baixa densidade (VLDL (mg/dl, lipoproteína de baixa densidade (LDL (mg/dl, lipoproteína de alta densidade (HDL (mg/dl, triglicérides (mg/dl e glicemia (mg/dl. Os testes foram feitos antes e após 16 semanas de treinamento aeróbio. O programa foi realizado com 2 sessões de treinamento não consecutivas por semana, com intensidade compreendida entre 60% e 70% da frequência cardíaca máxima e duração de 75 minutos por sessão.RESULTADOS: Os resultados observados revelam que o programa de exercício físico induziu uma diminuição não significativa da concentração plasmática de homocisteína. Foram ainda identificadas melhorias do perfil lipídico e do Consumo Máximo de Oxigênio (VO2máx, diminuição da glicemia, da pressão arterial diastólica, do percentual de gordura e massa gorda.CONCLUSÃO: Conclui-se que o programa de treinamento aeróbio reduziu o risco cardiovascular em indivíduos diabéticos do tipo 2, embora a alteração da homocisteína não tenha sido significativa.

  2. Caracterização de produtos microbianos solúveis (SMPs) em reatores aeróbio e anaeróbio de bancada em diferentes condições operacionais

    OpenAIRE

    Mesquita,Patrícia da Luz

    2009-01-01

    O tratamento biológico é caracterizado pela utilização de bactérias, aeróbias e/ou anaeróbias, para a degradação da matéria orgânica poluente. A análise da demanda química de oxigênio (DQO) é frequentemente utilizada para quantificar a matéria orgânica nos efluentes e medir a eficiência do tratamento biológico. A DQO efluente de reatores biológicos é compreendida não apenas por compostos afluentes que não foram degradados, mas também por compostos produzidos pelos microrganismos durante o tra...

  3. Parâmetros nutricionais e estabilidade aeróbia de silagens de cereais de inverno submetidas a diferentes regimes de corte no estádio vegetativo

    Directory of Open Access Journals (Sweden)

    G.F.M. Leão

    Full Text Available RESUMO O uso de regimes de corte em estádio vegetativo para os cereais de inverno é interessante quando se busca intensificar a produção de alimento volumoso para ruminantes. No entanto, é necessário se averiguar o impacto desse manejo sobre as características das silagens resultantes. Dessa forma, o objetivo do experimento foi avaliar o valor nutricional e a estabilidade aeróbia de silagens de cereais de inverno, submetidas a regimes de corte no estádio vegetativo, prévio ao corte para ensilagem. Os cereais utilizados foram trigo (Triticum aestivum cv. BRS Gralha Azul, cevada (Hordeum vulgare cv. BRS Brau, aveia-branca (Avena sativa cv. URS Guará, aveia- preta (Avena strigosa cv. Embrapa 139 e triticale (X Triticosecale cv. IPR 11, associados a três regimes de corte: sem cortes prévios (silagem exclusiva; um corte; e com dois cortes em estádio vegetativo e subsequente produção de silagem. Na avaliação nutricional, a cevada apresentou valores baixos de FDA (311,7 e 375,3g kg de MS-1 e altos de NDT (569,2 e 533,4g kg de MS-1 para os sistemas com um e dois cortes, respectivamente. Na avaliação da estabilidade aeróbia, os materiais foram bastante estáveis após a abertura dos silos, com exceção da aveia-branca e da aveia-preta, no regime sem cortes. As silagens de triticale e de cevada apresentaram as maiores estabilidades nutricionais com o aumento no número de cortes.

  4. Perfil lipídico e glicêmico de ratos treinados em exercício aeróbio ou anaeróbio e suplementados com maltodextrina Los lípidos y los niveles de glucosa de las ratas entrenadas en condiciones aeróbicas o anaeróbicas y se complementa con maltodextrina Lipids and glucose levels of trained rats in aerobic or anaerobic conditions and supplemented with maltodextrin

    Directory of Open Access Journals (Sweden)

    Cátia Fernandes Leite

    2013-03-01

    Full Text Available OBJETIVO: verificar as alterações no perfil lipídico e glicêmico de ratos treinados, suplementados com maltodextrina. MATERIAIS E MÉTODOS: o protocolo de treinamento consistiu de 8 semanas de natação em padrão contínuo (60min.dia-1 ou intermitente (2 períodos de 30min, com intervalo de 10min, com sobrecargas correspondentes a 5% e 10% do peso corporal, respectivamente. Durante 37 dias os animais foram suplementados com uma dose diária de 0,48g.kg-1 de maltodextrina dissolvida em água ou receberam água pura. RESULTADOS: o exercício aeróbio ocasionou aumento significativo no nível glicêmico. Os exercícios e a maltodextrina não causaram alterações no perfil lipídico. CONCLUSÃO: o exercício aeróbio proporcionou elevação no nível glicêmico, não causando hipoglicemia.El objetivo fue comprobar los cambios en los lípidos y los niveles de glucosa de las ratas entrenadas complementados con maltodextrina. MATERIAL Y MÉTODOS: El protocolo consistió en 8 semanas de patrón de natación continua (60min.dia-1 o intermitente (2 períodos de 30 min, con un intervalo de 10 min, con sobrecargas que corresponden al 5% y el 10% del peso corporal. Durante 37 días los animales fueron suplementados con una dosis diaria de 0,48 g.kg-1 maltodextrina disuelta en agua o agua pura. RESULTADOS: El ejercicio aeróbico provocó un aumento significativo en los niveles de glucosa en la sangre. Los ejercicios y la maltodextrina no causó cambios en el perfil lipídico. CONCLUSIONES: El ejercicio aeróbico dio lugar en los niveles de glucosa en la sangre, sin causar hipoglucemia.The objective was to verify changes in lipids and glucose levels of trained rats supplemented with maltodextrin. MATERIALS AND METHODS: The training protocol consisted of 8 weeks of continuous swimming pattern (60min.dia-1 or intermittent (2 periods of 30 minutes, with an interval of 10 minutes, with overloads corresponding to 5% and 10% of body weight, respectively. For

  5. Respostas cardiovasculares a mudança postural e capacidade aeróbia em homens e mulheres de meia-idade antes e após treinamento físico aeróbio Cardiovascular responses to postural change and aerobic capacity among middle-aged men and women before and after aerobic physical training

    Directory of Open Access Journals (Sweden)

    ST Leite

    2008-10-01

    Full Text Available OBJETIVO: Comparar respostas cardiovasculares a Manobra Postural Passiva (Tilt Test e capacidade cardiorrespiratória em homens e mulheres de meia-idade antes e após treinamento físico aeróbio. MATERIAIS E MÉTODOS: Sete homens - GH (44,6±2,1 anos e sete mulheres - GM (51,7±4,8 anos, participaram de treinamento físico aeróbio por 12 semanas. Foi realizado protocolo de Tilt Test (cinco minutos supino, dez minutos inclinado 70º, cinco minutos supino, com monitoração da pressão arterial e freqüência cardíaca. Para mensuração da capacidade cardiorrespiratória foi realizado protocolo em cicloergômetro. RESULTADOS: Na condição sedentária, GH mostrou maior influência parassimpática no controle da freqüência cardíaca evidenciada por maior intervalo RR (iRR durante Tilt Test. Na condição treinada, os valores de iRR de ambos os grupos se assemelham, tendo as mulheres iRR maior em supino, mas na inclinação os homens mantêm iRR mais elevado. Para pressão arterial, as mulheres permanecem com valores superiores após treino, mas a freqüência cardíaca tende a se assemelhar em ambos. Já na capacidade cardiorrespiratória, homens e mulheres têm um padrão de comportamento semelhante após treino. Com exceção dos valores absolutos da freqüência cardíaca, sem diferenças entre os grupos, para todas as outras variáveis os homens obtiveram valores superiores aos das mulheres. Observa-se ainda que, após o treinamento, houve redução significativa dos valores de pressão arterial no GM, mesmo continuando superiores aos dos homens. CONCLUSÃO: O treinamento parece ter reduzido os níveis pressóricos nas mulheres, além de serem observadas melhorias na capacidade cardiorrespiratória de ambos os grupos, permanecendo os homens com melhor desempenho do que as mulheres.OBJECTIVE: To compare the cardiovascular responses to passive postural maneuvers (tilt test and the cardiorespiratory capacity in middle-aged men and women

  6. Ioga versus atividade aeróbia: efeitos sobre provas espirométricas e pressão inspiratória máxima Yoga versus aerobic activity: effects on spirometry results and maximal inspiratory pressure

    Directory of Open Access Journals (Sweden)

    Dagoberto Vanoni de Godoy

    2006-04-01

    Full Text Available OBJETIVO: Esclarecer se, em indivíduos saudáveis, a prática de ioga pode modificar a pressão inspiratória máxima e os índices espirométricos quando comparada com a prática de ginástica aeróbia. MÉTODOS: Ensaio clínico controlado. Foram alocados consecutivamente 31 voluntários hígidos, formando-se dois grupos: um que praticou ginástica aeróbia (n = 15 e outro que praticou ioga (n = 16. Os indivíduos do primeiro grupo serviram como controles e praticaram ginástica aeróbia em duas sessões semanais com duração de 45 a 60 minutos por três meses. Os indivíduos do segundo grupo praticaram posturas selecionadas de ioga em duas sessões semanais com a mesma duração, também por três meses. Capacidade vital forçada, volume expiratório forçado no primeiro segundo e pressão inspiratória máxima foram medidos antes e ao final dos três meses de treinamento. RESULTADOS: Os índices espirométricos não apresentaram alterações significativas. As práticas de ioga ou ginástica aeróbia resultaram em pequenos aumentos da pressão inspiratória máxima, não significativos estatisticamente. Contudo, o delta absoluto da pressão inspiratória máxima (final menos inicial do grupo que praticou ioga demonstrou uma variação positiva significativa para ambos os sexos em relação ao grupo controle: sexo masculino 19,5 cm H2O versus 2,8 cm H2O (p = 0,05, e sexo feminino 20 cm H(20 versus 3,9 cm H2O (p = 0,01, respectivamente. CONCLUSÃO: A pressão inspiratória máxima de indivíduos que praticaram ioga ou ginástica aeróbia não aumentou de maneira estatisticamente significativa após três meses de treinamento. Entretanto, a variação absoluta da pressão inspiratória máxima foi maior entre os praticantes de ioga.OBJECTIVE: To clarify whether, in healthy individuals, practicing yoga can modify maximal inspiratory pressure and spirometric indices when compared with the practice of aerobic exercise. MEYHODS: A controlled

  7. Reator compartimentado anaeróbio/aeróbio: sistema de baixo custo para tratamento de esgotos de pequenas comunidades Anaerobic/aerobic baffled reactor: low cost system for sewage treatment in small communities

    Directory of Open Access Journals (Sweden)

    Gustavo H. R. da Silva

    2005-06-01

    Full Text Available No Brasil são conhecidas e usadas várias técnicas de tratamento de esgoto, desde os mais sofisticados sistemas de tratamento aos mais simples processos. Uma alternativa economicamente viável aos sistemas de tratamento de esgotos sanitários é o processo anaeróbio, o qual tem recebido especial atenção nas pesquisas desenvolvidas no País, notadamente os reatores anaeróbios de alta taxa, unidades compactas e com boa eficiência de tratamento. Dentre as alternativas tecnológicas capazes de proporcionar as referidas variações das condições ambientais necessárias à ocorrência dos processos, está o uso de reatores compartimentados anaeróbio/aeróbio. Este trabalho apresenta, como alternativa, um reator compartimentado anaeróbio/aeróbio, tratando esgoto sanitário, como possibilidade de ser utilizado em pequenas comunidades urbanas e rurais. O desempenho do sistema foi avaliado em diversos tempos de detenção hidráulica (TDH, nos quais os melhores valores de Demanda Química de Oxigênio Total (DQOtotal - 73,7% e Sólidos em Suspensão Totais (SST - 78,8%, foram obtidos com TDHtotal de 8 horas (4 horas para a fase anaeróbia e 4 horas para a fase aeróbia. O reator compartimentado apresentou a característica de estabilidade operacional necessária aos sistemas de baixo custo.Several techniques of sewage treatment, from the most sophisticated to the simplest processes, are known in Brazil. An economically viable alternative for the systems of treatment of sanitary sewage is the anaerobic process, which has been given special attention in Brazilian research programs, mainly in the field of high rate anaerobic reactors as they are compact units and have high efficiency. The use of baffled anaerobic/aerobic reactors is one technological solution to provide the necessary variations in environmental conditions to foster the processes mentioned. In this paper an alternative is presented in the form of a baffled anaerobic

  8. Estabilidade aeróbica de silagens de capim-elefante (Pennisetum purpureum, Schum emurchecido e tratado com inoculante microbiano Aerobic stability of wilted grass silages (Pennisetum Purpureum, Schum. treated with microbial inoculant

    Directory of Open Access Journals (Sweden)

    Adriana Guim

    2002-11-01

    Full Text Available Para avaliar o efeito de um inoculante microbiano sobre a estabilidade aeróbica de silagens de capim-elefante (Pennisetum purpureum, Schum pré-seco, foi conduzido um experimento na UNESP, Campus de Jaboticabal. O capim foi cortado com 96 dias de crescimento, permanecendo sob ação do sol, por aproximadamente 5 horas para o emurchecimento. Foram confeccionados silagens, em barricas plásticas de 200 L de capacidade, que receberam (CI ou não (SI o inoculante no momento da ensilagem. Para o estudo da deterioração aeróbica, na abertura dos silos (T0, cada barrica foi subdividida em três profundidades e as silagens expostas ao ar em um sistema, usado para a determinação de CO2, por 2 (T2, 4 (T4, 6 (T6 e 8 (T8 dias. A silagem da camada superficial não apresentou diferenças no valor de pH e contagem de leveduras, em relação à da camada intermediária, porém ambas apresentaram valores superiores à camada mais profunda. O teor de N-NH3 da camada superior foi menor que o da intermediária e profunda, que não diferiram entre si. A interação significativa entre inóculo e tempo de exposição mostrou que nos primeiros tempos de aeração (T0; T2 e T4 as silagens inoculadas não diferiram das controle em termos de pH, teor de N-NH3 e contagem de bolores, mas com avanço do tempo (T6 e T8 passaram a apresentar menor valor de pH, menor contagem de fungos e tendência a menor produção de CO2, indicando menor velocidade de deterioração após seis dias de exposição aeróbica.An experiment was carried out at UNESP, Jaboticabal Campus to evaluate the effect of a microbial inoculant on aerobic stability of wilted grass silage (Pennisetum purpureum, Schum. The grass was cut with 96 days of growing, remaining under sun action 5 hours to wilt. Silages were made in plastic silos, 0.2m³ capacity, that received (CI or not (SI inoculant at the ensilage time. For the study of aerobic deterioration, each silo was subdivided in three levels and the

  9. Treinamento aeróbico melhora a capacidade funcional de pacientes em hemodiálise crônica Aerobic exercise improves physical capacity in patients under chronic hemodialysis

    Directory of Open Access Journals (Sweden)

    Diane Michela Nery Henrique

    2010-06-01

    Full Text Available FUNDAMENTO: Na população geral, a prática regular de exercícios físicos se associa à melhora da capacidade funcional e à redução de eventos cardiovasculares. Já em portadores de doença renal crônica, uma população com significativo comprometimento da capacidade funcional e elevadas taxas de mortalidade cardiovascular, poucos estudos avaliam os efeitos da atividade física. OBJETIVO: Avaliar o efeito do treinamento aeróbico durante as sessões de hemodiálise, sobre a capacidade funcional e a pressão arterial de pacientes renais crônicos. MÉTODOS: Foram avaliados 14 pacientes portadores de doença renal crônica sob tratamento hemodialítico, antes e depois de 12 semanas de treinamento aeróbico realizado durante as sessões de hemodiálise. Os pacientes foram submetidos a monitorização ambulatorial da pressão arterial de 24 horas, teste de caminhada de 6 minutos e teste cardiopulmonar de exercício antes e depois do período de treinamento. RESULTADOS: Após o treinamento, observou-se aumento significativo da distância percorrida no teste de caminhada de 6 minutos de 509 ± 91,9 m para 555 ± 105,8 m, além de redução significativa da pressão arterial sistólica de 151 ± 18,4 mmHg para 143 ± 14,7 mmHg, da pressão arterial diastólica de 94 ± 10,5 mmHg para 91 ± 9,6 mmHg e da pressão arterial média de 114 ± 13,0 mmHg para 109 ± 11,4 mmHg. CONCLUSÃO: O treinamento aeróbico realizado durante as sessões de hemodiálise contribuiu para a melhora da capacidade funcional e para o controle da hipertensão arterial dos pacientes portadores de doença renal crônica.BACKGROUND: In the general population, regular practice of physical exercises is associated with improved physical capacity and reduction of cardiovascular events. Concerning patients with chronic kidney disease, a population with significant impairment of physical capacity and high rates of cardiovascular mortality, few studies have evaluated the effects

  10. Estabilidade aeróbia de silagens de capim-mombaça tratadas com Lactobacillus buchneri Aerobic stability of mombaça grass silages treated with Lactobacillus buchneri

    Directory of Open Access Journals (Sweden)

    Carla Luiza da Silva Ávila

    2009-05-01

    Full Text Available Objetivou-se avaliar o efeito da adição de duas cepas de Lactobacillus buchneri sobre a estabilidade aeróbia de silagens de capim-mombaça. O experimento foi conduzido em delineamento inteiramente casualizado com três repetições, em esquema de parcelas subdivididas no tempo, de modo que os tratamentos (silagens sem inoculantes e com inoculante experimental e comercial foram aleatorizados nas parcelas e os tempos de avaliação aeróbia das silagens (0, 2, 8 ou 10 dias após a abertura dos silos nas subparcelas. Após 90 dias de armazenamento, os silos foram abertos e amostras de aproximadamente 2,5 kg foram retiradas para avaliação da estabilidade aeróbia com base na temperatura de cada amostra. As mudanças químicas e microbiológicas foram avaliadas. Após abertura dos silos, verificou-se aumento nas populações de bactérias do ácido lático, leveduras e fungos filamentosos. Houve aumento nos valores de pH resultante da redução da concentração dos ácidos orgnicos e de aumentos dos teores de matéria seca e proteína bruta. A adição de L. buchneri às silagens melhorou sua estabilidade, enquanto a silagem sem inoculante apresentou estabilidade de 55 horas. As silagens inoculadas não ultrapassaram essa temperatura limite em um período de 10 dias. A melhoria da estabilidade foi ocasionada pela associação de altas concentrações de cido acético ao ácido propiônico e pela menor concentração de ácido lático no momento de abertura, o que inibiu a proliferação de fungos filamentosos e leveduras após abertura dos silos.This study aimed to evaluate the effect of the addition of two L. buchneri strains on the aerobic stability of the Mombaça grass silages. The experiment was carried out in a completely randomized design with three replicates in split-plot in time scheme, so that the treatments (silages without inoculant and with experimental or commercial inoculants were randomized on plot and in times of aerobic

  11. Aerobic stability of triticale silage in single culture or in mixtures with oat and/or legumes Estabilidade aeróbia de silagens de triticale em cultivo exclusivo ou em misturas com aveia e/ou leguminosas

    Directory of Open Access Journals (Sweden)

    Valter Harry Bumbieris Junior

    2010-11-01

    Full Text Available The objective of the present study was to evaluate the aerobic stability and losses during the fermentation process of triticale silages in single crop or in mixtures with oats and/or legumes. The following crops were used for silage production: triticale (X. Triticosecale Wittimack, triticale intercropped with forage pea (Pisum arvense and triticale intercropped with oats (Avena strigosa Schreb, forage pea and vetch (Vicia sativa. The dry matter content and its recovery did not differ among the silages. Buffer capacity was higher for tricale silage intercropped with oats, forage pea and vetch(88.67 m eq. NaOH/100 g DM followed by triticale intercropped with forage pea (80.80 m eq. NaOH/100 g DM. Electric conductivity values were higher in the intercropped triticale silages. Triticale silage presented the lowest temperatures observed in the silos, and the silages of intercropped triticale silages presented higher heat retention and higher pH values. Silage of triticale intercropped with oats and legumes presented lower aerobic stability but it did not reduce the aerobic stability of the total feed. Dry matter recovery during storage and in stability evaluations in aerobiosis is similar among the silages.O objetivo neste trabalho foi avaliar a estabilidade aeróbia e as perdas durante o processo de fermentação de silagens de triticale em cultivo exclusivo ou em misturas com aveia e/ou leguminosas. As culturas utilizadas para produção das silagens foram: triticale (X. Triticosecale Wittimack; triticale em consórcio com ervilha-forrageira (Pisum arvense; e triticale em consórcio com aveia (Avena strigosa Schreb, ervilha-forrageira e ervilhaca (Vicia sativa. O teor de matéria seca e a recuperação de matéria seca não diferiram entre as silagens. A capacidade tampão foi maior para a silagem de triticale cultivado em consórcio com aveia, ervilha-forrageira e ervilhaca (88,67 m eq. NaOH/100 g de MS, seguida da silagem de triticale cultivado

  12. Hipotensão pós-exercício aeróbio: uma revisão sistemática Post-exercisehypotension: a systematic review

    Directory of Open Access Journals (Sweden)

    Juliano Casonatto

    2009-04-01

    Full Text Available Diversos estudos investigaram os efeitos hipotensores após uma sessão de exercício aeróbio em humanos. No entanto, vários aspectos permanecem obscuros em relação à hipotensão pós-exercício (HPE, uma vez que diversas variáveis podem influenciar a resposta hipotensora, como intensidade, duração, tipo de exercício, estado clínico, faixa etária, etnia, sexo e estado de treinamento. Nesse sentido, o objetivo do presente estudo foi revisar sistematicamente a literatura, relacionando as principais variáveis da prescrição de uma sessão de exercício aeróbio e a HPE, assim como apresentar os possíveis mecanismos envolvidos. Foram encontrados 55 estudos que abrangeram a temática HPE e exercício aeróbio em humanos. A ocorrência da HPE está bem estabelecida na literatura, já que vários estudos identificaram reduções da pressão arterial em normotensos e hipertensos. Porém, os possíveis moduladores das respostas hipotensoras, como intensidade e duração da sessão de exercício, ainda são contraditórios. Em relação ao tipo de exercício, porém, existem indicativos de que os realizados de forma intermitente e que utilizam maior massa muscular podem acarretar maior HPE. Além disso, hipertensos devem apresentar maior magnitude e duração da HPE. Contudo, existem lacunas em relação aos diversos mecanismos fisiológicos envolvidos, que parecem ser diferentes entre normotensos e hipertensos.Several studies have investigated the hypotensor effects after an aerobic exercise session in humans. However, many aspects remain unclear concerning post-exercise hypotension (PEH, once many variables can influence on the hypotensor response, such as intensity, duration, type of exercise, clinical status, age, ethnic group, sex and training level. Therefore, the aim of the present study was to systematically review the literature, relating the main prescription variables of an aerobic exercise session to PEH, as well as to present

  13. Treinamento aeróbico prévio à compressão nervosa: análise da morfometria muscular de ratos Aerobic training previous to nerve compression: morphometry analysis of muscle in rats

    Directory of Open Access Journals (Sweden)

    Elisangela Lourdes Artifon

    2013-02-01

    Full Text Available INTRODUÇÃO: Ciatalgia origina-se da compressão do nervo isquiático e implica em dor, parestesia, diminuição da força muscular e hipotrofia. O exercício físico é reconhecido na prevenção e reabilitação de lesões, porém quando em sobrecargas pode aumentar o risco de lesões e consequente déficit funcional. OBJETIVO: Avaliar efeitos de treinamento aeróbico prévio a modelo experimental de ciatalgia em relação a parâmetros morfométricos dos músculos sóleos de ratos. MATERIAIS E MÉTODOS: 18 ratos divididos em três grupos: simulacro (mergulho, 30 segundos; exercício regular (natação, dez minutos diários; e treinamento aeróbico progressivo (natação em tempos progressivos de dez a 60 minutos diários. Ao final de seis semanas de exercício, os ratos foram submetidos ao modelo experimental da ciatalgia. No terceiro dia após a lesão, foram eutanasiados e tiveram seus músculos sóleos dissecados, pesados e preparados para análise histológica. Variáveis analisadas: peso muscular, área de secção transversa e diâmetro médio das fibras musculares. RESULTADOS: Observou-se diferença estatisticamente significativa para todos os grupos quando se comparou músculo controle e aquele submetido à lesão isquiática. A análise intergrupos não apresentou diferença estatisticamente significativa para nenhuma das variáveis analisadas. CONCLUSÃO: Tanto o exercício físico regular quanto o treinamento aeróbico não produziram efeitos preventivos ou agravantes às consequências musculares da inatividade funcional após ciatalgia.INTRODUCTION: Sciatica stems from compression of the sciatic nerve and results in pain, paresthesia, decreased muscle strength and hypertrophy. Exercise is recognized in the prevention and rehabilitation of injuries, but when performed in overload, it may increase the risk of injury and subsequent functional deficit. OBJECTIVE: To evaluate effects of aerobic training prior to an experimental model

  14. Efeito da suplementação de L-carnitina combinada ao exercício aeróbio sobre a composição corporal, lipidemia, gasto energético e desempenho físico de adultos do sexo masculino e feminino

    OpenAIRE

    Christianne de Faria Coelho

    2004-01-01

    O uso de suplementos alimentares à base de carnitina tem se tornado bastante popular dentre atletas. Nos seus possíveis efeitos biológicos, constam o emagrecimento e o melhor condicionamento aeróbio frente ao exercício físico. Embora o uso difundido também entre não-atletas, há poucas evidências científicas nestes grupos populacionais, particularmente adultos. O objetivo deste estudo foi avaliar os efeitos da suplementação de L-carnitina associada ao exercício físico aeróbio sobre a composiçã...

  15. Cambios en algunas variables hematológicas, en un grupo de mujeres mayores de 55 años, luego de un programa de entrenamiento aeróbico Changes in some hematologic variables in a group of women older tan 55 years, after a program of aerobic training

    OpenAIRE

    2003-01-01

    Objetivo: determinar los cambios en algunas variables hematológicas luego de un programa de actividad física aeróbica, por un período de cuatro meses, en un grupo de mujeres sedentarias sanas mayores de 55 años. Método: se estudiaron 14 mujeres mayores de 55 años, sedentarias, sanas, a quienes se les realizó un programa de actividad física aeróbica tres días a la semana, durante cuatro meses consecutivos, con una intensidad entre el 60 y el 85% de la FCmax y una duración de 60 minutos. Antes ...

  16. O treinamento físico aeróbio inibe a sinalização apoptótica muscular esquelética mediada por VEGF-VEGR2 em ratos espontaneamente hipertensos

    Directory of Open Access Journals (Sweden)

    Tiago Fernandes

    2012-12-01

    Full Text Available O treinamento físico aeróbio (TF tem sido utilizado como um importante tratamento não farmacológico da hipertensão arterial (HA, uma vez que ele corrige a rarefação microvascular e reduz a pressão arterial. Estudos mostram que as anormalidades microvasculares estão diretamente associadas às alterações do fator de crescimento vascular endotelial (VEGF e do VEGF receptor 2 (VEGFR2, bem como a um desequilíbrio da sinalização apoptótica na HA. Entretanto, pouco se conhece sobre os efeitos do TF sobre estes parâmetros na HA. Nós hipotetizamos que o TF recupere os fatores angiogênicos e promova um equilíbrio entre as proteínas anti e pró-apoptóticas da família Bcl-2 potencialmente, contribuindo para a revascularização e regressão da doença. Ratos espontaneamente hipertensos (SHR, n = 14 e Wistar Kyoto (WKY, n = 14 com 12 semanas de vida e divididos em quatro grupos: SHR, SHR treinado (SHR-T, WKY e WKY treinado (WKY-T foram estudados. Como esperado, 10 semanas de TF foram efetivas em reduzir a pressão arterial em SHR-T. Além disso, o TF promoveu bradicardia de repouso nos grupos de animais treinados (WKY-T e SHR-T, sendo considerado como um importante marcador de TF aeróbio. O TF também corrigiu a rarefação capilar em SHR-T e esta resposta se deve em grande parte por uma recuperação dos níveis periféricos de VEGF e um aumento na expressão de VEGFR2. Em paralelo, foi observada uma normalização das vias apoptóticas, com aumento da expressão de proteínas antiapoptóticas (Bcl-2 e Bcl-x e redução das pró-apoptóticas (Bad acompanhada pela fosforilação de Bad. Estes resultados sugerem que o TF promove revascularização periférica na HA dependente de um fino balanço de reguladores positivos e negativos de angiogênese.

  17. O papel do esteroide anabolizante sobre a hipertrofia e força muscular em treinamentos de resistência aeróbia e de força

    Directory of Open Access Journals (Sweden)

    Everton Crivoi do Carmo

    2011-06-01

    Full Text Available INTRODUÇÃO: Os efeitos dos esteroides anabolizantes (EA sobre a massa muscular e força são controversos e dependentes do treinamento realizado e das fibras musculares recrutadas. Com isso, o objetivo deste estudo foi avaliar os efeitos da associação de EA ao treinamento de força ou aeróbio sobre a hipertrofia e força muscular. MÉTODOS: Ratos Wistar (42 foram divididos em seis grupos: sedentário (SC, n = 7, sedentário anabolizante (SA, n = 7, treinado natação controle (TNC, n = 7, treinado natação anabolizante (TNA, n = 7, treinado força controle (TFC, n = 7 e treinado força anabolizante (TFA, n = 7. O EA foi administrado duas vezes por semana (10mg/kg/semana. Os protocolos de treinamento foram realizados durante 10 semanas, cinco sessões semanais. Foram avaliadas a hipertrofia dos músculos sóleo, plantar e gastrocnêmio (massa muscular corrigida pelo comprimento da tíbia, a proteína total muscular (Bradford e a força muscular em patas traseiras (testes de resistência à inclinação. RESULTADOS: Não foram observadas diferenças significantes na hipertrofia do músculo sóleo. Os grupos TFC e TFA apresentaram, respectivamente, hipertrofia de 18% e 31% no músculo plantar comparado ao grupo SC. A hipertrofia foi 13% maior no grupo TFA em relação ao grupo TFC. Resultados semelhantes foram encontrados no músculo gastrocnêmio. Os grupos TFC e TFA apresentaram significantes aumentos na quantidade total de proteína nos músculos plantares, sendo essa mais pronunciada no grupo TFA e positivamente correlaciona a hipertrofia muscular. Observamos aumento de força nas patas traseiras nos grupos TCF e TAF. CONCLUSÃO: A administração de EA ou sua associação ao treinamento aeróbio não aumenta a massa muscular e força. Porém, à associação ao treinamento de força leva a maior hipertrofia muscular em fibras glicolíticas. Portanto, o tipo de treinamento físico, recrutamento muscular e características das fibras

  18. A influência do treinamento de força e do treinamento aeróbio sobre as concentrações hormonais de testosterona e cortisol

    Directory of Open Access Journals (Sweden)

    Marcelo Rangel de Araújo

    2008-06-01

    Full Text Available A intenção desse trabalho é rever a influência do treinamento aeróbio e de força, perante as concentrações agudas e crônicas dos hormônios testosterona e cortisol. Além disso, verificar outros fatores importantes, tais como idade, alimentação e ritmo circadiano, os quais podem modificar agudamente as concentrações de testosterona e cortisol, dificultando assim o entendimento das respostas hormonais desencadeadas pelo treinamento. Apesar das diversas controvérsias encontradas no presente estudo, as atividades periodizadas e de alta intensidade parecem estimular maiores liberações de testosterona e pouca liberação de cortisol, potencializando, consequentemente, os níveis de força e hipertrofia muscular. Todavia, novos estudos devem ser realizados com delineamentos mais adequados respeitando as diversas interações (alimentação, idade, sexo, nível de experiência com o treinamento físico, etc. que envolvem o treinamento físico.

  19. Relação entre a administração de esteróide anabólico androgênico, treinamento físico aeróbio e supercompensação do glicogênio Relación entre la administración de un esteroide anabólico androgénico, el tratamiento físico aeróbico y la supercompensación del glucógeno Relation between anabolic androgenic steroid administration, aerobic physical training and glycogen supercompensation

    Directory of Open Access Journals (Sweden)

    Tatiana S Cunha

    2005-06-01

    Full Text Available A supercompensação do glicogênio é uma das adaptações induzidas pelo treinamento físico. Visando potencializar este fenômeno, muitos atletas utilizam doses suprafisiológicas de esteróides anabólicos androgênicos (EAA. O objetivo deste estudo foi avaliar em ratos os efeitos da nandrolona e do exercício aeróbio sobre o peso corporal, triglicerídeos, glicose e reservas de glicogênio. Ratos Wistar machos foram aleatoriamente divididos em quatro grupos: sedentário + veículo (SV, treinado + veículo (TV, sedentário + EAA (SEAA e treinado + EAA (TEAA, n = 7-14/grupo. Receberam injeção i.m. de nandrolona ou veículo durante nove semanas e durante o mesmo período os animais treinados foram submetidos a exercício aeróbio. Os dados foram analisados por ANOVA bifatorial e Tukey (p (SV: 0,2 ± 0,02 = SEAA: 0,21 ± 0,02mg/100mg]. A glicemia e as reservas de glicogênio do sóleo permaneceram inalteradas. O uso de doses suprafisiológicas de nandrolona não potencializou nenhum dos efeitos obtidos em resposta ao treinamento aeróbio.La supercompensación de glucógeno es una de las adaptaciones inducidas por el entrenamiento físico. Visualizando potencializar este fenómeno, muchos atletas utilizan dosis suprafisiológicas de estos esteroides anabólicos androgénicos (EAA. El objetivo de este estudio fue el de evaluar en ratas los efectos de nandrolona y del ejercicio aeróbico sobre el peso corporal, los triglicéridos, la gluclosa y las reservas de glucógeno. Ratas Wistar machos fueron aleatóriamente divididas en 4 grupos: sedentarios + vehículo (SV, entrenada + vehículo (EV, sedentario + EAA (SEAA y entrenada + EAA (EEAA, n = 7-14/grupo. Recibieron una inyección intramuscular de nandrolona en vehículo durante dos semanas y durante este mismo período los animales entrenados fueron sometidos a ejercicio aeróbico. Los datos fueron analizados usando las pruebas estadísticas ANOVA bifactorial y Tukey (p (SV: 0,2 ± 0,02 = SEAA

  20. Validade do teste de 30 minutos (T-30 na determinação da capacidade aeróbia, parâmetros de braçada e performance aeróbia de nadadores treinados Validity of 30 minutes test (T-30 in aerobic capacity, stroke parameters and aerobic performance determination of trained swimmers

    Directory of Open Access Journals (Sweden)

    Rafael Deminice

    2007-06-01

    Full Text Available O objetivo do presente estudo foi verificar a utilização da velocidade de 30 minutos (VT-30, freqüência de braçada (fB, comprimento de braçada (CB e índice de braçada (IB, obtidos no teste T-30, como métodos não-invasivos para determinação da performance aeróbia e técnica de nadadores treinados. Catorze nadadores submeteram-se a três esforços de 400m (85, 90 e 100% do esforço máximo para determinação da velocidade de limiar anaeróbio (VLan correspondente à concentração fixa de 3,5mM de lactato e um esforço máximo de 30 minutos (VT-30. fB, CB e IB foram calculados nos 10m centrais da piscina (nado limpo para o teste T-30 (fBT-30, CBT-30 e IBT-30 e progressivo. Através da relação entre VLan e parâmetros de braçada no teste progressivo, determinaram-se freqüência de braçada de limiar (fBLan, comprimento de braçada de limiar (CBLan e índice de braçada de limiar (IBLan. O tempo para realizar 400m em máximo esforço foi considerado como parâmetro de performance (P400. Não foi encontrada diferença significativa entre VLan (1,29 ± 0,07m.s-1 e VT-30 (1,29 ± 0,08m.s-1, que ainda apresentaram alta correlação (r = 0,90. Os valores de fBLan (33,6 ± 4,14 ciclos/min e fBT-30 (34,9 ± 3,53 ciclos/min e de CBLan (2,09 ± 0,20m/ciclo e CBT-30 (2,09 ± 0,20m/ciclo também não foram significativamente diferentes. Correlações significativas (p The aim of the present study was to verify the use of the 30 minutes velocity (VT-30, stroke rate (SR, stroke length (SL and stroke index (SI, obtained in T-30 test, as non-invasive methods for trained swimmer's aerobic performance and technical determination. Fourteen swimmers accomplished three efforts along 400 m (85, 90 and 100% of the maximum effort for anaerobic threshold speed determination (ATS corresponding to 3.5 mM lactate fixed concentration, as well as a 30 minutes maximal effort (VT-30. SR, SL, and SI were calculated within the 10 m midsection of the swimming pool

  1. Estudo longitudinal do equilíbrio postural e da capacidade aeróbica de idosos independentes Balance and aerobic capacity of independent elderly: a longitudinal cohort study

    Directory of Open Access Journals (Sweden)

    Giovanna A. Lima

    2011-08-01

    Full Text Available OBJETIVO: Avaliar a variação da capacidade aeróbica e do equilíbrio postural em idosos independentes por um período de três anos. MÉTODOS: A capacidade aeróbica dos voluntários foi avaliada por meio do Teste de Caminhada de 6 minutos (TC6; o equilíbrio postural, por meio da Escala de Equilíbrio de Berg (EEB; o número de quedas foi registrado por autorrelato e o nível de atividade física, pelo Questionário Internacional de Atividade Física (IPAQ - versão longa. As avaliações realizadas em 2008 foram comparadas às realizadas em 2005. RESULTADOS: Não houve diferença na pontuação da EEB e no número de quedas dos idosos avaliados (p>0,05. Houve diminuição da distância percorrida entre as duas avaliações, sendo que os voluntários percorreram 52,46±8,4 metros a menos na segunda avaliação. O IPAQ evidenciou aumento de indivíduos considerados ativos na segunda avaliação (83,3%. CONCLUSÃO: O presente estudo demonstrou que o equilíbrio postural, avaliado pela EEB, não se alterou nos idosos independentes e ativos no período de três anos. Nesse mesmo momento, observou-se uma redução da distância percorrida, avaliada pelo TC6.OBJECTIVE: To evaluate the variation in aerobic capacity and postural balance of independents elderly for a period of three years. METHODS: The aerobic capacity of the volunteers was assessed using a six minutes walk test (6MWT, the postural balance was assessed using the Berg Balance Scale (BBS, the number of falls was self-reported and physical activity level was assessed using the International Physical Activity Questionnaire (IPAQ - long version. Evaluations undertaken in 2008 were compared to those performed in 2005. RESULTS: There were no differences in balance and number of falls between 2008 and 2005 (p>0.05. There was a decrease in aerobic capacity over time of 52.46±8.4 meters walked. The IPAQ showed an increase in physical activity on the second evaluation (83.3%. CONCLUSION: The

  2. Estabilidade aeróbia de silagens do capim-marandu submetidas a diferentes intensidades de compactação na ensilagem Aerobic stability of marandu grass silages submitted to different packing intensities during ensiling

    Directory of Open Access Journals (Sweden)

    Rafael Camargo do Amaral

    2008-06-01

    Full Text Available Objetivou-se avaliar a estabilidade aeróbia das silagens de capim-marandu submetidas a diferentes pressões de compactação. A espécie forrageira foi colhida aos 60 dias de crescimento vegetativo. O delineamento experimental utilizado foi o inteiramente casualizado com quatro repetições, utilizando-se o modelo de medidas repetidas no tempo. Os tratamentos constituíram-se de quatro densidades (100, 120, 140 e 160 kg MS/m³. As alterações químicas das silagens foram determinadas com 0, 3 e 6 dias após a abertura. As leituras das temperaturas das silagens foram obtidas em intervalos de 12 horas, 156 horas após a acomodação dos baldes na câmara climática, utilizando-se o termômetro inserido a 10 cm no centro da massa de silagem. As silagens de maiores valores de densidade alcançaram máxima temperatura em maior tempo que as densidades inferiores, evidenciando a maior estabilidade decorrente de melhor compactação da massa ensilada. Com o avançar do tempo de exposição aeróbia, as silagens tiveram aumento nos valores de pH e decréscimos nos teores de nitrogênio amoniacal (N-NH3. Verificou-se queda nos teores de NIDN (nitrogênio insolúvel em detergente neutro e da fração B3 com o aumento da densidade, o que caracterizou a participação dessa fração durante o processo de proteólise após a quebra da vedação. Os teores de fibras em detergente neutro e detergente ácido durante a exposição ao ar sofreram acréscimo, sendo os maiores valores obtidos nas silagens de menor densidade. As silagens mais densas apresentaram maiores coeficientes de digestibilidade verdadeira in vitro que os demais tratamentos.This trial aimed to evaluate the aerobic stability of marandu grass silages submitted to different packing intensities. The forage was harvested at 60 days of regrowth. The following packing densities were evaluated: 100, 120, 140, and 160 kg DM/m³. Silage chemical changes were determined 0, 3, and 6 days after air

  3. Influencia del ejercicio físico aeróbico durante el embarazo en los niveles de hemoglobina y de hierro maternos. (Influence of the physical aerobic exercise during pregnancy in the maternal haemoglobin and iron levels.

    Directory of Open Access Journals (Sweden)

    James Stirling

    2008-04-01

    Full Text Available Resumen Son bien conocidos los efectos beneficiosos que el ejercicio físico tiene sobre la salud en general, aunque no se cuenta con la misma información cuando se desarrolla durante el embarazo. La mayor incertidumbre es saber si pueden coexistir ambos procesos, ejercicio y embarazo, sin conflictos materno-fetales y sin resultados del embarazo alterados. Especialmente cuando día a día, son más las mujeres que desean continuar ejercitándose de alguna forma, durante su embarazo. El objetivo de este trabajo es conocer la influencia del ejercicio físico aeróbico moderado desarrollado durante el segundo y tercer trimestres en los niveles de hemoglobina y de hierro maternos. Material y métodos: Se llevó acabo un estudio experimental que incluyó un total de 142 gestantes. Grupo casos: integrado por 72 mujeres. Grupo control: integrado por 70 mujeres. Los parámetros maternos estudiados fueron: niveles de hierro, nivel de hemoglobina previo al parto, edad gestacional, tipo de parto. Fetales: Peso de nacimiento, talla, perímetro craneal, test de Apgar (1´y 5´. Resultados: No se encontraron diferencias significativas a nivel estadístico entre ambos grupos (p menor que 0,05, el grupo de casos (ejercicio presento medias similares en los niveles de hemoglobina: 12.1 ± 0.8 y de hierro: 65.90 ± 7.1; que el grupo de control: hemoglobina: 12.3 ± 0.8 y hierro: 66.42 ± 8.4. El peso de nacimiento fue inferior en el grupo de casos dentro de valores normales (-142.1 grs.. Conclusión: El ejercicio aeróbico moderado desarrollado durante el segundo y tercer trimestre de embarazo parece no alterar los niveles de hierro y hemoglobina maternos. Abstract They are very well-known the beneficial effects that the physical exercise has about the health in general, although it is not had the same information when it refers to a pro- cess of remarkable importance: the pregnancy. The biggest uncertainty is to know if both processes, exercise and pregnancy can

  4. Avaliação da potência aeróbia de praticantes de Rugby em Cadeira de Rodas através de um teste de quadra

    Directory of Open Access Journals (Sweden)

    Lucinar Jupir Forner Flores

    2013-06-01

    Full Text Available O presente estudo teve por finalidade estimar a potência aeróbia em atletas com LME praticantes de RCR, correlacionar os níveis de VO2máx com a classificação funcional (CF dos atletas e analisar o comportamento da FC antes e pós-teste. A amostra foi composta por 10 atletas com LME, do sexo masculino e idade média de 29,6±6,5anos. Os atletas foram submetidos ao teste de corrida de 12 minutos e monitorados com o frequêncimetro cardíaco. A média do VO2máx foi de 18,3±8,1ml(kg.min-1 e da FCmáx de 114,6±25,3bpm. Os valores de VO2máx obtidos no estudo são classificados como médio para a população com tetraplegia. Observou-se que existe correlação moderada (r=0,77 entre a CF e o VO2máx entre atletas praticantes de RCR e por fim, observou-se baixos valores de FC frente á um teste submáximo, fato que pode estar relacionado à diminuição da atuação simpática após LME.

  5. A 1.5 ns OFF/ON switching-time voltage-mode LVDS driver/receiver pair for asynchronous AER bit-serial chip grid links with up to 40 times event-rate dependent power savings.

    Science.gov (United States)

    Zamarreno-Ramos, Carlos; Kulkarni, Raghavendra; Silva-Martinez, Jose; Serrano-Gotarredona, Teresa; Linares-Barranco, Bernabe

    2013-10-01

    This paper presents a low power fast ON/OFF switchable voltage mode implementation of a driver/receiver pair intended to be used in high speed bit-serial Low Voltage Differential Signaling (LVDS) Address Event Representation (AER) chip grids, where short (like 32-bit) sparse data packages are transmitted. Voltage-Mode drivers require intrinsically half the power of their Current-Mode counterparts and do not require Common-Mode Voltage Control. However, for fast ON/OFF switching a special high-speed voltage regulator is required which needs to be kept ON during data pauses, and hence its power consumption must be minimized, resulting in tight design constraints. A proof-of-concept chip test prototype has been designed and fabricated in low-cost standard 0.35 μ m CMOS. At ± 500 mV voltage swing with 500 Mbps serial bit rate and 32 bit events, current consumption scales from 15.9 mA (7.7 mA for the driver and 8.2 mA for the receiver) at 10 Mevent/s rate to 406 μ A ( 343 μ A for the driver and 62.5 μA for the receiver) for an event rate below 10 Kevent/s, therefore achieving a rate dependent power saving of up to 40 times, while keeping switching times at 1.5 ns. Maximum achievable event rate was 13.7 Meps at 638 Mbps serial bit rate. Additionally, differential voltage swing is tunable, thus allowing further power reductions.

  6. Treinamento aeróbio não altera pressão arterial de mulheres menopausadas e com síndrome metabólica Aerobic training does not alter blood pressure in menopausal women with metabolic syndrome

    Directory of Open Access Journals (Sweden)

    Aluísio Henrique Rodrigues de Andrade Lima

    2012-11-01

    Full Text Available FUNDAMENTO: A Hipertensão arterial (HA é uma condição tanto agravante quanto agravada pela Síndrome Metabólica (SM. A menopausa pode tornar o tratamento da hipertensão mais difícil porque é uma condição que favorece a piora nos componentes da SM. Embora existam evidências de que o treinamento com exercícios físicos reduza a pressão arterial, se as condições da menopausa e da SM afetam os benefícios induzidos pelo exercício é algo ainda não evidenciado. OBJETIVO: Comparar os efeitos do treinamento aeróbio na pressão arterial entre mulheres com SM não menopausadas e menopausadas. MÉTODOS: Foram recrutadas 44 mulheres divididas em quatro grupos experimentais: controle não menopausada (CNM: 39,5 ± 1,1 anos, n = 11; controle menopausada (CM: 54,9 ± 1,7 anos, n = 12; aeróbio não menopausada (ANM: 43,1 ± 2,1 anos, n = 11 e aeróbio menopausada (AM: 52,1 ± 1,6 anos, n = 10. Os grupos de exercício realizaram treinamento aeróbio durante três meses, cinco vezes por semana, com intensidade entre 60% e 70% da frequência cardíaca de reserva. A pressão arterial de repouso e a resposta pressórica clínica após 60 minutos de exercício foram medidas antes e após o período treinamento. O teste de ANOVA de dois fatores foi usado, considerando p 0,05. CONCLUSÃO: Três meses de treinamento aeróbio melhora componentes da SM, mas não altera a pressão arterial de repouso, nem a resposta pressórica aguda após uma sessão de exercício aeróbio em mulheres com SM.BACKGROUND: Arterial Hypertension (AH is an aggravating condition for Metabolic Syndrome (MS, as well as being aggravated by it. Menopause can make hypertension treatment more difficult, as it favors the worsening of MS components. Although there is evidence that exercise training reduces blood pressure, whether menopause and SM affect the exercise-induced benefits is yet to be elucidated. OBJECTIVE: To compare the effects of aerobic training on blood pressure in

  7. Qualidade de vida e síndrome metabólica em mulheres brasileiras: análise da correlação com a aptidão aeróbia e a força muscular

    Directory of Open Access Journals (Sweden)

    Tatiane Gomes Teixeira

    2015-08-01

    Full Text Available A síndrome metabólica (SM é definida pela presença de, ao menos três, dentre cinco fatores de risco cardiovascular: hiperglicemia, resistência à insulina, obesidade, dislipidemia e pressão arterial elevada. Embora portadores de SM apresentem baixa aptidão física e pior qualidade de vida (QV, quando comparado aos indivíduos sem SM, ainda não foram investigadas as correlações entre a aptidão física e a QV em mulheres com SM. O objetivo do presente estudo foi comparar a QV, força muscular e aptdião aeróbia, bem como analisar a correlação entre a QV e a aptidão física de mulheres com e sem SM. Participaram do estudo 49 mulheres, 21 com SM (33.5 ± 9.1 anos e 28 sem SM (32.3 ± 7.9 anos. Para avaliação da QV, aptidão aeróbia e força muscular foram utilizados, respectivamente, o questionário Short Form Health Survey 36 (SF-36, o teste de caminhada de 6 minutos (6-C e o teste de preensão manual. As mulheres com SM apresentaram pior QV, percorreram menor distância no 6-C e obtiveram menor força muscular relativa. Foi observada correlação positiva entre a aptidão aeróbia e quatro domínios da QV: capacidade funcional, limitação por aspectos físicos, dor e aspectos sociais da funcionalidade. Mulheres com SM apresentam menor de força muscular e aptidão aeróbia, bem como piores escores de QV no estado de saúde geral, capacidade funcional, dor no corpo, limitação por aspectos emocionais, aspectos sociais da funcionalidade e limitação por aspectos físicos quando comparado com mulheres sem SM.

  8. The clinical importance of cardiopulmonary exercise testing and aerobic training in patients with heart failure A importância clínica de testes de exercícios cardiopulmonares e treinamento aeróbico em pacientes com insuficiência cardíaca

    Directory of Open Access Journals (Sweden)

    R Arena

    2008-04-01

    Full Text Available INTRODUCTION: The appropriate physiological response to an acute bout of progressive aerobic exercise requires proper functioning of the pulmonary, cardiovascular and skeletal muscle systems. Unfortunately, these systems are all negatively impacted in patients with heart failure (HF, resulting in significantly diminished aerobic capacity compared with apparently healthy individuals. Cardiopulmonary exercise testing (CPX is a noninvasive assessment technique that provides valuable insight into the health and functioning of the physiological systems that dictate an individual’s aerobic capacity. The values of several key variables obtained from CPX, such as peak oxygen consumption and ventilatory efficiency, are often found to be abnormal in patients with HF. In addition to the ability of CPX variables to acutely reflect varying degrees of pathophysiology, they also possess strong prognostic significance, further bolstering their clinical value. Once thought to be contraindicated in patients with HF, participation in a chronic aerobic exercise program is now an accepted lifestyle intervention. Following several weeks/months of aerobic exercise training, an abundance of evidence now demonstrates an improvement in several pathophysiological phenomena contributing to the abnormalities frequently observed during CPX in the HF population. These exercise-induced adaptations to physiological function result in a significant improvement in aerobic capacity and quality of life. CONCLUSIONS: Furthermore, there is initial evidence to suggest that aerobic exercise training improves morbidity and mortality in patients with HF. This paper provides a review of the literature highlighting the clinical significance of aerobic exercise testing and training in this unique cardiac population.INTRODUÇÃO: A resposta fisiológica aguda ao exercício aeróbio progressivo demanda funcionamento adequado dos sistemas pulmonares, cardiovasculares e m

  9. Isolamento de bactérias aeróbias e sua sensibilidade a antimicrobianos em processos de osteomielite canina Aerobic bacterial isolates and susceptibility to antimicrobial agents in canine osteomyelitis

    Directory of Open Access Journals (Sweden)

    A.C. Simionato

    2003-04-01

    Full Text Available O objetivo deste trabalho foi estudar a presença de bactérias aeróbias em 20 cães com osteomielite, decorrente de exposição óssea. Na identificação das bactérias utilizou-se o sistema API-Bio Mérieux e testou-se a sensibilidade dos microrganismos in vitro, pelo método de difusão em ágar, frente a 14 diferentes antibacterianos. O osso mais acometido pela infecção foi a tíbia (35%. Isolaram-se 68,3% de bactérias Gram positivas e 31,7% de Gram negativas. Staphylococcus spp, Streptococcus spp e Enterococcus spp foram os gêneros mais freqüentes, representando respectivamente 34,1%, 14,6% e 14,6% do total de bactérias (41 cepas. Enterobactérias foram isoladas em 26,8% das amostras. Os cocos Gram positivos apresentaram maior sensibilidade à amoxicilina associada ao ácido clavulânico. Os microrganismos Gram negativos, tanto as bactérias da família Enterobacteriaceae como as do gênero Pseudomonas, apresentaram altos índices de resistência.The aim of this work was to detect aerobic bacteria in osteomyelitis process in dogs with bone exposure. The API-Bio Mérieux Identification System was used to identify the bacteria. Susceptibility in vitro was verified by the agar diffusion method, to 14 different antibiotics. The most frequent bone involved was tibia (35%. Gram positive cocci represented 68.3% from isolates and the Gram negative bacteria 31.7%. Staphylococcus spp, Streptococcus spp and Enterococcus spp were the most frequent genus, representing, respectively, 34.1%, 14.6%, and 14.6% of the total bacteria strains (41 strains. Enterobacteria were isolated in 26.8%. Cocci Gram positive presented good susceptibility to amoxicillin associated with clavulanic acid. Gram negative microorganisms, the enterobacteria and Pseudomonas sp, showed high resistance profile.

  10. Gasto energético aeróbico y anaeróbico en un circuito con cargas a seis intensidades diferentes. (Aerobic and anaerobic energy expenditure during at circuit weight training through six different intensities.

    Directory of Open Access Journals (Sweden)

    Rocío Cupeiro Coto

    2011-07-01

    Full Text Available ResumenEl entrenamiento con cargas es una actividad anaeróbica glucolítica intensa y se ha comprobado que el error en las estimaciones del gasto energético en esta actividad varía entre un 13 y un 30%. El principal objetivo de este trabajo es describir la contribución anaeróbica de energía en un circuito con cargas. Doce hombres (20-26 años y diecisiete mujeres (18-29 años estudiantes de Ciencias de la Actividad Física y del Deporte realizaron un entrenamiento en circuito de cargas a 6 intensidades diferentes (entre el 30% y 80% de su 15RM. Durante la totalidad de los circuitos se registró el gasto energético aeróbico por calorimetría indirecta, la frecuencia cardiaca con pulsómetro Polar® y la concentración de lactato en sangre capilar para medir la contribución anaeróbica. El incremento que produjo la energía anaeróbica se situó entre el 5,1% y un máximo del 13,5%, lo que hace evidente que medir o no la contribución anaeróbica en el entrenamiento en circuito puede provocar un error medio del 9,65%. Existen diferencias significativas (PAbstractResistance training is an intense anaerobic glycolytic activity and has been shown that estimates of energy expenditure in this activity turn out into an error that varies between 13 and 30%. The main aim of this paper is to describe the anaerobic energy contribution in circuit weight training. Twelve men (20-26 years and seventeen women (18-29 years students in Science of Physical Activity and Sport performed circuit training at six different intensities (between 30% and 80% of 15RM. During all the circuits aerobic energy expenditure was registered by indirect calorimetry, heart rate with Polar® monitors and lactate concentration in capillary blood to measure the anaerobic contribution. The increased due to anaerobic energy was between 5,1% and a maximum of 13,5%, which clearly means that to measure or not the anaerobic contribution in circuit training can lead to an average

  11. Cortical Response of Retardates for AER Audiometry

    Science.gov (United States)

    Hogan, Donald D.

    1971-01-01

    Averaged auditory evoked responses were obtained from 15 retarded and motor-handicapped subjects and from 15 nonretarded subjects in order to investigate comparative responsiveness and response features. (Author)

  12. Redução da pressão arterial, da IMC e da glicose após treinamento aeróbico em idosas com diabete tipo 2 Decrease in blood pressure, body mass index and glycemia after aerobic training in elderly women with type 2 diabetes

    Directory of Open Access Journals (Sweden)

    Luciana Zaranza Monteiro

    2010-10-01

    Full Text Available FUNDAMENTO: O processo de envelhecimento associa-se ao desenvolvimento de várias doenças, que podem ser amenizadas pela prática de atividades físicas. O treinamento aeróbico é um meio efetivo para manter e melhorar as funções cardiovasculares. Além disso, desempenha um papel fundamental na prevenção e tratamento de diversas doenças crônico-degenerativas, em especial o diabete melito. OBJETIVO: Verificar os efeitos de 13 semanas de treinamento aeróbico sobre a pressão arterial, o índice de massa corpórea e a glicemia em idosas com diabete tipo 2. MÉTODOS: Onze mulheres idosas diabéticas (61,0 ± 9,1 anos de idade, sedentárias, realizaram 13 semanas de treinamento aeróbico, compondo o grupo G2. Onze idosas (60,2 ± 6,8 anos de idade controladas não realizaram exercícios físicos durante a pesquisa, constituindo o grupo-controle (G1. O grupo G1 foi submetido somente a orientações educativas uma vez na semana, e o grupo G2, a caminhadas três vezes na semana. RESULTADOS: Houve redução significativa da glicemia e da pressão arterial diastólica nos dois grupos. Não foram encontradas reduções significativas no IMC após o treinamento aeróbico em ambos os grupos. CONCLUSÃO: Treze semanas de treinamento aeróbico foi suficiente para promover reduções significativas na pressão arterial diastólica e glicemia, portanto, esse tipo de exercício reduz os fatores de risco para doenças cardiovasculares e metabólicas.BACKGROUND: The aging process is associated with the development of several diseases, which can be attenuated by the practice of physical activities. Aerobic training is an effective method to maintain and improve cardiovascular function. Additionally, it has a crucial role in the prevention and treatment of several chronic-degenerative diseases, especially diabetes mellitus. }OBJECTIVE: To verify the effect of a 13-week aerobic training program on blood pressure (BP, body mass index (BMI and glycemia levels

  13. Medindo a pressão arterial em exercício aeróbico: subsídios para reabilitação cardíaca Medición de la presión arterial en ejercicio aeróbico: aportes para la rehabilitación cardiaca Blood pressure measurement during aerobic exercise: subsidies for cardiac rehabilitation

    Directory of Open Access Journals (Sweden)

    Emanuel Couto Furtado

    2009-07-01

    Full Text Available FUNDAMENTO: Documentos institucionais recomendam que variáveis hemodinâmicas - frequência cardíaca (FC e pressão arterial sistólica (PAS e diastólica (PAD - sejam rotineiramente controladas na parte aeróbica de sessões de exercício supervisionado para cardiopatas. OBJETIVO: a Determinar o comportamento e a reprodutibilidade da PA ao longo de 15 minutos de exercício de intensidade constante e moderada; b comparar a medida de PA obtida com equipamentos digital e convencional no exercício. MÉTODOS: Trinta adultos de ambos os sexos (de 65 ± 11 anos foram avaliados em 15 minutos no cicloergômetro de membros inferiores. A PA foi medida a cada dois minutos: entre o 3º e o 13º minutos, pelo esfigmomanômetro digital Tango (Suntech, Estados Unidos da América e, no 14º minuto, pelo esfigmomanômetro de coluna de mercúrio. Sete dias depois e em horário similar, seis indivíduos repetiram o protocolo para avaliar a reprodutibilidade. RESULTADOS: Enquanto a PAD não variou ao longo do exercício (p > 0,05, a PAS aumentou do 3º para o 7º minuto (146±4,1 versus 158±4,5 mmHg, p 0,05 e uma pequena diferença para a PAD (72±2,4 versus 78±2,3 mmHg; p FUNDAMENTO: Documentos institucionales recomiendan que las variables hemodinámicas - frecuencia cardiaca (FC y presión arterial sistólica (PAS y diastólica (PAD - se mantengan bajo control en la parte aeróbica de sesiones de ejercicio bajo supervisión para cardiópatas. OBJETIVO: : a Determinar el comportamiento y la reproductibilidad de la PA a lo largo de 15 minutos de ejercicio de intensidad constante y moderada; b Comparar la medición de PA obtenida con aparatos digital y convencional en el ejercicio. MÉTODOS: Se Evaluaron a 30 adultos de ambos sexos (de 65 ± 11 años en 15 minutos en el cicloergómetro de miembros inferiores. La PA se midió a cada 2 minutos: entre el 3º y el 13º minutos, por esfigmomanómetro digital Tango (Suntech, Estados Unidos de América y, en el 14º

  14. Relação da potência aeróbica máxima e da força muscular com a economia de corrida em atletas de endurance Relación de la potencia aeróbica máxima y de la fuerza muscular con la economía de le carrera en atletas de endurance Relationship of maximal aerobic power and muscular strength with the running economy in endurance athletes

    Directory of Open Access Journals (Sweden)

    Luiz Guilherme Antonacci Guglielmo

    2005-02-01

    Full Text Available O objetivo deste estudo foi analisar a relação da potência aeróbica máxima e da força muscular (força isotônica máxima e força explosiva de salto vertical com a economia de corrida (EC em atletas de endurance. Vinte e seis corredores do sexo masculino (27,9 ± 6,4 anos; 62,7 ± 4,3kg; 168,6 ± 6,1cm; 6,6 ± 3,1% de gordura corporal realizaram, em diferentes dias, as seguintes provas: a teste incremental para a determinação do consumo máximo de oxigênio (VO2max e sua respectiva intensidade (IVO2max; b teste submáximo com velocidade constante para determinar a EC; c teste de carga máxima no leg press; e d altura máxima de salto com contramovimento (SV. O VO2max (63,8 ± 8,3ml/kg/min foi significantemente correlacionado (r = 0,63; p El objetivo de este estudio fué el de analizar la relación de la potencia aeróbica máxima y da la fuerza muscular (fuerza isotónica máxima y de la fuerza explosiva de salto vertical con la economía de carrera (EC en atletas de endurance. Veintiseis corredores de sexo masculino (27,9 ± 6,4 años; 62,7 ± 4,3 kg; 168,6 ± 6,1 cm; 6,6 ± 3,1% de grasa corporal realizaron en diferentes días, los seguintes tests: a test incremental para la determinación del consumo máximo de oxígeno (VO2max y su respectiva intensidad (IVO2max; b test submáximo con velocidad constante para determinar la EC; c test de carga máxima como leg press y; d altura máxima de salto con contramovimento (SV. El VO2max (63,8 ± 8,3 ml/kg/min fué significantemente correlacionado (r = 0,63; p The objective of this study was to analyze the relationship of maximal aerobic power and the muscular strength (maximal isotonic strength and vertical jump explosive power with the running economy (RE in endurance athletes. Twenty-six male runners (27.9 ± 6.4 years; 62.7 ± 4.3 kg; 168.6 ± 6.1 cm; 6.6 ± 3.1% of body fat performed in different days the following tests: a incremental test to determine the maximal oxygen uptake (VO2max

  15. Comparação entre métodos invasivos e não invasivo de determinação da capacidade aeróbia em futebolistas profissionais Comparación entre métodos invasivos y no invasivos de determinación de la capacidad aeróbica en futbolistas profesionales Comparison between invasive and non-invasive methods for the determination of the aerobic capacity of professional soccer players

    Directory of Open Access Journals (Sweden)

    Adelino Sanchez Ramos da Silva

    2005-08-01

    Full Text Available O Limiar Anaeróbio (Lan pode ser determinado por protocolos que utilizam concentrações fixas de lactato sanguíneo como o OBLA (Onset of Blood Lactate Accumulation e os que utilizam procedimentos mais individualizados, como o Lactato Mínimo (Lacmin. Independente do método, a mensuração da capacidade aeróbia através do Lan nesses casos exige a utilização de equipamentos sofisticados, além do elevado custo por atleta, o que torna sua aplicação limitada. Como alternativa, um dos testes não invasivos mais empregados no meio esportivo é o de 12 minutos proposto por Cooper. O objetivo principal do presente estudo foi comparar a intensidade de exercício obtida pelo teste de 12min com as intensidades correspondentes ao Lan obtido pelo protocolo adaptado ao de Tegtbur et al. (1993 (Lac minat e pelo OBLA em futebolistas profissionais. Para tanto participaram 16 atletas pertencentes a uma equipe profissional filiada à série A3 do futebol paulista. Cada atleta foi avaliado nos três protocolos, com intervalo mínimo de 48 e máximo de 72 horas. Os resultados mostraram diferença (p El umbral anaeróbico (Lan puede ser determinado por protocolos que utilizan concentraciones fijas de lactato sanguíneo como el OBLA (Onset of Blood Lactate Accumulation y los que utilizan procedimientos mas individualizados como el Lactato Mínimo (Lacmin. Independiente del método, la medida de la capacidad aeróbica a traves del Lan en esos casos exige una utilización de equipamientos sofisticados, además del elevado costo por atleta lo que torna su aplicación limitada. Como alternativa, uno de los tests no invasivos mas empleados en el medio deportivo es el de 12 minutos propuesto por Cooper. El objetivo principal de este estudio fue el de comparar la intensidad de ejercicio obtenida por el test de 12 minutos con las intensidades obtenidas correspondientes al Lan obtenido por el protocolo adaptado al de Tegtbur et al. (1993 (Lac minat y por el OBLA en

  16. Evaluation of oxidative stress in mice subjected to aerobic exercise Avaliação do estresse oxidativo em camundongos submetidos ao exercício físico aeróbico

    Directory of Open Access Journals (Sweden)

    Mônica Cruvinel de Lima

    2012-08-01

    Full Text Available PURPOSE: To evaluate the influence of aerobic exercise on oxidative stress in mice. METHODS: The study included twenty female mice Mus musculus-Swiss divided into two groups: sedentary control (GA and exercise (GB, each containing ten animals. All animals underwent an adaptation period of seven days isolated in individual boxes. After this period, the animals in the exercise group (GB were trained in angled running wheel with circumference of 25 cm assembled on an articulated axle during five minutes for three consecutive days. On the fourth day, they underwent an exercise program of one session lasting 45 minutes. The evaluation of oxidative stress was performed by determining the levels of malondialhyde derived of lipid peroxidation by the TBA method. The samples were read in a spectrophotometer at 535 nm. RESULTS: No significant difference was observed in the intergroup comparison of MDA levels in the tissues evaluated. A significant difference was observed in the intragroup comparison of MDA levels in the control group (p = 0.0201.The Tukeys' post hoc test indicated significantly lower values of MDA in the smooth muscle in relation to plasma. In the analysis of variance in the exercise group, a significant difference between tissues (p = 0.0009, with significantly lower values in the smooth muscle in relation to plasma (pOBJETIVO: Avaliar a influência do exercício físico aeróbico sobre o estresse oxidativo em camundongos. MÉTODOS: Participaram do estudo 20 camundongos (Swiss, distribuídos em dois grupos: controle-sedentário (GA e exercício (GB cada um contendo dez animais. Todos os animais passaram por um período de adaptação de sete dias. Após os animais do grupo (GB receberam treinamento em roda giratória angulada montada sobre eixo articulado por cinco minutos durante três dias consecutivos. No quarto dia foram submetidos à única sessão de exercício por 45 minutos. A avaliação do estresse oxidativo foi realizada por

  17. Perfil fermentativo, estabilidade aeróbia e valor nutritivo de silagens de capim-marandu ensilado com aditivos Fermentative profile, aerobic stability, and nutritive value of marandu grass silages using additives at ensiling

    Directory of Open Access Journals (Sweden)

    Thiago Fernandes Bernardes

    2008-10-01

    Full Text Available Com o objetivo de avaliar as perdas em silagem de capim-marandu produzidas com aditivos foram desenvolvidos dois experimentos. No experimento 1, objetivou-se conhecer o perfil de fermentação e a estabilidade aeróbia de quatro silagens: 1 forragem não tratada (Controle; 2 tratada com Lactobacillus plantarum e Propionibacterium; 3 tratada com Lactobacillus buchneri; e 4 tratada com 0,1% de benzoato de sódio. No experimento 2, foram utilizados nove novilhos castrados Nelore (PC de 350 ± 38,9 kg, alocados em três quadrados latinos 3 x 3 para avaliação do consumo e da digestibilidade das rações contendo 85,4% das seguintes silagens de capim-marandu: 1 controle; 2 controle com L. plantarum, Pediococcus acidilactici + enzimas fibrolíticas; e 3 tratamento 2 + L. buchneri. No experimento 1, as silagens apresentaram baixas recuperações de MS durante a fermentação (média de 86% e os coeficientes de digestibilidade in vitro da matéria seca reduziram de 65,5% (momento da ensilagem para 50,0% no 60º dia após o fechamento dos silos. No experimento 2, o valor médio de consumo das rações foi de 5,7 kg MS/dia (1,6% PC e a digestibilidade de 51,6% e não diferiram entre as rações. As silagens apresentaram perdas acentuadas na fase fermentativa e o uso de aditivos não alterou essas perdas. A inoculação com bactérias não influenciou o consumo ou a digestibilidade das rações.Two trials were conducted to evaluate losses of Marandu grass silages using different additives. The fermentation profile and aerobic stability of the silages were evaluated on the first trial. The followings silages were evaluated: 1 - Marandu grass (Control, 2 - Marandu grass plus L. plantarum and Propionibacterium, 3 - Marandu grass plus L. buchneri, 4 - Marandu grass plus 0.1% of sodium benzoate. On the second experiment, it was utilized nine castrated Nellore steers (Body weight 350 ± 38.9 kg allocated in three Latin squares (3 x 3 to evaluate the intake and

  18. Moderate aerobic exercise during pregnancy, its relation to the behavior of the maternal blood El ejercicio aeróbico moderado durante el embarazo su relación con el comportamiento de la tensión arterial materna

    Directory of Open Access Journals (Sweden)

    R. Barakat

    2010-09-01

    Full Text Available

    A case-control design was used. Between May 1 of 2000 and September 30, 2001, a total of 480 women were interviewed at the first medical prenatal visit obtaining data on social, medical, employment, daily physical activity circumstances and consent. Participants were recruited from the Hospital Severo Ochoa in Leganés, Madrid.A total of 72 pregnant women with uncomplicated pregnancies (singleton gestations randomly assigned to an exercise group (case and 70 pregnant women randomly assigned to a control group. The exercise program consisted of a series of 35 minute sessions, three times per week during the second and third trimester of pregnancy, conducted by a qualified instructor following the ACOG guidelines. Moderate exercise was defined as ≤1000 Kcal/wk of energy expenditure. For a statistical treatment, SPSS program was used.Multiple potential confounding variables were also assessed for a possible association with or influence on pregnancy outcome (age, parity, smoking, employment, standing posture, etc.Our results did not show any associations of the exercise during pregnancy with adverse or negative blood pressure outcome.
    KEY WORDS: Exercise, pregnancy, blood pressure

     

    A pesar de los innegables avances de la ciencia, cuando se habla de la relación entre la actividad física y el embarazo, existen aún una gran cantidad de cuestiones sin resolver. Un ejemplo de ello es saber qué sucede con el funcionamiento de ciertos órganos y sistemas cuando la mujer embarazada realiza ejercicio, más aún cuando hablamos de parámetros, como los cardiovasculares, que se modifican de manera importante durante la gestación. Este trabajo de investigación pretende conocer la influencia del ejercicio físico de carácter aeróbico, desarrollado durante el segundo y tercer trimestre de embarazo sobre el comportamiento de la Tensi

  19. Estudo do raspado de conjuntiva e margem palpebral de pacientes tratados de retinoblastoma: etapa I - Microflora aeróbica Study of the conjunctival scrape and eyelid margin smears in patients treated for retinoblastoma: phase I - Aerobic microflora

    Directory of Open Access Journals (Sweden)

    Maria Carmen Menezes Santos

    2002-03-01

    Full Text Available Objetivo: A queixa de secreção ocular é muito freqüente entre os pacientes tratados de retinoblastoma submetidos à enucleação e radioterapia. A falta de dados sobre a microflora em pacientes nessas condições foi o que motivou este estudo. Métodos: Foram examinadas 114 órbitas de 58 pacientes. Este trabalho apresenta os resultados das culturas para bactérias aeróbicas e fungos, de conjuntiva e margem palpebral em 4 condições, com e sem enucleação, com e sem radioterapia. Procedeu-se à identificação dos microrganismos de acordo com o Protocolo do National Committee for Clinical Laboratory Standards e os esfregaços para citologia foram submetidos às colorações de Gram e Leishman. Resultados: A presença de microrganismos foi mais freqüente nas cavidades anoftálmicas irradiadas, tanto na conjuntiva (54,5% quanto na margem palpebral (63,6%, porém sem diferença estatisticamente significante. Além disso, em órbitas com bulbo ocular, a radiação, na fase tardia, representou um fator limitante da presença de microrganismos na conjuntiva e na margem palpebral, mas sem diferença estatisticamente significante. O Staphylococcus coagulase negativa foi o microrganismo mais freqüente na conjuntiva e margem palpebral de todos os grupos. Houve crescimento de fungo, Candida tropicalis, em apenas um caso. Conclusões: Sugere-se o uso de colírios antibióticos em pacientes tratados de retinoblastoma, portadores de cavidade anoftálmica, irradiada ou não.Purpose: Conjunctival discharge is a common complaint among patients treated for retinoblastoma who underwent enucleation and radiotherapy. Lack of data about the microflora in those patients motivated this study. Methods: One hundred and fourteen orbits of 58 patients were examined. The authors present the results of aerobic bacterial and fungal culture of conjunctival and eyelid margin smears, as well as conjunctival cytology, in 4 different conditions: with and without

  20. O treinamento físico aeróbio corrige a rarefação capilar e as alterações nas proporções dos tipos de fibra muscular esquelética em ratos espontaneamente hipertensos

    Directory of Open Access Journals (Sweden)

    Tiago Fernandes

    2012-08-01

    Full Text Available O treinamento físico (TF aeróbio tem sido utilizado como um importante tratamento não farmacológico na hipertensão arterial (HA, uma vez que ele reduz a pressão arterial. Estudos mostram que as anormalidades do músculo esquelético na HA estão associados à rarefação capilar, um aumento na porcentagem de fibras de contração rápida (tipo II, com predominância do metabolismo glicolítico e um aumento da fadiga muscular. Entretanto, pouco se conhece sobre os efeitos do TF sobre estes parâmetros na HA. Nós hipotetizamos que o TF corrija a rarefação capilar potencialmente contribuindo para a restauração da proporção dos tipos de fibras musculares. Ratos espontaneamente hipertensos (SHR, n=14 e Wistar Kyoto (WKY, n=14 com 12 semanas de vida e divididos em 4 grupos: SHR, SHR treinado (SHR-T, WKY e WKY treinado (WKY-T foram estudados. Como esperado, 10 semanas de TF foi efetivo em reduzir a pressão arterial em SHR-T. Além disso, avaliamos os principais marcadores de TF. A bradicardia de repouso, o aumento da tolerância a realização de esforço, do consumo de oxigênio de pico e da atividade da enzima citrato sintase muscular nos grupos de animais treinados (WKY-T e SHR-T mostram que a condição aeróbia foi alcançada com este TF. O TF também corrigiu a rarefação capilar no músculo sóleo em SHR-T. Em paralelo, foi observada uma redução na porcentagem de fibras do tipo IIA e IIX, ao passo que aumentou a porcentagem de fibras do tipo I induzidas pelo TF na HA. Estes resultados sugerem que o TF previne as alterações na composição dos tipos de fibras no músculo sóleo em SHR, uma vez que a angiogênese e o aumento da atividade da enzima citrato sintase são umas das mais importantes adaptações ao TF aeróbio, atuando na manutenção do metabolismo oxidativo e do perfil de fibras do músculo.

  1. Percentile values for aerobic performance running/walking field tests in children aged 6 to 17 years: influence of weight status Valores de percentiles de los tests de campo de capacidad aeróbica en niños de 6 a 17 años: influencia del peso corporal

    Directory of Open Access Journals (Sweden)

    J. Castro-Piñero

    2011-06-01

    Full Text Available The aim of this study was to provide percentiles values for four different aerobic performance tests in 2752 (1,261 girls Spanish children aged 6 to 17.9 years. Aerobic performance was assessed by the shuttle run test (20mSRT, 1-mile, 1/2-mile and 1/4-mile run/walk tests. Height and weight were measured, and body mass index was calculated. Boys had significantly better score than girls in the studied tests in all age groups, except in 1/4-mile test in 6-7 year old children. Underweight children had similar performance than their normalweight counterparts, and underweight boys had better performance than their obese counterparts. Overweight and obese children had lower performance than their normalweight counterparts. Having percentile values of the most used field tests to measure aerobic performance in youth may help to identify children and adolescents at risk for the major chronic diseases, as well as to evaluate the effects of alternative interventions.El propósito de este estudio fue proporcionar los valores de percentiles para cuatro pruebas de rendimiento aeróbico en 2752 (1261 chicas niños españoles con edades de 6 a 17,9 años. El rendimiento aeróbico se evalúo mediante la carrera durante 20 minutos (20mSRT, y las pruebas de correr / caminar 1 milla, ½ milla y ¼ de milla. Se midieron el peso y la talla y se calculó el índice de masa corporal. Los chicos tuvieron puntuaciones significativamente mejores que las chicas en las pruebas evaluadas y para todos los grupos de edad, excepto en la prueba de ¼ de milla en el grupo de 6-7 años. Los niños con peso bajo mostraron un rendimiento similar a sus homólogos con peso normal y los primeros tuvieron un rendimiento mejor que sus homólogos obesos. Los niños obesos y con sobrepeso tuvieron un menor rendimiento que sus homólogos con peso normal. El disponer de valores de percentiles para las pruebas empleadas más habitualmente para evaluar el rendimiento aeróbico en los j

  2. Comparação entre protocolos diretos e indiretos de avaliação da aptidão aeróbia em indivíduos fisicamente ativos Comparacion entre protocolos directos e indirectos de evaluación de la aptitud aeróbica en indivíduos fisicamente activos Comparison between direct and indirect protocols of aerobic fitness evaluation in physically active individuals

    Directory of Open Access Journals (Sweden)

    Luiz Gustavo da Matta Silva

    2005-08-01

    Full Text Available O limiar anaeróbio individual (IAT, o limiar glicêmico individual (IGT, a velocidade associada ao VO2max (Vmax, a velocidade média em corrida de 3.000m (Vm3km e a velocidade crítica (VC têm sido utilizados na avaliação aeróbia e prescrição de exercício para atletas-corredores. No entanto, estudos comparando estes parâmetros e sua possível aplicação para indivíduos não atletas ainda não foram realizados. Os objetivos do presente estudo foram comparar e estabelecer as relações entre IAT, IGT, Vmax, Vm3km e VC em indivíduos fisicamente ativos não atletas. Onze indivíduos fisicamente ativos e saudáveis (20,7 ± 1,8 anos; 74,2 ± 14,5kg; 48,9 ± 5,8mlO2.kg.min-1 realizaram randomicamente os seguintes testes de corrida em dias distintos: 1 determinação da Vm3km a partir do desempenho em corrida de 3.000m; 2 desempenho em corrida de 500m e 3 teste incremental em esteira ergométrica para determinação do IAT, IGT, VO2max e Vmax. A VC foi determinada por regressão linear (relação distância-tempo a partir dos testes de 3km e 500m. Não foram verificadas diferenças entre as velocidades do IAT e IGT (184,8 ± 27,7 e 182,8 ± 27,9m.min-1; P > 0,05, e entre Vmax e Vm3km (211,1 ± 30 e 213,4 ± 32,2m.min-1; P > 0,05. Apesar da alta correlação entre as variáveis estudadas, a VC (199,8 ± 30,4m.min-1 superestimou o IAT e o IGT (P El umbral anaeróbico individual (IAT, el umbral glucémico individual (IGT, la velocidad asociada al VO2max (Vmax, la velocidad media de carrera de 3.000m (Vm3km y la velocidad crítica (VC estan estudiados junto con la evaluación aeróbica y la prescripción del ejercicio para atletas corredores. Sin embargo, los estudios que comparan estos parámetros y su posible aplicación para personas no atletas no ha sido realizados aún. Los objetivos del presente estudio fueron el de comparar y establecer las relaciones entre IAT, IGT, Vmax, Vm3km y VC en individuos físicamente activos no atletas. Once

  3. Exercício aeróbico, treinamento de força muscular e testes de aptidão física para adolescentes com fibrose cística: revisão da literatura Exercise testing, aerobic and strength training for adolescents with cystic fibrosis: a literature review

    OpenAIRE

    Celia Regina Moutinho de Miranda Chaves; Cristiano Queiroz de Oliveira; José Augusto Alves de Britto; Maria Ignez Capella Gaspar Elsas

    2007-01-01

    São reconhecidos os benefícios da prática do exercício físico regular para pacientes com fibrose cística. Entretanto, poucos estudos envolvem pacientes adolescentes. O objetivo deste artigo foi revisar os efeitos da prática regular de exercícios aeróbicos e de força e resistência muscular para adolescentes com fibrose cística. Os principais testes de aptidão física para esta faixa etária e a importância deles para melhora do prognóstico e tratamento da doença também foram avaliados. As inform...

  4. Aerobic and anaerobic mineralization of Salvinia molesta and Myriophyllum aquaticum leachates from a tropical reservoir (Brazil Mineralização aeróbia e anaeróbia dos lixiviados de Salvinia molesta e Myriophyllum aquaticum de um reservatório tropical (Brasil

    Directory of Open Access Journals (Sweden)

    Renato Henriques da Silva

    2011-06-01

    Full Text Available AIM: This study aimed at describing and discussing the leachates mineralization (aerobic and anaerobic of two species of aquatic macrophytes (Salvinia molesta and Myriophyllum aquaticum from a tropical reservoir (22° 00' S and 47° 54' W; METHODS: The incubations were prepared with plant leachates and reservoir water sample and were maintained during 45 days in the dark (at 20 °C. The organic carbon and the oxygen consumption kinetics were evaluated; RESULTS: Irrespective of to the experimental condition, the leachates were mainly utilized for catabolic processes (i.e., respiration, mineralization was slightly faster in an aerobic environment (1.22 fold and in this condition, the yield of refractory products was smaller (2.3%; the O/C stoichiometric ratios values (oxygen consumed per atom of carbon from mineralization of the 2 types of leachates were similar (ca. 1.12; CONCLUSIONS: According to these results we conclude that the leachate from selected macrophytes is rapidly decomposed and subsidize primariy the microbial catabolism (aerobic or anaerobic; in addition, we propose that S. molesta contributes more to the input of dissolved organic matter within the reservoir.OBJETIVO: Nesse estudo foram descritas as mineralizações (aeróbias e anaeróbias dos lixiviados de 2 espécies de macrófitas aquáticas (Salvinia molesta e Myriophyllum aquaticum que ocorrem em um reservatório tropical (22° 00' S e 47° 54' O; MÉTODOS: As incubações, preparadas com os lixiviados das plantas e amostra de água do reservatório, foram mantidas no escuro e a 20 °C, por 45 dias. Foram avaliadas as cinéticas de perda de massa do carbono orgânico e de consumo de oxigênio; RESULTADOS: Independente da condição experimental, os lixiviados foram principalmente utilizados na respiração; as mineralizações foram ligeiramente mais rápidas em meio aeróbio (1,22 vezes e nessa condição, os rendimentos dos produtos refratários foram menores (2,3%; as

  5. Avaliação da produção de óxido nítrico em ratos, submetidos aos exercícios aeróbio e anaeróbio Evaluation of the production of nitric oxide in mice, submitted to aerobic and anaerobic exercises

    OpenAIRE

    Vanessa Guimarães de Freitas Cruvelo D'Ávila; Nozelmar Borges de Sousa Júnior; Fábio Borges de Sousa; Lídia Andreu Guillo

    2008-01-01

    Óxido nítrico (NO) exerce influências muito importantes em vários processos fisiológicos. Neste trabalho avaliamos a produção de NO sanguíneo em ratos Wistar, submetidos ao nado aeróbio e anaeróbio agudos. A formação do óxido nítrico foi verificada através da dosagem dos produtos de oxidação estáveis do metabolismo do óxido nítrico (nitratos). Para isso utilizamos o método colorimétrico de Griess. Verificamos a existência de uma diferença significativa (p = 0,000261) na produção de óxido nítr...

  6. O efeito de um programa de exercício físico aeróbio combinado com exercícios de resistência muscular localizada na melhora da circulação sistêmica e local: um estudo de caso El efecto de un programa de ejercício físico aeróbico combinado con los ejercicios de resistencia muscular localizada en la mejora de la circulacion sistemica y local. Estudio de un caso The effect of a program of combined aerobic physical exercise with exercises of localized muscular resistance in the improvement of systemic and local circulation: a case study

    Directory of Open Access Journals (Sweden)

    Ricardo Bosco

    2004-02-01

    Full Text Available INTRODUÇÃO: A trombofilia, estado que predispõe à ocorrência de trombose, decorre da existência de alterações da hemostasia, podendo ser congênita ou adquirida. A deficiência de proteína S, que ocorre pela falta do co-fator para a proteína C, é uma alteração congênita que pode resultar em trombofilia. A reabilitação física, considerada uma terapêutica eficaz, tem seu papel definido na prevenção e tratamento de doenças cardiovasculares. OBJETIVO: Este estudo se propôs a verificar a influência do exercício físico aeróbio associado aos exercícios de resistência muscular localizada na circulação sistêmica e colateral do membro superior e inferior direito e na redução das conseqüências causadas pelas retrações decorrentes das cirurgias. MATERIAL E MÉTODO: A amostra foi composta por uma paciente do sexo feminino, 19 anos, portadora da síndrome de hipercoagulabilidade (trombofilia congênita por deficiência da proteína S, com obstrução total na artéria axilar direita e parcial na artéria femoral superficial direita. O programa de exercícios foi dividido em duas fases. Fase I: Atividades para aumento da amplitude de movimentos, em que se realizavam aplicação de calor, alongamentos passivos manuais mantidos, drenagem linfática e manipulações Effleurage. Fase II: Constituída de exercício aeróbio (45 minutos de caminhada, três vezes por semana, intensidade de 60% a 85% da freqüência cardíaca máxima e exercícios de resistência muscular localizada (contrações dinâmicas, três séries com o máximo de repetições possíveis, baixa intensidade, favorecendo fatores aeróbios. RESULTADOS: 1. Melhora da circulação colateral à artéria axilar, constatada pelo aumento na velocidade de pulso sistólico (verificado através do exame doppler pulsado - na artéria radial, passou de 3,4cm/s para 16,8cm/s; na artéria braquial, de 8,7cm/s para 45,9cm/s. 2. Melhor tolerância ao exercício aeróbio. 3

  7. Efeito do exercício aeróbico e resistido no controle autonômico e nas variáveis hemodinâmicas de jovens saudáveis Effect of resistance and aerobic exercise on the autonomic control and hemodynamic variables in health young individuals

    Directory of Open Access Journals (Sweden)

    César Cavinato Cal Abad

    2010-12-01

    Full Text Available A prática de exercícios aeróbicos e resistidos provoca ajustes agudos e crônicos distintos. Já foram documentadas diferenças hemodinâmicas e musculares entre os exercícios; todavia, quanto aos ajustes autonômicos, os estudos são escassos e controversos. O objetivo deste estudo foi analisar as adaptações hemodinâmicas e autonômicas após uma sessão de exercício aeróbico (30 minutos, bicicleta ergométrica e resistido (três séries de 12 repetições para os principais grupamentos musculares, em indivíduos jovens e saudáveis. Para tanto, utilizamos medidas da pressão arterial (PA, frequência cardíaca (FC, cálculo do duplo produto e análise da variabilidade da FC (VFC nos domínios do tempo e da frequência e a Plotagem de Poincaré. Neste protocolo, a FC durante o exercício aeróbico foi maior do que no resistido (153,32 ± 2,76 vs. 143,10 ± 3,38 bpm, respectivamente. O exercício aeróbico gerou aumento da PA sistólica durante o exercício (7,25 ± 1,97 mmHg. Já o exercício resistido provocou aumento tanto da PA sistólica quanto da diastólica durante sua execução (14,83 ± 1,53; 11,92 ± 1,69 mmHg, respectivamente. Não foi observada hipotensão pós-exercício para nenhuma das sessões. Ao comparar o exercício aeróbico com o resistido na fase de recuperação, verificamos diminuição na VFC no resistido nas variáveis: RMSSD (37,74 ± 5,30 vs. 19,50 ± 2,32, NN50 (94,13 ± 23,65 vs. 27,63 ± 6,68, PNN50 (16,10 ± 4,72 vs. 3,53 ± 0,89, SD1 (26,65 ± 3,85 vs. 13,73 ± 1,66, SD2 (88,98 ± 10,71 vs. 61,88 ± 5,49 e HF (257,25 ± 45,08 vs. 102,75 ± 18,75 ms². Concluiu-se que, para os protocolos investigados, o trabalho cardiovascular durante o exercício foi semelhante, resultando principalmente do aumento da FC no exercício aeróbico e do aumento da PAS no resistido. No período de recuperação, o exercício resistido promoveu maior alteração autonômica, compatível com manutenção do balan

  8. Valoración del efecto de un programa de ejercicio aeróbico a intensidad moderada y un programa de ejercicio de resistencia muscular, sobre la calidad de vida, aptitud física, control clicémico y memoria auditiva a corto plazo en mujeres adultas mayores con diabetes mellitus tipo 2 del área de salud de Aserrí

    OpenAIRE

    Carpio Carvajal, Yancy; Gamboa Garro, Roberto

    2007-01-01

    TESIS TEXTO COMPLETO Valora el efecto de un programa de ejercicio aeróbico a intensidad moderada y programa de ejercicio de resistencia muscular, sobre la calidad de vida, aptitud física, control glicémico y memoria auditiva a corto plazo en mujeres adultas mayores con Diabetes Mellitus (DM) Tipo 2. Para la investigación se contó con la participación de 45 mujeres adultas, con edad promedio de 70.62 - 7,82 (rango de 57 a 89 años) que padecían DM tipo 2, las cuales habitaban en el Area de S...

  9. Changes in some hematologic variables in a group of women older tan 55 years, after a program of aerobic training Cambios en algunas variables hematológicas, en un grupo de mujeres mayores de 55 años, luego de un programa de entrenamiento aeróbico

    Directory of Open Access Journals (Sweden)

    Diana Patricia Díaz Hernández

    2003-03-01

    Full Text Available Objective: to evaluate changes in some hematologic variables after a four-month program of aerobic physical activity, in a group of healthy women, older than 55 years. Methods: 14 healthy sedentary women, older than 55 years were studied; they participated in a program of aerobic physical activity, three times per week, during four months, with an intensity between 60-85% of the maximal heart rate and with 60 minutes of duration per session. Before and after the program blood specimens were obtained to evaluate changes of hemoglobin, hematocrite, red blood cells count, average corpuscular volume, average corpuscular hemoglobin, and average concentration of corpuscular hemoglobin; by means of a maximal test in treadmill the maximal oxygen uptake (VO2max was determined. Results: significant increase was found in hemoglobin (p<0.01, hematocrite (p<0.001, average corpuscular volume (p<0.001, average corpuscular hemoglobin (p<0.01 and VO2max (p<0.05. There were no changes in red blood cell count and average concentration of corpuscular hemoglobin. Conclusion: in the studied group, a program of regular physical activity, with an intensity between 60-85% of the maximal heart rate, increased hemoglobin and hematocrite. This results suggest that aerobic training increases the transport of oxygen to tissues. Objetivo: determinar los cambios en algunas variables hematológicas luego de un programa de actividad física aeróbica, por un período de cuatro meses, en un grupo de mujeres sedentarias sanas mayores de 55 años. Método: se estudiaron 14 mujeres mayores de 55 años, sedentarias, sanas, a quienes se les realizó un programa de actividad física aeróbica tres días a la semana, durante cuatro meses consecutivos, con una intensidad entre el 60 y el 85% de la FCmax y una duración de 60 minutos. Antes y después del programa de actividad física se obtuvieron muestras de sangre para evaluar el comportamiento de la hemoglobina (Hb, el hematocrito

  10. Fermentation, losses, and aerobic stability of sugarcane silages treated with chemical or bacterial additives Fermentação, perdas e estabilidade aeróbia de silagens de cana-de-açúcar tratadas com aditivos químicos ou bacterianos

    Directory of Open Access Journals (Sweden)

    André de Faria Pedroso

    2008-12-01

    Full Text Available Utilization of sugarcane Saccharum officinarum L. silage is increasing in Brazil but intensive ethanol production during fermentation reduces forage quality. This experiment aimed to evaluate the effects of additives on fermentation and aerobic stability of sugarcane silages produced in minisilos. Treatments were (fresh basis: untreated silage (control, urea (5.0 g kg-1, sodium benzoate (1.0 g kg-1, potassium sorbate (0.3 g kg-1, Lactobacillus plantarum (1 x 10(6 cfu g-1, and Lactobacillus buchneri (3.64 x 10(5 cfu g-1. At the 94th day after ensilage, ethanol concentration was lower in urea, benzoate, sorbate and L. buchneri supplemented silages and higher in L. plantarum inoculated silage, as compared to control. Urea and benzoate treated silages showed the highest and L. plantarum treated silage the lowest in vitro dry matter digestibility. Effluent production was higher in the urea treated silage. Inoculation with L. buchneri reduced 50% ethanol production as compared to control. Urea and L. buchneri reduced yeast count. Aerobic stability was enhanced by L. buchneri and benzoate. Sodium benzoate and L. buchneri were the most promising additives, improving both silage fermentation and aerobic stability; inoculants containing L. plantarum can be deleterious to fermentation and conservation of sugarcane silages.A utilização de silagem de cana-de-açúcar (Saccharum officinarum L. está aumentando no Brasil, mas a intensa produção de etanol durante a fermentação reduz a qualidade da forragem. Este experimento visou avaliar os efeitos de aditivos na fermentação e estabilidade aeróbia de silagens de cana-de-açúcar produzidas em minisilos. Os tratamentos foram (base matéria verde: silagem sem tratamento (controle, uréia (5,0 g kg-1, benzoato de sódio (1,0 g kg-1, sorbato de potássio (0,3 g kg-1, Lactobacillus plantarum (1 x 10(6 ufc g-1 e Lactobacillus buchneri (3,64 x 10(5 ufc g-1. Aos 94 dias após a ensilagem, a concentração de

  11. Efeito do treinamento físico de membros superiores aeróbio de curta duração no deficiente físico com hipertensão leve The effect of short term Aerobic physical training using upper limbs in paraplegic persons with mild to moderate hypertension

    Directory of Open Access Journals (Sweden)

    Sandra Haddad

    1997-09-01

    Full Text Available OBJETIVO: Verificar as alterações provocadas pelo treinamento físico (TF, com membros superiores (MMSS, em condição aeróbia de curta duração, sobre variáveis dos sistemas cardiovascular e metabólico. MÉTODOS: Foram estudados 11 deficientes físicos (DF paraplégicos, com média de idade de 59 anos, sendo 7 homens e 4 mulheres, com lesão de T9 a T11 e grau leve de hipertensão arterial sistêmica (HAS. Os DF foram avaliados antes e após 12 semanas de um programa de TF supervisionado de MMSS, por meio de teste ergométrico (TE em cicloergômetro mecânico adaptado para MMSS, utilizando-se protocolo intermitente com incremento de carga de 125kgm/min (20w para mulheres e 140kgm/min (25w para homens a cada 3min., em velocidade que variou de 83 a 95rpm. O consumo de oxigênio (VO2 foi calculado de acordo com a equação para MMSS do American College of Sports Medicine. A intensidade do exercício durante o programa de TF foi estabelecida pela reserva de freqüência cardíaca (RFC de Karvonen, com variação de 65% a 85% e escala de percepção subjetiva ao esforço de Borg obtida pelo TE. RESULTADOS: A capacidade aeróbia máxima estimada aumentou 22% (930±349 vs 1138±290mL/min; p=0,003; a pressão arterial sistólica (PAS e diastólica (PAD em repouso e no exercício submáximo diminuíram em 4%, 15% e 5%, 5%, respectivamente. CONCLUSÃO: O TF aeróbio de intensidade leve a moderada com MMSS, além de melhorar a aptidão funcional exerce também papel importante como modelo terapêutico não medicamentoso na resposta hipertensiva observada em DF paraplégicos.PURPOSE: To study the modifications induced by physical training (PT using upper limbs in aerobic condition of short duration on cardiovascular and metabolic variables. METHODS: Eleven paraplegic persons, with a mean age of 59 years, 7 men and 4 women with lesions at T9 through T11 and mild hypertension (HAS were studied. The patients were studied before and after 12 weeks of a

  12. Exercício aeróbico, treinamento de força muscular e testes de aptidão física para adolescentes com fibrose cística: revisão da literatura Exercise testing, aerobic and strength training for adolescents with cystic fibrosis: a literature review

    Directory of Open Access Journals (Sweden)

    Celia Regina Moutinho de Miranda Chaves

    2007-09-01

    Full Text Available São reconhecidos os benefícios da prática do exercício físico regular para pacientes com fibrose cística. Entretanto, poucos estudos envolvem pacientes adolescentes. O objetivo deste artigo foi revisar os efeitos da prática regular de exercícios aeróbicos e de força e resistência muscular para adolescentes com fibrose cística. Os principais testes de aptidão física para esta faixa etária e a importância deles para melhora do prognóstico e tratamento da doença também foram avaliados. As informações foram coletadas a partir de livro-texto e artigos publicados na literatura nacional e estrangeira nas seguintes bases de dados: LILACS, MEDLINE/PubMed, Biblioteca Cochrane e SciELO, abrangendo o período de 1994 a 2004. Foram utilizados os termos "exercise" e "cystic fibrosis" para seleção dos artigos. Esta pesquisa demonstrou que a prática de exercício aeróbico e treinamento de força muscular melhoram a desobstrução da árvore brônquica, diminuem a queda progressiva da função pulmonar, aumentam a massa muscular e a resistência ao exercício, promovem o desenvolvimento ósseo e melhoram a auto-estima e a qualidade de vida. Os melhores resultados foram obtidos com os programas de treinamento assistido, devido a sua maior regularidade.The benefits of regular physical exercises for cystic fibrosis patients are well known. Nevertheless, few studies involve adolescent patients. The objective of this article was to review the effects of regular practice of aerobic exercises, strength exercises and muscular exercises in adolescents with cystic fibrosis. The main physical fitness tests for this age bracket and their value in improving prognosis and treatment were assessed as well. Information was collected from text books and articles published in the national and foreign literature in the following databases: LILACS, MEDLINE/PubMed, Cochrane Library and SciELO, comprising the period of 1994 to 2004. The terms "exercise" and

  13. Efeito do exercício aeróbio e resistido no perfil antropométrico e respostas cardiovasculares de idosos portadores de hipertensão = Aerobic exercise and resistance effect on the anthropometric profile and cardiovascular responses in elderly people with high blood pressure

    Directory of Open Access Journals (Sweden)

    Kleverton Krinski

    2006-01-01

    Full Text Available O presente estudo teve por objetivo analisar os efeitos do exercício aeróbio e resistido no perfil antropométrico e respostas cardiovasculares de idosos portadores de hipertensão arterial (HA. A amostra foi composta de 53 voluntários de ambos os sexos, todos sedentários, com idade de 64,28±4,7 anos, cor branca, portadores de HA. Foram analisados os níveis de pressão arterial (PA, freqüência cardíaca (FC peso corporal (Kg, IMC e percentual de gordura corporal (%GC, antes, durante e após seis meses de exercícios. O protocolo de treinamento foi composto por uma sessão de exercícios, dividida em 20 minutos de atividade aeróbia e 40 minutos de exercícios resistidos dinâmicos, com freqüência semanal de três vezes e duração de seis meses. Como principais resultados apresentaram-se diferenças significativas em relação ao %GC, acompanhado de umaredução linear na pressão arterial média (PAM e FC, indicando uma melhora em importantes parâmetros morfofuncionais.The present study aimed to analyze the aerobic and resistance exercise effects on the anthropometric profile and cardiovascular responses in elderly people with High Blood Pressure (HBP. The sample consisted of 53 volunteers of both genders who were allsedentary, at the age of 64.28±4.7 years old, fair skin, with HBP. The blood pressure levels, cardiac frequency (CF, body weight (Kg, BMI and body fat percentage (BF% were analyzed before, during and after the period of exercises. The training protocol consisted ofexercise sessions divided into 20 minutes of aerobic activity and 40 minutes of dynamic resistance exercises, three times a week, during a period of six months. Results showed a significant difference in relation to the BF%, followed by a linear reduction in the AverageBlood Pressure (ABP and CF, as well as an improvement in important morphofunctional parameters.

  14. Perdas fermentativas e estabilidade aeróbia de silagens de cana-de-açúcar tratadas com cal virgem e cloreto de sódio Fermentation losses and aerobic stability of sugarcane silages treated with whitewash and sodium chlorite

    Directory of Open Access Journals (Sweden)

    A.V. Rezende

    2011-04-01

    Full Text Available Esta pesquisa foi realizada com o objetivo de determinar o efeito da inclusão de cal virgem e cloreto de sódio sobre as perdas fermentativas e a estabilidade aeróbia de silagens de cana-de-açúcar. O delineamento experimental utilizado foi o totalmente ao acaso em esquema de parcelas subdivididas com quatro repetições, de modo que os aditivos foram avaliados nas parcelas (silagem sem aditivo; silagens contendo 0,5; 1,0 e 2,0% de cloreto de sódio; e silagens contendo 0,5; 1,0 e 1,5% de cal virgem na matéria natural e os tempos de exposição ao oxigênio nas subparcelas. Após 75 dias da ensilagem, os silos foram abertos para determinação dos teores de matéria seca (MS e da perda de MS por efluente e gases e aferição da temperatura e do pH da silagem. A inclusão de cal nas silagens, independentemente da dose utilizada, proporcionou maior teor de MS e menor perda de MS. As menores temperaturas foram observadas nas silagens tratadas com cloreto de sódio. Os aditivos utilizados, sobretudo o cloreto de sódio, foram eficientes em manter a estabilidade aeróbia da silagem de cana.The objective of this work was to determine the inclusion of whitewash and sodium chloride on the fermentative losses and aerobic stability of sugarcane silages. It was used a completely randomized experimental design in split plot scheme with four replicates, so the additives were evaluated in the plots (silage without additive, silages containing 0.5; 1.0 and 2.0% of sodium chloride; and silages containing 0.5; 1.0 and 1.5% of whitewash, on the basis of natural matter and the time of exposition to oxygen was evaluated in the subplots. After 75 days from ensilage, silos were opened for determination of the contents of dry matter (DM and the loss of dry matter by effluent and gases and checking of temperature and pH of the silage. The addition of whitewash into silages, regardless to the dose utilized, provides greater DM content and smaller loss of DM. The

  15. Novos aditivos microbianos na ensilagem da cana-de-açúcar: composição bromatológica, perdas fermentativas, componentes voláteis e estabilidade aeróbia New microbial additives on sugarcane ensilage: bromatological composition, fermentative losses, volatile compounds and aerobic stability

    Directory of Open Access Journals (Sweden)

    Patrick Schmidt

    2011-03-01

    Full Text Available Nesta pesquisa, comparou-se a inclusão de aditivo composto por cepas de Lactobacillus brevis + Enterococcus faecium + L. plantarum à inoculação com aditivo comercial contendo cepas de Lactobacillus buchneri e à ensilagem sem aditivos (controle. As silagens foram confeccionadas em silos experimentais e armazenadas por 90 dias antes da abertura do silo. Foram avaliadas a composição bromatológica da cana-de-açúcar antes e após a ensilagem, a composição de ácidos orgânicos e etanol das silagens, a estabilidade aeróbia e as perdas fermentativas durante o processo de ensilagem. O uso do aditivo composto e do aditivo comercial contendo cepas de Lactobacillus buchneri provocou aumento da produção de efluentes e de gases e da perda total de matéria seca. O teor de ácido lático da silagem aumentou com o uso do aditivo composto, embora esse aditivo também tenha elevado o teor de etanol (18,6% da MS em relação ao da silagem controle (14,4%. A estabilidade aeróbia da silagem não foi influenciada pelos inoculantes adicionados no processo de ensilagem. Os aditivos aplicados prejudicaram o processo de ensilagem da cana-de-açúcar.In this study, the inclusion of Lactobacillus brevis + Enterococcus faecium + L. plantarum was compared to the inoculation with a commercial additive containing strains of Lactobacillus buchneri and to the silage without additives (control. Silages were prepared in experimental silos and stored for 90 days before opening of the silos. It was evaluated chemical composition of sugarcane before and after ensiling process, composition of organic acids and ethanol in the silages, aerobic stability and fermentative losses during the ensiling process. Use of compound additive and commercial additive containing strains of Lactobacillus buchneri increased production of effluents and gas and total dry matter losses. Lactic acid content in the silage increased with the use of compound additive, although this additive

  16. Estabilidade aeróbia da ração total e de silagens de capim-marandu tratadas com aditivos químicos e bacterianos Aerobic stability of total mixed ration and marandugrass silage using microbial or chemical additive

    Directory of Open Access Journals (Sweden)

    Thiago Fernandes Bernardes

    2007-08-01

    Full Text Available Esta pesquisa foi realizada com o objetivo de determinar o efeito da inclusão de aditivo químico e da inoculação de bactérias homo e heterofermentativas sobre a estabilidade aeróbia de silagens de capim-marandu e da ração total. Foram conduzidos três experimentos para avaliação do benzoato de sódio e de dois inoculantes, um contendo Lactobacillus plantarum + Propionibacterium e o segundo Lactobacillus buchneri. Após 60 dias de fermentação, os silos foram abertos e as silagens e a ração total (RT contendo silagens de capim-marandu foram colocadas em caixas de isopor e transferidas para câmara climática, a 25 ± 1ºC, para determinação das variações de temperatura na ração total e na silagem, das recuperações de MS e das alterações no pH da silagem. O delineamento experimental foi o inteiramente casualizado, em esquema de parcelas subdivididas. Houve perdas de MS e elevação dos teores de pH quando as silagens foram colocadas em condições de aerobiose. A temperatura das silagens e da RT teve discreto aumento durante os seis dias de aeração. O uso de bactérias ou de benzoato de sódio não influenciou a estabilidade aeróbia das silagens.This research evaluated the inclusion of chemical additive and the inoculation with homo and heterofermentative bacteria on the aerobic stability of the Marandu grass silages and on the total mixed ration (TMR. It was conducted three experiments to evaluate sodium benzoate and two inoculants: 1. Lactobacillus plantarum + Propionibacterium and; 2. Lactobacillus buchneri. The silos were opened after 60 days of fermentation; the silages and the TMR containing the silages were placed in a polystyrene box, and transferred to a climatic chamber kept at 25 ± 1ºC to determine the temperature changes, dry matter recovery, and pH values. The data were analyzed according to a complete randomized design, in a split plot arrangement. The silages showed DM losses and increasing pH during the

  17. Efeitos do estado e especificidade do treinamento aeróbio na relação %VO2max versus %FCmax durante o ciclismo Effects of the state and specificity of aerobic training on the %VO2max versus %HRmax ratio during cycling

    Directory of Open Access Journals (Sweden)

    Fabrizio Caputo

    2005-01-01

    Full Text Available OBJETIVO: Determinar os efeitos do estado e especificidade de treinamento aeróbio na relação entre o percentual do consumo máximo de oxigênio (%VO2max e o percentual da frequência cardíaca máxima (%FCmax durante o exercício incremental realizado no cicloergômetro. MÉTODOS: Sete corredores, 9 ciclistas, 11 triatletas e 12 sedentários, todos do sexo masculino e aparentemente saudáveis, foram submetidos a um teste incremental até a exaustão no cicloergômetro. Regressões lineares entre %VO2max e %FCmax foram determinadas para cada indivíduo. Com base nessas regressões, foram calculados %FCmax correspondentes a determinados %VO2max (50, 60, 70, 80 e 90% de cada participante. RESULTADOS: Não foram encontradas diferenças significantes entre todos os grupos nos %FCmax para cada um dos %VO2max avaliados. Analisando-se os voluntários como um único grupo, as médias dos %FCmax correspondentes a 50, 60, 70, 80 e 90% %VO2max foram 67, 73, 80, 87, e 93%, respectivamente. CONCLUSÃO: Nos grupos analisados, a relação entre o %VO2max e %FCmax durante o exercício incremental no ciclismo não é dependente do estado e especificidade do treinamento aeróbio.OBJECTIVE: To determine the effects of the status and specificity of exercise training in the ratio between maximum oxygen consumption (%VO2max and the percentage of maximal heart rate (%HRmax during incremental exercise on a cycle ergometer. METHODS: Seven runners, 9 cyclists, 11 triathletes, and 12 sedentary individuals, all male and apparently healthy, underwent exhaustive incremental exercise on cycle ergometers. Linear regressions between %VO2max x %HRmax were determined for each individual. Based on these regressions, %HRmax was assessed corresponding to a determined %VO2max (50, 60, 70, 80, and 90% from each participant. RESULTS: Significant differences were not found between the groups in %HRmax for each of the %VO2max assessed. Analyzing the volunteers as a single group, the

  18. Eficiência na remoção de NAT, DBO e DQO utilizando reator aeróbio de leito fluidizado com circulação em tubos concêntricos associado ao decantador de coluna em uma produção intensiva de tilápia

    Directory of Open Access Journals (Sweden)

    Tsunao Matsumoto

    Full Text Available RESUMO O desenvolvimento da aquicultura intensiva é acompanhado de um crescente impacto ambiental produzido pelos efluentes gerados. Os sistemas de recirculação para aquicultura (SRA são uma alternativa compacta e trabalham com elevadas densidades de estocagem e menores volumes de água. Foi utilizado um decantador de coluna (DC associado ao reator aeróbio de leito fluidizado com circulação em tubos concêntricos (BAS-CT com tempo de retenção hidráulica (TRH de 0,55 e 0,20 h respectivamente, num SRA com tilápias de 0,32 kg de peso médio e densidade de estocagem de 33,1 kg.m-3 em relação à remoção do nitrogênio amoniacal total (NAT, demanda bioquímica de oxigênio (DBO e demanda química de oxigênio (DQO. As eficiências na remoção de NAT, DBO e DQO foram 35,2, 48,0 e 64,9%, respectivamente. No uso de DC com o BAS-CT, obteve-se bom desempenho, com baixos TRH no tratamento do efluente.

  19. Efeito da atividade física associada à orientação alimentar em adolescentes obesos: comparação entre o exercício aeróbio e anaeróbio Efecto de la actividad física asociada a la orientación alimentar en adolescentes obesos: comparación entre el ejercicio aeróbico y anaeróbico Effect of physical activity associated with nutritional orientation for obese adolescents: comparison between aerobic and anaerobic exercise

    Directory of Open Access Journals (Sweden)

    Renata Viccari Sabia

    2004-10-01

    Full Text Available A obesidade na adolescência é uma doença universal de prevalência mundial crescente, assumindo caráter epidemiológico como problema de saúde pública na sociedade moderna. Este trabalho teve como objetivo comparar o efeito do exercício físico aeróbio contínuo e anaeróbio intermitente associado à orientação alimentar sobre a composição corporal, as medidas bioquímicas e a capacidade física de adolescentes obesos. Foram investigados 28 adolescentes (média de idade = 13 anos, com índice de massa corporal (IMC acima do percentil 95 para a idade e sexo, distribuídos em dois grupos de forma aleatória: exercício de caminhada contínua (GEC; n = 13 e exercício de corrida intermitente (GEI; n = 15 e submetidos a um programa de treinamento físico três vezes por semana durante 16 semanas por 20 a 40 minutos. A atividade de orientação nutricional ocorreu uma vez por semana, em grupo, por 60 minutos, durante todo o experimento. Foram realizadas, no período inicial e final, medidas de peso e altura, pregas subcutâneas, circunferências do braço (CB e muscular do braço (CMB, composição corporal por bioimpedância elétrica, análises bioquímicas séricas (glicemia e lipídios e determinação direta de consumo máximo de oxigênio (VO2max e limiar anaeróbio (LAn. Como resultados antropométricos, observamos diminuição do IMC e das pregas cutâneas com diferença significativa nos dois grupos (GEC e GEI. Na avaliação bioquímica, houve diminuição significativa nos níveis séricos de HDL e LDL, colesterol total, e aumento do triglicérides e glicemia no GEC, embora mantendo-se dentro dos valores de normalidade. No GEI, o HDL e triglicérides tiveram diminuição significativa. O VO2max aumentou estatisticamente nos dois grupos. Concluímos que a atividade física proposta e a orientação alimentar, tanto para o GEC quanto para GEI, foi suficiente e satisfatória, promovendo diminuição ponderal, melhora da composi

  20. Comparação entre os métodos rápidos SimplateR TPC- CI e PetrifilmR AC e os métodos convencionais de contagem em placas para a enumeração de aeróbios mesófilos em sorvetes Comparasion of SimplateR test and Petrifilm with plate count agar method for detection and enumeration of bacteria in ice cream

    OpenAIRE

    Anderson de Souza Sant'ana; Caetano da Conceição; Denise Rosane Perdomo Azeredo

    2002-01-01

    A contagem de aeróbios mesófilos ou contagem padrão em placas em um produto alimentício reflete a qualidade da matéria-prima, bem como as condições de processamento, manuseio e estocagem. O método de contagem em placas tradicionais requer 48h de incubação para a posterior leitura dos resultados. Comparou-se dois métodos que parecem ser uma boa alternativa para a contagem padrão em placas: SimplateR TPC-CI e PetrifilmR AC. Também avaliou-se a capacidade inibitória do 2, 3, 5 cloreto de trifeni...

  1. Efeito do Lactobacillus buchneri na fermentação, estabilidade aeróbia e no valor nutritivo de silagem de cana-de-açúcar Effect of Lactobacillus buchneri on fermentation, aerobic stability, and nutritive value of sugar cane silage

    Directory of Open Access Journals (Sweden)

    Clayton Quirino Mendes

    2008-12-01

    Full Text Available Dois experimentos foram realizados para avaliar o valor nutritivo, a estabilidade aeróbia de silagens de cana-de-açúcar e a digestibilidade aparente de rações contendo essas silagens. No experimento 1, a cana-de-açúcar foi ensilada sem aditivo ou inoculada com cepas NCIMB 40788 do Lactobacillus buchneri (5 x 10(4 ufc/g de matéria verde. Amostras das silagens foram analisadas e comparadas à cana-de-açúcar in natura para avaliação da estabilidade aeróbia, considerando os dados de temperatura, pH e perdas de MS das silagens. No experimento 2, utilizaram-se 12 cordeiros distribuídos em blocos completos casualizados e mantidos em gaiolas para ensaio de metabolismo recebendo rações contendo cana-de-açúcar in natura, silagem de cana-de-açúcar sem aditivo ou silagem de cana-de-açúcar tratada com Lactobacillus buchneri. Os teores de matéria seca, carboidratos solúveis e ácido acético foram maiores na silagem com aditivo. O teor de etanol não diferiu entre as silagens. A silagem tratada com aditivo apresentou menor perda de matéria seca e manutenção do pH durante o período de avaliação em aerobiose. A digestibilidade aparente de fibra em detergente neutro, fibra em detergente ácido e hemicelulose foram maiores nas rações contendo silagem de cana-de-açúcar.Two trials were performed to evaluate the nutritive value and aerobic stability of sugar cane silage, as well as apparent digestibility of diets containing these silages. In trial 1, sugar cane was ensiled without additive or inoculated with strains NCIMB 40788 of Lactobacillus buchneri (5 x 10(4 cfu/g wet basis. Silages were sampled, analyzed, and compared with fresh sugar cane. Aerobic stability was evaluated by controlling the temperature, pH, and dry matter losses of the silages. In trial 2, twelve lambs were assigned to a complete randomized block design and placed in metabolism crates and fed with diets composed by fresh sugar cane, sugar cane silage without

  2. Tratamento de águas residuárias de suinocultura em reatores anaeróbios horizontais seguidos de reator aeróbio em batelada sequencial Swine waste water treatment in horizontal anaerobic reactor followed by aerobic sequencing batch reactor

    Directory of Open Access Journals (Sweden)

    Ariane C. dos Santos

    2011-01-01

    Full Text Available Avaliou-se o desempenho de um sistema combinado anaeróbio-aeróbio para o tratamento de águas residuárias de suinocultura, com concentrações médias de sólidos suspensos totais (SST de 18.624 e 11.395 mg L-1. Foram utilizados quatro reatores anaeróbios horizontais com volume total de 49,5 L cada, um com manta de lodo (RAHML e três de leito fixo (RAHLF, instalados em série e seguidos de um reator aeróbio operado em batelada sequencial (RBS com volume total de 339 L e com alimentação contínua. Nos RAHLF, foram utilizados como meios suporte de anéis de bambu, anéis plásticos de eletroduto corrugado e anéis de bucha (Luffa cillyndrica, respectivamente. Os tempos de detenção hidráulica (TDH e as cargas orgânicas volumétricas (COV aplicadas no RAHML foram de 12 e 10 h e 53 e 61 g DQO (L d-1, respectivamente. O RBS foi operado com ciclo de 24 h e COV de 0,34 e 0,50 g DQO (L d-1. As eficiências médias de remoção de DQOtotal e SST para o conjunto de reatores anaeróbios horizontais, em série, foram de 96 e 99%, e de 96 e 95%, respectivamente. As maiores produções volumétricas de metano ocorreram nos RAHLF, com valores médios de até 0,744 m³ CH4 (m³ reator d-1. A inclusão do RBS permitiu melhorar a qualidade do efluente e a estabilidade do sistema de tratamento, atingindo eficiências de remoção de DQOtotal e SST de 99 e 99%, e de 98 e 99%, respectivamente. No RBS, ocorreu nitrificação e desnitrificação, com remoções de N-amoniacal de até 65%.An anaerobic-aerobic combined system was evaluated to treat swine wastewater with an average total suspended solids (TSS concentration of 18,624 to 11,395 mg L-1. The anaerobic treatment system was constituted by four horizontal reactors each one having a total volume of 49.5 L, one with sludge blanket (HASBR and tree with fixed film (HAFFR installed in series, followed by an aerobic sequential batch reactor (SBR with continue feeding, with total volume of 339 L. In the

  3. Contagem de bactérias mesófilas aeróbias e características físico-químicas do leite humano armazenado em embalagem de polietileno / Aerobic mesophilic bacteria count and physical and chemical characteristics of breast milk stored in polyethylene packages

    Directory of Open Access Journals (Sweden)

    Mayara de Simas Mesquita

    2016-08-01

    Full Text Available Objetivo: Avaliar a contaminação por bactérias mesófilas aeróbias em leite humano ordenhado pasteurizado (LHOP e a influência da embalagem de polietileno sobre as características físico-químicas do leite humano (LH cru e pasteurizado. Metodologia: Foram analisadas 55 amostras de leite humano ordenhado (LHO, oriundas do Banco de Leite Humano (BLH do Hospital Maternidade Herculano Pinheiro (HMHP e do Instituto Fernandes Figueira (IFF. Na determinação das condições higiênico-sanitárias do LHOP, foi realizada contagem de bactérias mesófilas aeróbias. A acidez Dornic, o valor energético, gordura, lactose e proteínas em LH cru e pasteurizado foram realizados antes e após o armazenamento de 15 dias nas embalagens. Foram realizadas análises descritivas e da influência da embalagem sobre os parâmetros, segundo ANOVA. Valores p < 0,05 foram considerados significativos. Resultados: A ocorrência de mesófilos no LHOP variou de 0 a 12%. O LH cru e pasteurizado apresentaram acidez < 8oDornic, indicando boas práticas de manejo e condições higiênico-sanitárias adequadas. Gordura, valor energético, lactose e proteínas do LH nas embalagens de polietileno e vidro variaram, respectivamente, 3,2–3,5%, 65–68 Kcal/dL, 6,0% e 0,9–1,3%. Não foram observadas diferenças significativas nas características físico-químicas do LH entre as embalagens. Conclusão: A embalagem de polietileno pode ser uma alternativa viável para uso em BLH. ======================================================= Objective: To determine the aerobic mesophilic bacteria count in pasteurized human milk and to evaluate the influence of polyethylene bags on the physicochemical characteristics of raw and pasteurized human milk. Methods: 55 samples of human milk coming from the Human Milk Bank of Herculano Pinheiro Hospital and Fernandes Figueira Institute were analyzed. An aerobic mesophilic bacteria count was performed when determining the sanitary hygienic

  4. Treinamento aeróbio em natação melhora a resposta de parâmetros metabólicos de ratos durante teste de esforço Aerobic swimming training improves metabolic parameters response during exertion test in rats

    Directory of Open Access Journals (Sweden)

    Juliana Silveira Freitas

    2010-04-01

    Full Text Available Foram investigados os efeitos do treinamento aeróbio em natação com baixa intensidade sobre as respostas do lactato e da glicose sanguíneos de ratos durante teste de esforço. Ratos Wistar adultos foram distribuídos aleatoriamente em dois grupos: sedentário (n = 6 e treinado (n = 6. Todos receberam água e ração ad libitum e foram mantidos em ambiente com temperatura de 22 ± 2ºC e ciclo claro/escuro de 12 horas. O grupo treinado foi submetido a um programa de natação contínua sem sobrecarga, 30 min/dia, cinco dias/semana, por seis semanas. Três dias após a última sessão de treino, as concentrações sanguíneas de lactato e glicose foram medidas em três momentos durante dois testes de esforço de 20 minutos (repouso, 10 min e 20 min, sendo um sem carga e outro com carga (5% do peso corporal, separados por dois dias. Observou-se correlação inversa entre lactato e glicose durante o exercício (ρ = - 0,74; P 0,05. Conclui-se que o treinamento aeróbio em natação aplicado foi capaz de alterar as respostas do lactato e glicose sanguíneos de ratos durante os testes de esforço.The effects of low intensity aerobic swimming training on blood lactate and glucose responses in rats were investigated during exertion test. Twelve adult male Wistar rats were randomly divided into two groups: sedentary (n= 6 and trained (n= 6. All animals received water and food ad libitum and were kept in a room with temperature of 22 ± 2ºC and dark/light cycle of 12 hours. Animals from trained group were submitted to a swimming training protocol of 30 min/day, 5 days/week, for 6 weeks. Sedentary animals did not exercise. Three days after the last training session all animals were submitted to two 20-minute swimming tests with 48 hour-interval, being one unloaded and the other with a load of 5 % of body weight. Blood lactate and glucose were measured at rest, 10 min and 20 min of exercise. Negative correlation between blood lactate and glucose levels

  5. Efeitos do exercício aeróbico e anaeróbico em variáveis de risco cardíaco em adultos com sobrepeso Effects of aerobic and anaerobic exercise on cardiac risk variables in overweight adults

    Directory of Open Access Journals (Sweden)

    Mônica Medeiros Moreira

    2008-10-01

    Full Text Available FUNDAMENTO: O exercício físico aeróbico é importante aliado no combate aos fatores de risco cardiovascular. No entanto, os efeitos de exercícios de alta intensidade sobre tais fatores ainda são pouco conhecidos. OBJETIVO: Comparar os efeitos de protocolos de exercícios aeróbico e anaeróbico sobre fatores associados ao risco cardíaco. MÉTODOS: Vinte e dois indivíduos com idade média de 40±8 anos foram alocados nos grupos: controle (CO, treinamento de endurance (ET e treinamento intermitente (IT. Os protocolos tiveram duração de 12 semanas, três vezes por semana; e intensidades de 10% abaixo e 20% acima do limiar anaeróbico (LAn. Foram medidas: massa corporal total (MCT, índice de massa corporal (IMC, circunferências de cintura (CINT e quadril (QUA e a composição corporal, além das concentrações plasmáticas de glicose (GLI, colesterol total (CHO e triglicérides (TG; ainda foram calculados a razão cintura-quadril (PCCQ e o índice de conicidade (Índice C. RESULTADOS: As variáveis de MCT, IMC, CINT, GLI e a composição corporal apresentaram alterações significativas nos grupos ET e IT. Os valores de CHO e QUA foram significativamente reduzidos no grupo ET, enquanto a PCCQ mostrou redução significativa no grupo IT. O LAn e o índice C, no grupo IT foram significativamente diferentes em relação a ET. CONCLUSÃO: Tendo em vista as diferenças encontradas nas respostas das variáveis estudadas, em razão do treinamento empregado, concluímos que um programa de exercício que contemple atividades de alta e baixa intensidades seja mais completo para garantir a redução de maior número de variáveis de risco cardíaco.BACKGROUND: Aerobic exercise is an important ally in the fight against cardiovascular risk factors. However, the effects of high-intensity exercise on these factors are still poorly known. OBJECTIVE: To compare the effects of aerobic and anaerobic exercise protocols on cardiac risk factors. METHODS: 22

  6. Aerobic bacterial microflora of Broad-snouted caiman (Caiman latirostris oral cavity and cloaca, originating from Parque Zoológico Arruda Câmara, Paraíba, Brazil Microflora bacteriana aeróbica da cavidade oral e cloaca de jacaré-de-papo-amarelo (Caiman latirostris procedentes do Zoológico de João Pessoa, PB, Brasil

    Directory of Open Access Journals (Sweden)

    J.S.A. Silva

    2009-03-01

    Full Text Available The objective of this study was to isolate and identify the aerobic bacterial microflora from the oral cavity mucosa and cloaca's samples, collected from Broad-snouted caiman (Caiman latirostris, born and bred in captivity at Parque Zoológico Arruda Câmara, João Pessoa, Paraíba, Brazil. The most common bacteria were Staphylococcus sp. (14.74%, Corynebacterium sp. (13.68%, Escherichia coli (13.68% and Shigella sp. (11.58%, and the less common were Citrobacter sp. (1.05%, Klebsiella pneumoniae (1.05% and Salmonella sp. (1.05%.This emphasizes the importance of these microorganisms' participation in infectious processes (sepsis and injuries caused by crocodilians.O presente estudo teve como objetivo isolar e identificar a microflora bacteriana aeróbica presente na mucosa da cavidade oral e da cloaca de exemplares de jacarés-de-papo-amarelo (Caiman latirostris nascidos e criados em cativeiro no Parque Zoológico Arruda Câmara, localizado na cidade de João Pessoa - PB. As bactérias mais freqüentes foram Staphylococcus sp. (14,74%, Corynebacterium sp.(13,68%, Escherichia coli (13,68% e Shigella sp. (11,58%, e as menos prevalentes foram Citrobacter sp.(1,05%, Klebsiella pneumoniae (1,05% e Salmonella sp. (1,05%. Ressalta-se a importância da participação desses microrganismos em processos infecciosos (septicemias e em feridas provocadas por crocodilianos.

  7. Índices técnicos correspondentes à velocidade crítica e à máxima velocidade de 30 minutos em nadadores com diferentes níveis de performance aeróbia Technical indexes corresponding to the critical speed and the maximal speed of 30 minutes in swimmers with different aerobic performance levels

    Directory of Open Access Journals (Sweden)

    Jailton Gregório Pelarigo

    2007-06-01

    Full Text Available O principal objetivo deste estudo foi verificar o efeito do nível de performance aeróbia na relação entre os índices técnicos correspondentes à velocidade crítica (VC e à velocidade máxima de 30 minutos (V30 em nadadores. Participaram deste estudo, 23 nadadores do gênero masculino com características antropométricas similares, divididos segundo o nível de performance aeróbia em grupo G1 (maior performance (n = 13 e G2 (menor performance (n = 10. Os indivíduos tinham pelo menos quatro anos de experiência no esporte e treinavam um volume semanal de 30.000 a 45.000m. A VC foi determinada através do coeficiente angular da regressão linear entre as distâncias (200 e 400m e seus respectivos tempos. A V30 foi determinada através da máxima distância realizada em um teste de 30 minutos. Todas as variáveis foram determinadas no nado crawl. A VC foi significantemente maior do que a V30 no grupo G1 (1,30 ± 0,04 vs. 1,23 ± 0,06m.s-1 e no G2 (1,17 ± 0,08 vs. 1,07 ± 0,06m.s-1. As duas variáveis foram maiores no grupo G1. As taxas de braçada correspondentes à VC (TBVC e à V30 (TBV30 obtidas nos grupos G1 (33,07 ± 4,34 vs. 31,38 ± 4,15 ciclos.min-1 e G2 (35,57 ± 6,52 vs. 33,54 ± 5,89 ciclos.min-1 foram similares entre si. A TBVC foi significantemente menor no grupo 1 do que no grupo 2, enquanto que a TBV30 não foi diferente entre os grupos. Os comprimentos de braçada correspondentes à VC (CBVC e à V30 (CBV30 foram significantemente maiores no grupo G1 (2,41 ± 0,33 vs. 2,38 ± 0,30m.ciclo-1 do que no G2 (2,04 ± 0,43 vs. 1,97 ± 0,40m.ciclo-1, e similares entre si nos dois grupos. As correlações (r entre a VC e a V30 e as variáveis técnicas correspondentes às duas velocidades foram significantes em todas as comparações (0,68 a 0,91. Portanto, a relação entre a velocidade e as variáveis técnicas correspondentes à VC e à V30 não é modificada pelo nível de performance aeróbia.The main objective of this study

  8. Predição da potência aeróbia (VO2máx de crianças e adolescentes em teste incremental na esteira rolante Prediction of aerobic power (VO2max of children and adolescents during an incremental treadmill test

    Directory of Open Access Journals (Sweden)

    Fabiana Andrade Machado

    2013-03-01

    Full Text Available O consumo máximo de oxigênio (VO2máx é a quantidade máxima de energia que pode ser produzida pelo metabolismo aeróbio em determinada unidade de tempo, podendo ser determinado direta ou indiretamente através de equações preditivas. O objetivo deste trabalho foi elaborar uma equação preditiva específica para determinar o VO2máx de meninos de 10 a 16 anos. Quarenta e dois meninos realizaram teste ergoespirométrico de corrida em esteira rolante com velocidade inicial de 9 km/h até exaustão voluntária. Através da regressão linear múltipla foi possível desenvolver a seguinte equação para a determinação indireta do VO2máx: VO2máx (ml/min = -1574,06 + (141,38 x Vpico + (48,34 * Massa corporal, com erro padrão de estimativa = 191,5 ml/min (4,10 ml/kg/min e o coeficiente de determinação = 0,934. Sugerimos que esta é uma fórmula adequada para predizer o VO2máx para esta população.The maximal oxygen uptake (VO2max is the maximal quantity of energy that can be produced by the aerobic metabolism in certain time unity. It can be determined direct or indirectly by predictive equations. The objective of this study was to make a specific predictive equation to determine the VO2max from boys aged 10-16 years-old. Forty-two boys underwent a treadmill running ergospirometric test, with the initial velocity set at 9 km/h, until voluntary exhaustion. By the multiple linear regression was possible to develop the following equation for the indirect determination of the VO2max: VO2max (ml/min = -1574.06 + (141.38 x Vpeak + (48.34 * Body mass, with standard error of estimate = 191.5 ml/min (4.10 ml/kg/min and coefficient of determination = 0.934. We suggest that this formula is appropriate to predict VO2max for this population.

  9. O bloqueio da síntese do óxido nítrico promove aumento da hipertrofia e da fibrose cardíaca em ratos submetidos a treinamento aeróbio Nitric oxide synthesis blockade increases hypertrophy and cardiac fibrosis in rats submitted to aerobic training

    Directory of Open Access Journals (Sweden)

    Hugo Celso Dutra de Souza

    2007-08-01

    Full Text Available OBJETIVO: O presente estudo avaliou as adaptações teciduais cardíacas em ratos submetidos a treinamento aeróbio, após o bloqueio da síntese de óxido nítrico (NO. MÉTODOS: Os animais (n = 48 foram divididos em quatro grupos: sedentários (grupo CONTROLE, hipertensos após administração de Ng-nitro-L-arginina metil éster durante sete dias (grupo L-NAME, treinados por meio de natação durante oito semanas (grupo TREINADO e treinados e tratados com L-NAME na última semana (grupo TREINADO L-NAME. Em todos os animais foi registrada a pressão arterial (PA e realizada a avaliação morfométrica cardíaca. RESULTADOS: Os grupos L-NAME e TREINADO L-NAME apresentaram-se hipertensos em relação aos demais (p OBJECTIVE: The objective of the present study was to evaluate cardiac tissue adaptations in rats submitted to aerobic training after nitric oxide (NO synthesis blockade. METHODS: The animals (n=48 were divided into four groups: sedentary (CONTROL group; hypertensive after administration of NG-nitro-L-arginine methyl ester for 7 days (L-NAME Group; trained for 8 weeks through swimming exercises (TRAINED Group;trained and treated with L-NAME during the last week (L-NAME TRAINED Group. All the animals were submitted to the experiment procedures for blood pressure (BP readings and cardiac morphometric evaluation. RESULTS: In comparison to the other groups, the L-NAME and L-NAME TRAINED groups were hypertensive (p<0.05; however, BP elevation in the L-NAME TRAINED group was significantly lower than the L-NAME group (p<0.05. The heart weight indexes for the TRAINED and L-NAME TRAINED groups were higher than the CONTROL and L-NAME groups (p<0.05. Also they had presented higher rates of macroscopic cardiac area and cardiac fibrosis in relation to the rest (p<0.05; comparisons revealed that the values for the L-NAME TRAINED group were significantly higher (p<0.05 than the others. CONCLUSION: Short term NO synthesis blockade in sedentary animals

  10. Evaluación del proceso de descomposición aeróbica de egeria densa como alimento potencial para especies acuáticas (An assessment of the aerobic decomposition of Egeria densa as a potencial source of food for aquatic species

    Directory of Open Access Journals (Sweden)

    Nacif Osorio, Yamel

    2007-04-01

    Full Text Available ResumenLas plantas acuáticas son ampliamente conocidas como fuentes de alimento. En el caso de los organismos omnívorodetritívoros,el nivel de descomposición que presentan los vegetales al ser ingeridos determinan su contenido nutritivo. En este trabajo se evaluó el contenido nutrimental de la macrófita Egeria densa en estado de descomposición aeróbica a distintos tiempos, analizando los cambios que ocurren en la composición de su tejido, así como los principales agentes bióticos y abióticos que inciden en el proceso. Serealizó una caracterización físico-química del hábitat donde se recolectó esta especie. En el laboratorio se aplicó un diseño 2 X 2, con factores como temperatura (ambiente:21ºC y 25ºC y tamaño del vegetal (macrófita entera y fraccionada en segmentos < de 50mm,acondicionado con un inóculo bacteriano proveniente del sedimento del sitio de recolección. Se practicaron estudios microbiológicos en los inóculos aplicados inicialmente y del proceso de descomposición a través de su modificación semanal, sobre la cantidad y tipo de bacterias: coliformes fecales, totales y en grupos específicos deenterobacterias y algunas bacterias atógenas. Para analizar los cambios ocurridos en la composición del ensilado, se analizaron muestras semanales en su contenido de proteína, carbohidratos,lípidos, materia orgánica, minerales y contenido energético.A partir de los resultados de degradación del vegetal, se determinó un tiempo óptimo de acción bacteriana (2-3 semanas, para obtener material cuyo contenido nutritivo y energético pueda ser empleado como alimento en especies acuáticas de hábitos alimenticiosomnívoro– detritívoro.

  11. Efeito do exercício aeróbio e resistido no perfil antropométrico e respostas cardiovasculares de idosos portadores de hipertensão - DOI: 10.4025/actascihealthsci.v28i1.1093 Aerobic exercise and resistance effect on the anthropometric profile and cardiovascular responses in elderly people with high blood pressure - DOI: 10.4025/actascihealthsci.v28i1.1093

    Directory of Open Access Journals (Sweden)

    Hassan Mohamed Elsangedy

    2006-03-01

    Full Text Available O presente estudo teve por objetivo analisar os efeitos do exercício aeróbio e resistido no perfil antropométrico e respostas cardiovasculares de idosos portadores de hipertensão arterial (HA. A amostra foi composta de 53 voluntários de ambos os sexos, todos sedentários, com idade de 64,28±4,7 anos, cor branca, portadores de HA. Foram analisados os níveis de pressão arterial (PA, freqüência cardíaca (FC peso corporal (Kg, IMC e percentual de gordura corporal (%GC, antes, durante e após seis meses de exercícios. O protocolo de treinamento foi composto por uma sessão de exercícios, dividida em 20 minutos de atividade aeróbia e 40 minutos de exercícios resistidos dinâmicos, com freqüência semanal de três vezes e duração de seis meses. Como principais resultados apresentaram-se diferenças significativas em relação ao %GC, acompanhado de uma redução linear na pressão arterial média (PAM e FC, indicando uma melhora em importantes parâmetros morfofuncionaisThe present study aimed to analyze the aerobic and resistance exercise effects on the anthropometric profile and cardiovascular responses in elderly people with High Blood Pressure (HBP. The sample consisted of 53 volunteers of both genders who were all sedentary, at the age of 64.28±4.7 years old, fair skin, with HBP. The blood pressure levels, cardiac frequency (CF, body weight (Kg, BMI and body fat percentage (BF% were analyzed before, during and after the period of exercises. The training protocol consisted of exercise sessions divided into 20 minutes of aerobic activity and 40 minutes of dynamic resistance exercises, three times a week, during a period of six months. Results showed a significant difference in relation to the BF%, followed by a linear reduction in the Average Blood Pressure (ABP and CF, as well as an improvement in important morphofunctional parameters

  12. Condicionamento físico aeróbio moderado promove redução no rápido ganho de peso de ratos adultos desnutridos nos períodos de gestação e lactação Moderate aerobic physical conditioning reduces the fast weight gain of adult rats malnourished during pregnancy and lactation

    Directory of Open Access Journals (Sweden)

    Tâmara Nunes de Araújo

    2010-04-01

    Full Text Available OBJETIVO: Foram avaliados os efeitos do condicionamento físico aeróbio moderado sobre o peso corporal e o ganho de peso de animais submetidos à desnutrição na gestação e lactação e alimentados com dieta normoprotéica após o desmame. MÉTODOS: Ratos machos Wistar foram gerados e amamentados por nutrizes alimentadas com dieta normoprotéica (caseína 17% e dieta hipoprotéica (caseína 8%, formando os grupos Nutridos (n=18 e Desnutridos (n=17 inicialmente e, após o desmame, foram alimentados com dieta normoprotéica padrão do biotério (Labina®, Purina. Aos 60 dias de vida, os animais foram subdivididos em quatro grupos: Nutrido Sedentário (n=9, Nutrido Condicionado (n=7, Desnutrido na Gestação e Lactação Sedentário (n=8 e Desnutrido na Gestação e Lactação Condicionado (n=9. O condicionamento físico aeróbio moderado foi realizado em esteira elétrica durante 8 semanas, 5 dias/ semana, 60min/dia e os animais sofreram eutanásia após o término do protocolo. Realizaram-se as análises do peso corporal (g e do ganho de peso corporal (%. RESULTADOS: Observou-se menor peso corporal nos grupos Desnutrido na Gestação e Lactação Sedentário (247,00: 134,00 - 335,00 e Desnutrido na Gestação e Lactação Condicionado (245,00: 166,00 - 324,50 comparados respectivamente, aos grupos Nutrido Sedentário (303,75: 176,00 - 372,00 e Nutrido Condicionado (290,25: 190,00 - 372,00 (pOBJECTIVE: The objective of this study was to assess the effects of moderate aerobic physical conditioning on the body weight and weight gain of rats whose mothers were fed a low protein diet during gestation and lactation. METHODS: Male Wistar rats were bred from dams fed a normal- (17% casein or low-protein (8% casein diet, constituting the initial nourished (n=18 and malnourished (n=17 groups. After weaning, they were fed the standard diet of the laboratory, with normal protein content (Labina®, Purina. At the age of 60 days, the animals were divided

  13. O treinamento físico aeróbio inibe a sinalização apoptótica muscular esquelética mediada por VEGF-VEGR2 em ratos espontaneamente hipertensos Aerobic exercise training inhibits skeletal muscular apoptotic signaling mediated by VEGF-VEGR2 in spontaneously hypertesive rats

    Directory of Open Access Journals (Sweden)

    Tiago Fernandes

    2012-12-01

    Full Text Available O treinamento físico aeróbio (TF tem sido utilizado como um importante tratamento não farmacológico da hipertensão arterial (HA, uma vez que ele corrige a rarefação microvascular e reduz a pressão arterial. Estudos mostram que as anormalidades microvasculares estão diretamente associadas às alterações do fator de crescimento vascular endotelial (VEGF e do VEGF receptor 2 (VEGFR2, bem como a um desequilíbrio da sinalização apoptótica na HA. Entretanto, pouco se conhece sobre os efeitos do TF sobre estes parâmetros na HA. Nós hipotetizamos que o TF recupere os fatores angiogênicos e promova um equilíbrio entre as proteínas anti e pró-apoptóticas da família Bcl-2 potencialmente, contribuindo para a revascularização e regressão da doença. Ratos espontaneamente hipertensos (SHR, n = 14 e Wistar Kyoto (WKY, n = 14 com 12 semanas de vida e divididos em quatro grupos: SHR, SHR treinado (SHR-T, WKY e WKY treinado (WKY-T foram estudados. Como esperado, 10 semanas de TF foram efetivas em reduzir a pressão arterial em SHR-T. Além disso, o TF promoveu bradicardia de repouso nos grupos de animais treinados (WKY-T e SHR-T, sendo considerado como um importante marcador de TF aeróbio. O TF também corrigiu a rarefação capilar em SHR-T e esta resposta se deve em grande parte por uma recuperação dos níveis periféricos de VEGF e um aumento na expressão de VEGFR2. Em paralelo, foi observada uma normalização das vias apoptóticas, com aumento da expressão de proteínas antiapoptóticas (Bcl-2 e Bcl-x e redução das pró-apoptóticas (Bad acompanhada pela fosforilação de Bad. Estes resultados sugerem que o TF promove revascularização periférica na HA dependente de um fino balanço de reguladores positivos e negativos de angiogênese.Aerobic exercise training (ET has been established as an important non-pharmacological treatment for hypertension, since it corrects the microvascular rarefaction and decreases blood pressure

  14. Efeitos do desempenho aeróbio na máxima fase estável de lactato sanguíneo determinada em protocolo intermitente na natação Effect of aerobic performance level on the maximal lactate steady state determined during intermittent protocol in swimming

    Directory of Open Access Journals (Sweden)

    Camila Coelho Greco

    2010-04-01

    Full Text Available Atletas de endurance frequentemente realizam exercícios intermitentes, com o objetivo de aumentar a intensidade do treinamento. Um índice bastante importante na avaliação desses atletas é a máxima fase estável de lactato sanguíneo (MLSS, que em geral é determinada com um protocolo contínuo. No entanto, as pausas existentes durante o exercício intermitente podem modificar as condições metabólicas dele. O objetivo deste estudo foi comparar a intensidade de nado correspondente à MLSS determinada de forma contínua (MLSSc e intermitente (MLSSi em atletas com diferentes níveis de rendimento aeróbio. Doze nadadores (22 ± 8 anos; 69,9 ± 7,63kg e 1,76 ± 0,07m e oito triatletas do gênero masculino (22 ± 9 anos; 69,5 ± 10,4kg e 1,76 ± 0,13m, realizaram os seguintes testes em diferentes dias em uma piscina de 25 m: 1 teste máximo na distância de 400m (v400; 2 duas a quatro repetições com duração de 30 min em diferentes intensidades, para a determinação da MLSSc, e; 4 duas a quatro tentativas de 12 x 150s com intervalo de 30s (5:1 em diferentes intensidades, para a determinação da MLSSi. Os nadadores apresentaram maiores valores em relação aos triatletas da v400 (1,38 ± 0,05 e 1,26 ± 0,06m.s-1, respectivamente, MLSSc (1,23 ± 0,05 e 1,08 ± 0,04m.s-1, respectivamente e MLSSi (1,26 ± 0,05 e 1,11 ± 0,05m.s-1, respectivamente. No entanto, a diferença percentual entre a MLSSc e a MLSSi foi estatisticamente similar entre os grupos (3%. Não houve diferença significante entre a concentração de lactato na MLSSc e na MLSSi nos dois grupos. Com base nesses resultados, pode-se concluir que o exercício intervalado utilizado permite um aumento na intensidade do exercício correspondente a MLSS, sem modificação na concentração de lactato, independente do nível de desempenho aeróbio.Endurance athletes frequently perform intermittent exercises with the aim to increase training intensity. A very important index in the

  15. Efectos del entrenamiento físico en piscina climatizada sobre la capacidad aeróbica de un grupo de niños asmáticos. (Effects of the physical training in a warm-water pool on the aerobic power of a group of asthmatic children.

    Directory of Open Access Journals (Sweden)

    Juan David Fernández Villada

    2009-07-01

    Full Text Available ResumenObjetivo: Observar cambios en la capacidad aeróbica de un grupo de niños asmáticos después de un entrenamiento físico en piscina climatizada (EFPC. Método: 22 niños asmáticos, se dividieron en grupo experimental (GE y grupo control (GC de 11 cada uno. El GE se sometió a un EFPC durante 18 semanas de manera controlada, mientras el GC solo hacía sus actividades cotidianas. A ambos grupos se les realizó pruebas de esfuerzo en banda rodante para determinar el máximo consumo de oxígeno en METS y la frecuencia cardiaca máxima (FCM. Se midió en cada sesión de EFPC si los niños presentaban asma inducida por esfuerzo (AIE. Resultados: Al iniciar el estudio, el promedio de METS y de la FCM fueron similares en ambos grupos (Anova METS p = 0.5568; Anova FCM p = 0.5198; METS: GE 11.61 ± 2.33 DS, GC 11.05 ± 2.08 DS; FCM: GE 165.09 ± 13.85 DS, GC 161.46 ± 12.12 DS. Al finalizar, sólo el GE mejoró en los promedios de los METS de la diferencia pre-post según la prueba de observaciones apareadas (METS GE 6.65 ± 3.46 DS; Anova p = 0.0006. La FCM también aumentó, siendo significativa en el GE (FCM: GE 22.45 ± 19.04 DS; Anova FCM p = 0.0823. Solo el 6,06% de las mediciones presentaron AIE. Conclusión: Se encontró aumento significativo de la capacidad aeróbica en el GE, comparado con el GC. Se sugiere que utilizar piscina climatizada para el entrenamiento físico del asmático puede disminuir el AIE.Abstract Objective: To observe changes in the aerobic power in a group of asthmatic children after of a physical training in warm-water pool (EFPC. Method: 22 asthmatic children, who were divided in to an experimental group (GE and a control group (GC of 11 each. The GE was submitted to an EFPC for 18 weeks in a controlled way, while the GC only did their daily activities. Treadmill ergometer testing were conducted to both groups, to determine the maximal oxygen consumption in MET and the maximum heart rate (FCM. Each section of the

  16. Effects of inoculantes use in forage silages on protein and fiber levels, nutrients digestibility, pH, fermentation and aerobic stability/ Efeitos da utilização de inoculantes em silagens de forrageiras sobre os teores de proteína e fibra, digestibilidade dos nutrientes, pH, fermentação e estabilidade aeróbia

    Directory of Open Access Journals (Sweden)

    Elzânia Sales Pereira

    2005-06-01

    Full Text Available Forage silage is the main form of voluminous food storage in the world. The ensiling makes possible the palatable food supply during the whole year, mainly in the drought period. During the ensiling process, the green forage inside of the silo suffers many transformations until the complete stabilization of the mass, acquiring the silage characteristics. With the objective of improving the fermentation process, some farmers have been using inoculants. However, the use of these inoculants, without evaluation of silage nutritional quality can increase the material cost. Besides, a big importance has been spared to the silage preservation process and your aerobics stability, mainly during the period of your use. Several works showing controversial results were found, in the literature, although some researches have shown beneficial effects of inoculants use on silage preservation and quality. It can be concluded that the inoculants use should not be considered as substitute of ensiling appropriate handling, such as: crop, compactation, storage and closure. In silages appropriately prepared, the inoculants use presents little or any benefit on silage preservation and quality.A silagem de forrageiras é a principal forma de armazenamento de alimento volumoso no mundo. A ensilagem possibilita o fornecimento de alimento palatável durante todo o ano, principalmente no período de seca. Durante o processo de ensilagem, a forragem verde colocada no silo sofre transformação até a estabilização completa da massa, adquirindo as características de silagem. No intuito de melhorar o processo de fermentação, têm-se utilizado alguns inoculantes. Porém, a utilização destes, sem avaliação da qualidade nutricional da silagem pode aumentar o custo do material ensilado. Além disso, importância crescente tem sido dispensada ao processo de preservação das silagens e a sua estabilidade aeróbia, sobretudo durante o período de sua utilização. Embora

  17. Adaptação enzimática da LDH em ratos submetidos a treinamento aeróbio em esteira e laser de baixa intensidade Adaptation of LDH enzyme in rats undergoing aerobic treadmill training and low intensity laser therapy

    Directory of Open Access Journals (Sweden)

    WHB Vieira

    2006-01-01

    Full Text Available OBJETIVO: Verificar a atividade e padrão eletroforético da LDH em resposta ao exercício em esteira em ratos submetidos à fotoestimulação por laser de baixa intensidade (780 etam. MÉTODO: Foram utilizados nesse estudo 54 ratos machos jovens (30dias, Winstar, com peso inicial médio de 112 ± 4,7g, os quais foram divididos em quatro grupos: dois permaneceram em repouso, GRC (grupo repouso controle, n= 9 e GRL (grupo repouso laser, n= 10, sendo o segundo irradiado por laser, e outros dois foram submetidos ao treinamento aeróbio e testes de esforço crescente em esteira (em degraus descontínuos visando à determinação do limiar de anaerobiose (LA durante 5 semanas, GEC (grupo exercício controle, n= 16 e GEL (grupo exercício laser, n= 19, sendo o último também irradiado por laser. O laser foi aplicado no quadríceps, glúteo máximo, sóleo e tibial anterior (TA, bilateralmente, imediatamente após cada sessão de treinamento, usando: 3,8J/cm², 15mW, 10s, modo contínuo, durante 5 semanas. Amostras de sóleo, TA e coração foram removidas 48 horas após a última sessão de exercício para análise eletroforética e espectrofotométrica. A estatística foi realizada através do teste ANOVA e post-hoc de TUKEY. O nível de significância foi considerado (pOBJECTIVE: To analyze the activity and electrophoretic pattern of the enzyme LDH in response to treadmill training, in rats undergoing photostimulation using low-level laser therapy (LLLT (780 etam. METHOD: Fifty-four 30-day-old male Winstar rats initially weighing 112 ± 4.7g were divided into four groups. Two groups remained at rest: resting control group (RCG, n= 9 and resting LLLT group (RLG, n= 10. The other two groups underwent a five-week treadmill program of aerobic training and non-continuous incremental effort tests, with the aim of determining the anaerobic limit. One of the latter was an exercise control group (ECG, n= 16 and the other was an exercise LLLT group (ELG, n

  18. Perdas fermentativas, composição química, estabilidade aeróbia e digestibilidade aparente de silagem de cana-de-açúcar com aditivos químico e microbiano Fermentation losses, chemical composition, aerobic stability and apparent digestibility of sugarcane ensiling with chemical and microbial additives

    Directory of Open Access Journals (Sweden)

    Geraldo Balieiro Neto

    2009-06-01

    Full Text Available O objetivo deste trabalho foi avaliar a influência da adição de cal virgem e Lactobacillus buchneri em perdas fermentativas, valor nutritivo, estabilidade aeróbia e digestibilidade aparente da silagem de cana-de-açúcar (Saccharum officinarum. O primeiro experimento avaliou perdas fermentativas, pH e temperatura, composição química e digestibilidade in vitro da matéria seca de silagens de cana-de-açúcar, com adição ou sem adição de cal ou de inoculante bacteriano (L. buchneri; o segundo avaliou o consumo de matéria seca e a digestibilidade aparente da cana-de-açúcar ensilada com os mesmos aditivos para cordeiros. Os aditivos não reduziram as perdas na ensilagem, e silagens com cal apresentaram maiores perdas por efluentes. O consumo de matéria seca da silagem com inoculante foi inferior ao da silagem com cal ou ao da cana-de-açúcar in natura. A digestibilidade aparente da matéria seca da silagem com cal foi inferior à da cana-de-açúcar in natura e à da silagem com inoculante. A digestibilidade aparente do extrato etéreo das silagens com cal foi superior à da cana-de-açúcar in natura. Os valores de nutrientes digestíveis totais da cana-de-açúcar in natura ou ensilada com inoculante ou cal foram de 61,2, 54,1 e 51,7%, respectivamente. Independentemente do aditivo, a ensilagem da cana-de-açúcar resulta em perda de nutrientes e redução de digestibilidade.The objective of this work was to evaluate the influence addition whitewash (CaO and Lactobacillus buchneri in fermentation losses, nutritional value, aerobic stability and apparent digestibility of sugarcane (Saccharum officinarum silages. A first experiment evaluated fermentation losses, pH and temperature values, chemical composition and in vitro dry matter digestibility of sugarcane silages with or without bacterial inoculants (L. buchneri or CaO. A second experiment evaluated intake and apparent digestibility of sugarcane silage with the same additives to

  19. Larval feeding behavior of the truncatus group of Thrypticus (Diptera: Dolichopodidae that breed in the aerenchyma of Pontederiaceae Comportamiento alimentario de las larvas del grupo truncatus de Thrypticus (Diptera: Dolichopodidae que se crían en el aerénquima de Pontederiaceae

    Directory of Open Access Journals (Sweden)

    M. Cristina Hernández

    2007-12-01

    -Laubach (Pontederiaceae, minando cerca de la epidermis y abriendo varios orificios al exterior. La larva de T. romus Bickel & Hernández crece en E. azurea (Sw. Kunth, formando una mina curva, corta en comparación con las otras especies. La larva de T. formosensis Bickel & Hernández se desarrolla en Pontederia cordata L. (Pontederiaceae, excavando la mina entre la epidermis y la gran celda central de los pecíolos. Por último, la larva de T. taragui Bickel & Hernández se cría en tallos sumergidos de P. subovata (Seub. in Mart. Lowden, formando una mina subepidérmica con ramificaciones hacia la estela central del tallo. No se pudieron asociar las minas correspondientes a las especies T. yanayacu, T. chanophalus y T. azuricola. No se encontraron predadores ni parásitos de larvas o pupas, se observaron casos de canibalismo entre larvas cuando el trazado de dos minas confluye. Las especies del grupo truncatus poseen un modo de alimentación sumamente específico, confinadas al aerénquima, se alimentan de la savia extraída de los orificios roídos en los haces vasculares de los pecíolos y tallos, posiblemente con levaduras simbiontes como suplemento para la nutrición. Numerosas colecciones en el campo y pruebas en el laboratorio, indican que estos insectos están asociados con plantas hospedadoras específicas dentro de la misma familia. Esta especialización sugiere una larga asociación insecto-hospedadora.

  20. Assessment of the efficiency of SimPlate™ total plate count color indicator (TPC CI to quantify mesophilic aerobic microorganisms in pasteurized milk Avaliação da eficiência do SimPlate™ Total Plate Count Color Indicator (TPC CI para enumeração de microrganismos aeróbios mesófilos em leite pasteurizado

    Directory of Open Access Journals (Sweden)

    Luís Augusto Nero

    2002-01-01

    Full Text Available The SimPlate™ TPC CI system is a rapid method to count mesophilic aerobic microorganisms (MAM in foods, based on the use of resazurine to indicate bacterial growth. Its efficiency in pasteurized milk was evaluated using 142 pasteurized milk samples (38 type A, 43 type B and 61 type C collected in Londrina, PR. The standard plating method, using Plate Count Agar (PCA was used for comparison. The plates of both systems were incubated at 35ºC and read after 24h and 48h. The occurrence of false-positive and false-negative wells and the predominant microorganisms in them were also evaluated. The results were compared by simple correlation and mean variance analyses. The correlation (r and mean variance values were 0.6811 and 0.7583 for the results obtained after 24h, respectively, and 0.9126 and 0.0842 for the results obtained after 48h, respectively. These results indicate that the performance of the system increases when the plates are incubated for 48h. When the three types of milk were evaluated separately, these values were 0.9285 and 0.0817 for type A milk, 0.9231 and 0.0466 for type B milk and 0.7209 and 0.1082 for type C milk. These results indicate that the better the quality of the milk the better the performance of SimPlate™ TPC CI. False-negative wells, found more frequently in samples with high MAM counts, were caused by Gram positive microorganisms, poorly detected by the SimPlate™ TPC CI system because they grew slowly and had low reduction capacity. The results indicated a higher efficiency of the SimPlate™ TPC CI system in the reading at 48h.O sistema SimPlate™ TPC CI é um método rápido para enumeração de microrganismos aeróbios mesófilos (MAM em alimentos que utiliza a resazurina como substância indicadora de crescimento bacteriano. Para avaliar sua eficiência em leite pasteurizado, 142 amostras (38 de leite tipo A, 43 de leite tipo B e 61 de leite tipo C foram colhidas em Londrina, PR, e analisadas pelo Sim

  1. Comparação entre os métodos rápidos SimplateR TPC- CI e PetrifilmR AC e os métodos convencionais de contagem em placas para a enumeração de aeróbios mesófilos em sorvetes Comparasion of SimplateR test and Petrifilm with plate count agar method for detection and enumeration of bacteria in ice cream

    Directory of Open Access Journals (Sweden)

    Anderson de Souza Sant'ana

    2002-01-01

    Full Text Available A contagem de aeróbios mesófilos ou contagem padrão em placas em um produto alimentício reflete a qualidade da matéria-prima, bem como as condições de processamento, manuseio e estocagem. O método de contagem em placas tradicionais requer 48h de incubação para a posterior leitura dos resultados. Comparou-se dois métodos que parecem ser uma boa alternativa para a contagem padrão em placas: SimplateR TPC-CI e PetrifilmR AC. Também avaliou-se a capacidade inibitória do 2, 3, 5 cloreto de trifeniltetrazólio quando adicionado ao Agar Plate Count. Este corante é incolor na forma oxidada e vermelho quando reduzido pelos microrganismos, devido à formação de formazano. O coe-ficiente de correlação obtido, através de estudos conduzidos com 60 amostras de sorvetes, entre 0,866-0,979 indicou uma equivalente sensibilidade dos métodos testados. Somente a contagem padrão em placas com TTC diferiu signicativamente da contagem padrão em placas.The mesophilic aerobic plate count or standard plate count (SPC of fresh food product reflects conditions of raw product quality, processing, handling and storage. Current standard methods require a 48h incubation period to obtain the results. Two rapid alterantive methods: SimplateTM TPC-CI and PetrifilmTM Aerobic Count (AC Plate were compared to standard methods. Also, we evaluated the inhibitory effect of 2, 3, 5 triphenyltetrazolium chloride (TTC when added to Plate Count Agar. This dye is colorless in the oxidized form and red when reduced by microorganisms, due to the formation of formazan. Sixty ice cream samples were used in this study to obtain correlation coefficients, which ranged from 0.866-0.979, indicating equivalent sensitivities to existing methods. Only plate count with TTC differed significantly from the standard plate count.

  2. Índices fisiológicos associados com a "performance" aeróbia em corredores de "endurance": efeitos da duração da prova Índices fisiológicos asociados a la "performance" aerobia en competidores de "endurance": efectos de la duración de la prueba Physiological indexes associated with aerobic performance in endurance runners: effects of race duration

    Directory of Open Access Journals (Sweden)

    Benedito Sérgio Denadai

    2004-10-01

    Full Text Available O objetivo deste estudo foi analisar a validade do consumo máximo de oxigênio (VO2max, da velocidade correspondente ao VO2max (vVO2max, do tempo de exaustão na vVO2max (Tlim, da economia de corrida (EC e do limiar anaeróbio (LAn para a predição da performance de atletas de endurance. Quatorze corredores de endurance (33,4 ± 4,4 anos; 62,7 ± 4,3kg; 166,1 ± 5,0cm; VO2max = 60,4 ± 5,9ml.kg-1.min-1 realizaram os seguintes testes: a competição simulada nas distâncias de 1.500 e 5.000m. e; b testes de laboratório para a determinação do VO2max, vVO2max, EC, LAn e Tlim na intensidades de 100% vVO2max. As velocidades (km/h da vVO2max (18,7 ± 0,8, LAn (17,3 ± 1,1 v1.500m (19,9 ± 0,8 e v5.000m (17,9 ± 0,9 foram significantemente diferentes. A regressão múltipla stepwise revelou que o LAn foi o único preditor da performance da v5.000m, explicando 50% da variação desta performance. Para a v1.500m, o Tlim e a vVO2max explicaram 88% da variação da performance. Com base em nossos resultados, pode-se concluir que a validade dos índices fisiológicos (VO2max, vVO2max, Tlim, EC e LAn, para a predição da performance aeróbia de atletas de endurance, é dependente da distância da prova (1.500 x 5.000m analisada.El objetivo de este estudio fue analizar la validez del consumo máximo de oxígeno (VO2max, de la velocidad correspondiente al VO2max (vVO2max, del tiempo de exaustión en la vVO2max (Tlim, de la economía de la carrera (EC y del umbral anaeróbico (LAn para predecir la performance de atletas de endurance. Catorce competidores de endurance (33,4 ± 4,4 años; 62,7 ± 4,3kg; 166,1 ± 5,0cm; VO2max = 60,4 ± 5,9ml.kg-1.min-1 realizaron las siguientes pruebas: a competición simulada en las distancias de 1.500 y 5.000m. e; b pruebas de laboratorio para la determinación del VO2max, vVO2max, EC, LAn y Tlim en la intensidad del 100% vVO2max. Las velocidades (km/h de la vVO2max (18,7 ± 0,8, LAn (17,3 ± 1,1 v1.500m (19,9 ± 0,8 y v5

  3. Self-Determination: Using Agency, Efficacy and Resilience (AER) to Counter Novice Teachers' Experiences of Intensification

    Science.gov (United States)

    Keogh, Jayne; Garvis, Susanne; Pendergast, Donna; Diamond, Pat

    2012-01-01

    The intensification process associated with the first year of teaching has a significant impact on beginning teachers' personal and professional lives. This paper uses a narrative approach to investigate the electronic conversations of 16 beginning teachers on a self-initiated group email site. The participants' electronic exchanges demonstrated…

  4. Electrochemical Mitigation of hydrogen Environment Embrittlement of Ultra-High Strength AerMet(Trademark) 100

    Science.gov (United States)

    2006-01-01

    Environments A single edge notch specimen of UNS K92580 was machined, 10.2mm wide x 2.54mm thick. The notch was electrospark -machined to 0.065mm wide...low values in Fig. 17. Unfortunately, its use is limited to overpotentials above r1 = -0.5V, below which Zn deposits from solution. Again, the...white film is noticed on the specimen surface indicating the deposition of Ce(OH) 3 due to the shift in local pH at the sample/electrolyte interface

  5. Aerófonos y mitología caribeña

    OpenAIRE

    Giselda E. Hernández Ramírez; Gerardo Izquierdo Díaz

    2011-01-01

    El trabajo aborda la musicalidad de los aborígenes prehispánicos, aspecto muy reiterado en las Crónicas de Indias por los europeos y que han quedado reflejadas en las obras escritas por: Fernando de Oviedo, Fray Bartolomé de Las Casas, Pedro Mártir de Anglería, y Núñez Cabeza de Vaca, que de manera irresoluta nos posibilitan explicar las prácticas organológicas de estas sociedades pretéritas. También se refleja la asociación de instrumentos de soplo con el sistema simbólico e iconográfico en ...

  6. Specification and Analysis of the AER/NCA Active Network Protocol Suite in Real-Time Maude

    Science.gov (United States)

    2006-05-31

    Springer, 2003. [6] M. Clavel , F. Durán, S. Eker, P. Lincoln, N. Mart́ı-Oliet, J. Meseguer, and J. F. Quesada. Maude: Specification and programming in...rewriting logic. Theoretical Computer Science, 285:187–243, 2002. [7] M. Clavel , F. Dúran, S. Eker, P. Lincoln, N. Mart́ı-Oliet, J. Meseguer, and C

  7. Fungos aeróbios no intestino grosso de borregos e de ovelhas criados em pastagens tropicais

    Directory of Open Access Journals (Sweden)

    C.E.S. Freitas

    2012-02-01

    Full Text Available Fungi populations were evaluated in large intestine from sheep raised in the North of Minas Gerais, Brazil. The samples were from 39 Santa Inês crossbred ewes and 30 lambs raised on Tanzania grass (Panicum maximum cv. Tanzania, both supplemented with mineral mixtures. The clinical specimens were directly collected from rectal ampoule with sterile swabs. The development of fungal mycelium was observed in all lamb samples and positive cultures were observed in 34 ewe specimens (87.2%. After microculture of 40 colonies from lambs, 34 isolates of the genus Aspergillus, three of Paecilomyces spp., one Acremonium sp., and one Trichoderma sp. were identified. Out of the 39 isolates from ewes, 15 Paecilomyces spp., 11 Aspergillus spp., 11 Malbranchea spp., and one Onychocola sp. were identified. The results showed the predominance of the genus Aspergillus in the lambs, while the genus Paecilomyces, Malbranchea, and Aspergillus were predominant, in ewes.

  8. Estructura y función de la ATP sintasa de las arqueas aeróbicas

    OpenAIRE

    Héctor Vicente Miranda-Astudillo

    2012-01-01

    Desde el descubrimiento de las arqueas ha llamado la atención su capacidad para sobrevivir en ambientes difíciles. A través de los años, las arqueas han pasado de ser rarezas extremófilas a ser consideradas organismos de importancia universal que han sido utilizados para elucidar preguntas biológicas fundamentales. La filogenia del dominio Arquea se encuentra en constante cambio y cuenta hasta la fecha con 5 ramas principales: Crenarchaeota, Euryarchaeota, Thaumarchaeota, Korarchaeota y Nanoa...

  9. 77 FR 58203 - AER Energy Resources, Inc.; Alto Group Holdings, Inc.; Bizrocket.Com Inc.; Fox Petroleum, Inc...

    Science.gov (United States)

    2012-09-19

    ... From the Federal Register Online via the Government Publishing Office ] SECURITIES AND EXCHANGE....; Geopulse Explorations Inc.; Global Technologies Group Inc.; KMA Global Solutions International, Inc.; Mike The Pike Productions Inc.; Mobile Star Corp.; SavWatt USA Inc.; Scorpex Inc.; Silver Dragon...

  10. Ejercicio aeróbico y de fuerza en personas con una enfermedad pulmonar obstructiva (epoc): estudio de caso

    OpenAIRE

    Blas, Lara; Castillo, Daniel; Lacalzada, Oscar; Iturricastillo, Aitor

    2016-01-01

    El objetivo del estudio fue describir las respuestas fisiológicas de pacientes con EPOC en cada una de las sesiones de un programa de entrenamiento físico de ocho semanas y analizar los efectos producidos por el programa en el rendimiento físico de estos pacientes. En este estudio participaron cuatro personas a las que se les diagnosticó EPOC (64±6 años). Se realizó un test (T1) de 6 minutos de caminata (6MWT) para determinar la capacidad cardiovascular de los participantes y, después de ocho...

  11. Treinamento aeróbio não altera pressão arterial de mulheres menopausadas e com síndrome metabólica

    OpenAIRE

    Aluísio Henrique Rodrigues de Andrade Lima; Henrique Eduardo Couto; Glêbia Alexa Cardoso; Lidiane Tavares Toscano; Alexandre Sérgio Silva; Maria Paula Gonçalves Mota

    2012-01-01

    FUNDAMENTO: A Hipertensão arterial (HA) é uma condição tanto agravante quanto agravada pela Síndrome Metabólica (SM). A menopausa pode tornar o tratamento da hipertensão mais difícil porque é uma condição que favorece a piora nos componentes da SM. Embora existam evidências de que o treinamento com exercícios físicos reduza a pressão arterial, se as condições da menopausa e da SM afetam os benefícios induzidos pelo exercício é algo ainda não evidenciado. OBJETIVO: Comparar os efeitos do trein...

  12. Aerobic bacterial microbiota in stomoxys calcitrans: preliminary studies in Brazil Microbiota bacteriana aeróbica em Stomoxys calcitrans: estudos preliminares no Brasil

    Directory of Open Access Journals (Sweden)

    Bruno G. de Castro

    2007-12-01

    Full Text Available The stable fly, Stomoxys calcitrans, has a great importance in medical and veterinary health due to its feeding and reproductive habits, which can disseminate some pathogenic agents among hosts even at long distances. This study aimed to describe, for the first time in Brazil, the bacterial microbiota in segments of the stable fly. Bacterial species were isolated from three different segments (cuticle, mouth parts and abdominal alimentary tract of the stable fly. Twenty dairy farms were visited in four municipalities: Barra Mansa, Quatis, Resende and Rio Claro in the State of Rio de Janeiro in order to collect 20 flies in each site. Dissection of the flies and procedures of isolation and identification of bacterial species were performed. A total of 161 colonies of 33 distinct species were isolated, such as Escherichia coli, Staphylococcus aureus, and S. intermedius. Stomoxys calcitrans may harbor bacterial agents on their cuticle, mouth parts and abdominal alimentary tract and these bacteria may be pathogenic to their hosts.A mosca dos estábulos, Stomoxys calcitrans, possui grande importância médica e veterinária devido a seus hábitos alimentares e reprodutivos, visto que pode disseminar agentes patogênicos para hospedeiros, mesmo a longas distâncias. Esse estudo teve por objetivo, pela primeira vez no Brasil, descrever a microbiota bacteriana de segmentos da mosca dos estábulos. As espécies bacterianas foram isoladas de três diferentes segmentos (superfície externa, aparelho bucal e trato digestivo abdominal de S. calcitrans. Foram visitadas 20 fazendas leiteiras em quatro municípios: Barra Mansa, Quatis, Resende e Rio Claro no Estado do Rio de Janeiro para coletar 20 moscas em cada uma delas. A dissecção das moscas e os procedimentos de isolamento e identificação bacteriana foram realizados. Um total de 161 colônias de 33 espécies distintas foi isolado, dentre elas Escherichia coli, Staphylococcus aureus e S. intermedius. Stomoxys calcitrans pode veicular agentes bacterianos presentes na superfície externa, aparelho bucal e trato digestivo abdominal e essas bacterias possuem potencial patogênico a diversos hospedeiros deste muscídeo.

  13. Test Firing of chunk wood - Is it possible to automate the fuel supply?; Proveldning av knubbved - Aer det moejligt att automatisera braenslematningen?

    Energy Technology Data Exchange (ETDEWEB)

    Persson, Tomas; Danielsson, Bengt-Olof

    2013-05-15

    Chunk wood is a wood fuel with a fuel particle length typically between 50 and 150 mm. The ad-vantage of chunk wood compared to wood chips is that the fuel dry as fast as fuel wood, but can be produced and handled as wood chip. Technologies for efficient producing, drying and distribution of Chunk wood have been developed since the 1970:s and machines for manufacturing the fuel is available on the market, but still there is no small-scale heating equipment in operation to burn the fuel automatically. The aim of the study was to investigate how the feeding and firing of chunk wood works in a standard 200 kW biomass boiler for various types of biofuels. The main focus was on studying how the fuel feeding system works using chunk wood and if the combustion and emissions are satisfactory. The boiler have a main fuel feeding auger screw connected to the bottom of the fuel storage, followed by a cell feeder and another auger screw that is feeding the fuel into the combustion chamber. The power consumption for the fuel feeding auger screws and the CO-emissions were measured during the firing period. In order to obtain reference values for the stresses in the fuel feeding system and the CO-emissions, regular wood chips were initially fired followed by the chunk wood firing. During the chunk wood firing period several interruptions in the fuel feeding occurred, as the trigger mechanism for the motor protection stopped the fuel supply. Most of the interruptions, however, could be resolved through manual reversing of the fuel feeding auger screw. Only at two occasions the entrance to the auger screw were manually cleared from large fuel pieces. The cell feeder and the auger screw feeding the fuel into the combustion chamber were stopped twice, and to continue operating the boiler it was enough to restart the feeding system. However, as they are both operated by the same motor we do not know whether the two shutdowns that occurred were caused by feeding problems in the auger screw or in the cell feeder. The stresses on the feeder screw varied during the test and during different operating periods, but when the first fuel feeding screw stops, the power requirements was more than three times the normal. The presence of the largest pieces in the chunk wood caused problems when the fuel was entering into the screw, and these problems caused most of the interruptions and the highest screw stress. High screw stress also arises when chunk wood slices get stuck between the auger screw and the cover. By releasing the upper part of the cover, so that the lid can move upwards seemed to reduce this problem. It thus seems beneficial with a greater distance between the lid and screw when chunk wood is to be used. The combustion performance seems to be satisfactory for chunk wood firing in these tests, however only the CO-emissions were measured. If the fuel can be produced without the presence of oversized pieces, the results show that there is a good chance that the fuel can be fired in conventional wood chip boilers of about 200 kW. The most important way forward from now on is to evaluate the market of chippers for chunk wood with respect to the presence of oversized pieces. If there are no chippers that provide adequate fuel without the presence of oversized pieces and it is impossible to develop such shippers, a more methodological work have to be put on developing the fuel feeding system.

  14. Influencia del trabajo aeróbico programado en el desarrollo de la gestación : Parámetros materno-fetales

    OpenAIRE

    Barakat Carballo, Ruben

    2011-01-01

    A través de la historia, las recomendaciones acerca del ejercicio durante la gestación han estado basadas más en razones sociales y culturales que en evidencias puramente científicas. Tradicionalmente, los consejos médicos alentaban a la moderación, aunque el concepto de "moderado" era algo conservador. No obstante, esta opinión no se dirigía en la misma dirección del creciente número de mujeres incluidas en programas de actividades físicas recreacionales y deportes. Actualmente, con el ejerc...

  15. Formation of Stylet Sheaths in aere (in air from eight species of phytophagous hemipterans from six families (Suborders: Auchenorrhyncha and Sternorrhyncha.

    Directory of Open Access Journals (Sweden)

    J Kent Morgan

    Full Text Available Stylet sheath formation is a common feature among phytophagous hemipterans. These sheaths are considered essential to promote a successful feeding event. Stylet sheath compositions are largely unknown and their mode of solidification remains to be elucidated. This report demonstrates the formation and solidification of in āere (in air produced stylet sheaths by six hemipteran families: Diaphorina citri (Psyllidae, Asian citrus psyllid, Aphis nerii (Aphididae, oleander/milkweed aphid, Toxoptera citricida (Aphididae, brown citrus aphid, Aphis gossypii (Aphididae, cotton melon aphid, Bemisia tabaci biotype B (Aleyrodidae, whitefly, Homalodisca vitripennis (Cicadellidae, glassy-winged sharpshooter, Ferrisia virgata (Pseudococcidae, striped mealybug, and Protopulvinaria pyriformis (Coccidae, pyriform scale. Examination of in āere produced stylet sheaths by confocal and scanning electron microscopy shows a common morphology of an initial flange laid down on the surface of the membrane followed by continuous hollow core structures with sequentially stacked hardened bulbous droplets. Single and multi-branched sheaths were common, whereas mealybug and scale insects typically produced multi-branched sheaths. Micrographs of the in āere formed flanges indicate flange sealing upon stylet bundle extraction in D. citri and the aphids, while the B. tabaci whitefly and H. vitripennis glassy-winged sharpshooter flanges remain unsealed. Structural similarity of in āere sheaths are apparent in stylet sheaths formed in planta, in artificial diets, or in water. The use of 'Solvy', a dissolvable membrane, for intact stylet sheath isolation is reported. These observations illustrate for the first time this mode of stylet sheath synthesis adding to the understanding of stylet sheath formation in phytophagous hemipterans and providing tools for future use in structural and compositional analysis.

  16. Internal valves in populations of Meridion circulare from the A'er Mountain region of northeastern China: Implications for taxonomy and systematics

    Institute of Scientific and Technical Information of China (English)

    J.P. KOCIOLEK; Yan LIU; Quanxi WANG

    2011-01-01

    A population of Meridion circulare var.circulare (Greville) C.A.Agardh from Inner Mongolia was found to produce Innenschalen or internal spores.Examination of this population with light and scanning electron microscopy showed morphological differentiation between vegetative and spore morphologies.Vegetative valves typically bear costae and one rimoportula at the headpole.Spores lack costae and have two rimoportulae,one at the headpole and the other at the footpole.There is plasticity in the production of valve morphologies,and a variety of vegetative valve and spore combinations are evident.This population of M.circulare var.circulare has initial valves of over 90μm in length,and all of the initial cells encountered are acostate and bear two rimoportulae.These observations suggest that either spores are the product of sexual reproduction,or that initial valves may be produced parthenogenetically in Meridion.Spores as products of the sexual process have not been reported in diatoms previously,and parthenogenesis in Meridion was reported previously but discounted in other published reports.The plasticity of valve morphologies expressed in M.circulare var.ciculare,between vegetative valves and spores (and back) across a short temporal period suggests that diatoms can alter their cell wall structure dramatically and quickly in response to external variables.

  17. Efecto agudo de dos intensidades de ejercicio aeróbico sobre la presión arterial en reposo de personas normotensas

    Directory of Open Access Journals (Sweden)

    M. Gamboa Granados

    2014-09-01

    Conclusión: Se comprueba la existencia del efecto hipotensor en la presión arterial sistólica después de realizar 2 sesiones de ejercicio en banda sin fin, sin embargo los mejores resultados se obtuvieron al realizar ejercicio a una intensidad del 70% de la frecuencia cardiaca reserva.

  18. Máxima velocidade aeróbia calculada pelo custo da frequência cardíaca: relação com a performance

    Directory of Open Access Journals (Sweden)

    D.F. da Silva

    2015-03-01

    Conclusões: A vFCmax em corredores recreacionais de meia idade tem elevada relação com as performances de 10 e 15 km e não foi diferente da Vpico (para vFCmax de Lacour et al., apresentando resultados semelhantes aos observados pelos métodos baseados no custo de oxigênio.

  19. Efectos del ejercicio aeróbico sobre globulina enlazante de hormonas sexuales y sensibilidad a insulina en mujeres jóvenes con sobrepeso

    OpenAIRE

    Argüello Gutiérrez, Yenny Paola

    2011-01-01

    El sobrepeso y la obesidad asociados a la inactividad física y los hábitos alimenticios, se han convertido en una carga de morbi-mortalidad tanto en países industrializados como en países en desarrollo, por ser factores de riesgo para el desarrollo de enfermedades crónicas no transmisibles (ECNT) como son enfermedades cardiovasculares, resistencia a la insulina, diabetes mellitus tipo 2 (DM2), algunos cánceres y desórdenes del aparato locomotor, entre otras. Pues bien, dentro del análisis y a...

  20. VLSI Implementation of a 2.8 Gevent/s Packet-Based AER Interface with Routing and Event Sorting Functionality.

    Science.gov (United States)

    Scholze, Stefan; Schiefer, Stefan; Partzsch, Johannes; Hartmann, Stephan; Mayr, Christian Georg; Höppner, Sebastian; Eisenreich, Holger; Henker, Stephan; Vogginger, Bernhard; Schüffny, Rene

    2011-01-01

    State-of-the-art large-scale neuromorphic systems require sophisticated spike event communication between units of the neural network. We present a high-speed communication infrastructure for a waferscale neuromorphic system, based on application-specific neuromorphic communication ICs in an field programmable gate arrays (FPGA)-maintained environment. The ICs implement configurable axonal delays, as required for certain types of dynamic processing or for emulating spike-based learning among distant cortical areas. Measurements are presented which show the efficacy of these delays in influencing behavior of neuromorphic benchmarks. The specialized, dedicated address-event-representation communication in most current systems requires separate, low-bandwidth configuration channels. In contrast, the configuration of the waferscale neuromorphic system is also handled by the digital packet-based pulse channel, which transmits configuration data at the full bandwidth otherwise used for pulse transmission. The overall so-called pulse communication subgroup (ICs and FPGA) delivers a factor 25-50 more event transmission rate than other current neuromorphic communication infrastructures.

  1. Analysis of adverse events with use of orthodontic sequential aligners as reported in the manufacturer and user facility device experience database

    Directory of Open Access Journals (Sweden)

    Rooban Thavarajah

    2015-01-01

    Conclusions: The AERs associated with SA has been described. Though the MAUDE database is not an exact, wholesome and reliable source to identify the potential AER, currently, it is the only available source of AERs associated with SA use. The nature of AERs with the use of SA and its potential pathogenesis and implications has been discussed.

  2. Report by the AERES on the unit: Fuel Study Department (DEC) under the supervision of the establishments and bodies: Atomic Energy and Alternative Energies Commission (CEA); Rapport de l'AERES sur l'unite: Departement d'Etudes des Combustibles (DEC) sous tutelle des etablissements et organismes: Commissariat a l'Energie Atomique et aux Energies Alternatives (CEA)

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2011-03-15

    This report is a kind of audit report on a research laboratory, the DEC (Departement d'Etudes des Combustibles, Fuel Study Department) which comprises four departments: a department of analysis and characterization of fuel behaviour (SA3C) which comprises four laboratories, a Plutonium, Uranium and Minor Actinides department (SPUA) which comprises four laboratories, a department for the investigation and simulation of fuel behaviour (four laboratories) and the Leca-Star department (3 laboratories and a project group). The authors discuss an assessment of the whole unit activities in terms of strengths and opportunities, aspects to be improved, risks and recommendations, productions and publications on different themes (fundamental research on fuels, fuel design, fabrications, characterizations and property measurements, experimental irradiations, characterization of irradiated fuels and chemical and radio-chemical analysis, modelling and simulation). A more detailed assessment is presented for each theme in terms of scientific quality, influence and attractiveness (awards, recruitment capacity, capacity to obtain financing and to tender, participation to international programs), strategy and governance, and project

  3. Report by the AERES on the unit: Reactor Study Department (DER) under the supervision of the establishments and bodies: Atomic Energy and Alternative Energies Commission (CEA); Rapport de l'AERES sur l'unite: Departement d'Etudes des Reacteurs (DER) sous tutelle des etablissements et organismes: CEA

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2011-02-15

    This report is a kind of audit report on a research laboratory, the DER (Departement d'Etudes des Reacteurs, Reactor Study Department) whose activity if focused on four main themes: neutron transport simulation in reactor cores, thermal-hydraulic simulation of reactors, design and safety of innovative reactors, nuclear instrumentation for reactors. The authors discuss an assessment of the whole unit activities in terms of strengths and opportunities, aspects to be improved, risks and recommendations, productions and publications, scientific quality, influence and attractiveness (awards, recruitment capacity, capacity to obtain financing and to tender, participation to international programs), strategy and governance, and project. These same aspects are then discussed and commented for each theme

  4. Report by the AERES on the unit: Unit of researches on neutron transport and radioactivity confinement in nuclear installations under the supervision of the establishments and bodies: IRSN; Rapport de l'AERES sur l'unite: Unite de recherches en neutronique et confinement de la radioactivite dans les installations nucleaires sous tutelle des etablissements et organismes: IRSN

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2010-07-15

    This report is a kind of audit report on a research laboratory whose activity is organized in three departments: neutron transport and criticality (themes: numerical methods, maths and statistics related to the simulation of neutral particle propagation, nuclear data, uncertainty propagation and bias estimation, code qualification and associated experimental programs, neutron transport in reactors and fuel cycle, criticality accidents), radionuclide transfer in radioactive waste disposals (site identification strategy, hydro-mechanical phenomena affecting storage performance, physical-chemical evolution factors, storage modelling), and metrology and confinement of radioactive gases and aerosols. The authors discuss an assessment of the unit activities in terms of strengths and opportunities, aspects to be improved and recommendations, productions and publications. A more detailed assessment is presented for each department in terms of scientific quality, influence and attractiveness (awards, recruitment capacity, capacity to obtain financing and to tender, participation to international programs), strategy and governance, and project

  5. Report by the AERES on the unit: Research unit for man radiation protection under the supervision of establishments and bodies: IRSN; Rapport de l'AERES sur l'unite: Unite de recherche pour la protection radiologique de l'homme sous tutelle des etablissements et organismes: IRSN

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2010-10-15

    This report is a kind of audit report on a research laboratory, whose activity is dedicated to man radiation protection, and is organized about four main themes: means to determine in any circumstances the dose received by a victim of an external irradiation or internal contamination, characterization of the biological effects ionizing radiations may create in a sane tissue, epidemiological approaches to the assessment of the exceeding risk associated with exposure to ionizing radiation on different populations, and experimental toxicology for the identification of biological effects induced par long duration and low dose exposures to some radionuclides. The authors discuss an assessment of the whole unit activities in terms of strengths and opportunities, productions and publications, scientific quality, influence and attractiveness (awards, recruitment capacity, capacity to obtain financing and to tender, participation to international programs), strategy and governance, and project. These same aspects are then discussed and commented for each theme: dosimetry, ionizing radiation pathology and experimental therapies, epidemiology of ionizing radiations, experimental and post-accidental radio-toxicology

  6. Swab culture monitoring of automated endoscope reprocessors after high-level disinfection

    Institute of Scientific and Technical Information of China (English)

    Lung-Sheng Lu; Keng-Liang Wu; Yi-Chun Chiu; Ming-Tzung Lin; Tsung-Hui Hu; King-Wah Chiu

    2012-01-01

    AIM:To conduct a bacterial culture study for monitoring decontamination of automated endoscope reprocessors (AERs) after high-level disinfection (HLD).METHODS:From February 2006 to January 2011,authors conducted randomized consecutive sampling each month for 7 AERs.Authors collected a total of 420 swab cultures,including 300 cultures from 5 gastroscope AERs,and 120 cultures from 2 colonoscope AERs.Swab cultures were obtained from the residual water from the AERs after a full reprocessing cycle.Samples were cultured to test for aerobic bacteria,anaerobic bacteria,and mycobacterium tuberculosis.RESULTS:The positive culture rate of the AERs was 2.0% (6/300) for gastroscope AERs and 0.8% (1/120)for colonoscope AERs.All the positive cultures,including 6 from gastroscope and 1 from colonoscope AERs,showed monofloral colonization.Of the gastroscope AER samples,50% (3/6) were colonized by aerobic bacterial and 50% (3/6) by fungal contaminations.CONCLUSION:A full reprocessing cycle of an AER with HLD is adequate for disinfection of the machine.Swab culture is a useful method for monitoring AER decontamination after each reprocessing cycle.Fungal contamination of AERs after reprocessing should also be kept in mind.

  7. Efeito de diferentes intensidades de exercício físico aeróbico sobre parâmetros cardiovasculares na hipertensão pulmonar

    OpenAIRE

    Ricardo Meirelles Borba

    2015-01-01

    Introdução: A hipertensão pulmonar (HP) se caracteriza pela presença de pressão média na artéria pulmonar maior ou igual a 25 mmHg em repouso e aumento progressivo da resistência vascular pulmonar, levando a hipertrofia patológica do ventrículo direito (VD), seguida de falência do ventrículo e morte súbita. Evidências mostram que na HP há uma disfunção no sistema nervoso autônomo (SNA), apresentando redução da variabilidade da frequência cardíaca (VFC), com aumento da modulação simpática e re...

  8. Perfil lipídico e glicêmico de ratos treinados em exercício aeróbio ou anaeróbio e suplementados com maltodextrina

    OpenAIRE

    Cátia Fernandes Leite; Cláudia Pinho Hartleben; Caroline Soares Magalhães; Airton José Rombaldi

    2013-01-01

    OBJETIVO: verificar as alterações no perfil lipídico e glicêmico de ratos treinados, suplementados com maltodextrina. MATERIAIS E MÉTODOS: o protocolo de treinamento consistiu de 8 semanas de natação em padrão contínuo (60min.dia-1) ou intermitente (2 períodos de 30min, com intervalo de 10min), com sobrecargas correspondentes a 5% e 10% do peso corporal, respectivamente. Durante 37 dias os animais foram suplementados com uma dose diária de 0,48g.kg-1 de maltodextrina dissolvida em água ou rec...

  9. Influência da cafeína na resposta pressórica ao exercício aeróbio em sujeitos hipertensos Caffeine influence on blood pressure response to aerobic exercise in hypertensive subjects

    Directory of Open Access Journals (Sweden)

    Raquel Freire Cazé

    2010-10-01

    Full Text Available A redução da pressão arterial (PA promovida pelo exercício físico é evidente segundo a literatura atual. Mecanismos neuro-humorais explicam essa resposta hipotensora, em que a diminuição da atividade simpática apresenta-se como um dos principais mecanismos. Porém, a ingestão de alimentos ricos em cafeína (CA pode suprimir esta atenuação simpática. O objetivo desse estudo foi elucidar o impacto da ingestão de CA na resposta pressórica ao exercício em pessoas hipertensas. Sete hipertensos (52,3 ± 3,3 anos, sendo cinco mulheres, realizaram duas sessões de caminhada com 40 minutos de duração, em dois dias de treinamento, tendo previamente ingerido CA (4mg/kg de peso corporal ou placebo (PL. A PA e a frequência cardíaca foram verificadas anteriormente a ingestão, após 15, 30, 45, 60 minutos da ingestão em estado de repouso e com 10, 20 e 30 minutos após o exercício. Os dados foram tratados por meio de estatística descritiva, e pelo teste não paramétrico de Wilcoxon (p Blood pressure reduction (BP promoted by physical exercise is evident according to the current literature. Neurohumoral mechanisms explain this hypotensive response, in which decrease of the sympathetic activity appears as one of its main mechanisms. However, the ingestion of caffeine-rich food (CA can suppress this sympathetic attenuation. The objective of this study was to elucidate the impact of CA ingestion in BP after exercise, in hypertensive individuals. Seven hypertensive subjects (52.3 +/-3.3 years, being 5 women, accomplished two walk sessions with 40 minutes of duration, in two days of training, having previously ingested CA (4 mg/kg of body weight or placebo (PL. BP and heart rate were verified previously to the ingestion, after 15, 30, 45, 60 minutes of the ingestion, at rest and with 10, 20 and 30 minutes after exercise. Data were treated through descriptive statistics and by the non-parametric Wilcoxon test (p<0.05. BP mean increased from 124.9/80.9 mmHg before ingestion to 129.4/84.3 mmHg 60 minutes later (p< 0.05. In the recovery period, after 30 minutes of exercise, hypotensive answer was observed in the PL procedure (decrease of 122.6/79.4 mmHg to 115.7/78.6 mmHg, while in the procedure with CA, BP was significantly higher than at rest (increase of 124.9/80.9 mmHg to 136.9/90.9 mmHg, p<0.05. It was concluded that CA not only suppresses the hypotensive response to exercise, but also provokes post-exercise hypertension.

  10. Variaciones de los valores plasmáticos de lípidos, hidratos de carbono y hormonas en una prueba de intensidad creciente, en deportistas de resistencia aeróbica

    OpenAIRE

    Ansón Manso, Miguel Ángel; González Haro, Carlos; Escanero Marcén, Jesús Fernando; Soria Aznar, Marisol

    2013-01-01

    Validación de una prueba incremental para conocer el grado de entrenamiento de los deportistas y su futuro rendimiento en competición deportiva mediante la obtención del crossover o punto de cruce metabólico y verificación que las ecuaciones estequiométricas aplicadas se correlacionan con los procesos metabólicos determinantes de las mismas. Conocer la bioquímica del ejercicio y las variaciones sericas de glucosa y grasas a lo largo de todo el rango de intensidad del ejercicio y post-ejercici...

  11. Potência aeróbica máxima, freqüência cardíaca e capacidade vital em ambientes normo e hiperbárico

    Directory of Open Access Journals (Sweden)

    Carlos Alberto Moreira

    1999-10-01

    Full Text Available Este estudo se propôs verificar variáveis fisiológicas. Revisando a literatura sobre o presente trabalho, levantaram-se vários tratados especificando as reações e adaptações tanto fisiológicas quanto comportamentais ocorridas no organismo durante o mergulho. Seguiu-se o modelo da pesquisa descritiva do tipo survey, da qual participaram mergulhadores da Marinha do Brasil, do sexo masculino, praticantes de atividades físicas num total de 9, com média da idade de 28 ± 4,3 anos, peso de 76,7 ± 8,32kg e estatura de 173,8 ± 6,33cm. Todos foram submetidos à avaliação de vários parâmetros fisiológicos determinados para o estudo ao nível do mar (ambiente normobárico e aos 18 metros de profundidade (ambiente hiperbárico, pressurizados em câmara hiperbárica, sendo verificadas as variáveis propostas em exercício. Os resultados são analisados no nível de significância de p 0,05 denota não existir diferença significativa entre os ambientes verificados. O consumo máximo de oxigênio (p = 0,00013; < 0,05 e a capacidade vital (p = 0,00126; < 0,05 denotam existir diferenças significativas entre os ambientes. Isto comprova a importância de conhecer as reações fisiológicas avaliadas e revisadas na literatura como componentes essenciais da performance, com ênfase na fisiologia do exercício hiperbárica.

  12. Exposure of BALB/c mice to diesel engine exhaust origin secondary organic aer-osol (DE-SOA) during the developmental stages impairs the social behavior in adult life of the males

    OpenAIRE

    2016-01-01

    Secondary organic aerosol (SOA) is a component of particulate matter (PM) 2.5 and formed in the atmosphere by oxidation of volatile organic compounds. Recently, we have reported that inhalation exposure to diesel engine exhaust (DE) originated SOA (DE-SOA) affect novel object recognition ability and impair maternal behavior in adult mice. However, it is not clear whether early life exposure to SOA during the de-velopmental stages affect social behavior in adult life or not. In the present stu...

  13. Influência das condições de aeração no tratamento de efluentes fenólicos com biofilmes em reator aeróbio

    OpenAIRE

    Maiorano, Alfredo Eduardo; Zuccolo-Fieri,Marisa; Carter,José Marcio; Costa,Alberto José Moitta da; Leite,Jader Vieira; Sanchez,Cássia Regina; Magossi,Luiz Roberto; Andrade,Renato de Jesus; Terra,Márcio Henrique

    2005-01-01

    No presente trabalho foi estudada a influência das condições de aeração no tratamento de efluentes fenólicos com biofilmes. Os ensaios foram realizados com efluente sintético para simular dejetos industriais com elevadas concentrações de fenol. Foram testadas vazões de aeração de 0,7, 1,6, 2,3 vvm na cinética de biodegradação de fenol. Nas melhores condições testadas, quais sejam: reator de leito empacotado, com suporte de esferas de cerâmica e vazão de 2,3 vvm, foi atingida eficiência de rem...

  14. Respuesta del lulo La Selva (Solanum quitoense x Solanum hirtum a la aplicación de fermentados aeróbicos tipo bocashi y fertilizante químico

    Directory of Open Access Journals (Sweden)

    Víctor Hugo Ramírez-Builes

    2010-04-01

    Full Text Available En un suelo derivado de cenizas volcánicas bien drenado y de alta fertilidad del municipio Ansermanuevo (zona cafetera de Colombia, en el cultivo de lulo (Solanum quitoense x S. hirtum se evaluaron tres fuentes orgánicas tipo bocashi, provenientes de los procesos de fermentación de pulpa de café, lombricompuesto y gallinaza y un tratamiento con fertilizante químico (10-30-10 más un testigo absoluto sin aplicación de fertilizantes. Se empleó un diseño experimental en bloques completos al azar con tres repeticiones, cada repetición estuvo constituida por 58 plantas. Las aplicaciones de materiales orgánicos mejoraron las características del suelo, estabilizando el pH, aumentando la capacidad de intercambio catiónico y la materia orgánica. En términos generales, el tratamiento de mejor desempeño fue el bocashi de gallinaza, con un promedio de cuajamiento de fruto de 38.3% y un mayor rendimiento (4.7 t/ha. Los bocashis de lombricompuesto y pulpa de café no fueron estadísticamente diferentes al tratamiento químico y todos los tratamientos fueron distintos (P < 0.05 al testigo, lo que demuestra la buena respuesta del cultivo de lulo a las aplicaciones de fuentes orgánicas.

  15. Respuesta del lulo La Selva (Solanum quitoense x Solanum hirtum a la aplicación de fermentados aeróbicos tipo bocashi y fertilizante químico

    Directory of Open Access Journals (Sweden)

    Ramírez-Builes Víctor Hugo

    2010-06-01

    Full Text Available En un suelo derivado de cenizas volcánicas bien drenado y de alta fertilidad del municipio Ansermanuevo (zona cafetera de Colombia, en el cultivo de lulo (Solanum quitoense x S. hirtum se evaluaron tres fuentes orgánicas tipo bocashi, provenientes de los procesos de fermentación de pulpa de café, lombricompuesto y gallinaza y un tratamiento con fertilizante químico (10-30-10 más un testigo absoluto sin aplicación de fertilizantes. Se empleó un diseño experimental en bloques completos al azar con tres repeticiones, cada repetición estuvo constituida por 58 plantas. Las aplicaciones de materiales orgánicos mejoraron las características del suelo, estabilizando el pH, aumentando la capacidad de intercambio catiónico y la materia orgánica. En términos generales, el tratamiento de mejor desempeño fue el bocashi de gallinaza, con un promedio de cuajamiento de fruto de 38.3% y un mayor rendimiento (4.7 t/ha. Los bocashis de lombricompuesto y pulpa de café no fueron estadísticamente diferentes al tratamiento químico y todos los tratamientos fueron distintos (P < 0.05 al testigo, lo que demuestra la buena respuesta del cultivo de lulo a las aplicaciones de fuentes orgánicas.

  16. Respuesta del balance simpático-parasimpático de la variabilidad de la frecuencia cardíaca durante una semana de entrenamiento aeróbico en ciclistas de ruta

    Directory of Open Access Journals (Sweden)

    G. Rosales-Soto

    2016-12-01

    Conclusiones: Los resultados de este estudio muestran un aumento significativo en la respuesta del balance autonómico del cociente baja frecuencia/alta frecuencia posterior al entrenamiento. Además, una disminución significativa de la potencia de la banda de alta frecuencia durante la recuperación que puede implicar aumento de la actividad de la respuesta parasimpática. Estos cambios podrían ayudar al control y diseño de programas de entrenamiento de forma individualizada para el ciclismo en ruta, además de ser una herramienta barata y no invasiva.

  17. Exposure of BALB/c mice to diesel engine exhaust origin secondary organic aer-osol (DE-SOA during the developmental stages impairs the social behavior in adult life of the males

    Directory of Open Access Journals (Sweden)

    Tin-Tin eWin-Shwe

    2016-01-01

    Full Text Available Secondary organic aerosol (SOA is a component of particulate matter (PM 2.5 and formed in the atmosphere by oxidation of volatile organic compounds. Recently, we have reported that inhalation exposure to diesel engine exhaust (DE originated SOA (DE-SOA affect novel object recognition ability and impair maternal behavior in adult mice. However, it is not clear whether early life exposure to SOA during the de-velopmental stages affect social behavior in adult life or not. In the present study, to investigate the effects of early life exposure to DE-SOA during the gestational and lactation stages on the social behavior in the adult life, BALB/c mice were exposed to clean air (control, DE, DE-SOA and gas without any particulate matter in the inhala-tion chambers from gestational day 14 to postnatal day 21 for 5 h a day and 5 days per week. Then adult mice were examined for changes in their social behavior at the age of 13 week by a sociability and social novelty preference, social interaction with a juvenile mouse and light-dark transition test, hypothalamic mRNA expression levels of social behavior-related genes, estrogen receptor-alpha and oxytocin receptor as well as of the oxidative stress marker gene, heme oxygenase (HO-1 by real-time RT-PCR method. In addition, hypothalamic level of neuronal excitatory marker, glutamate was determined by ELISA method. We observed that sociability and social novelty pref-erence as well as social interaction were remarkably impaired, expression levels of es-trogen receptor-alpha, oxytocin receptor mRNAs were significantly decreased, ex-pression levels of HO-1 mRNAs and glutamate levels were significantly increased in adult male mice exposed to DE-SOA compared to the control ones. Findings of this study indicate early life exposure of BALB/c mice to DE-SOA may affect their late-onset hypothalamic expression of social behavior related genes, trigger neurotoxi-city and impair social behavior in the males.

  18. Magnitude da hipotensão pós-exercício aeróbio agudo: Uma revisão sistemática dos estudos randomizados

    Directory of Open Access Journals (Sweden)

    Ana Cristina Oliveira Marques-Silvestre

    2014-09-01

    Full Text Available Objetivou-se revisar sistematicamente estudos randomizados sobre a magnitude da hipotensão pós-exercício (HPE em adultos. Consultaram-se as bases Pubmed, Scielo e Lilacs, combinando os indexadores “exercise” e “hypotension”, sendo encontrados 1336 estudos. Destes, excluíram-se 1268 por títulos, 37 por resumos, 10 não randomizados, 1 por repetição de dados, restando 20. Estes foram avaliados segundo os itens de randomização, mascaramento, sigilo de alocação, análise por intenção de tratar e quantitativamente pela Escala de Jadad. As reduções das pressões sistólica (PAS e diastólica (PAD em normotensos foram inferiores à dos hipertensos (−9±3 vs −11±6 mmHg e −5±2 vs −8±6 mmHg, respetivamente. Em ambos os grupos, os indivíduos ativos apresentaram HPE maior que os sedentários (normotensos: PAS −10±4 vs −8±1 mmHg; PAD −5±1 vs −4±1 mmHg; hipertensos: PAS −16±4 vs −9±2 mmHg; PAD −7±4 vs −5±3 mmHg, respetivamente. Nestes estudos, a magnitude da HPE variou entre −4 a −19 mmHg para PAS e −2 a −9 mmHg para PAD, valores que dependem tanto das características da amostra, seus estágios pressóricos iniciais, sexo e nível de atividade física, como também do protocolo de exercício utilizado, não havendo consenso sobre a influência da sua duração ou da intensidade do exercício.

  19. Entrenamiento de la capacidad aeróbica por medio de la terapia acuática en niños con parálisis cerebral tipo diplejía espástica

    OpenAIRE

    Fajardo, Nandy; Moscoso, Fabiola

    2013-01-01

    Los autores de este artículo pretenden identificar las características que debe tener una propuesta de intervención fisioterapéutica para el entrenamiento de la capacidad aérobica en niños y niñas entre los 8 y los 12 años, con parálisis cerebral tipo diplejía espástica, empleando la terapia acuática.

  20. Influência do índice glicêmico na glicemia em exercício físico aeróbico The glycemic index influence on glucose in aerobic exercise

    Directory of Open Access Journals (Sweden)

    Valéria Cristina de Faria

    2011-09-01

    Full Text Available OBJETIVO: Avaliar a influência do índice glicêmico (IG na resposta glicêmica antes e durante o exercício físico decorrente a diferentes sessões experimentais pré-exercício. MÉTODOS: Doze homens adultos realizaram três sessões experimentais pré-exercício: de alto índice glicêmico (AIG; de baixo índice glicêmico (BIG; e em estado de jejum, sendo nesta última oferecida duas formas diferenciadas de hidratação durante o exercício: água e bebida carboidratada. RESULTADOS: Durante o período de repouso, o tipo de refeição, de AIG ou de BIG, interferiu no comportamento da glicemia, ambas tendendo ao "efeito rebote". Durante o exercício, não foi observada diferença na resposta glicêmica entre as quatro ações testadas; contudo, a intervenção com bebida carboidratada manteve constante a glicemia ao longo dos 60 min do exercício. CONCLUSÃO: O IG é determinante na resposta glicêmica ao longo de uma hora antes do exercício, porém não interfere na resposta glicêmica durante a atividade.OBJECTIVE: Evaluate the influence of glycemic index (GI on the glycemic response before and during the physical exercise after to different experimental sessions pre-exercise. METHODS: Twelve adult males performed three experimental sessions pre-exercise: of high glycemic index (HGI; of low glycemic index (LGI; In condition of fast, although this one take two different ways of hydration while the exercise: water and carbohydrate drink. RESULTS: During the repose period, the type of meal, even the HGI and also the LGI, interfered on glycemic's behavior, both tendency to the "Rebound Effect". During the exercise, it was not observed differences in glycemic answers between the four tested actions, although the intervention with CHO drink maintained constant blood along all 60 min of exercise. CONCLUSION: The GI is determinant in the glycemic response over an hour before exercise, but does not interfere in the glycemic response during the activity.

  1. Microbiota cloacal aeróbia de cracídeos cativos no Rio Grande do Sul e sua susceptibilidade a antimicrobianos Cloacal microbiota identification and evaluation of the antimicrobial resistance in captive cracids from Rio Grande do Sul, Brazil

    Directory of Open Access Journals (Sweden)

    Helton Fernandes Santos

    2010-12-01

    Full Text Available Os cracídeos são aves silvestres que habitam as matas tropicais da América. Foram coletadas, no ano de 2007, amostras cloacais de 51 aves de dez espécies diferentes de cracídeos mantidos em cativeiros no Estado do Rio Grande do Sul. A partir dos swabs, colhidos assepticamente, foi realizado o isolamento e a caracterização bacteriana e o teste de susceptibilidade antimicrobiana dos isolados. Foram identificadas 93 cepas de bactérias. As bactérias mais frequentemente isoladas foram Escherichia coli, Staphylococcus spp. e Streptococcus spp. Todas as amostras foram negativas para o isolamento de Salmonella spp. O resultado do teste de sensibilidade mostrou que dentre as 93 cepas isoladas, todas foram sensíveis apenas ao imipinem. Adicionalmente, os menores percentuais de resistência foram observados frente ao cloranfenicol e ciprofloxacina. Os gêneros e espécies bacterianas com maior percentual de resistência a diferentes antibióticos testados foram Escherichia coli, Serratia marcescens, Staphylococcus aureus e Streptococcus spp. Com os resultados obtidos no presente trabalho, concluí-se, que a população de cracídeos estudada apresenta sua microbiota cloacal composta por vários gêneros e espécies bacterianas e que a multirresistencia pode ser um problema no futuro, uma vez que algumas cepas isoladas mostraram percentuais elevados de resistência a diferente antimicrobianos.Cracids are wildlife Galliformes which inhabits the America's tropical forests. Fifty one cloacal swabs were collected from 10 different species of captive cracids from the Rio Grande do Sul State during 2007. The cloacal swab samples were submitted to bacterial isolation, identification and, subsequently; antimicrobial susceptibility testing. Ninety three bacterial isolates were obtained from the cracid population examined. The most prevalent among the isolates were Escherichia coli, and bacteria from the Staphylococcus and Streptococcus genera. All samples tested in this study were negative for Salmonella spp. The antimicrobial susceptibility tests showed that none of the 93 strains presented resistance to the antimicrobial imipinem. In addition, the lower percentages of resistance were observed against cloranfenicol and ciprofloxacine. The bacteria genus and species with the highest percentage of resistance to the different antimicrobials examined were E. coli, Serratia marcescens, Staphylococcus spp. and Streptococcus spp. In conclusion, the data presented in this article demonstrate that the cloacal microbiota of the reported cracid population is composed of several bacterial genera and species and multi-drug resistance may be a problem for the future, since some strains showed elevated percentage of resistance against several different antimicrobials.

  2. Biodegradación de HAPs durante la biorremediación aeróbica de suelos contaminados con hidrocarburos del petróleo. Análisis de poblaciones bacterianas y genes funcionales

    OpenAIRE

    Izquierdo Romero, Andrés Ricardo

    2014-01-01

    [spa] La contaminación de suelos con derivados del petróleo es un problema a nivel mundial, especialmente en los países productores y exportadores de crudo, teniendo consecuencias muy perjudiciales para el medio ambiente y la salud humana. Una de las mejores alternativas de remediación de suelos es la aplicación de métodos biológicos, como la biorremediación, por tratarse de una tecnología amigable con el medio ambiente y por sus menores costos en comparación con técnicas físicas y químicas. ...

  3. Equações para a previsão da potência aeróbia (VO2 de jovens adultos brasileiros Equations for predicting aerobic power (VO2 of young Brazilian adults

    Directory of Open Access Journals (Sweden)

    Paula Magrani

    2010-06-01

    Full Text Available FUNDAMENTO: O VO2 pode ser previsto, com base em parâmetros antropométricos e fisiológicos, para determinadas populações. OBJETIVO: Propor modelos preditivos do VO2 submáximo e máximo para jovens adultos brasileiros. MÉTODOS: Os 137 voluntários (92 homens foram submetidos ao teste progressivo de esforço máximo (GXT no ciclo ergômetro (Monark®, Br. Medidas de trocas gasosas e ventilatórias foram realizadas em circuito aberto (Aerosport® TEEM 100, EUA. Em outro grupo, 13 voluntários foram submetidos ao GXT e a um teste de onda quadrada (SWT, para avaliar a validade externa das fórmulas do ACSM, de Neder et al e do nomograma de Åstrand-Ryhming. Adotou-se o delineamento experimental de validação cruzada e o nível de significância de p BACKGROUND: VO2 may be predicted with base on anthropometric and physiological parameters for determined populations. OBJECTIVE: To propose models for submaximal and maximal VO2 prediction in young Brazilian adults. METHODS: A total of 137 volunteers (92 men underwent graded maximal exercise test (GXT in a cycle ergometer (MonarkTM, Br. Gas exchange and respiratory measurements were performed in an open circuit (AerosportTM TEEM 100, USA. In another group, 13 volunteers underwent GXT and a square wave test (SWT in order to evaluate the external validity of Neder et al's formula, ACSM's formula, and of Åstrand-Ryhming nomogram. The study design chosen was a cross-validation and the significance level was set at p < 0.05. RESULTS: For men during submaximal exercises, a mathematical model was deduced with base on workload, body mass, and age, which explained 89% of the VO2 variation, with SEE (standard error of the estimate = 0.33 l.min-1. For the maximum load in the male group, another model with the same variables explained 71% of VO2 variation, with SEE = 0.40 l.min-1. For women, 93% of VO2 variation could be explained, with SEE = 0.17 l.min-1, both in submaximal and maximal exercise, with only one equation by use e of the same independent variables. CONCLUSION: The models derived in the present study proved to be accurate to predict submaximal and maximal VO2 in young Brazilian adults. (Arq Bras Cardiol. 2010; [online]. ahead print, PP.0-0

  4. Efeitos do exercício aeróbio durante a hemodiálise em pacientes com doença renal crônica: uma revisão da literatura

    OpenAIRE

    Joseane Böhm; Mariane Borba Monteiro; Fernando Saldanha Thomé

    2012-01-01

    INTRODUÇÃO: Pacientes com doença renal crônica (DRC) têm capacidade física e funcional reduzida quando comparados à população geral. O tratamento hemodialítico torna as atividades desses pacientes restritas, favorecendo o estilo de vida sedentário e a limitação funcional. Pacientes em hemodiálise (HD) são menos ativos, apresentam baixa tolerância ao exercício e alto descondicionamento físico. Em virtude dessas alterações, têm sido propostos programas de exercício físico que visam não somente ...

  5. Cervicovaginal aerobic microflora of women with spontaneous abortion or preterm delivery in Araraquara-Brazil Microbiota aeróbica cérvico-vaginal de mulheres com aborto espontâneo ou prematuridade fetal em Araraquara - Brasil

    Directory of Open Access Journals (Sweden)

    Maria Stella G. Raddi

    1998-10-01

    Full Text Available Microbiological routine exams of endocervix and vaginal specimens of 22 women with clinical history of recent spontaneous abortion or premature rupture of membranes were accomplished. Chlamydia trachomatis, Streptococcus pyogenes, Streptococcus agalactiae, Candida sp and Gardnerella vaginalis were recovered from 54.5% (12 of the women. Ureaplasma urealyticum was frequently isolated (45.5% but 5 out of 22 had U. urealyticum only. Our report stands for the importance of quantitative as well as qualitative investigation on genital microflora in pregnant women, since it is likely to influence on pregnancy outcome.Rotina bacteriológica do conteúdo vaginal e cervical de 22 mulheres com histórico de aborto recente ou ruptura precoce das membranas foi realizada. Chlamydia trachomatis, Streptococcus pyogenes, Streptococcus agalactiae, Candida sp e Gardnerella vaginalis foram isolados em 54,5% (12 das pacientes. Apesar de Ureaplasma urealyticum ter sido frequentemente encontrado (45,5%, somente em 5 das 22 mulheres foi o único microrganismo presente nos materiais analisados. Esses resultados chamam a atenção para a importância de investigação quantitativa bem como qualitativa da microbiota genital em gestantes, tendo em vista ter consequências na gestação.

  6. Modulation of vagal activity to atria electrical remodeling resulted from rapid atrial pacing

    Institute of Scientific and Technical Information of China (English)

    Shulong Zhang; Yanzong Yang; Yingxue Dong; Lianjun Gao; Donghui Yang; Chunyue Zhao; Hongwei Zhao; Xiaomeng Yin; Jinqiu Liu; Zhihu Lin

    2008-01-01

    Background Atrial electrical remodeling(AER)plays an important role in the pathogenesis and maintenance of atrialfibrillation.However,little is known about modulation of vagal activilty to AER.This study aimed to investigate the relationshipbetween vagal moduation and AER. Methods Twenty four adult mongrel dogs under general anesthesia were randomized into 3groups.Sympathetic activity was blocked by administration of metoprolol in 3 groups.The changes in vagal modulation to atria afterAER were observed in 10 dogs without vagal interruption in group A.The effects of vagal intervention on AER were investigated in 8dogs with administration of atropine in group B.The impact of aggressively vagal activity on AER was studied in 6 dogs with bilateralcervical vag sympathetic trunLks stimulation during AER in group C.Bilateral cervicall vagosympathetic trunks were decentralized.Multipolar catheters wereplaced into high right atria(RA),coronary sinus(CS)and rightventricle(RV).AER was induced by 600 bpmpacing through RA catheter for 30 minutes.Attial effective refractory period(ERP)and vulnerability window (VW)of atrial fibrillationwere measured with and without vagal stimulation before and after AER.Results In group A,ERP decreased significantly at baselineand during vagal stimulation after AER compared with that beforeAER(all P<0.05).In group B,ERP remaind unchanged at baselineand vagal stimulation after AER compared with tbat before AER (all P>0.05).In group C,ERP shortened significantly at baseline andvagal stimulation after AER compared with that before AER(all P<0.05).ERP shortening after AER in Groups A and C increasedsignificantly than that in group B (all P<0.05).Atrial fibrillation could not be induced at baseline(VW close to 0) before and after AERin three groups.VW became widen significantly during vagal stimulation after AER compared with that before AER in Groups A and C(all P<0.05),while VW remained unchanged in group B (VW close to 0).Conclusions

  7. Identifying Housing and Meteorological Conditions Influencing Residential Air Exchange Rates in the DEARS and RIOPA Studies: Development of Distributions for Human Exposure Modeling

    Science.gov (United States)

    Appropriate prediction of residential air exchange rate (AER) is important for estimating human exposures in the residential microenvironment, as AER drives the infiltration of outdoor-generated air pollutants indoors. AER differences among homes may result from a number of fact...

  8. Diagrammatic Approach for Complete Automation of Relational Database Normalization at Conceptual Level

    Directory of Open Access Journals (Sweden)

    M.S. Patwardhan

    2010-11-01

    Full Text Available AER (Articulated Entity Relationship diagrams proposed by us, are the extension of EntityRelationship (ER diagrams to accommodate functional dependencies (FDs as their integral part.Accommodation of FDs in ER diagram helps to achieve total and unconditional automation of relationaldatabase normalization. In this paper we have implemented a software Integrated DevelopmentEnvironment (IDE, called AER IDE, designed by extending the Graphical Editing Framework (GEF andDraw2d plug-in functionality of Eclipse. The AER IDE helps to draw, validate, store and normalize AERdiagrams. An AER IDE has five modules. AER Editor allows creation and edition of AER diagrams usingModel View controller (MVC approach. AER diagrams are translated and stored as an xml file. AERValidator provides the facility of AER diagram validation based on a set of proposed rules. AERNormalizer allows normalization of an AER diagram, in one go, with the help of the proposed AERnormalization rules and algorithms. Thus, it allows the total and unconditional automation of relationaldatabase normalization up to a given normal form; as an integral part of AER IDE. It also serves as avisual aid for the normalization process which is always easy to understand and interpret rather thantheoretical approach. AER-XML Bidirectional Translator provides the import and export functionality ofAER diagram, to and from an XML template making it compatible with the other toolset. AER-SQLGenerator generates DDL scripts in the SQL schema format. The AER IDE is tested with ten distinct AERdiagrams with all possible combinations of AER features and validation rules.

  9. Effects of pH and Competing Anions on the Solution Speciation of Arsenic by Ion Exchange Resins

    Energy Technology Data Exchange (ETDEWEB)

    Impellitteri, Christopher A.; Ryan, JAmes A.; Al-Abed, Souhail R.; Scheckel, Kirk G.; Randall, Paul M.; Richardson, Collin A.

    2003-03-26

    Anion-exchange resins (AER) are used to differentiate As(V) and As(III) by retaining As(V) and allowing As(III) to pass through. AERs allow rapid speciation of As in the field which precludes the effects of sample preservation on As speciation. Aqueous environmental samples contain anions that may interfere with the speciation of As. This study compares the speciation of As by two commercially available AERs. A silica-based AER was selected for further study. As(V) and As(III) were passed through the AER in the presence of NO3 -, SO4 2-, HPO4 2-, Cl- and HCO3 - at pH 4, 6 and 8. Recoveries of As species in mixed systems range between 90 to 100%. Breakthrough curves for As(V) are presented which allow calculation of loading rates. HPO4 2- has the greatest effect on the speciation of As by AER.

  10. Diurnal and seasonal variation in air exchange rates and interzonal flows measured by active tracer gas in five Danish homes

    DEFF Research Database (Denmark)

    Clausen, Geo; Bekö, Gabriel; Toftum, Jørn

    2016-01-01

    and airflows between rooms. AERs changed rapidly during the day and differed between rooms. Occupant behavior (window opening) strongly influenced the AERs. AERs were highest in the summer, lowest in the winter. Interzonal airflow measurements indicated that the air within a given floor is well mixed, while...... there is less air movement between different floors. The position of the internal doors (open/closed) had a strong influence on the air movements within the dwelling....

  11. Predicting residential air exchange rates from questionnaires and meteorology: model evaluation in central North Carolina.

    Science.gov (United States)

    Breen, Michael S; Breen, Miyuki; Williams, Ronald W; Schultz, Bradley D

    2010-12-15

    A critical aspect of air pollution exposure models is the estimation of the air exchange rate (AER) of individual homes, where people spend most of their time. The AER, which is the airflow into and out of a building, is a primary mechanism for entry of outdoor air pollutants and removal of indoor source emissions. The mechanistic Lawrence Berkeley Laboratory (LBL) AER model was linked to a leakage area model to predict AER from questionnaires and meteorology. The LBL model was also extended to include natural ventilation (LBLX). Using literature-reported parameter values, AER predictions from LBL and LBLX models were compared to data from 642 daily AER measurements across 31 detached homes in central North Carolina, with corresponding questionnaires and meteorological observations. Data was collected on seven consecutive days during each of four consecutive seasons. For the individual model-predicted and measured AER, the median absolute difference was 43% (0.17 h(-1)) and 40% (0.17 h(-1)) for the LBL and LBLX models, respectively. Additionally, a literature-reported empirical scale factor (SF) AER model was evaluated, which showed a median absolute difference of 50% (0.25 h(-1)). The capability of the LBL, LBLX, and SF models could help reduce the AER uncertainty in air pollution exposure models used to develop exposure metrics for health studies.

  12. Probabilistic estimation of residential air exchange rates for population-based human exposure modeling

    Science.gov (United States)

    Residential air exchange rates (AERs) are a key determinant in the infiltration of ambient air pollution indoors. Population-based human exposure models using probabilistic approaches to estimate personal exposure to air pollutants have relied on input distributions from AER meas...

  13. Review of Air Exchange Rate Models for Air Pollution Exposure Assessments

    Science.gov (United States)

    A critical aspect of air pollution exposure assessments is estimation of the air exchange rate (AER) for various buildings, where people spend their time. The AER, which is rate the exchange of indoor air with outdoor air, is an important determinant for entry of outdoor air pol...

  14. Characterization of atypical Aeromonas salmonicida isolates by ribotyping and plasmid profiling

    DEFF Research Database (Denmark)

    Pedersen, Karl; Dalsgaard, Inger; Larsen, J.L.

    1996-01-01

    A total of 38 strains of atypical Aeromonas salmonicida, three oxidase-negative but otherwise typical Aer. salmonicida, three typical Aer. salmonicida, and two reference strains, isolated from several countries and fish species were examined with respect to rRNA gene restriction patterns (ribotypes...

  15. A May American Economic Review Papers Seminar and an Analytic Project for Advanced Undergraduates

    Science.gov (United States)

    Elliott, Catherine S.

    2004-01-01

    The author describes two learning activities for teaching economics at the advanced undergraduate level: a May American Economic Review (AER) papers seminar and an analytic project. Both activities help students learn to "do economics." The May AER papers seminar promotes in-depth synthesis and interpretation on the basis of printed session papers…

  16. Measurement of air exchange rates in different indoor environments using continuous CO2 sensors

    Institute of Scientific and Technical Information of China (English)

    Yan YOU; Can Niu; Jian Zhou; Yating Liu; Zhipeng Bai; Jiefeng Zhang; Fei He; Nan Zhang

    2012-01-01

    A new air exchange rate (AER) monitoring method using continuous CO2 sensors was developed and validated through both laboratory experiments and field studies.Controlled laboratory simulation tests were conducted in a 1-m3 environmental chamber at different AERs (0.1-10.0 hr-1).AERs were determined using the decay method based on box model assumptions.Field tests were conducted in classrooms,dormitories,meeting rooms and apartments during 2-5 weekdays using CO2 sensors coupled with data loggers.Indoor temperature,relative humidity (RH),and CO2 concentrations were continuously monitored while outdoor parameters combined with on-site climate conditions were recorded.Statistical results indicated that good laboratory performance was achieved:duplicate precision was within 10%,and the measured AERs were 90%-120% of the real AERs.Average AERs were 1.22,1.37,1.10,1.91 and 0.73 hr-1 in dormitories,air-conditioned classrooms,classrooms with an air circulation cooling system,reading rooms,and meeting rooms,respectively.In an elderly particulate matter exposure study,all the homes had AER values ranging from 0.29 to 3.46 hr-1 in fall,and 0.12 to 1.39 hr-1 in winter with a median AER of 1.15.

  17. A nation-wide cross-sectional study of urinary albumin excretion rate, arterial blood pressure and blood glucose control in Danish children with type 1 diabetes mellitus. Danish Study Group of Diabetes in Childhood

    DEFF Research Database (Denmark)

    Mortensen, H B; Marinelli, K; Nørgaard, K

    1990-01-01

    than 20 to 150 micrograms min-1 were compared with those for 569 diabetic adolescents with AER less than or equal to 20 micrograms min-1 and duration of diabetes more than 2 years. The group with AER greater than 20 to 150 micrograms min-1 had significantly higher mean age (16.5 years) than the group...

  18. Genome-wide association study of urinary albumin excretion rate in patients with type 1 diabetes

    DEFF Research Database (Denmark)

    Sandholm, Niina; Forsblom, Carol; Mäkinen, Ville-Petteri;

    2014-01-01

    AIMS/HYPOTHESIS: An abnormal urinary albumin excretion rate (AER) is often the first clinically detectable manifestation of diabetic nephropathy. Our aim was to estimate the heritability and to detect genetic variation associated with elevated AER in patients with type 1 diabetes. METHODS: The di...

  19. Annual Percentage Rate and Annual Effective Rate: Resolving Confusion in Intermediate Accounting Textbooks

    Science.gov (United States)

    Vicknair, David; Wright, Jeffrey

    2015-01-01

    Evidence of confusion in intermediate accounting textbooks regarding the annual percentage rate (APR) and annual effective rate (AER) is presented. The APR and AER are briefly discussed in the context of a note payable and correct formulas for computing each is provided. Representative examples of the types of confusion that we found is presented…

  20. Estudo experimental dos efeitos de exercícios padronizados, aeróbios e anaeróbios em portadores de diabetes tipo II, mediante avaliações antropométricas, da glicemia e termográficas

    OpenAIRE

    Luiz Eduardo Genovez Damiano

    2007-01-01

    O diabetes Mellitus tipo II tem sido preocupação corrente nos dias atuais, pois, independente dos fatores desencadeados desta doença e de até certo ponto, algumas controvérsias sobre os mesmos, quaisquer investigações que possam contribuir para a melhoria de vida dos portadores do diabetes Mellitus tipo II, são altamente necessários. Destaque-se também que o levantamento estatístico e social da incidência dessa doença, tem demonstrado recentemente, que ocorrências tem incidido em indivíduos c...

  1. Selección mediante Simulación de una Estructura de Modelo Cinético para la Degradación Aeróbica de Efluentes de una Industria Láctea Selection by Simulation of a Model for the Kinetic Structure of an Aerobic Degradation System for Effluents from a Milk Industry

    Directory of Open Access Journals (Sweden)

    M.A. Rosa

    2004-01-01

    Full Text Available El propósito de este trabajo consiste en implementar una metodología de selección de estructuras de modelos cinéticos, para el caso concreto de la degradación aerobia de los efluentes industriales de una empresa láctea regional, utilizando como herramienta la simulación. Esta se encuentra disponible en un software comercial específico y consiste en configurar para uno o varios sustratos, un set de estructuras de modelos de complejidad creciente, con velocidades de degradación independientes, para evaluar el comportamiento del sistema mediante combinaciones de las mismas, confrontando los resultados obtenidos por simulación con los datos experimentales. Los resultados alcanzados para una estructura relativamente simple se consideran satisfactorios para ser implementados industrialmente. El aporte más importante lo constituye la convalidación tanto de la metodología propuesta como de la potencialidad del software para ser aplicado al análisis de situaciones reales, lo cual resulta de especial importancia para el análisis y diseño de plantas de tratamientoThis work consisted in implementing a methodology for the selection of kinetic model structures for a real case of aerobic degradation of industrial effluents from a regional milk industry using simulation as a tool. This tool is available in a specific commercial software and consists of making configurations for one or several substrates with a set of structural models of increasing complexity and independent degradation velocities. The behavior of the system is evaluated using various combinations of the preceding considerations and comparing the simulated results with industrial experimental data. The results obtained using a relatively simple structure were satisfactory for industrial application. The most important contribution was the proof that both the proposed methodology and the power of the software could be applied to real situations, which is of especial importance for the analysis and design of treatment plants

  2. Reproducibility of maximum aerobic power (VO2max among soccer players using a modified heck protocol Reprodutibilidade da potência aeróbia máxima (VO2max em jogadores de futebol utilizando o protocolo de heck modificado

    Directory of Open Access Journals (Sweden)

    Paulo Roberto Santos-Silva

    2007-01-01

    Full Text Available OBJECTIVE: To determine the degree of reproducibility of maximum oxygen consumption (VO2max among soccer players, using a modified Heck protocol. METHODS: 2 evaluations with an interval of 15 days between them were performed on 11 male soccer players. All the players were at a high performance level; they were training for an average of 10 hours per week, totaling 5 times a week. When they were evaluated, they were in the middle of the competitive season, playing 1 match per week. The soccer players were evaluated on an ergometric treadmill with velocity increments of 1.2 km.h-1 every 2 minutes and a fixed inclination of 3% during the test. VO2max was measured directly using a breath-by-breath metabolic gas analyzer. RESULTS: The maximum running speed and VO2max attained in the 2 tests were, respectively: (15.6 ± 1.1 vs. 15.7 ± 1.2 km.h-1; [P = .78] and (54.5 ± 3.9 vs. 55.2 ± 4.4 ml.kg-1.min-1; [P = .88]. There was high and significant correlation of VO2max between the 2 tests with a 15-day interval between them [r = 0.97; P OBJETIVO: Determinar o grau de reprodutibilidade do consumo máximo de oxigênio (VO2max em jogadores de futebol utilizando o protocolo de Heck modificado. MÉTODOS: Foram avaliados por duas vezes, com intervalo de 15 dias entre os testes, 11 futebolistas masculinos. Todos eram de alto nível, treinavam em média 10 horas por semana subdivididos em treinamentos físicos, técnicos, táticos e jogos competitivos, totalizando cinco vezes por semana e na fase em que foram avaliados se encontravam em pleno período competitivo realizando um jogo por semana. Os futebolistas foram avaliados em esteira ergométrica (1,2 km.h-1 a cada dois minutos e inclinação fixa durante o teste em 3%. O VO2max foi medido diretamente utilizando analisador metabólico de análise de gases expirados respiração-a-respiração. RESULTADOS: A velocidade máxima de corrida e o VO2max atingido nos dois testes foram respectivamente: (15,6 ± 1,1 vs. 15,7 ± 1,2 km.h-1; [p = 0,78] e (54,5 ± 3,9 vs. 55,2 ± 4,4 ml.kg-1.min-1; [P = 0,88]. Houve correlação significante e alta do VO2max entre os dois testes após 15 dias de intervalo [r = 0,97; P< 0,001]. CONCLUSÃO: O protocolo de Heck modificado foi reprodutível e o intervalo de quinze dias entre os testes ergoespirométricos não foi suficiente para modificar significativamente o VO2max dos jogadores de futebol.

  3. Efeito da suplementação com maltotextrina e cafeína durante exercício aeróbico em parâmetros cardiorrespiratórios e metabólicos em paciente diabético

    Directory of Open Access Journals (Sweden)

    Diego Luis Venancio

    2010-11-01

    Full Text Available O Diabetes Mellitus Tipo 2 é uma doença crônica que está afetando a população de forma crescente, tornando-se um sério problema de Saúde Pública. A suplementação esportiva como forma de prevenção da hipoglicemia para esses indivíduos pode favorecer a prática de exercícios físicos. O objetivo do presente trabalho, caracterizado como estudo de caso, foi investigar o efeito da suplementação com maltodextrina com ação isolada e também associada à cafeína em parâmetros metabólicos e cardivasculares. A metodologia utilizada foi a de indução de atividade física utilizando protocolo de esteira, com suplementação de substância controle (placebo, maltodextrina e cafeína de forma isolada em um primeiro momento e em associação em um segundo momento. A hipótese a ser testada refere-se a prevenção da instalação de quadro hipoglicêmico em paciente portador de Diabetes Mellitus Tipo 2 com 67 anos, percentual de gordura > 35%, sedentário, (VO2máx = 20,92 mL.Kg-1.min-1, glicemia de jejum de 184 mmol, com relato de mal estar durante a prática de exercício físico leve, provavelmente ocasionada pela queda no valor de glicemia. O trabalho cardíaco se manteve estável nos 3 tratamentos. De forma isolada, a cafeína não proporcionou alteração significativa na glicemia. A suplementação com maltodextrina, de forma isolada e associada a cafeína foi eficiente para minimização dos efeitos de hipoglicemia esperados. A pressão arterial e freqüência cardíaca não apresentaram resultado conclusivo e necessitam de mais estudos para verificação da interação entre fármacos utilizados pelo paciente em associação aos tratamentos.

  4. Exercício aeróbio como terapia de exposição a estímulos interoceptivos no tratamento do transtorno de pânico Aerobic exercise as exposure therapy to interoceptive cues in panic disorder

    Directory of Open Access Journals (Sweden)

    Ricardo William Muotri

    2007-10-01

    Full Text Available Os ataques de pânico são representados por um período distinto no qual há o início súbito de intensa apreensão, temor ou terror, freqüentemente associados com sentimentos de catástrofe iminente, diagnosticado em aproximadamente 10% da população. O Transtorno de Pânico é um transtorno de ansiedade que se caracteriza pela recorrência de ataques de pânico: crises súbitas de mal-estar e sensação de perigo ou morte iminente, acompanhadas de diversos sintomas físicos e cognitivos. Os indivíduos com Transtorno de Pânico apresentam, caracteristicamente, preocupações acerca das implicações ou conseqüências dos ataques de pânico. É uma condição clínica complexa que envolve diferentes modalidades ou conglomerados de sintomas. Assim, o foco nas sensações físicas erroneamente interpretadas no transtorno de pânico e na hipocondria centraliza-se basicamente nas manifestações autonômicas, como taquicardia e dispnéia. Há poucos estudos sobre atividade física e transtorno de pânico. O principal objetivo do estudo visa identificar com diferentes descrições se há uma população "nuclear" com sintomas predominantemente respiratórios apresentando esquiva de atividade física e a influência do exercício nesta população.Panic attacks are represented by distinct periods in which there is a sudden beginning of internal apprehension, fear or terror, frequently associated with feelings of imminent catastrophe, diagnosed in approximately 10% of the population. The panic disorder is an anxiety crisis that is characterized by the recurrence of panic attacks: sudden crises of uneasiness and sensation of danger or imminent death, followed by diverse physical and cognitive symptoms. Individuals with panic disorder are characteristically concerned about panic attacks implications or consequences. It is a complex clinical condition that involves different modalities or myriad of symptoms. Thus, the focus on the physical sensations misinterpreted in panic disorder and hypochondria, is basically centered in autonomic manifestations, such as tachycardia and dyspnea. There are scarce studies on physical activity and panic disorder. The main purpose of the study is to identify with different descriptions whether there is a 'main' population with symptoms predominantly respiratory presenting avoidance of physical activity and exercise influence on this population.

  5. Influência das condições de aeração no tratamento de efluentes fenólicos com biofilmes em reator aeróbio Influence of aeration conditions in phenolics effluents treatment using biofilms in aerobic reactor

    OpenAIRE

    Alfredo Eduardo Maiorano; Marisa Zuccolo-Fieri; José Marcio Carter; Alberto José Moitta da Costa; Jader Vieira Leite; Cássia Regina Sanchez; Luiz Roberto Magossi; Renato de Jesus Andrade; Márcio Henrique Terra

    2005-01-01

    No presente trabalho foi estudada a influência das condições de aeração no tratamento de efluentes fenólicos com biofilmes. Os ensaios foram realizados com efluente sintético para simular dejetos industriais com elevadas concentrações de fenol. Foram testadas vazões de aeração de 0,7, 1,6, 2,3 vvm na cinética de biodegradação de fenol. Nas melhores condições testadas, quais sejam: reator de leito empacotado, com suporte de esferas de cerâmica e vazão de 2,3 vvm, foi atingida eficiência de rem...

  6. Changes in some hematologic variables in a group of women older tan 55 years, after a program of aerobic training Cambios en algunas variables hematológicas, en un grupo de mujeres mayores de 55 años, luego de un programa de entrenamiento aeróbico

    OpenAIRE

    2003-01-01

    Objective: to evaluate changes in some hematologic variables after a four-month program of aerobic physical activity, in a group of healthy women, older than 55 years. Methods: 14 healthy sedentary women, older than 55 years were studied; they participated in a program of aerobic physical activity, three times per week, during four months, with an intensity between 60-85% of the maximal heart rate and with 60 minutes of duration per session. Before and after the program blood specimens were o...

  7. Respuesta del lulo La Selva (Solanum quitoense x Solanum hirtum a la aplicación de fermentados aeróbicos tipo bocashi y fertilizante químico Response of the lulo fruit cv. La Selva (Solanum quitoense x Solanum hirtum at the aerobic organic and inorganic fertilizer applications

    Directory of Open Access Journals (Sweden)

    Víctor Hugo Ramírez-Builes

    2010-04-01

    Full Text Available En un suelo derivado de cenizas volcánicas bien drenado y de alta fertilidad del municipio Ansermanuevo (zona cafetera de Colombia, en el cultivo de lulo (Solanum quitoense x S. hirtum se evaluaron tres fuentes orgánicas tipo bocashi, provenientes de los procesos de fermentación de pulpa de café, lombricompuesto y gallinaza y un tratamiento con fertilizante químico (10-30-10 más un testigo absoluto sin aplicación de fertilizantes. Se empleó un diseño experimental en bloques completos al azar con tres repeticiones, cada repetición estuvo constituida por 58 plantas. Las aplicaciones de materiales orgánicos mejoraron las características del suelo, estabilizando el pH, aumentando la capacidad de intercambio catiónico y la materia orgánica. En términos generales, el tratamiento de mejor desempeño fue el bocashi de gallinaza, con un promedio de cuajamiento de fruto de 38.3% y un mayor rendimiento (4.7 t/ha. Los bocashis de lombricompuesto y pulpa de café no fueron estadísticamente diferentes al tratamiento químico y todos los tratamientos fueron distintos (P In this study four fertilization treatments in lulo crop (Solanum quitoense x S.hirtum were evaluated, three organic with several manure sources like coffee skin , earthworm residues and chicken manure, and a four treatment consisted of inorganic fertilizer with a composition of 10-30-30 ( N,P,K and a control without fertilizer applications. A complete block random design with three replications was used and each replication with 58 plants. The organic fertilization increase the soil pH, cation exchange capacity and soil organic matter. The best treatment was the aerobic fermented, based on chicken manure with a fruit yield average of 4731 kg .ha-1, the rest of the organic treatments did no showed statistical differences with the inorganic fertilization and all were statistical different with the control without fertilizer applications, which showed a good crop response to the organic applications.

  8. Influência do treinamento físico aeróbio no transporte mitocondrial de ácidos graxos de cadeia longa no músculo esquelético: papel do complexo carnitina palmitoil transferase Influence of aerobic physical training in the motochondrial transport of long chain fatty acids in the skeletal muscle: role of the carnitine palmitoil transferase

    Directory of Open Access Journals (Sweden)

    Alex Shimura Yamashita

    2008-04-01

    Full Text Available O ácido graxo (AG é uma importante fonte de energia para o músculo esquelético. Durante o exercício sua mobilização é aumentada para suprir as necessidades da musculatura ativa. Acredita-se que diversos pontos de regulação atuem no controle da oxidação dos AG, sendo o principal a atividade do complexo carnitina palmitoil transferase (CPT, entre os quais três componentes estão envolvidos: a CPT I, a CPT II e carnitina acilcarnitina translocase. A função da CPT I durante o exercício físico é controlar a entrada de AG para o interior da mitocôndria, para posterior oxidação do AG e produção de energia. Em resposta ao treinamento físico há um aumento na atividade e expressão da CPT I no músculo esquelético. Devido sua grande importância no metabolismo de lipídios, os mecanismos que controlam sua atividade e sua expressão gênica são revisados no presente estudo. Reguladores da expressão gênica de proteínas envolvidas no metabolismo de lipídios no músculo esquelético, os receptores ativados por proliferadores de peroxissomas (PPAR alfa e beta, são discutidos com um enfoque na resposta ao treinamento físico.Fatty acids are an important source of energy for the skeletal muscle. During exercise, their mobilization is increased to supply the muscle energetic needs. Many points of regulation act in the fatty acids metabolism, where the carnitine palmytoiltransferase (CPT complex is the main control system. Three compounds named CPT I, CPT II and carnitine acyl carnitine translocase (CACT are components of this system. Its function is to control the influx of fatty acids inside the mitochondria for posterior oxidation and energy production. There is a pronounced increase in both activity and gene expression of CPT I in the skeletal muscle in response to exercise. Due to its importance in lipid metabolism, the controlling mechanisms are reviewed in the present study. The modulation of gene expression by peroxisome proliferator-activated receptors (PPARs alpha and beta during the physical training is also discussed in this review.

  9. Estudios teóricos sobre la enzima D-aminoácido oxidasa : nuevos aspectos experimentales sobre la oxidación aeróbica de los nucleótidos de piridina por la peroxidasa del rábano

    OpenAIRE

    Moreno Puertas, Cosme

    2011-01-01

    Dada la incógnita actual acerca de los substratos del enzima d-aminoácido oxidasa y su papel biológico se proponen como substratos del mismo átomos de carbono alfa en conformación beta o similar correspondientes a proteínas. Esta proposición esta basada en el parecido químico-estructural entre las estructuras mencionadas y el carbono x de los d-aminoácidos objeto de la catálisis. Se proponen nuevos mecanismos de acción para el enzima cuyo resultado es la síntesis de derivados oxigenados (hidr...

  10. Análise das variações da frequência cardíaca durante testes máximos aeróbio e anaeróbio : comparação entre atletas velocistas e fundistas

    OpenAIRE

    Jacinto, Alexandre Daniel Curado

    2005-01-01

    Dissertação de licenciatura apresentada à Faculdade de Ciências do Desporto e Educação Física Recentemente têm sido realizadas várias campanhas, numa tentativa de persuadir as populações, para a manutenção de uma prática de actividade física regular, abandonando, hábitos sedentaristas, de modo a abandonar estilos de vida não saudáveis. Este trabalho teve como objectivo verificar as diferenças existentes nos valores da frequência cardíaca de repouso, no pico e após o esforço, entre três ...

  11. Mutagenic and antimutagenic effects of aqueous extract of rosemary (Rosmarinus officinalis L.) on meristematic cells of Allium cepa.

    Science.gov (United States)

    Felicidade, I; Lima, J D; Pesarini, J R; Monreal, A C D; Mantovani, M S; Ribeiro, L R; Oliveira, R J

    2014-11-28

    Polyphenolic compounds present in rosemary were found to have antioxidant properties, anticarcinogenic activity, and to increase the detoxification of pro-carcinogens. The aim of the study was to determine the effect the aqueous extract of rosemary (AER) on mutagenicity induced by methylmethane sulfonate in meristematic cells of Allium cepa, as well as to describe its mode of action. Anti-mutagenicity experiments were carried out with 3 different concentrations of AER, which alone showed no mutagenic effects. In antimutagenicity experiments, AER showed chemopreventive activity in cultured meristematic cells of A. cepa against exposure to methylmethane sulfonate. Additionally, post-treatment and simultaneous treatment using pre-incubation protocols were the most effective. Evaluation of different protocols and the percent reduction in DNA indicated bioantimutagenic as well desmutagenic modes of action for AER. AER may be chemopreventive and antimutagenic.

  12. Pleiotropic patterning response to activation of Shh signaling in the limb apical ectodermal ridge.

    Science.gov (United States)

    Wang, Chi-Kuang Leo; Tsugane, Mizuyo H; Scranton, Victoria; Kosher, Robert A; Pierro, Louis J; Upholt, William B; Dealy, Caroline N

    2011-05-01

    Sonic hedgehog (Shh) signaling in the limb plays a central role in coordination of limb patterning and outgrowth. Shh expression in the limb is limited to the cells of the zone of polarizing activity (ZPA), located in posterior limb bud mesoderm. Shh is not expressed by limb ectoderm or apical ectodermal ridge (AER), but recent studies suggest a role for AER-Shh signaling in limb patterning. Here, we have examined the effects of activation of Shh signaling in the AER. We find that targeted expression of Shh in the AER activates constitutive Shh signaling throughout the AER and subjacent limb mesoderm, and causes a range of limb patterning defects with progressive severity from mild polydactyly, to polysyndactyly with proximal defects, to severe oligodactyly with phocomelia and partial limb ventralization. Our studies emphasize the importance of control of the timing, level and location of Shh pathway signaling for limb anterior-posterior, proximal-distal, and dorsal-ventral patterning.

  13. A review of air exchange rate models for air pollution exposure assessments.

    Science.gov (United States)

    Breen, Michael S; Schultz, Bradley D; Sohn, Michael D; Long, Thomas; Langstaff, John; Williams, Ronald; Isaacs, Kristin; Meng, Qing Yu; Stallings, Casson; Smith, Luther

    2014-11-01

    A critical aspect of air pollution exposure assessments is estimation of the air exchange rate (AER) for various buildings where people spend their time. The AER, which is the rate of exchange of indoor air with outdoor air, is an important determinant for entry of outdoor air pollutants and for removal of indoor-emitted air pollutants. This paper presents an overview and critical analysis of the scientific literature on empirical and physically based AER models for residential and commercial buildings; the models highlighted here are feasible for exposure assessments as extensive inputs are not required. Models are included for the three types of airflows that can occur across building envelopes: leakage, natural ventilation, and mechanical ventilation. Guidance is provided to select the preferable AER model based on available data, desired temporal resolution, types of airflows, and types of buildings included in the exposure assessment. For exposure assessments with some limited building leakage or AER measurements, strategies are described to reduce AER model uncertainty. This review will facilitate the selection of AER models in support of air pollution exposure assessments.

  14. US residential building air exchange rates: new perspectives to improve decision making at vapor intrusion sites.

    Science.gov (United States)

    Reichman, Rivka; Shirazi, Elham; Colliver, Donald G; Pennell, Kelly G

    2017-02-22

    Vapor intrusion (VI) is well-known to be difficult to characterize because indoor air (IA) concentrations exhibit considerable temporal and spatial variability in homes throughout impacted communities. To overcome this and other limitations, most VI science has focused on subsurface processes; however there is a need to understand the role of aboveground processes, especially building operation, in the context of VI exposure risks. This tutorial review focuses on building air exchange rates (AERs) and provides a review of literature related building AERs to inform decision making at VI sites. Commonly referenced AER values used by VI regulators and practitioners do not account for the variability in AER values that have been published in indoor air quality studies. The information presented herein highlights that seasonal differences, short-term weather conditions, home age and air conditioning status, which are well known to influence AERs, are also likely to influence IA concentrations at VI sites. Results of a 3D VI model in combination with relevant AER values reveal that IA concentrations can vary more than one order of magnitude due to air conditioning status and one order of magnitude due to house age. Collectively, the data presented strongly support the need to consider AERs when making decisions at VI sites.

  15. Surveillance cultures of samples obtained from biopsy channels and automated endoscope reprocessors after high-level disinfection of gastrointestinal endoscopes

    Directory of Open Access Journals (Sweden)

    Chiu King-Wah

    2012-09-01

    Full Text Available Abstract Background The instrument channels of gastrointestinal (GI endoscopes may be heavily contaminated with bacteria even after high-level disinfection (HLD. The British Society of Gastroenterology guidelines emphasize the benefits of manually brushing endoscope channels and using automated endoscope reprocessors (AERs for disinfecting endoscopes. In this study, we aimed to assess the effectiveness of decontamination using reprocessors after HLD by comparing the cultured samples obtained from biopsy channels (BCs of GI endoscopes and the internal surfaces of AERs. Methods We conducted a 5-year prospective study. Every month random consecutive sampling was carried out after a complete reprocessing cycle; 420 rinse and swabs samples were collected from BCs and internal surface of AERs, respectively. Of the 420 rinse samples collected from the BC of the GI endoscopes, 300 were obtained from the BCs of gastroscopes and 120 from BCs of colonoscopes. Samples were collected by flushing the BCs with sterile distilled water, and swabbing the residual water from the AERs after reprocessing. These samples were cultured to detect the presence of aerobic and anaerobic bacteria and mycobacteria. Results The number of culture-positive samples obtained from BCs (13.6%, 57/420 was significantly higher than that obtained from AERs (1.7%, 7/420. In addition, the number of culture-positive samples obtained from the BCs of gastroscopes (10.7%, 32/300 and colonoscopes (20.8%, 25/120 were significantly higher than that obtained from AER reprocess to gastroscopes (2.0%, 6/300 and AER reprocess to colonoscopes (0.8%, 1/120. Conclusions Culturing rinse samples obtained from BCs provides a better indication of the effectiveness of the decontamination of GI endoscopes after HLD than culturing the swab samples obtained from the inner surfaces of AERs as the swab samples only indicate whether the AERs are free from microbial contamination or not.

  16. Presencia electrocardiogr?fica de bradicardia sinusal en reposo atribuible a la exigencia del trabajo de larga duraci?n (fondo) en comparaci?n con ejercicios de corta duraci?n y gran intensidad

    OpenAIRE

    2015-01-01

    El prop?sito de este estudio es identificar si la bradicardia sinusal es directamente proporcional al tiempo y tipo de trabajo de resistencia aer?bica. Se tom? un electrocardiograma basal digital de 12 derivaciones para el estudio comparativo de 114 deportistas de atletismo, ciclismo, triatl?n, nataci?n y potencia de la Provincia de Pichincha, de los cuales el 59.65% (n=68) eran varones, sumados los practicantes de resistencia aer?bica (86.96%) y no resistencia aer?bica (13.04%). Se busc? ...

  17. Spatiotemporally‐Resolved Air Exchange Rate as a Modifier of Acute Air Pollution‐Related Morbidity in AtlantaMorbidity in Atlanta

    Science.gov (United States)

    Epidemiological studies frequently use central site concentrations as surrogates of exposure to air pollutants. Variability in air pollutant infiltration due to differential air exchange rates (AERs) is potentially a major factor affecting the relationship between central site c...

  18. Development and Evaluation of a New Air Exchange Rate Algorithm for the Stochastic Human Exposure and Dose Simulation Model (ISES Presentation)

    Science.gov (United States)

    Previous exposure assessment panel studies have observed considerable seasonal, between-home and between-city variability in residential pollutant infiltration. This is likely a result of differences in home ventilation, or air exchange rates (AER). The Stochastic Human Exposure ...

  19. Exposure to Sumas Mountain chrysotile induces similar gene expression changes as Libby Amphibole but has greater effect on long-term pathology and lung function

    Science.gov (United States)

    This study was designed to provide understanding of the toxicity of naturally occurring asbestos (NOA) including Libby amphibole (LA), Sumas Mountain chrysotile (SM), El Dorado Hills tremolite (ED) and Ontario ferroactinolite cleavage fragments (ON). Rat-respirable fractions (aer...

  20. Synthesis of blue-photoluminescent graphene quantum dots/polystyrenic anion-exchange resin for Fe(III) detection

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Wenjun, E-mail: wjzhang@hebut.edu.cn; Gan, Jie

    2016-05-30

    Highlights: • GQD/PS-AER was prepared as a solid fluorescent sensor with millimeter size. • The GQD/PS-AER sensor could detect Fe{sup 3+} ions selectively. • The GQD/PS-AER sensor could be reusable. • This method is simple and economical. - Abstract: A novel solid fluorescent sensor with millimeter size, based on graphene quantum dots/polystyrenic anion-exchange resin (GQDs/PS-AER) was obtained for the detection of Fe{sup 3+}. The linear response range of Fe{sup 3+} was obtained from 1 μM to 7 μM and the detection limit was as low as 0.65 μM. In addition, the sensor could be regenerated by adding complexing agent EDTA and be separated by using simple filtration.

  1. Exercício concorrente: análise do efeito agudo da ordem de execução sobre o gasto energético total

    OpenAIRE

    Panissa, Valéria Leme Gonçalves; Bertuzzi, Rômulo Cássio de Moraes; Lira, Fábio Santos; Júlio, Ursula Ferreira; Franchini, Emerson

    2009-01-01

    O objetivo do presente estudo foi analisar o efeito da ordem de execução dos exercícios de força e aeróbio sobre o gasto energético total na sessão. Para isso, dez homens tiveram seu consumo de oxigênio medido continuamente durante as seguintes sessões: aeróbio-força (AF) e força-aeróbio (FA). O exercício aeróbio consistiu de 30 minutos de corrida na esteira a 90% da velocidade do limiar anaeróbio. A sessão de força foi composta de quatro exercícios, na qual os participantes realizavam três s...

  2. Comparison of overnight, morning and 24-hour urine collections in the assessment of diabetic microalbuminuria

    DEFF Research Database (Denmark)

    Eshøj, O; Feldt-Rasmussen, B; Larsen, M L;

    1987-01-01

    overnight and morning urine samples. These values were slightly improved by relating AER to the excretion of creatinine and it is concluded that overnight as well as morning urine collections can be used when diagnosing microalbuminuria in insulin-dependent diabetics. Furthermore the results show...... that the albumin to creatinine ratio in morning urine is a reliable estimate of 24 h AER and better than measurement of the albumin concentration alone....

  3. A splice variant of CD44 expressed in the apical ectodermal ridge presents fibroblast growth factors to limb mesenchyme and is required for limb outgrowth

    OpenAIRE

    Sherman, Larry; Wainwright, David; Ponta, Helmut; Herrlich, Peter

    1998-01-01

    Signals from the apical ectodermal ridge (AER) of the developing vertebrate limb, including fibroblast growth factor-8 (FGF-8), can maintain limb mesenchymal cells in a proliferative state. We report here that a specific CD44 splice variant is crucial for the proliferation of these mesenchymal cells. Epitopes carried by this variant colocalize temporally and spatially with FGF-8 in the AER throughout early limb development. A splice variant containing the same sequences expressed on model cel...

  4. RRTMGP: A High-Performance Broadband Radiation Code for the Next Decade

    Science.gov (United States)

    2015-09-30

    the PI of this project, and his team at AER includes programmers with experience coding for modern computer architectures, including the recent GPU ...Supercomputer Center (CSCS) in Lugano will be developing a GPU version (OpenACC) of this code for use in the ICON LES model. This version will provide a...significant foundation for the GPU version of our code that is a deliverable for this project. Andre Wehe of AER will spend the first week in November

  5. O estilo de vida de pacientes hipertensos de um programa de exercício aeróbico: estudo na Cidade de Toluca, México El estilo de vida de pacientes hipertensos de un programa de ejercicio aerobio: estudio en la Ciudad de Toluca, México The life style of the hypertensive patient of a program of aerobic exercise: study in the Toluca City, Mexico

    Directory of Open Access Journals (Sweden)

    Cleotilde Garci Reza

    2008-06-01

    Full Text Available A hipertensão arterial, assintomática e desconhecida pela maioria dos seus por tadores, é importante fator de risco para complicações cardiovasculares e renais. Este é um estudo quantitativo e descritivo. Objetivou identificar os estilos de vida associados ao incremento do descontrole da pressão ar terial em pacientes hipertensos que acodem a um programa de exercício. A coleta dos dados ocorreu num centro de saúde do município do Toluca, México, durante agosto 2006 a março 2007. Foi utilizado um questionário aplicado a 200 pacientes hipertensos, através do referencial do "Modelo de Campo de Saúde da Lalonde". O estudo mostrou que o nível de pressão do grupo estudado possui relação estatisticamente significativa com o tabagismo, consumo de álcool e tratamento. A falta do controle da pressão arterial pode propiciar a evolução de doenças cardiovasculares e coronárias.La hipertensión arterial es asintomatica y desconocida por la mayorías de sus portadores y es un impor tante factor de riesgo para complicaciones cardiovasculares y renales. Este es un estudio cuantitativo y descriptivo. Con el objetivo de evaluar el estilo de vida de pacientes hiper tensos registrados en un programa de ejercicio aerobio. La colecta de los datos ocurrió en un centro de salud del municipio de Toluca, México, durante agosto de 2006 a marzo de 2007. Fue utilizado un cuestionario aplicado a 200 pacientes hiper tensos, a través del referencial del "Modelo Campo de Salud de Lalonde". El estudio muestra que existe relación estadística entre los niveles de presión ar terial, con el tabaquismo, consumo de alcohol, y el tratamiento. La falta del control de la presión arterial puede propiciar la evolución de enfermedades cardiovasculares y coronarias.Hypertension is an asymptomatic and an unnoticed disease for the majority of hypertensive individuals and an important long-term factor of risk for cardiovascular and renal complications. It is quantitative and descriptive study. The study aims to evaluate hypertenses’s lifestyles in a program of aerobic exercise. The collection of data was made in a health center of Mexico City, during the months of August in 2006 to March in 2007. A questionnaire was applied to 200 hypertenses, using the referencial framework of Lalonde: "Field of Health Model". The study showed the existing statistic relationship between the levels of arterial pressure, smoking habits, consumption of alcohol and the monitoring of their blood pressure condition. The lack of control of the ar terial pressure may propitiate the evolution of coronary and cardiovascular illnesses.

  6. Effects of caffeine (3 mg on maximal oxygen consumption, plasmatic lactate and reaction time after maximum effort. Efectos de la utilización de 3 mg de cafeína sobre los niveles de potencia aeróbica máxima, de lactato plasmático y del tiempo de reacción simple, ambos después de la realización de esfuerzo máximo.

    Directory of Open Access Journals (Sweden)

    Siqueira Rodrigues, André Valentim

    2006-10-01

    Full Text Available AbstractThe stimulants caffeine effects on sport performance have been widely investigated. The Maximal Oxygen Uptake (MOU has been used inrecent researches which aim to elucidate mechanisms of caffeine during maximal effort. As a physiological pattern to evaluate the effect of caffeine during the effort and after it (recovery, plasmatic lactate is presented in many studies. In this context, the present study aimed to investigate physiological changes: VO2 MAX on an ergometric device (speed and grade on a treadmill; plasmatic lactate (L and modification of cognitive and motor performance (Reaction Time Test - RTT produced by caffeine. Five apparently healthy volunteers (26 ± 5 years; 67 ± 12.5 kg were submitted twice to the following routine: plasmatic lactate at rest (L 0, reaction time test at rest RTT (R, maximum effort test on treadmill, plasmatic lactate concentrations at minute 1 (L 1, 2 (L 2 and 4 (L 3after effort, and RTT (1. They were given either one placebo capsule (400 mg corn starch or caffeine (3 mg/kg of body weight. Two-way ANOVA with repetition was used to compare variables at placebo (P and caffeine (C moments. The caffeine moment presented non-significant reduction in RRT, non-significant increase in plasmatic lactate and non-significant modification in VO2 MAX, when compared to placebo moment. Thus, one can conclude that 3 mg/kg/bw of caffeine with 12h of abstinence, presented non-significant effects in maximal oxygen uptake, plasmatic lactate and in simple reaction time.ResumenLos efectos estimulantes de la cafeína en el desarrollo atlético vienen siendo ampliamente investigados. El consumo Máximo de Oxígeno (VO2 MAX ha sido empleado en estudios recientes que buscan elucidar los mecanismos de la cafeína durante el esfuerzo máximo através de métodos neurológico así como fisiológicos. En este contexto, este estudio objetiva analizar las variaciones generadas por la cafeína en respuestas ergoespirométrica (VO2 MAX, plasmática (Lactato-L y motora (Test del Tiempo de Reacción – TTR. Para eso, 5 individuos hígidos, todos hombres, (26 ± 5 años, 67 ± 12,5 kg se sometieron dos veces a la siguiente rutina: dosaje de lactato plasmático (L0, TTR (0, test de esfuerzo máximo en estera ergométrica, dosaje de lactato (L1, (L2, (L3, y TTR(1. Les fue administrada una cápsula de 400 mg de placebo (almidón de maíz o 3 mg/kg/peso corpóreo (pc de cafeína. Fue empleada la ANOVA de dos factores con repetición para la comparación de las variables en los momentos C, P. El momento cafeína presentó reducción no significativa en el tiempo de reacción, en el lactato plasmático y en VO2 MAX. Así, se puede concluir que cafeína 3 mg/kg/pc con abstinencia de 12 h. no presenta efectos significativos en el consumo máximo de oxígeno, así como en la concentración de lactato plasmático y en el tiempo de reacción simple.

  7. Hipotensão pós-exercício em hipertensos submetidos ao exercício aeróbio de intensidades variadas e exercício de intensidade constante Hipotensión pós ejercicio en hipertensos sometidos a ejercicio aerobio de intensidades variadas y ejercicio de intensidad constante Post-exercise hypotension in hypertensive individuals submitted to aerobic exercises of alternated intensities and constant intensity-exercise

    Directory of Open Access Journals (Sweden)

    Gisela Arsa da Cunha

    2006-12-01

    Full Text Available O exercício agudo pode resultar em hipotensão pós-exercício (HPE, que tem sido observada em normotensos e hipertensos, especialmente após exercícios contínuos (intensidade baixa a moderada. O objetivo foi comparar os efeitos hipotensores de exercícios de intensidade variada (EIV e constante (EIC e verificar se EIV potencializa a HPE. Onze hipertensos (56,8 ± 2,6 anos; IMC = 26,5 ± 0,3kg/m² foram submetidos a teste ergométrico (TE e a duas sessões de exercícios submáximos em esteira (45 min, em dias distintos e com intervalo de 48h, sendo uma sessão de EIV alternando-se 2 min a 55,9 ± 2,6% e 1 min a 74,5 ± 4,0% da reserva de freqüência cardíaca (RFC e uma sessão de EIC a 60 ± 2,5% da RFC. Em ambas as sessões os participantes permaneciam em repouso por 10 min (rep para aferição da pressão arterial (PA e freqüência cardíaca (FC, e então executaram 5 min de aquecimento seguidos de 45 min de EIV ou EIC. A PA e a FC foram monitoradas a cada 5 min de exercício e aos 5, 10, 15, 30, 60, 90 e 120 min de recuperação pós-exercício (rec. ANOVA e teste t de Student evidenciaram HPE de pressão arterial sistólica (PAS após ambas as sessões (p El ejercicio agudo puede resultar en hipotensión pos ejercicio (HPE, que ha sido observada en normotensos e hipertensos, especialmente después de ejercicios continuos (intensidad baja a moderada. El objetivo ha sido comparar los efectos hipotensores de Ejercicios de Intensidad Variada (EIV y Constante (EIC y verificar si EIV potencia la HPE. Once hipertensos (56,8 ± 2,6 años; IMC 26,5 ± 0,3kg/m² fueron sometidos a test ergométrico (TE y a dos sesiones de ejercicios submáximos en cinta ergométrica (45 min, en días distintos y con intervalo de 48h, con una sesión de EIV alternándose 2 min a 55,9 ± 2,6% e 1 min a 74,5 ± 4,0% de la reserva de frecuencia cardíaca (RFC y una sesión de EIC a 60 ± 2,5% de RFC. En ambas sesiones, los participantes permanecían en reposo por 10 min (rep para medir la presión arterial (PA y frecuencia cardíaca (FC, y a 5 min de calentamiento seguidos de 45 min de EIV o EIC. La PA y la FC fueron monitoreadas a cada 5 min de ejercicio y también a los 5, 10, 15, 30, 60, 90 y 120 min de recuperación pos ejercicio (rec. ANOVA y test-t de Student evidenciaron HPE de presión arterial sistólica (PAS después de las dos sesiones (p Acute exercise may result in post-exercise hypotension (PEH, which has been observed both for normotensive and hypertensive individuals, especially after continuous exercise (low to moderate intensity. The purposes were to compare the hypotensive effects of continuous exercise performed with alternated (AI and constant intensities (CI and verify if AI is more effective on inducing PEH. Eleven hypertensive subjects (56.8 ± 2.6 years; BMI of 26.5 ± 0.3 kg/m² performed, on different days, an incremental test (IT and two submaximal exercise sessions (45 min on treadmill (AI and CI. The AI consisted of 2 min at 55.9 ± 2.6% and 1 min at 74.5 ± 4.0% of heart rate reserve (HRR while the CI consisted of 45 min at 60 ± 2.5% of HRR. On both sessions participants rested for 10 min before exercise for blood pressure (BP and heart rate (HR measurements and then performed a 5 min warm-up followed by 45 min of either AI or CI. BP and HR were monitored at each 5 min of exercise and at the 5th, 10th, 15th, 30th, 60th, 90th and 120th min of post-exercise recovery (rec. ANOVA and Student t-test evidenced PEH of systolic blood pressure (SBP after both sessions when compared to resting (p < 0.001 at all moments of rec with no differences between AI and CI. PEH of diastolic blood pressure (DBP was observed at the 5th, 10th, 15th and 30th min of rec after CI (p < 0.05, but not after AI. PEH of mean blood pressure (MBP was observed after CI and AI at all moments of rec. In spite of the similar PEH for SBP, the CI resulted in PEH of DBP, with longer reduction of MBP. No differences were observed between treatments for the absolute values of BP during the rec period. The authors conclude that the exercise intensities applied during AI did not induce additional hypotensive effects in relation to CI during the rec.

  8. Alkaloids extract of Retama monosperma (L.) Boiss. seeds used as novel eco-friendly inhibitor for carbon steel corrosion in 1 M HCl solution: Electrochemical and surface studies

    Science.gov (United States)

    El Hamdani, Naoual; Fdil, Rabiaa; Tourabi, Mustapha; Jama, Charafeddine; Bentiss, Fouad

    2015-12-01

    Current research efforts now focus on the development of non-toxic, inexpensive and environmentally friendly corrosion inhibitors as alternatives to different organic and non-organic compounds. In this field, alkaloids extract of Retama monosperma (L.) Boiss. seeds (AERS) was tested for the first time as corrosion inhibitor for carbon steel in 1 M HCl medium using electrochemical and surface characterization techniques. The obtained results showed that this plant extract's acts as an efficient corrosion inhibitor for carbon steel in 1 M HCl and an inhibition efficiency of 94.4% was reached with 400 mg/L of AERS at 30 °C. Ac impedance experimental data revealed a frequency distribution of the capacitance, simulated as constant phase element. Impedance results demonstrated that the addition of the AERS in the corrosive solution decreases the charge capacitance and simultaneously increases the function of the charge/discharge of the interface, facilitating the formation of an adsorbed layer over the steel surface. Polarization curves indicated that AERS is a mixed inhibitor. Adsorption of such alkaloid extract on the steel surface obeyed to the Langmuir adsorption isotherm. X-ray photoelectron spectroscopy (XPS) showed that the inhibition of steel corrosion in normal hydrochloric solution by AERS is mainly controlled by a physisorption process and the inhibitive layer is composed of an iron oxide/hydroxide mixture where AERS molecules are incorporated.

  9. The development of automatic emotion regulation in an implicit emotional Go/NoGo paradigm and the association with depressive symptoms and anhedonia during adolescence.

    Science.gov (United States)

    Zhang, Wenhai; Ding, Qiang; Chen, Ning; Wei, Qing; Zhao, Cancan; Zhang, Ping; Li, Xiying; Liu, Qiang; Li, Hong

    2016-01-01

    Impaired automatic emotion regulation (AER) is closely related to major depressive disorder. Our research in adults has identified two AER-related components, Go N2 and NoGo P3, in an implicit emotional Go/NoGo paradigm. However, it is unclear whether Go N2 and NoGo P3 reflect the development of AER in adolescents and the relationship of these components with subclinical depressive symptoms and trait anhedonia. We collected EEG data from 55 adolescents while they completed the implicit emotional Go/NoGo task. After the experiment, the subjects completed the Chinese version of the Temporal Experience of Pleasure Scale and the Beck Depression Inventory. Consistent with results in adults, we determined that Go N2 represents automatic top-down attention to emotions in Go trials, whereas NoGo P3 represents automatic response inhibition in NoGo trials. These AER components exhibited age-dependent improvement during adolescence. Additionally, NoGo P3 amplitudes elicited by viewing positive faces were positively correlated with trait anhedonia, whereas NoGo P3 amplitudes elicited by viewing negative faces were negatively correlated with depressive symptoms. Our observations provide further understanding of the neurodevelopmental mechanism of AER and yield new insight into dissociable impairments in AER in adolescents with major depressive disorder during positive and negative implicit processing.

  10. The development of automatic emotion regulation in an implicit emotional Go/NoGo paradigm and the association with depressive symptoms and anhedonia during adolescence

    Directory of Open Access Journals (Sweden)

    Wenhai Zhang

    2016-01-01

    Full Text Available Impaired automatic emotion regulation (AER is closely related to major depressive disorder. Our research in adults has identified two AER-related components, Go N2 and NoGo P3, in an implicit emotional Go/NoGo paradigm. However, it is unclear whether Go N2 and NoGo P3 reflect the development of AER in adolescents and the relationship of these components with subclinical depressive symptoms and trait anhedonia. We collected EEG data from 55 adolescents while they completed the implicit emotional Go/NoGo task. After the experiment, the subjects completed the Chinese version of the Temporal Experience of Pleasure Scale and the Beck Depression Inventory. Consistent with results in adults, we determined that Go N2 represents automatic top-down attention to emotions in Go trials, whereas NoGo P3 represents automatic response inhibition in NoGo trials. These AER components exhibited age-dependent improvement during adolescence. Additionally, NoGo P3 amplitudes elicited by viewing positive faces were positively correlated with trait anhedonia, whereas NoGo P3 amplitudes elicited by viewing negative faces were negatively correlated with depressive symptoms. Our observations provide further understanding of the neurodevelopmental mechanism of AER and yield new insight into dissociable impairments in AER in adolescents with major depressive disorder during positive and negative implicit processing.

  11. Aerobic exercise does not compromise muscle hypertrophy response to short-term resistance training.

    Science.gov (United States)

    Lundberg, Tommy R; Fernandez-Gonzalo, Rodrigo; Gustafsson, Thomas; Tesch, Per A

    2013-01-01

    This study tested the hypothesis that chronic aerobic and resistance exercise (AE+RE) would elicit greater muscle hypertrophy than resistance exercise only (RE). Ten men (25 ± 4 yr) performed 5 wk unilateral knee extensor AE+RE. The opposing limb was subjected to RE. AE completed 6 hr prior to RE consisted of ~45 min one-legged cycle ergometry. RE comprised 4 × 7 maximal concentric-eccentric knee extensions. Various indexes of in vivo knee extensor function were measured before and after training. Magnetic resonance imaging (MRI) assessed m. quadricep femoris (QF) cross-sectional area (CSA), volume, and signal intensity (SI). Biopsies obtained from m. vastus lateralis determined fiber CSA, enzyme levels, and gene expression of myostatin, atrogin-1, MuRF-1, PGC-1α, and VEGF. Increases (P 0.05). QF SI increased (12%; P < 0.05) after AE+RE, but not RE. Neither AE+RE nor RE showed altered mRNA levels. Citrate synthase activity increased (P < 0.05) after AE+RE. The results suggest that the increased aerobic capacity shown with AE+RE was accompanied by a more robust increase in muscle size compared with RE. Although this response was not carried over to greater improvement in muscle function, it remains that intense AE can be executed prior to RE without compromising performance outcome.

  12. Correlation between the distribution pattern of virulence genes and virulence of Aeromonas hydrophila strains

    Institute of Scientific and Technical Information of China (English)

    ZHU Daling; LI Aihua; WANG Jianguo; LI Ming; CAI Taozhen; HU Jing

    2007-01-01

    Nine strains of Aeromonas hydrophila isolated from diseased fish or soft-shelled tortoise were tested for the presence of three virulence genes including the genes encoding aerolysin,hemolysin,and extracellular serine protease (i.e.,aerA,hlyA,and ahpA,respectively).These genes were investigated using polymerase chain reaction (PCR)with specific primers for each gene.And the pathogenicities to Carrassius auratus ibebio of these strains were also assayed.PCR results demonstrated that the distribution patterns of aerA,hlyA,and ahpA were different in these strains.6/9 of A.hydrophila strains were aer A positive,8/9 of strains hly A positive,7/9 of strains ahp A positive,respectively.However,the assay for pathogenesis showed that two strains (A.hydrophila XS91-4-1 and C2)were strong virulent,two strains (A.hydrophila ST78-3-3 and 58-20-9)avirulent and the rest middle virulent was to the fish.In conclusion,there are significant correlation between the distribution pattern of the three virulence genes and the pathogenicity to Carrassius auratus ibebio.All strong virulent A.hydrophila strains were aerA+hlyA+ahpA+genotype,and all aerA+hlyA+ahpA+strains were virulent.Strains with the genotype of aerA-hlyA-ahpA+have middle pathogenicity.In the present study,we found for the first time that all A.hydrophila isolated from the ahpA positive were virulent to Carrassius auratus ibebio.Additionally,there was a positive correlation between the virulence of A.hydrophila and the presence of aerA and ahpA.

  13. On the scale estimation using truncated swath measurements from low Earth orbiting satellites

    Science.gov (United States)

    Liu, Qi

    2013-05-01

    Truncation effect caused by limited swath width of low Earth orbiting (LEO) satellites results in inevitable underestimation of object scale when using pixel-counting methods. A new approach is proposed to obtain more accurate object scale through truncated measurements. The approach is based upon the mean object area fraction (MOAF), which depicts the relative population of object points in a varying-size domain and proves to be less sensitive to truncation effect. The MOAF-equivalent radius (MER) is deduced by comparing the actual MOAF with the standard one inferred from a circle object. Numerical simulations are implemented to demonstrate the MER characteristics. In contrast to area-equivalent radius (AER) that is merely determined by the absolute amount of object points, MER relies on the overall spatial structure of the object. For objects with irregular shapes, the MER value is generally smaller than AER in the absence of truncation. Nevertheless, taking the actual AER as true scale, MER has significantly reduced biases compared to AER once the object is truncated. This advantage can be reinforced when focusing on size statistics of analogous objects, because negative and positive biases associated with various truncation situations coexist in MER, against the uniform negative biases of AER. When applied to MODIS cloud mask data that are restricted in individual granules, MER has consistently larger values than AER for most truncated clouds. Compared with the explicitly problematic estimation from AER due to truncation, MER offers a notable elevation on the estimated cloud size and gets closer to the truth.

  14. Enhanced Raman Scattering by Molecular Nanoaggregates

    Directory of Open Access Journals (Sweden)

    Daniel L. Akins

    2014-02-01

    Full Text Available The formation of a molecular aggregate in a confined, nanodimensioned region of space leads to what might be termed a ‘molecular nanoaggregate’. The present review deals with a theoretical formulation termed ‘aggregation-enhanced Raman scattering’ (AERS, and its use in discussion of relative Raman band intensities and selection rules for nanoaggregates. AERs represents a concept for discussion of nanoaggregates that is different from those provided by resonance Raman scattering, surface-enhanced Raman scattering and Mie scattering, all of which ignore the impact of aggregation of molecules on Raman scattering. Beyond the theoretical formulation behind the AERS phenomenon, also outlined in this review are representative samples of the publications of other authors and researchers using AERS to provide explanations for experimental findings. In addition to clarifying issues regarding the use of nanocomposites involving aggregated molecules, it is found that increasing use of AERS concepts is being made to rationalize Raman spectral observations in a range of other disciplines that fall in both the physical sciences and the medical fields.

  15. Annual Energy Review 2002

    Energy Technology Data Exchange (ETDEWEB)

    Seiferlein, Katherine E. [USDOE Energy Information Administration (EIA), Washington, DC (United States)

    2003-10-01

    The Annual Energy Review (AER) presents the Energy Information Administration’s historical energy statistics. For many series, statistics are given for every year from 1949 through 2002. The statistics, expressed in either physical units or British thermal units, cover all major energy activities, including consumption, production, trade, stocks, and prices, for all major energy commodities, including fossil fuels, electricity, and renewable energy sources. Publication of this report is required under Public Law 95–91 (Department of Energy Organization Act), Section 205(c), and is in keeping with responsibilities given to the Energy Information Administration (EIA) under Section 205(a)(2), which states: “The Administrator shall be responsible for carrying out a central, comprehensive, and unified energy data and information program which will collect, evaluate, assemble, analyze, and disseminate data and information....” The AER is intended for use by Members of Congress, Federal and State agencies, energy analysts, and the general public. EIA welcomes suggestions from readers regarding data series in the AER and in other EIA publications. Related Publication: Readers of the AER may also be interested in EIA’s Monthly Energy Review, which presents monthly updates of many of the data in the AER. Contact our National Energy Information Center for more information.

  16. Effect of short-term alkaline intervention on the performance of buffer-free single-chamber microbial fuel cell.

    Science.gov (United States)

    Yang, Na; Ren, Yueping; Li, Xiufen; Wang, Xinhua

    2017-06-01

    Anolyte acidification is a drawback restricting the electricity generation performance of the buffer-free microbial fuel cells (MFC). In this paper, a small amount of alkali-treated anion exchange resin (AER) was placed in front of the anode in the KCl mediated single-chamber MFC to slowly release hydroxyl ions (OH(-)) and neutralize the H(+) ions that are generated by the anodic reaction in two running cycles. This short-term alkaline intervention to the KCl anolyte has promoted the proliferation of electroactive Geobacter sp. and enhanced the self-buffering capacity of the KCl-AER-MFC. The pH of the KCl anolyte in the KCl-AER-MFC increased and became more stable in each running cycle compared with that of the KCl-MFC after the short-term alkaline intervention. The maximum power density (Pmax) of the KCl-AER-MFC increased from 307.5mW·m(-2) to 542.8mW·m(-2), slightly lower than that of the PBS-MFC (640.7mW·m(-2)). The coulombic efficiency (CE) of the KCl-AER-MFC increased from 54.1% to 61.2% which is already very close to that of the PBS-MFC (61.9%). The results in this paper indicate that short-term alkaline intervention to the anolyte is an effective strategy to further promote the performance of buffer-free MFCs.

  17. Polysaccharide-based silver nanoparticles synthesized by Klebsiella oxytoca DSM 29614 cause DNA fragmentation in E. coli cells.

    Science.gov (United States)

    Baldi, Franco; Daniele, Salvatore; Gallo, Michele; Paganelli, Stefano; Battistel, Dario; Piccolo, Oreste; Faleri, Claudia; Puglia, Anna Maria; Gallo, Giuseppe

    2016-04-01

    Silver nanoparticles (AgNPs), embedded into a specific exopolysaccharide (EPS), were produced by Klebsiella oxytoca DSM 29614 by adding AgNO3 to the cultures during exponential growth phase. In particular, under aerobic or anaerobic conditions, two types of silver nanoparticles, named AgNPs-EPS(aer) and the AgNPs-EPS(anaer), were produced respectively. The effects on bacterial cells was demonstrated by using Escherichia coli K12 and Kocuria rhizophila ATCC 9341 (ex Micrococcus luteus) as Gram-negative and Gram-positive tester strains, respectively. The best antimicrobial activity was observed for AgNPs-EPS(aer), in terms of minimum inhibitory concentrations and minimum bactericidal concentrations. Observations by transmission electron microscopy showed that the cell morphology of both tester strains changed during the exposition to AgNPs-EPS(aer). In particular, an electron-dense wrapped filament was observed in E. coli cytoplasm after 3 h of AgNPs-EPS(aer) exposition, apparently due to silver accumulation in DNA, and both E. coli and K. rhizophila cells were lysed after 18 h of exposure to AgNPs-EPS(aer). The DNA breakage in E. coli cells was confirmed by the comparison of 3-D fluorescence spectra fingerprints of DNA. Finally the accumulation of silver on DNA of E. coli was confirmed directly by a significant Ag(+) release from DNA, using the scanning electrochemical microscopy and the voltammetric determinations.

  18. Aggregate size and architecture determine biomass activity for one-stage partial nitritation and anammox

    DEFF Research Database (Denmark)

    Vlaeminck, S.; Terada, Akihiko; Smets, Barth F.

    2010-01-01

    In partial nitritation/anammox systems, aerobic and anoxic ammonium-oxidizing bacteria (AerAOB and AnAOB) remove ammonium from wastewater. In this process, large granular microbial aggregates enhance the performance, but little is known about this type of granulation so far. In this study......, aggregates of three reactors (A, B, C) with different inoculation and operation were studied. The test objectives were to quantify the AerAOB and AnAOB abundance and the activity balance for the different aggregate sizes, and to relate aggregate morphology, size distribution, and architecture putatively...... to the inoculation and operation of the reactors. Fluorescent in-situ hybridization (FISH) was applied on aggregate sections to quantify AerAOB and AnAOB, as well as to visualize the aggregate architecture. The activity balance of the aggregates was calculated as the nitrite accumulation rate ratio (NARR), i...

  19. The apical ectodermal ridge of the mouse model of ectrodactyly Dlx5;Dlx6-/- shows altered stratification and cell polarity, which are restored by exogenous Wnt5a ligand.

    Science.gov (United States)

    Conte, Daniele; Garaffo, Giulia; Lo Iacono, Nadia; Mantero, Stefano; Piccolo, Stefano; Cordenonsi, Michelangelo; Perez-Morga, David; Orecchia, Valeria; Poli, Valeria; Merlo, Giorgio R

    2016-02-15

    The congenital malformation split hand/foot (SHFM) is characterized by missing central fingers and dysmorphology or fusion of the remaining ones. Type-1 SHFM is linked to deletions/rearrangements of the DLX5-DLX6 locus and point mutations in the DLX5 gene. The ectrodactyly phenotype is reproduced in mice by the double knockout (DKO) of Dlx5 and Dlx6. During limb development, the apical ectodermal ridge (AER) is a key-signaling center responsible for early proximal-distal growth and patterning. In Dlx5;6 DKO hindlimbs, the central wedge of the AER loses multilayered organization and shows down-regulation of FGF8 and Dlx2. In search for the mechanism, we examined the non-canonical Wnt signaling, considering that Dwnt-5 is a target of distalless in Drosophila and the knockout of Wnt5, Ryk, Ror2 and Vangl2 in the mouse causes severe limb malformations. We found that in Dlx5;6 DKO limbs, the AER expresses lower levels of Wnt5a, shows scattered β-catenin responsive cells and altered basolateral and planar cell polarity (PCP). The addition of Wnt5a to cultured embryonic limbs restored the expression of AER markers and its stratification. Conversely, the inhibition of the PCP molecule c-jun N-terminal kinase caused a loss of AER marker expression. In vitro, the addition of Wnt5a on mixed primary cultures of embryonic ectoderm and mesenchyme was able to confer re-polarization. We conclude that the Dlx-related ectrodactyly defect is associated with the loss of basoapical and PCP, due to reduced Wnt5a expression and that the restoration of the Wnt5a level is sufficient to partially reverts AER misorganization and dysmorphology.

  20. Ion-exchange selectivity of diclofenac, ibuprofen, ketoprofen, and naproxen in ureolyzed human urine.

    Science.gov (United States)

    Landry, Kelly A; Sun, Peizhe; Huang, Ching-Hua; Boyer, Treavor H

    2015-01-01

    This research advances the knowledge of ion-exchange of four non-steroidal anti-inflammatory drugs (NSAIDs) - diclofenac (DCF), ibuprofen (IBP), ketoprofen (KTP), and naproxen (NPX) - and one analgesic drug-paracetamol (PCM) - by strong-base anion exchange resin (AER) in synthetic ureolyzed urine. Freundlich, Langmuir, Dubinin-Astakhov, and Dubinin-Radushkevich isotherm models were fit to experimental equilibrium data using nonlinear least squares method. Favorable ion-exchange was observed for DCF, KTP, and NPX, whereas unfavorable ion-exchange was observed for IBP and PCM. The ion-exchange selectivity of the AER was enhanced by van der Waals interactions between the pharmaceutical and AER as well as the hydrophobicity of the pharmaceutical. For instance, the high selectivity of the AER for DCF was due to the combination of Coulombic interactions between quaternary ammonium functional group of resin and carboxylate functional group of DCF, van der Waals interactions between polystyrene resin matrix and benzene rings of DCF, and possibly hydrogen bonding between dimethylethanol amine functional group side chain and carboxylate and amine functional groups of DCF. Based on analysis of covariance, the presence of multiple pharmaceuticals did not have a significant effect on ion-exchange removal when the NSAIDs were combined in solution. The AER reached saturation of the pharmaceuticals in a continuous-flow column at varying bed volumes following a decreasing order of DCF > NPX ≈ KTP > IBP. Complete regeneration of the column was achieved using a 5% (m/m) NaCl, equal-volume water-methanol solution. Results from multiple treatment and regeneration cycles provide insight into the practical application of pharmaceutical ion-exchange in ureolyzed urine using AER.

  1. Fast vision through frameless event-based sensing and convolutional processing: application to texture recognition.

    Science.gov (United States)

    Perez-Carrasco, Jose Antonio; Acha, Begona; Serrano, Carmen; Camunas-Mesa, Luis; Serrano-Gotarredona, Teresa; Linares-Barranco, Bernabe

    2010-04-01

    Address-event representation (AER) is an emergent hardware technology which shows a high potential for providing in the near future a solid technological substrate for emulating brain-like processing structures. When used for vision, AER sensors and processors are not restricted to capturing and processing still image frames, as in commercial frame-based video technology, but sense and process visual information in a pixel-level event-based frameless manner. As a result, vision processing is practically simultaneous to vision sensing, since there is no need to wait for sensing full frames. Also, only meaningful information is sensed, communicated, and processed. Of special interest for brain-like vision processing are some already reported AER convolutional chips, which have revealed a very high computational throughput as well as the possibility of assembling large convolutional neural networks in a modular fashion. It is expected that in a near future we may witness the appearance of large scale convolutional neural networks with hundreds or thousands of individual modules. In the meantime, some research is needed to investigate how to assemble and configure such large scale convolutional networks for specific applications. In this paper, we analyze AER spiking convolutional neural networks for texture recognition hardware applications. Based on the performance figures of already available individual AER convolution chips, we emulate large scale networks using a custom made event-based behavioral simulator. We have developed a new event-based processing architecture that emulates with AER hardware Manjunath's frame-based feature recognition software algorithm, and have analyzed its performance using our behavioral simulator. Recognition rate performance is not degraded. However, regarding speed, we show that recognition can be achieved before an equivalent frame is fully sensed and transmitted.

  2. Amusia and protolanguage impairments in schizophrenia

    Science.gov (United States)

    Kantrowitz, J. T.; Scaramello, N.; Jakubovitz, A.; Lehrfeld, J. M.; Laukka, P.; Elfenbein, H. A.; Silipo, G.; Javitt, D. C.

    2017-01-01

    Background Both language and music are thought to have evolved from a musical protolanguage that communicated social information, including emotion. Individuals with perceptual music disorders (amusia) show deficits in auditory emotion recognition (AER). Although auditory perceptual deficits have been studied in schizophrenia, their relationship with musical/protolinguistic competence has not previously been assessed. Method Musical ability was assessed in 31 schizophrenia/schizo-affective patients and 44 healthy controls using the Montreal Battery for Evaluation of Amusia (MBEA). AER was assessed using a novel battery in which actors provided portrayals of five separate emotions. The Disorganization factor of the Positive and Negative Syndrome Scale (PANSS) was used as a proxy for language/thought disorder and the MATRICS Consensus Cognitive Battery (MCCB) was used to assess cognition. Results Highly significant deficits were seen between patients and controls across auditory tasks (p<0.001). Moreover, significant differences were seen in AER between the amusia and intact music-perceiving groups, which remained significant after controlling for group status and education. Correlations with AER were specific to the melody domain, and correlations between protolanguage (melody domain) and language were independent of overall cognition. Discussion This is the first study to document a specific relationship between amusia, AER and thought disorder, suggesting a shared linguistic/protolinguistic impairment. Once amusia was considered, other cognitive factors were no longer significant predictors of AER, suggesting that musical ability in general and melodic discrimination ability in particular may be crucial targets for treatment development and cognitive remediation in schizophrenia. PMID:25066878

  3. CARACTERÍSTICAS ESPECIAIS DA GINÁSTICA DE ACADEMIA NO SEU PROCESSO EVOLUTIVO NO BRASIL

    Directory of Open Access Journals (Sweden)

    Sandra Barbosa da Costa

    2008-07-01

    Full Text Available O objetivo do presente trabalho é descrever criticamente a evolução da ginástica de academia a partir do surgimento da dança aeróbica nos Estados Unidos da América (EUA, na década de 70. Para tanto, foi utilizada a análise documental e a revisão de literatura como procedimentos denominados "Gerações da Ginástica Aeróbica". A Dança Aeróbica, versão antecessora da Ginástica Aeróbica, surgiu nos EUA com a bailarina Jacki Sorensen, como uma forma alternativa de aquisição de condicionamento cardiovascular. Esta atividade associava rítmico-musicalmente saltos e deslocamentos aproveitando elementos coreográficos da Dança. Movimentos que posteriormente passariam a ser substituídos por exercícios calistênicos, paulatinamente, introduzidos por Professores de Educação Física e artistas como Jane Fonda, transformando, assim, a dança aeróbica em ginástica aeróbica (GA. Além das características técnicas que permearam o desenvolvimento da GA, abordamos também, neste trabalho, as implicações individuais e sociais desta disciplina, devido ao fato de ela estar diretamente ligada à reprodução de valores de consumo da sociedade capitalista. Consumismo, culto ao corpo, individualismo e narcisismo são algumas das conseqüências contraditórias que marcaram seu desenvolvimento no Brasil e no mundo.

  4. Annual Energy Review 2010

    Energy Technology Data Exchange (ETDEWEB)

    None

    2011-10-01

    This twenty-ninth edition of the Annual Energy Review (AER) presents the U.S. Energy Information Administration’s (EIA) most comprehensive look at integrated energy statistics. The summary statistics on the Nation’s energy production, consumption, trade, stocks, and prices cover all major energy commodities and all energy-consuming sectors of the U.S. economy from 1949 through 2010. The AER is EIA’s historical record of energy statistics and, because the coverage spans six decades, the statistics in this report are well-suited to long-term trend analysis.

  5. Efeito do treinamento físico de natação sobre a resposta vasomotora arterial em ratos espontaneamente hipertensos: papel das espécies reativas de oxigênio e de nitrogênio

    OpenAIRE

    Camila Paixão Jordão

    2010-01-01

    Estudos demonstram o envolvimento do superóxido vascular (O-2) na hipertensão arterial, associado à menor vasodilatação, decorrente da redução na biodisponibilidade de óxido nitrico (NO). O treinamento físico (TF) aeróbio tem sido mostrado eficiente em diminuir a pressão arterial em hipertensos, associado a melhora da função endotelial. Entretanto, os mecanismos pelos quais o TF modula a vasomotricidade não são completamente conhecidos. O Objetivo foi avaliar o efeito TF aeróbio (natação, 10 ...

  6. The Nitrogen Balance of Three Long-term Agroecosystems on a Boreal Soil in Western Canada

    Energy Technology Data Exchange (ETDEWEB)

    Ross, Shirley M.; Izaurralde, Roberto C.; Janzen, H. H.; Robertson, J. A.; Mcgill, William B.

    2008-09-01

    Nitrogen (N) budgets can be used to quantify the flows of N in agroecosystems and to account for differences in losses and retention of N. The objective of our study was to develop 24-year N budgets for three diverse cropping systems on a boreal soil at Breton, Alberta, Canada: AER an agroecological 8-year rotation, with N inputs from legumes [fababean (Vicia faba L.), red clover (Trifolium pratense L.), alfalfa (Medicago sativa L.)] and manure; CF - a continuous perennial grass legume forage system, with N inputs from fertilizer (18 kg N ha-1 yr-1) and white clover (Trifolium repens L.); and CG - a continuous annual grain system, with N fertilizer (90 kg N ha-1 yr-1). We were able to compile detailed N budgets, demonstrate accumulation of soil N, and attribute differences in N flow and permanence to treatment effects. For AER and CG, net inputs almost exactlymatched gains in soil N. The AER system had the highest N flow and the largest net N accumulation. Soil total N mass to 30 cm depth increased in all systems during 1980 2005, but increases were smaller in CG (0.59 Mg N ha-1) than in AER (1.90 Mg N ha-1) and CF (1.63 Mg N ha-1), showing the effect of legumes, perennial species, and manure in the latter systems. The proportion of total N inputs retained as soil N with organic N inputs in AER (44%) was about twice that with synthetic N fertilizer in CG (23%). The CF system had the lowest productivity and the least N loss to the environment (4 kg N ha-1 yr-1, compared to 28 for AER and 24 for CG). The proportion of N inputs lost to the environment was 16% for AER and 24% for CG. In CF, gains of soil N exceeded apparent net N inputs, perhaps because we under-estimated N inputs from clover. Estimate of legume N input was one of the larger sources of uncertainty. The study affirmed the value of N budgets in evaluating agroecosystem performance, and identified AER and CF as productive and sustainable systems due to their minimal reliance on external N inputs and small

  7. Congenital malformations of the flipper in three West Indian manatees, Trichechus manatus, and a proposed mechanism for development of ectrodactyly and cleft hand in mammals.

    Science.gov (United States)

    Watson, A G; Bonde, R K

    1986-01-01

    Three cases of congenital ectrodactyly of the flipper in the manatee are described, including one case of bilaterally-symmetrical cleft hand. A hypothesis assumes that a defect in the apical ectodermal ridge (AER) in the developing hand plate of the early embryo is the initiating factor in the development of ectrodactylous and cleft hand malformations in man and other mammals. Variations in the site, extent, and time of the AER defect will account for many of the morphologic variations observed in these congenital malformations.

  8. Hydrogen Environment Assisted Cracking of Ultra-High Strength AetMet(Trademark) 100 Steel

    Science.gov (United States)

    2006-01-01

    strength alloys[17] and at the region of maximum crack tip hydrostatic tension for IIAC[871. Traditional UIISS such as AISI 4340 and 300M are particularly...of 1725 MNPa[21藁. Despite these advances, AerMetTM 100 is susceptible to HAC comparable to older UHSSfI 8󈧝- 301 . For example, IRAC of AerMetTM 100...older UHSSs such as AISI 4340, 18Ni Maraging and 300M show severe IG HEAC for a wide range of composition, thermal treatment and environmental

  9. Avaliação ergoespirométrica em atleta paraolímpico de esqui alpino: estudo de caso = Cardiopulmonary exercise test on a treadmill for a paralympic alpine skiing athlete: case study

    Directory of Open Access Journals (Sweden)

    Vinagre, Nelson Alexandre Campos

    2012-01-01

    Conclusões: O esquiador pôde responder ao procedimento de diferentes cargas durante o teste. No teste aplicado o atleta tem que aprender a gerenciar sua resistência, força e capacidades coordenativas. A avaliação da capacidade aeróbica poderá ajudar o desempenho durante o treinamento e competições, visto que os atletas devem dividir sua atenção com uma gama de exigências que juntas são atendidas em grande parte pelo sistema aeróbio

  10. Indoor air quality in passive and conventional new houses in Sweden

    DEFF Research Database (Denmark)

    Langer, Sarka; Bekö, Gabriel; Bloom, Erica;

    2015-01-01

    flora were measured. Air exchange rates (AER) were estimated from the CO2 concentrations measured in the bedrooms. The median AER was slightly higher in the passive houses than in the conventional ones (0.68h-1 vs. 0.60h-1). The median concentrations in the passive and the conventional buildings were 10...... sources of formaldehyde may have been more pronounced in the conventional houses. In contrast to the passive houses, the indoor microbiological flora indicated possible mould or moisture problems in six (29%) of the conventionally built houses. When compared with the results previously reported...

  11. Measurement and ALE3D Simulation of Violence in a Deflagration Experiment With LX-10 and Aermet-100 Alloy

    Energy Technology Data Exchange (ETDEWEB)

    Knap, J; McClelland, M A; Maienschein, J L; Howard, W M; Nichols, A L; deHaven, M R; Strand, O T

    2006-06-22

    We describe the results of a Scaled-Thermal-Explosion-eXperiment (STEX) for LX-10 (94.7 % HMX, 5.3 % Viton A) confined in an AerMet 100 (iron-cobalt-nickel alloy) tube with reinforced end caps. The experimental measurements are compared with predictions of an Arbitrary-Lagrangian-Eulerian (ALE3D) computer model. ALE3D is a three-dimensional multi-physics computer code capable of solving coupled equations describing thermal, mechanical and chemical behavior of materials. In particular, we focus on the processes linked to fracture and fragmentation of the AerMet tube driven by the LX-10 deflagration.

  12. OS EFEITOS DO EXERCÍCIO AERÓBICO NO TRATAMENTO DO DIABETES MELLITUS TIPOS 1 E 2

    OpenAIRE

    da Silva Neto, João Henrique; Ex-aluno do Centro Universitário La Salle; Marques Toigo, Adriana

    2013-01-01

    O objetivo desse estudo foi revisar na literatura os efeitos do exercício aeróbico (especialmente na modalidade de dança) no tratamento do diabetes mellitus tipo 1 e tipo 2, apresentando resultados obtidos em pesquisa nacionais e internacionais. Inicialmente foram abordados aspectos conceituais sobre o diabetes mellitus tipos 1 e 2. Em seguida, verificou-se como o exercício aeróbico vem sendo utilizado como tratamento do diabetes e quais são seus benefícios em relação aos índices glicêmicos e...

  13. Annual Energy Review, 2008

    Energy Technology Data Exchange (ETDEWEB)

    None

    2009-06-01

    The Annual Energy Review (AER) is the Energy Information Administration's (EIA) primary report of annual historical energy statistics. For many series, data begin with the year 1949. Included are statistics on total energy production, consumption, trade, and energy prices; overviews of petroleum, natural gas, coal, electricity, nuclear energy, renewable energy, and international energy; financial and environment indicators; and data unit conversions.

  14. Proceedings of the Cloud Impacts on DoD Operations and Systems 1993 Conference (CIDOS - 93) Held in Fort Belvoir, Virginia on 16-19 November 1993

    Science.gov (United States)

    1994-07-01

    Ahmadjian, M., et al., (1990) for a hardware description, and Alpert , J.R., (1993) for a review of current status. Fortunately, this instrument...Jean Francois Louis, Larry Knowlton, and Jeanne Sparrow at AER. This research was supported by the U.S. Air Force Systems Command under contact

  15. Air bubble-induced detachment of positively and negatively charged polystyrene particles from collector surfaces in a parallel-plate flow chamber

    NARCIS (Netherlands)

    Gomez-Suarez, C; Van der Mei, HC; Busscher, HJ

    2000-01-01

    Electrostatic interactions between colloidal particles and collector surfaces were found tcr be important in particle detachment as induced by the passage of air bubbles in a parallel-plate Row chamber. Electrostatic interactions between adhering particles and passing air bubbles, however, a-ere fou

  16. Social Support as a Moderator for Alcohol-Related Partner Aggression during the Transition to Parenthood

    Science.gov (United States)

    Caldeira, Valerie; Woodin, Erica M.

    2012-01-01

    Alcohol-related partnAer aggression is a pervasive social problem throughout various life stages, including the transition to parenthood. Previous research shows that alcohol use is associated with partner aggression perpetration for both men and women; however, not all individuals who consume alcohol act aggressively. In this study, the…

  17. Do time-averaged, whole-building, effective volatile organic compound (VOC) emissions depend on the air exchange rate? A statistical analysis of trends for 46 VOCs in U.S. offices.

    Science.gov (United States)

    Rackes, A; Waring, M S

    2016-08-01

    We used existing data to develop distributions of time-averaged air exchange rates (AER), whole-building 'effective' emission rates of volatile organic compounds (VOC), and other variables for use in Monte Carlo analyses of U.S. offices. With these, we explored whether long-term VOC emission rates were related to the AER over the sector, as has been observed in the short term for some VOCs in single buildings. We fit and compared two statistical models to the data. In the independent emissions model (IEM), emissions were unaffected by other variables, while in the dependent emissions model (DEM), emissions responded to the AER via coupling through a conceptual boundary layer between the air and a lumped emission source. For 20 of 46 VOCs, the DEM was preferable to the IEM and emission rates, though variable, were higher in buildings with higher AERs. Most oxygenated VOCs and some alkanes were well fit by the DEM, while nearly all aromatics and halocarbons were independent. Trends by vapor pressure suggested multiple mechanisms could be involved. The factors of temperature, relative humidity, and building age were almost never associated with effective emission rates. Our findings suggest that effective emissions in real commercial buildings will be difficult to predict from deterministic experiments or models.

  18. Development and Evaluation of a New Air Exchange Rate Algorithm for the Stochastic Human Exposure and Dose Simulation Model

    Science.gov (United States)

    between-home and between-city variability in residential pollutant infiltration. This is likely a result of differences in home ventilation, or air exchange rates (AER). The Stochastic Human Exposure and Dose Simulation (SHEDS) model is a population exposure model that uses a pro...

  19. Single-walled carbon nanotubes as delivery vehicles enhance the immunoprotective effects of a recombinant vaccine against Aeromonas hydrophila.

    Science.gov (United States)

    Gong, Yu-Xin; Zhu, Bin; Liu, Guang-Lu; Liu, Lei; Ling, Fei; Wang, Gao-Xue; Xu, Xin-Gang

    2015-01-01

    To reduce the economic losses caused by diseases in aquaculture industry, more efficient and economic prophylactic measures should be urgently investigated. In this research, the effects of a novel functionalized single-walled carbon nanotubes (SWCNTs) applied as a delivery vehicle for recombinant Aeromonas hydrophila vaccine administration via bath or injection in juvenile grass carp were studied. The results showed that SWCNT as a vector for the recombinant protein aerA, augmented the production of specific antibodies, apparently stimulated the induction of immune-related genes, and induced higher level of survival rate compared with free aerA subunit vaccine. Furthermore, we compared the routes of bath and intramuscular injection immunization by SWCNTs-aerA vaccine, and found that similar antibody levels induced by SWCNTs-aerA were observed in both immunization routes. Meanwhile, a similar relative percentage survival (approximately 80%) was found in both a 40 mg/L bath immunization group, and a 20 μg injection group. The results indicate that functionalized SWCNTs could be a promising delivery vehicle to potentiate the immune response of recombinant vaccines, and might be used to vaccinate juvenile fish by bath administration method.

  20. Air exchange rates and alternative vapor entry pathways to inform vapor intrusion exposure risk assessments.

    Science.gov (United States)

    Reichman, Rivka; Roghani, Mohammadyousef; Willett, Evan J; Shirazi, Elham; Pennell, Kelly G

    2016-11-12

    Vapor intrusion (VI) is a term used to describe indoor air (IA) contamination that occurs due to the migration of chemical vapors in the soil and groundwater. The overall vapor transport process depends on several factors such as contaminant source characteristics, subsurface conditions, building characteristics, and general site conditions. However, the classic VI conceptual model does not adequately account for the physics of airflow around and inside a building and does not account for chemical emissions from alternative "preferential" pathways (e.g. sewers and other utility connections) into IA spaces. This mini-review provides information about recent research related to building air exchange rates (AERs) and alternative pathways to improve the accuracy of VI exposure risk assessment practices. First, results from a recently published AER study for residential homes across the United States (US) are presented and compared to AERs recommended by the US Environmental Protection Agency (USEPA). The comparison shows considerable differences in AERs when season, location, building age, and other factors are considered. These differences could directly impact VI assessments by influencing IA concentration measurements. Second, a conceptual model for sewer gas entry into buildings is presented and a summary of published field studies is reported. The results of the field studies suggest that alternative pathways for vapors to enter indoor spaces warrant consideration. Ultimately, the information presented in this mini-review can be incorporated into a multiple-lines-of-evidence approach for assessing site-specific VI exposure risks.

  1. 76 FR 57060 - International Cooperation on Harmonisation of Technical Requirements for Registration of...

    Science.gov (United States)

    2011-09-15

    ... Requirements for Registration of Veterinary Medicinal Products; Draft Guidance for Industry on... announcing the availability of a draft guidance for industry ( 214) entitled ``Draft Guidance for Industry... transmit data elements for submission of adverse event reports (AERs) to all member regions....

  2. Steady exercise removes VO(2max) difference between mitochondrial genomic variants.

    Science.gov (United States)

    Marcuello, Ana; Martínez-Redondo, Diana; Dahmani, Yahya; Terreros, José L; Aragonés, Teresa; Casajús, José A; Echavarri, José M; Quílez, Julia; Montoya, Julio; López-Pérez, Manuel J; Díez-Sánchez, Carmen

    2009-09-01

    It has been clearly established that mitochondrial variants, among other potential factors, influence on VO(2max). With this study we sought to determine whether this genetic predisposition could be modified by steady exercise. Mitochondrial genetic variants were determined in 70 healthy controls (CON) and in 77 athletes who trained regularly (50 cyclists, aerobic training (AER), and 27 runners of 400m, anaerobic training (NoAER)). All of them were male Spanish Caucasian individuals. A maximum graded exercise test (GXT) in cycle-ergometer was performed to determine VO(2max) (mL kg(-1)min(-1)). Our results confirmed that, in CON, VO(2max) (P=0.007) was higher in Non-J than J individuals. Furthermore, we found that AER and NoAER showed, as it could be expected, higher VO(2max) than CON, but not differences between mitochondrial variants have been found. According with these findings, the influence of mitochondrial DNA (mtDNA) variants on VO(2max) has been confirmed, and a new conclusion has arisen: the steady exercise is able to remove this influence. The interest of these promising findings in muscular performance should be further explored, in particular, the understanding of potential applications in sport training and in muscle pathological syndromes.

  3. AcEST: BP916178 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ribosomal protein S20 OS=Nitrobacter ha... 31 3.3 sp|Q9I2Q2|METH_PSEAE Methionine synthase OS=Pseudomonas a...KGDRDAAIQAMKRAEPE 57 >sp|Q9I2Q2|METH_PSEAE Methionine synthase OS=Pseudomonas aer

  4. Publii papinii statii thebaidos : Liber Secundus commentario exegetico aesthetique instructus

    NARCIS (Netherlands)

    Mulder, Heine Melle

    1954-01-01

    Interea gelidis Maia satus aliger umbris iussa gerens magni remeat Iovis; undique pigrae ire vetant nubes et turbidus inplicat aer, nec zephyri rapuere gradum, sed foeda silentis aura poli. Styx inde novem circumflua campis, hinc obiecta vias torrentum incendia cludunt. Zie: hoofdstuk 1

  5. Development of a novel, sensitive amperometric-FIA glucose biosensor by packing up the amperometric cell with glucose oxidase modified anion exchange resin.

    Science.gov (United States)

    Su, Yuhua; Huang, Weixiong; Hu, Rongzong; Ding, Haodong; Hu, Kangkang

    2009-04-15

    In this work, the anion exchange resin (AER) was modified with a layer of glucose oxidase (GOD) and poly(diallyldimethylammonium chloride) (PDDA), respectively, via layer-by-layer electrostatic self-assembling strategy. The PDDA and GOD modified AER (PDDA/GOD/AER) was then packed into a home-made amperometric cell for flow injection analysis (FIA) of glucose. This design simplified the setup by integrating the enzyme reactor into the amperometric cell. And the AER in the cell behaved bifunctional, it was not only the support of enzymes, but also an anti-interference tool due to its retention effect toward ascorbic acid (AA) and uric acid (UA). A platinum modified porous titanium (Pt/PTi) electrode was utilized in the cell as the working electrode (WE), due to its large effective surface area it could increase the response by 8.3 times as compared with the planar pure platinum electrode. The proposed biosensor was very sensitive (22.4 microA cm(-2) mM(-1)) in glucose quantification, and the linear range was from 1 micromol L(-1) to 2 mmol L(-1) with the detection limit of 0.8 micromol L(-1). The biosensor was used for serum glucose determination, and the result obtained was satisfying. This work may have provided a reference design of the amperometric cell which could be adopted in other enzymatic-FIA biosensors.

  6. Experimental Investigation on Increasing Milling Tool Life by Variable Cutting Depth Manufacturing%利用变切深法提高铣刀耐用度的实验研究

    Institute of Scientific and Technical Information of China (English)

    袁野; 杨后川; 崔季

    2013-01-01

    采用涂层硬质合金刀具对Aer Metl00超高强度钢和TB6钛合金分别进行固定切深和变切深铣削实验,对比分析了固定切深和变切深两种铣削方式对刀具耐用度的影响.结果表明:固定切深产生边界磨损,而变切深产生均匀磨损,采用变切深方法加工Aer Met100钢和TB6钛合金,提高刀具的耐用度可提高50%以上.%Two different milling experiments (fixed cutting depth and variable cutting depth) on Aer Met 100 super high strength steel and TB6 titanium alloy are carried out by using coated cemented carbide tools. The effects on tool life by fixed depth cutting and variable depth cutting are analyzed. The results show that the boundary wear appears when the fixed cutting depth is used, while the u-niform wear appears when the variable cutting depth is used. The variable cutting depth is applied to milling Aer Met 100 steel and TB6 titanium alloy, the tool life can be improved more than 50%.

  7. Aerosol optical depth retrieval in the Arctic region using MODIS data over snow

    NARCIS (Netherlands)

    Mei, L.; Xue, Y.; Leeuw, G. de; Hoyningen-Huene, W. von; Kokhanovsky, A.A.; Istomina, L.; Guang, J.; Burrows, J.P.

    2013-01-01

    The Arctic is vulnerable to the long-term transport of aerosols because they affect the surface albedo when particles are deposited on snow and ice. However, aerosol observations for this area are sparse and hence there is considerable uncertainty in the knowledge on the properties of the Arctic aer

  8. Annual International Conference on Aging Aircraft (2nd) Held in Baltimore, Maryland on 3-5 October 1989

    Science.gov (United States)

    1990-02-01

    we had corrosion is intergranular corrosion (exfolia- a lot of corrosion of spar cords, webs and wing tion), where a lot of the structure is rendered...3135 Brasilia 70045, Brazil 609-896-2255 212-340-0200 Clifford H. Wells A.C.V. Victorazzo Failure Analysis Association, Inc. Embraer- Empresa Bras.Aer

  9. The Arts and Australian Education: Realising Potential. Australian Education Review No. 58

    Science.gov (United States)

    Ewing, Robyn

    2011-01-01

    Australian Education Review (AER) 58 surveys the international and national research on the role and effect of arts-rich programming in schools and in the broader community, and examines the policies and practices that inhibit or support these initiatives. It puts the case that embedding the Arts in learning would be a powerful catalyst for…

  10. Complete Genome Sequences of Aerococcus christensenii CCUG 28831T, Aerococcus sanguinicola CCUG 43001T, Aerococcus urinae CCUG 36881T, Aerococcus urinaeequi CCUG 28094T, Aerococcus urinaehominis CCUG 42038 BT, and Aerococcus viridans CCUG 4311T

    DEFF Research Database (Denmark)

    Carkaci, Derya; Dargis, Rimtas; Nielsen, Xiaohui Chen;

    2016-01-01

    Strains belonging to the genus Aerococcus are causative agents of human and animal infections, including urogenital infections, bacteremia/septicemia, and infective endocarditis. This study reports the first fully closed and complete genome sequences of six type strains belonging to the genus Aer...... Aerococcus using a combination of Illumina HiSeq and PacBio sequencing technologies...

  11. Oito semanas de treinamento intervalado na doença vascular periférica: um estudo de caso = Eight weeks of interval training on the peripheral vascular disease: a case study

    Directory of Open Access Journals (Sweden)

    Campos, Tiago Pereira

    2015-01-01

    Conclusão: O treinamento intervalado associado ao treinamento de força melhorou a capacidade aeróbia e anaeróbia do paciente, e pode ser uma boa alternativa para o tratamento da doença vascular periférica

  12. 22 CFR 211.3 - Cooperating sponsor agreements; program procedure.

    Science.gov (United States)

    2010-04-01

    ... proposed. AID/W's approval of and signature on the AER completes this decision process. (ii) Individual programs. The other basic pattern of decision making results in a Transfer Authorization. The TA is used... submission to AID/W, a decision must be made on a proposal submitted by a private voluntary organization...

  13. Improving the toughness of ultrahigh strength steel

    Energy Technology Data Exchange (ETDEWEB)

    Soto, Koji

    2002-08-15

    The ideal structural steel combines high strength with high fracture toughness. This dissertation discusses the toughening mechanism of the Fe/Co/Ni/Cr/Mo/C steel, AerMet 100, which has the highest toughness/strength combination among all commercial ultrahigh strength steels. The possibility of improving the toughness of this steel was examined by considering several relevant factors.

  14. The implications of the Irish air travel tax

    NARCIS (Netherlands)

    J. Veldhuis; J. Zuidberg

    2009-01-01

    Aer Lingus, Ryanair and CityJet (the ‘Airlines’) are currently endeavouring to persuade the Irish Government to withdraw the Irish Air Travel Tax (ATT), which has applied to flights out of Ireland since 30 March 2009. The Airlines have commissioned "Amsterdam Aviation Economics" (part of SEO Economi

  15. Impact of low-dose acetylsalicylic acid on kidney function in type 2 diabetic patients with elevated urinary albumin excretion rate

    DEFF Research Database (Denmark)

    Gaede, Peter; Hansen, Henrik Post; Parving, Hans-Henrik

    2003-01-01

    Low-dose treatment with acetylsalicylic acid (ASA) is widely recommended to type 2 diabetic patients as primary prevention against cardiovascular disease. High-dose treatment with cyclooxygenase inhibitors reduces urinary albumin excretion rate (AER) in type 1 diabetic patients with micro...

  16. Workload demand in police officers during mountain bike patrols

    NARCIS (Netherlands)

    Takken, T.; Ribbink, A.; Heneweer, H.; Moolenaar, H.; Wittink, H.

    2009-01-01

    To the authors' knowledge this is the first paper that has used the training impulse (TRIMP) 'methodology' to calculate workload demand. It is believed that this is a promising method to calculate workload in a range of professions in order to understand the relationship between work demands and aer

  17. Burlington Northern Taconite Transshipment Facility, Duluth-Superior Harbor, Superior Wisconsin. Environmental Assessment Report.

    Science.gov (United States)

    1975-03-01

    TECHNICAL APPENDIX I nt rodWc tua Bentiro, (Macr,,inverc terates) ar i:1nprtant mtnt-mers ro .e aquat i food web. The taxonomi qroups ,jhi ch art, most...13. Tribelos sp- 57 Mollusca ’ Gas tropoda Anmni.cola sp. -- 115 1120- Physa sp. - 29 -- Valvata sincera 29 115 -- Pelecvpoda sph aer i idae

  18. The Passing on Defence Aviated Into State Aid Law

    DEFF Research Database (Denmark)

    Ølykke, Grith Skovgaard

    2015-01-01

    The two annotated judgments concern the aftermath of a differentiated taxation on travelling, which was implemented in breach of the free movement provisions in the Treaties. Airlines (Aer Lingus and Ryanair) who were identified as beneficiaries of the advantage arising from being subject to the ...

  19. System analysis of high speed, long range weapon systems

    NARCIS (Netherlands)

    Moerel, J.L.P.A.; Halswijk, W.H.C.

    2005-01-01

    Many countries are developing technologies for future hypersonic air breathing cruise missiles. These missiles are foreseen to be employed against, amongst others, deeply buried targets. The main technological challenges are related to severe aerodynamic heating and complex physical processes of aer

  20. Terahertz Quantum Cascade Structures Using Step Wells And Longitudinal Optical-Phonon Scattering

    Science.gov (United States)

    2009-06-01

    Z. R. Wasilewski , G. C. Aers, H. C. Liu, and J. C. Cao, Appl. Phys. Lett. 90, 041112 (2007). 40. W. Freeman and G. Karunasiri, Proc. Ninth Int. Conf...John Wiley & Sons Ltd, Chichester, 2006). 54. Communication with M. Troccoli. 55. H. C. Liu, M. Wächter, D. Ban, Z. R. Wasilewski , M. Buchanan

  1. Res-E Support Policies in the Baltic States: Electricity Price Aspect (Part II)

    Science.gov (United States)

    Bobinaite, V.; Priedite, I.

    2015-04-01

    Increasing volumes of electricity derived from renewable energy sources (RES-E) affect the electricity market prices and the prices for final electricity consumers in the Baltic States. The results of a multivariate regression analysis show that in 2013 the RES-E contributed to decreasing the electricity market prices in the Baltic States. However, the final electricity consumers pay for the promotion of RES-E through the approved RES-E component which has a tendency to increase. It is estimated that in 2013 the net benefits from the wind electricity promotion were achieved in Lithuania and Latvia while the net cost - in Estonia. This suggests that the economic efficiency of the wind electricity support scheme based on the application of feed-in tariffs was higher than that based on the feed-in premium. Rakstā analizēta elektroenerģijas ražošanas no atjaunojamiem energoresursiem (AER-E) palielināšanas ietekme uz elektroenerģijas tirgus cenu un gala cenu elektroenerģijas lietotājiem Baltijas valstīs. Daudzfaktoru regresijas analīzes rezultāti atklāja, ka AER-E 2013. gadā varētu samazināt elektroenerģijas tirgus cenas Baltijas valstīs. Tomēr jāņem vērā, ka elektroenerģijas lietotāja gala cenā ir iekļauta AER-E atbalsta komponente, kurai ir raksturīgi palielināties. Aprēķināts, ka no vēja elektroenerģijas ražošanas Latvijā un Lietuvā tika iegūta tīrā peļņa, bet Igaunijā tikai nosedza pašizmaksu. Tas liecina, ka vēja elektroenerģijas atbalsta shēmai, kas balstīta uz obligātā iepirkuma atbalsta principu, ir augstāka ekonomiskā efektivitāte, nekā atbalsta shēmai, kas balstīta uz piemaksu par no AER saražoto elektroenerģiju obligātā iepirkuma ietvaros.

  2. Enhanced Al and Zn removal from coal-mine drainage during rapid oxidation and precipitation of Fe oxides at near-neutral pH

    Science.gov (United States)

    Burrows, Jill E.; Cravotta, Charles A.; Peters, Stephen C.

    2017-01-01

    Net-alkaline, anoxic coal-mine drainage containing ∼20 mg/L FeII and ∼0.05 mg/L Al and Zn was subjected to parallel batch experiments: control, aeration (Aer 1 12.6 mL/s; Aer 2 16.8 mL/s; Aer 3 25.0 mL/s), and hydrogen peroxide (H2O2) to test the hypothesis that aeration increases pH, FeII oxidation, hydrous FeIII oxide (HFO) formation, and trace-metal removal through adsorption and coprecipitation with HFO. During 5.5-hr field experiments, pH increased from 6.4 to 6.7, 7.1, 7.6, and 8.1 for the control, Aer 1, Aer 2, and Aer 3, respectively, but decreased to 6.3 for the H2O2 treatment. Aeration accelerated removal of dissolved CO2, Fe, Al, and Zn. In Aer 3, dissolved Al was completely removed within 1 h, but increased to ∼20% of the initial concentration after 2.5 h when pH exceeded 7.5. H2O2 promoted rapid removal of all dissolved Fe and Al, and 13% of dissolved Zn.Kinetic modeling with PHREEQC simulated effects of aeration on pH, CO2, Fe, Zn, and Al. Aeration enhanced Zn adsorption by increasing pH and HFO formation while decreasing aqueous CO2 available to form ZnCO30 and Zn(CO3)22− at high pH. Al concentrations were inconsistent with solubility control by Al minerals or Al-containing HFO, but could be simulated by adsorption on HFO at pH pH where Al(OH)4− was predominant. Thus, aeration or chemical oxidation with pH adjustment to ∼7.5 could be effective for treating high-Fe and moderate-Zn concentrations, whereas chemical oxidation without pH adjustment may be effective for treating high-Fe and moderate-Al concentrations.

  3. 2型糖尿病患者糖化血红蛋白及尿白蛋白与骨密度变化的关系研究%The Study Of The Relationship Between HbA1c And Urinary Albumin To Bone Mineral Density Changes In Patients With Type 2 Diabetes Mellitus

    Institute of Scientific and Technical Information of China (English)

    陈振新; 朱锋; 林国新; 陈金星

    2015-01-01

    目的:观察2型糖尿病患者血糖水平、糖化血红蛋白(HbA1c)、24小时尿白蛋白排泄率(AER)与骨密度(BMD)的变化的关系.方法:选取2010年01月—2015年01月入住我院的45~75岁2型糖尿病患者82例及随机选取的正常人群20例为对照组,分别对其血糖、HbA1c、24h尿白蛋白排泄率(AER)、腰椎和股骨颈BMD及相关生化指标等进行检测.将糖尿病患者根据HbA1c300mg/24h为I B组;HbA1c>7%分为Ⅱ组,其中AER300mg/24h为ⅡB组.结果:2型糖尿病组与正常对照组相比,骨密度显著降低(P300mg/24h;GroupⅡHbA1c>7%, GroupⅡA AER300mg/24h.Results Compared with control group, BMD of the group of Type 2 Diabetes mellitus decreased significantly (P<0.05). BMD at the femoral neck in diabetes group ⅡB was significantly lower than that in groupⅠA, groupⅠB and groupⅡA (P<0.05).Conclusions BMD significantly lowers in patients with Type 2 Diabetes mellitus than in controls, BMD of patients with unfulfilled blood sugar control and elevated AER decreased the most significantly than others.

  4. Identification of effluent organic matter fractions responsible for low-pressure membrane fouling

    KAUST Repository

    Filloux, Emmanuelle

    2012-11-01

    Anion exchange resin (AER), powder activated carbon (PAC) adsorption and ozonation treatments were applied on biologically treated wastewater effluent with the objective to modify the effluent organic matter (EfOM) matrix. Both AER and PAC led to significant total organic carbon (TOC) removal, while the TOC remained nearly constant after ozonation. Liquid Chromatography-Organic Carbon Detection (LC-OCD) analysis showed that the AER treatment preferentially removed high and intermediate molecular weight (MW) humic-like structures while PAC removed low MW compounds. Only a small reduction of the high MW colloids (i.e. biopolymers) was observed for AER and PAC treatments. Ozonation induced a large reduction of the biopolymers and an important increase of the low MW humic substances (i.e. building blocks).Single-cycle microfiltration (MF) and ultrafiltration (UF) tests were conducted using commercially available hollow fibres at a constant flux. After reconcentration to their original organic carbon content, the EfOM matrix modified by AER and PAC treatments exhibited higher UF membrane fouling compared to untreated effluent; result that correlated with the higher concentration of biopolymers. On the contrary, ozonation which induced a significant degradation of the biopolymers led to a minor flux reduction for both UF and MF filtration tests. Based on a single filtration, results indicate that biopolymers play a major role in low pressure membrane fouling and that intermediate and low MW compounds have minor impact. Thus, this approach has shown to be a valid methodology to identify the foulant fractions of EfOM. © 2012 Elsevier Ltd.

  5. The protective effect of the RAS inhibitor on diabetic patients with nephropathy in the context of VEGF suppression

    Institute of Scientific and Technical Information of China (English)

    Haibing CHEN; Junxi LU; Qing LI; Yuqian BAO; Junling TANG; Huijuan LU; Kunsan XIANG; Weiping JIA

    2009-01-01

    Aim:The aim of the present study was to explore whether renin angiotensin system (RAS) inhibitor can reduce the produc-tion of vascular endothelium growth factor (VEGF).Further,we sought to elucidate the correlation between VEGF level and certain clinical parameters,such as albumin excretion rate (AER),before and after treatment with angiotensin type 1 receptor blocker.Methods: We recruited 166 type 2 diabetic patients at various stages of diabetic nephropathy (DN) and 46 healthy control subjects for a cross-sectional study.We recruited another 42 hypertensive type 2 diabetic patients with microalbuminuria for a longitudinal study involving a 6-month irbesartan treatment protocol.Urinary VEGF (uVEGF) levels were determined using ELISA.Results: In the cross-sectional study,hypertensive type 2 diabetic patients who received RAS inhibitor presented lower uVEGF levels than those who did not receive the RAS inhibitor.Statistical analysis indicated that uVEGF level was independently correlated with the AER.In the longitudinal study involving the 6-month irbesartan treatment,we demonstrated that uVEGF levels decreased significantly in patients who achieved a 50% AER reduction (remission group,n=32).In contrast,uVEGF levels remained unchanged in patients who did not exhibit a 50% AER reduction (nonremission group,n=10).Furthermore,the change in uVEGF was significantly correlated with the change in AER (r=0.65,P<0.01) before and after 6 months of irbesartan treatment.This result held true even after we had adjusted for the decrease in average blood pressure.Conclusion: The protective effect of the RAS inhibitor in DN patients is associated with the suppression of VEGF.Accordingly,it may be possible to use uVEGF as a marker of DN progression.We suggest that uVEGF may be an important target for therapeutic intervention in the context of DN.

  6. [Effects of diet and aerobic or anaerobic exercises on eating disorders].

    Science.gov (United States)

    Martinez-Rodriguez, Alejandro

    2014-10-19

    Introducción: Actividades físicas de larga duración, con predominio aeróbico, requieren una práctica deportiva extensiva y continuada para obtener mejoras en el rendimiento. Mientras que las actividades anaeróbicas, requieren de un volumen de entrenamiento menor, aunque a intensidades más elevadas para alcanzar un buen estado de forma deportiva. La disminución del porcentaje graso dentro de la composición corporal, tanto de deportes aeróbicos como anaeróbicos, es una cuestión presente, sobretodo en estos último tiempos. Conseguir un adecuado estado nutricional, con estrategias inadecuadas, puede originar la aparición de trastornos de la conducta alimentaria. Objetivo: determinar las diferencias existentes entre dos grupos de deportistas en función de la práctica de deportes aeróbicos o anaeróbicos, en cuanto a la presencia de desórdenes alimentarios, adherencia a dieta baja en grasa y actividad física. Método: En este estudio participaron 206 sujetos varones entrenados que cumplimentaron los cuestionarios de actividad física en el tiempo libre de Minnesota abreviado, EAT-26 y Predimed de “Adherencia a dieta baja en grasa”. Resultados: Los deportistas que practican deportes aeróbicos muestran mayores puntuaciones en la mayoría de las subescalas y en el resultado total del cuestionario EAT-26. A mayor número de sesiones de práctica en deportes aeróbicos, aparecen puntuaciones superiores en el Control Oral. Dentro de esta población, el consumo de suplementos incrementa significativamente las puntuaciones del EAT-26 y la predisposición a un TCA, al igual que los planes de entrenamientos muy estrictos. Discusión: Los deportistas que practican deportes de corte más aeróbico parecen mostrar una mayor predisposición a la presencia de un TCA.

  7. Genetic Predisposition to Diabetic Nephropathy: Evidence for a Role of ACE (I/D) Gene Polymorphism in Type 2 Diabetic Population from Kutch Region.

    Science.gov (United States)

    Parchwani, Deepak N; Palandurkar, Kamlesh M; Hema Chandan Kumar, D; Patel, Darshan J

    2015-01-01

    Genetic polymorphism as described with angiotensin-converting enzyme gene has been proposed as a putative mediator of diabetic nephropathy. We substantiate the hypothesis that genetic variants of the ACE have significant impacts on diabetic nephropathy. To assess the possible association between the three ACE polymorphic variants and DN in an ethnically homogeneous type 2 diabetic population from Kutch region. A 287-bp insertion/deletion polymorphism in intron 16 of the ACE gene was examined by polymerase chain reaction using a case-control approach conducted with 309 unrelated type 2 diabetic patients of Kutch origin (159 Ahir and 150 Rabari, with >10 years duration of T2DM). Of the patients, 143 had nephropathy {AER >30 mg/day (Ahir, n:73 and Rabari, n:70)} and were considered as cases; all others {n:166 (86 Ahir and 80 Rabari)} were normoalbuminuric (AER diabetes.

  8. Resposta renal à maltodextrina e ao treinamento em diferentes intensidades

    OpenAIRE

    Cátia Fernandes Leite; Airton José Rombaldia

    2015-01-01

    O objetivo foi investigar a resposta renal à ingestão de maltodextrina e à natação de padrão aeróbio ou anaeróbio de alta intensidade em ratos. Materiais e métodos O protocolo consistiu de oito semanas de natação em padrão aeróbio (sobrecarga 5%) ou intermitente (sobrecarga 10%). Durante 37 dias os animais foram suplementados, por meio de gavagem, com uma dose diária de 0,48g.Kg−1 de maltodextrina dissolvida em água ou receberam água pura, antes do treinamento. Resultados O treinamento anaeró...

  9. Development of a computer code for neutronic calculations of a hexagonal lattice of nuclear reactor using the flux expansion nodal method

    Directory of Open Access Journals (Sweden)

    Mohammadnia Meysam

    2013-01-01

    Full Text Available The flux expansion nodal method is a suitable method for considering nodalization effects in node corners. In this paper we used this method to solve the intra-nodal flux analytically. Then, a computer code, named MA.CODE, was developed using the C# programming language. The code is capable of reactor core calculations for hexagonal geometries in two energy groups and three dimensions. The MA.CODE imports two group constants from the WIMS code and calculates the effective multiplication factor, thermal and fast neutron flux in three dimensions, power density, reactivity, and the power peaking factor of each fuel assembly. Some of the code's merits are low calculation time and a user friendly interface. MA.CODE results showed good agreement with IAEA benchmarks, i. e. AER-FCM-101 and AER-FCM-001.

  10. Nitrogen removal and microbial characteristics in CANON biofilters fed with different ammonia levels.

    Science.gov (United States)

    Liang, Yuhai; Li, Dong; Zhang, Xiaojing; Zeng, Huiping; Yang, Zhuo; Cui, Shaoming; Zhang, Jie

    2014-11-01

    The nitrogen removal performance and microbial characteristics of four completely autotrophic nitrogen removal over nitrite (CANON) biofilters were investigated. These four reactors were simultaneously seeded from a stable CANON biofilter with a seeding ratio of 1:1, which were fed with different ammonia levels. Results suggested that with the ammonia of 200-400 mg L(-1), aerobic ammonia-oxidizing bacteria (AerAOB) and anaerobic ammonia-oxidizing bacteria (AnAOB) could perform harmonious work. The bioactivity and population of the two groups of bacteria were both high, which then resulted in excellent nitrogen removal, while too low or too high ammonia would both lead to worse performance. When ammonia was too high, the bioactivity, biodiversity and population of AerAOB all decreased and then resulted in the lowest nitrogen removal. Nitrosomonas and Candidatus Brocadia were detected as predominant functional microbes in all the four reactors. Finally, strategies for treating sewage with different ammonia levels were proposed.

  11. Indoor air quality in the Swedish housing stock and its dependence on building characteristics

    DEFF Research Database (Denmark)

    Langer, Sarka; Bekö, Gabriel

    2013-01-01

    Data from a recent Swedish survey on the status of the housing stock and indoor air quality were placed in the public domain by the Swedish National Board of Housing, Building and Planning in 2011. The available parameters included the year of construction, dwelling location, type of ventilation...... system, temperature, relative humidity, air exchange rate (AER), and concentrations of nitrogen dioxide (NO2), formaldehyde and Total Volatile Organic Compounds (TVOC) from 157 single-family houses and 148 apartments. The median AER was lower in the single-family houses than in apartments (0.33h-1 vs. 0...... exchange rate was a significant predictor of the concentrations of all three indoor pollutants. While ventilation seemed to be a source of NO2, increased ventilation rate appeared to decrease the indoor concentrations of formaldehyde and TVOC. © 2013 Elsevier Ltd....

  12. A Simple Halide-to-Anion Exchange Method for Heteroaromatic Salts and Ionic Liquids

    Directory of Open Access Journals (Sweden)

    Neus Mesquida

    2012-04-01

    Full Text Available A broad and simple method permitted halide ions in quaternary heteroaromatic and ammonium salts to be exchanged for a variety of anions using an anion exchange resin (A− form in non-aqueous media. The anion loading of the AER (OH− form was examined using two different anion sources, acids or ammonium salts, and changing the polarity of the solvents. The AER (A− form method in organic solvents was then applied to several quaternary heteroaromatic salts and ILs, and the anion exchange proceeded in excellent to quantitative yields, concomitantly removing halide impurities. Relying on the hydrophobicity of the targeted ion pair for the counteranion swap, organic solvents with variable polarity were used, such as CH3OH, CH3CN and the dipolar nonhydroxylic solvent mixture CH3CN:CH2Cl2 (3:7 and the anion exchange was equally successful with both lipophilic cations and anions.

  13. Distribution and genetic diversity of functional microorganisms in different CANON reactors.

    Science.gov (United States)

    Liu, Tao; Li, Dong; Zeng, Huiping; Li, Xiangkun; Liang, Yuhai; Chang, Xiaoyan; Zhang, Jie

    2012-11-01

    Completely autotrophic nitrogen removal over nitrite (CANON) has been regarded as an efficient and economical process for nitrogen removal from wastewater. The distribution and genetic diversity of the functional microorganisms in five lab-scale CANON reactors have been investigated by using some molecular biology methods. Nitrosomonas-like aerobic ammonium oxidizing bacteria (AerAOB) and Candidatus Brocadia-related anaerobic ammonium oxidizing bacteria (AnAOB) were detected as predominant functional microbes in the five reactors while Nitrobacter-like nitrite oxidizing bacteria (NOB) existed only in the systems operated at ambient temperature. Communities of AerAOB and AnAOB were almost similar among the five reactors while the distribution of the functional microbes was either scattered or densely packed. Meanwhile, this study has demonstrated the feasibility of starting up CANON by inoculating conventional activated sludge in low ammonium content at ambient temperature.

  14. AVALIAÇÃO DA FLORA MICROBIANA E DE DEGERMAÇÃO EXPERIMENTAL EM EQUIPE DE ENFERMAGEM, AMBIENTE E MATERIAL SANITÁRIO, EM ENFERMARIA DE ORTOPEDIA E TRAUMATOLOGIA

    Directory of Open Access Journals (Sweden)

    Celina de Arruda Camargo

    1972-09-01

    Full Text Available RESUMO Estudou-se a ecologia dos microrganismos aeróbios patogênicos em duas Enfermarias de Ortopedia e Traumatologia, observando-se predomínio de bactérias Gram negativas. A etiologia das infecções, adquiridas ou não no hospital, dos doentes internados, mostrou também predomínio acentuado de bactérias Gram negativas. As mãos e narinas de funcionários em contato direto com os doentes, mostraram presença de flora bacteriana aeróbia mista constituída de Gram positivos (patogênico e não patogênicos e Gram negativos. Os resultados obtidos com a antissepsia de utensílios sanitários com solução contendo composto quaternário de amônio, metanol e etanol foram excelentes.

  15. A VLSI array of low-power spiking neurons and bistable synapses with spike-timing dependent plasticity.

    Science.gov (United States)

    Indiveri, Giacomo; Chicca, Elisabetta; Douglas, Rodney

    2006-01-01

    We present a mixed-mode analog/digital VLSI device comprising an array of leaky integrate-and-fire (I&F) neurons, adaptive synapses with spike-timing dependent plasticity, and an asynchronous event based communication infrastructure that allows the user to (re)configure networks of spiking neurons with arbitrary topologies. The asynchronous communication protocol used by the silicon neurons to transmit spikes (events) off-chip and the silicon synapses to receive spikes from the outside is based on the "address-event representation" (AER). We describe the analog circuits designed to implement the silicon neurons and synapses and present experimental data showing the neuron's response properties and the synapses characteristics, in response to AER input spike trains. Our results indicate that these circuits can be used in massively parallel VLSI networks of I&F neurons to simulate real-time complex spike-based learning algorithms.

  16. Aggregate Size and Architecture Determine Microbial Activity Balance for One-Stage Partial Nitritation and Anammox

    DEFF Research Database (Denmark)

    Vlaeminck, S.E.; Terada, Akihiko; Smets, Barth F.

    2010-01-01

    Aerobic ammonium-oxidizing bacteria (AerAOB) and anoxic ammonium-oxidizing bacteria (AnAOB) cooperate in partial nitritation/anammox systems to remove ammonium from wastewater. In this process, large granular microbial aggregates enhance the performance, but little is known about granulation so far....... In this study, three suspended-growth oxygen-limited autotrophic nitrification-denitrification (OLAND) reactors with different inoculation and operation (mixing and aeration) conditions, designated reactors A, B, and C, were used. The test objectives were (i) to quantify the AerAOB and AnAOB abundance......AOB-rich aggregates (reactors B and C). The hypothesized granulation pathways include granule replication by division and budding and are driven by growth and/or decay based on species-specific physiology and by hydrodynamic shear and mixing....

  17. Prescrição de exercício físico para mulheres com síndrome dos ovários policísticos: impacto sobre a aptidão cardiorrespiratória e resposta afetiva

    OpenAIRE

    Costa, Eduardo Caldas

    2012-01-01

    analisar o efeito do treinamento aeróbio periodizado sobre a aptidão cardiorrespiratória e respostas afetivas em mulheres com síndrome dos ovários policísticos (SOP) e II) investigar se o exercício aeróbio realizado na zona de prazer para essa população atende a recomendação do American College of Sports Medicine (ACSM) no que se refere à intensidade para melhoria da saúde. Metodologia: foram incluídas mulheres na faixa etária entre 18 e 34 anos, com diagnóstico de SOP de ac...

  18. Resposta cronotrópica ao teste anaeróbio máximo de corrida - MART

    OpenAIRE

    Flávio Areal Lemos; Tony Meireles Santos

    2013-01-01

    INTRODUÇÃO: A frequência cardíaca (FC) no teste anaeróbio máximo de corrida (MART) expressa o comportamento autonômico cardíaco em exercício. Ainda não foi investigado se tais respostas cronotrópicas apresentam associação com o desempenho aeróbio e anaeróbio. OBJETIVOS: Descrever a resposta cronotrópica cardíaca durante o MART nos segundos iniciais de estímulo (FC ON) e de recuperação (FC OFF) e estabelecer a associação entre as variáveis cronotrópicas com o desempenho aeróbio e anaeróbio. MÉ...

  19. Análise do estresse oxidativo em jogadores juniores de futebol

    OpenAIRE

    Fiamoncini, Rafaela Liberali

    2002-01-01

    Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro Tecnológico. Programa de Pós-Graduação em Engenharia de Produção. A ergonomia estuda o homem no trabalho e suas interações. O presente trabalho estudou o jogador de futebol em situação real de trabalho e suas interações fisiológicas, em uma rotina de exercício aeróbio e anaeróbio. O aumento do oxigênio utilizado durante exercícios aeróbios pode prejudicar o funcionamento corporal, pois ocorre a formação de grande quant...

  20. ultrastructural study of limb bud development in green turtles chelonia mydas

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    morphological changes during the embryonic development of limbs of the green turtle,chelonia mydas,were studied during the entire period of incubation,using transmission and scanning electron microscopy (tem and sem).limb buds were first observed at stage 2.at that stage,the tip was covered with an apical ectodermal ridge (aer) which began to regress at stage 6.associated with aer was the presence of the mesenchymal cells which,consequently,differentiated into muscles,cartilage and bones.the gross features of the skeletal development appeared as a condensation of the cartilaginous structures in the proximal distal region of the limbs.the primordial digits were gradually enclosed by hard keratinized webbed skin.the increase in rate of ossification and skin pigmentation was correlated with the growth of the limbs.the development of the limbs was closely related to the transitional appearance of mucus secretion from the epidermis.

  1. Manual de Aerografía, técnicas y estilos

    OpenAIRE

    Guzmán Galarza, Manuel

    1994-01-01

    El aerógrafo es un instrumento de precisión y para sacarle el máximo de provecho hay que entender su funcionamiento. El aerógrafo al igual que un pincel, exige destreza para crear efectos y en manos expertas, su manipulación no es más que la extensión de la mente. Se empieza revisando los equipos y materiales, luego las técnicas básicas para terminar con técnicas avanzadas, en los que se pone énfasis en el manejo y control del instrumento para que los resultados sean buenos, progresivos lo qu...

  2. Background Information and User Guide for MIL-F-8785C, Military Specification - Flying Qualities of Piloted Airplanes

    Science.gov (United States)

    1982-07-01

    008861A(USAF), 31 March 1971 MIL-C-18244A( WEP ) , I Deceiiiber 1962 MIL-F-18372(Aer), 31 March 1955 MIL--W-25140A, 15 April 1973 MIL-F-83300, 31...with cunrtniin requirements ’rh1 ol-1 rhait Mf1,-I,-94901) reqo irts "Imict ional Imockup iiod s i t:i or te S-":’ of’ "an opern0 ona1l mockup which

  3. Acute Kidney Injury and Bisphosphonate Use in Cancer: A Report From the Research on Adverse Drug Events and Reports (RADAR) Project

    Science.gov (United States)

    Edwards, Beatrice J.; Usmani, Sarah; Raisch, Dennis W.; McKoy, June M.; Samaras, Athena T.; Belknap, Steven M.; Trifilio, Steven M.; Hahr, Allison; Bunta, Andrew D.; Abu-Alfa, Ali; Langman, Craig B.; Rosen, Steve T.; West, Dennis P.

    2013-01-01

    Purpose: To determine whether acute kidney injury (AKI) is identified within the US Food and Drug Administration's Adverse Events and Reporting System (FDA AERS) as an adverse event resulting from bisphosphonate (BP) use in cancer therapy. Methods: A search of the FDA AERS records from January 1998 through June 2009 was performed; search terms were “renal problems” and all drug names for BPs. The search resulted in 2,091 reports. We analyzed for signals of disproportional association by calculating the proportional reporting ratio for zoledronic acid (ZOL) and pamidronate. Literature review of BP-associated renal injury within the cancer setting was conducted. Results: Four hundred eighty cases of BP-associated acute kidney injury (AKI) were identified in patients with cancer. Two hundred ninety-eight patients (56%) were female; mean age was 66 ± 10 years. Multiple myeloma (n = 220, 46%), breast cancer (n = 98, 20%), and prostate cancer (n = 24, 5%) were identified. Agents included ZOL (n = 411, 87.5%), pamidronate (n = 8, 17%), and alendronate (n = 36, 2%). Outcomes included hospitalization (n = 304, 63.3%) and death (n = 68, 14%). The proportional reporting ratio for ZOL was 1.22 (95% CI, 1.13 to 1.32) and for pamidronate was 1.55 (95% CI, 1.25 to 1.65), reflecting a nonsignificant safety signal for both drugs. Conclusion: AKI was identified in BP cancer clinical trials, although a safety signal for BPs and AKI within the FDA AERS was not detected. Our findings may be attributed, in part, to clinicians who believe that AKI occurs infrequently; ascribe the AKI to underlying premorbid disease, therapy, or cancer progression; or consider that AKI is a known adverse drug reaction of BPs and thus under-report AKI to the AERS. PMID:23814519

  4. Evaluación del proceso de compostaje de dos mezclas de residuos avícolas

    OpenAIRE

    Riera, Nicolás I.; Della Torre, Virginia; Rizzo, Pedro F.; Butti, Mariano; Bressan, Fabiana M.; Zarate, Natalia; Weigandt, Cristian; Crespo, Diana Elvira

    2014-01-01

    Los residuos del sector avícola, principalmente guano (aves ponedoras) y cama de parrilleros (aves de engorde), pueden generar un impacto negativo en el ambiente contribuyendo a la contaminación de suelo, agua y aire. La estabilización aeróbica a través del compostaje es una alternativa de tratamiento para reducir la contaminación. El objetivo de este trabajo fue evaluar el proceso de compostaje en dos m...

  5. Energetics of high-speed running: integrating classical theory and contemporary observations.

    Science.gov (United States)

    Weyand, Peter G; Bundle, Matthew W

    2005-04-01

    We hypothesized that the anaerobic power and aerobic power outputs during all-out runs of any common duration between 10 and 150 s would be proportional to the maximum anaerobic (E(an-max)) and aerobic powers (E(aer-max)) available to the individual runner. Seventeen runners who differed in E(an-max) and E(aer-max) (5 sprinters, 5 middle-distance runners, and 7 long distance runners) were tested during treadmill running on a 4.6 degrees incline. E(an-max) was estimated from the fastest treadmill speed subjects could attain for eight steps. E(aer-max) was determined from a progressive, discontinuous, treadmill test to failure. Oxygen deficits and rates of uptake were measured to assess the respective anaerobic and aerobic power outputs during 11-16 all-out treadmill runs that elicited failure between 10 and 220 s. We found that, during all-out runs of any common duration, the relative anaerobic and aerobic powers utilized were largely the same for sprint, middle-distance, and long-distance subjects. The similar fractional utilization of the E(an-max) and E(aer-max) available during high-speed running 1) provides empirical values that modify and advance classic theory, 2) allows rates of anaerobic and aerobic energy release to be quantified from individual maxima and run durations, and 3) explains why the high-speed running performances of different event specialists can be accurately predicted (R(2) = 0.97; n = 254) from two direct measurements and the same exponential time constant.

  6. Dynamic Fracture Simulations of Explosively Loaded Cylinders

    Energy Technology Data Exchange (ETDEWEB)

    Arthur, Carly W. [Univ. of California, Davis, CA (United States). Dept. of Civil and Environmental Engineering; Goto, D. M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2015-11-30

    This report documents the modeling results of high explosive experiments investigating dynamic fracture of steel (AerMet® 100 alloy) cylinders. The experiments were conducted at Lawrence Livermore National Laboratory (LLNL) during 2007 to 2008 [10]. A principal objective of this study was to gain an understanding of dynamic material failure through the analysis of hydrodynamic computer code simulations. Two-dimensional and three-dimensional computational cylinder models were analyzed using the ALE3D multi-physics computer code.

  7. Operation Brain Trauma Therapy

    Science.gov (United States)

    2013-10-01

    investigators. This included resveratrol , N-acetylcysteine, necrostatin, INO-1001, glibenclamide, AER 271, edaravone, melatonin, fluoxetine, amphetamine...significantly ameliorates cortical damage following traumatic brain injury. Exp Neurol. 2000;161:631-637. 34. Sullivan PG, Rabchevsky AG , Hicks RR, et al...Berges L. Dependency of cyclosporine tissue distribution and metabolism on the age and gender of rats after a single intravenous dose. Internat J

  8. Long-term risk of cardiovascular disease after treatment for aggressive non-Hodgkin lymphoma.

    Science.gov (United States)

    Moser, Elizabeth C; Noordijk, Evert M; van Leeuwen, Flora E; le Cessie, Saskia; Baars, Joke W; Thomas, José; Carde, Patrice; Meerwaldt, Jacobus H; van Glabbeke, Martine; Kluin-Nelemans, Hanneke C

    2006-04-01

    Cardiovascular disease frequently occurs after lymphoma therapy, but it is common in the general population too. Therefore, risk estimation requires comparison to population-based rates. We calculated risk by standardized incidence ratios (SIRs) and absolute excess risks (AERs) per 10,000 person-years based on general population rates (Continuous Morbidity Registry Nijmegen) in 476 (Dutch and Belgian) patients with aggressive non-Hodgkin lymphoma (NHL) treated with at least 6 cycles of doxorubicin-based chemotherapy in 4 European Organization for Research on Treatment of Cancer (EORTC) trials (1980-1999). Cumulative incidence of cardiovascular disease, estimated in a competing risk model, was 12% at 5 years and 22% at 10 years (median follow-up, 8.4 years). Risk of chronic heart failure appeared markedly increased (SIR, 5.4; 95% CI, 4.1-6.9) with an AER of 208 excess cases per 10 000 person-years, whereas risk of coronary artery disease matched the general population (SIR, 1.2; 95% CI, 0.8-1.8; AER, 8 per 10 000 person-years). Risk of stroke was raised (SIR, 1.8; 95% CI, 1.1-2.4; AER, 15 per 10 000 person-years), especially after additional radiotherapy (> 40 Gy). Preexisting hypertension, NHL at young age, and salvage treatment increased risk of all cardiovascular events; the effect of radiotherapy was dose dependent. In conclusion, patients are at long-term high risk of chronic heart failure after NHL treatment and need therefore life-long monitoring. In contrast, risk of coronary artery disease appeared more age dependent than treatment related.

  9. Alanine mutagenesis of the primary antigenic escape residue cluster, c1, of apical membrane antigen 1.

    Science.gov (United States)

    Dutta, Sheetij; Dlugosz, Lisa S; Clayton, Joshua W; Pool, Christopher D; Haynes, J David; Gasser, Robert A; Batchelor, Adrian H

    2010-02-01

    Antibodies against apical membrane antigen 1 (AMA1) inhibit invasion of Plasmodium merozoites into red cells, and a large number of single nucleotide polymorphisms on AMA1 allow the parasite to escape inhibitory antibodies. The availability of a crystal structure makes it possible to test protein engineering strategies to develop a monovalent broadly reactive vaccine. Previously, we showed that a linear stretch of polymorphic residues (amino acids 187 to 207), localized within the C1 cluster on domain 1, conferred the highest level of escape from inhibitory antibodies, and these were termed antigenic escape residues (AER). Here we test the hypothesis that immunodampening the C1 AER will divert the immune system toward more conserved regions. We substituted seven C1 AER of the FVO strain Plasmodium falciparum AMA1 with alanine residues (ALA). The resulting ALA protein was less immunogenic than the native protein in rabbits. Anti-ALA antibodies contained a higher proportion of cross-reactive domain 2 and domain 3 antibodies and had higher avidity than anti-FVO. No overall enhancement of cross-reactive inhibitory activity was observed when anti-FVO and anti-ALA sera were compared for their ability to inhibit invasion. Alanine mutations at the C1 AER had shifted the immune response toward cross-strain-reactive epitopes that were noninhibitory, refuting the hypothesis but confirming the importance of the C1 cluster as an inhibitory epitope. We further demonstrate that naturally occurring polymorphisms that fall within the C1 cluster can predict escape from cross-strain invasion inhibition, reinforcing the importance of the C1 cluster genotype for antigenic categorization and allelic shift analyses in future phase 2b trials.

  10. ON THE QUESTION OF PROCESS CONTROL COMBINED GRAIN DRYING

    Directory of Open Access Journals (Sweden)

    Valentina Afonkina

    2016-03-01

    Full Text Available A large part of the grain produced in the South Urals has high humidity and needs to be dried before storage. Drying is an energy-intensive process and is about 70 % of the total energy consumption for post-harvest processing of grain. Modern grain drying equip¬ment, implements high-convection drying, and heat provides cost 5 350–5 500 kJ per 1 kg of evaporated moisture, which is well above the theoretical calculations. Combined drying, which involves high-temperature drying step and aeration enables to reduce heat costs up to 30 %. To control the combined drying process it is necessary that final grain moisture relates to such parameters of high-temperature drying and aeration as the initial moisture content, the temperature of grain and the time subsequent aering. The paper describes the said relation as a mathematical model of the second order obtained experi¬mentally for wheat. The model has been derived from the implementation of Box-Benkin plan for three factors – the initial grain moisture, temperature and time of grain heating and aering. The experiment was conducted for a 200 mm thick fixed grain bed. We also have got a model relating energy consumption to the said parameters. The model of the final grain moisture within the variation of factors can be used to create a control algorithm for combined drying. Taking as the set parameters final moisture, initial moisture and grain heating temperature, a microcontroller calculates the time for active aering necessary to obtain final grain moisture and an unloading mechanism provides the necessary time through regulating the discharge rate. The model makes it possible to calculate the energy usage for drying at different values of initial moisture, temperature and time of grain heating and aering.

  11. Development of Medical Technology for Contingency Response to Marrow Toxic Substances

    Science.gov (United States)

    2012-09-08

    deployment of caAERS (caBIG® Adverse Event Reporting System; part of the NCI “ cancer Biomedical Informatics Grid”, or caBIG®, project) is in process...Accreditation of Healthcare Organizations BMT Bone Marrow Transplantation KIR Killer Immunoglobulin-like Receptor BMT CTN Blood and Marrow...Transplant - Clinical Trials Network MDACC MD Anderson Cancer Center BODI Business Objects Data Integrator MDS Myelodysplastic Syndrome National Marrow

  12. Agile Software Development in Defense Acquisition: A Mission Assurance Perspective

    Science.gov (United States)

    2012-03-23

    Process-neutral • Software mission assurance does not assume any particular software development methodology , programming language, or tools • Mission...24 Source: [Guano 2008] ^ AER0SPACE The Life Cycle Perspective of Agile Software Development 26 (A) AEROSPACE Agile Life Cycle Example: Scrum ...Daily Scrum Meeting Monthly Sprint Meeting Scrum is a lean approach to software development - Simple "inspect and adapt management framework

  13. The effects of two different swimming training periodization on physiological parameters at various exercise intensities.

    Science.gov (United States)

    Clemente-Suárez, Vicente Javier; Dalamitros, Athanasios; Ribeiro, João; Sousa, Ana; Fernandes, Ricardo J; Vilas-Boas, J Paulo

    2017-05-01

    This study analysed the effects of two different periodization strategies on physiological parameters at various exercise intensities in competitive swimmers. Seventeen athletes of both sexes were divided to two groups, the traditional periodization (TPG, n = 7) and the reverse periodization group (RPG, n = 10). Each group followed a 10-week training period based on the two different periodization strategies. Before and after training, swimming velocity (SV), energy expenditure (EE), energy cost (EC) and percentage of aerobic (%Aer) and anaerobic (%An) energy contribution to the swimming intensities corresponding to the aerobic threshold (AerT), the anaerobic threshold (AnT) and the velocity at maximal oxygen uptake (vVO2max) were measured. Both groups increased the %An at the AerT and AnT intensity (P ≤ .05). In contrast, at the AnT intensity, EE and EC were only increased in TPG. Complementary, %Aer, %An, EE and EC at vVO2max did not alter in both groups (P > .05); no changes were observed in SV in TPG and RPG at all three intensities. These results indicate that both periodization schemes confer almost analogous adaptations in specific physiological parameters in competitive swimmers. However, given the large difference in the total training volume between the two groups, it is suggested that the implementation of the reverse periodization model is an effective and time-efficient strategy to improve performance mainly for swimming events where the AnT is an important performance indicator.

  14. La energía humana el esfuerzo físico

    Directory of Open Access Journals (Sweden)

    Luis Suárez Flórez

    2011-02-01

    Full Text Available Se llama la atención sobre la energía humana, su importancia como elemento de productividad y como principio ó quizás como fin de la actividad deportiva. Se estudia el máximo esfuerzo físico, así como también algunos conceptos acerca de la energía aeróbica y la energía anaeróbica.

  15. cis–regulation and mis–regulation – Insights into genomic regulatory mechanisms underlying the control of fgf8a in zebrafish Danio rerio

    OpenAIRE

    Komisarczuk, Anna Zofia

    2008-01-01

    Fibroblast growth factor 8 (Fgf8) is a potent vertebrate morphogen that plays decisive roles in multiple developmental processes, such as cellular proliferation, survival, differentiation, growth and migration. Fgf8 regionalizes the forebrain and has organizing activity in the midbrain–hindbrain boundary (MHB). Fgf8 induces limb formation and maintains the apical ectodermal ridge (AER), it controls development of the branchial arches and craniofacial skeleton, and its expressio...

  16. Multiple roles of mesenchymal beta-catenin during murine limb patterning.

    Science.gov (United States)

    Hill, Theo P; Taketo, Makoto M; Birchmeier, Walter; Hartmann, Christine

    2006-04-01

    Recently canonical Wnt signaling in the ectoderm has been shown to be required for maintenance of the apical ectodermal ridge (AER) and for dorsoventral signaling. Using conditional gain- and loss-of-function beta-catenin alleles, we have studied the role of mesenchymal beta-catenin activity during limb development. Here, we show that loss of beta-catenin results in limb truncations due to a defect in AER maintenance. Stabilization of beta-catenin also results in truncated limbs, caused by a premature regression of the AER. Concomitantly, in these limbs, the expression of Bmp2, Bmp4 and Bmp7, and of the Bmp target genes Msx1, Msx2 and gremlin, is expanded in the mesenchyme. Furthermore, we found that the expression of Lmx1b, a gene exclusively expressed in the dorsal limb mesenchyme and involved in dorsoventral patterning, is reduced upon loss of beta-catenin activity and is expanded ventrally in gain-of-function limbs. However, the known ectodermal regulators Wnt7a and engrailed 1 are expressed normally. This suggests that Lmx1b is also regulated, in part, by a beta-catenin-mediated Wnt signal, independent of the non-canoncial Wnt7a signaling pathway. In addition, loss of beta-catenin results in a severe agenesis of the scapula. Concurrently, the expression of two genes, Pax1 and Emx2, which have been implicated in scapula development, is lost in beta-catenin loss-of-function limbs; however, only Emx2 is upregulated in gain-of-function limbs. Mesenchymal beta-catenin activity is therefore required for AER maintenance, and for normal expression of Lmx1b and Emx2.

  17. Catalizador para la oxidación selectiva de hidrocarburos

    OpenAIRE

    Álvaro Rodríguez, Mercedes; Amarajothi, Dhakshinamoorthy; García Gómez, Hermenegildo

    2010-01-01

    La presente invención se refiere a un catalizador sólido que comprende una matriz reticular metal-orgánica y un agente promotor de la generación de radicales, a un procedimiento de obtención de dicho catalizador ya su uso como catalizador en la reacción de oxidación aeróbica selectiva de hidrocarburos.

  18. Energy Security Means Energy Interdependence

    Science.gov (United States)

    2009-09-24

    robertbryce.com. i BP Statistical Review of World Energy 2009. ii Donald Losman, “Oil Denial: An...aer/txt/ptb0103.html xix BP Statistical Review of World Energy 2009. xx BP Statistical Review of World Energy 2009. xxi Author interview with...Betrand Barré, Areva headquarters, Paris, May 7, 2009. xxii BP Statistical Review of World Energy 2009. xxiii For a comparison of various fuels in

  19. [PHYSICAL ACTIVITY LEVELS, PHYSICAL FITNESS AND SCREE TIME AMONG CHILDREN AND ADOLESCENTS FROM BOGOTÁ, COLOMBIA].

    Science.gov (United States)

    Prieto-Benavides, Daniel Humberto; Correa-Bautista, Jorge Enrique; Ramírez-Vélez, Robinson

    2015-11-01

    Objetivo: examinar la relación entre los niveles de actividad física (AF) de forma objetiva, la condición física (CF) y el tiempo de exposición a pantallas en niños y adolescentes de Bogotá, Colombia. Métodos: estudio descriptivo y transversal, realizado en 149 niños y adolescentes en edad escolar entre 9 y 17 años de Bogotá, Colombia. Los niveles de AF se valoraron con acelerómetro durante siete días. El tipo y tiempo de exposición a pantallas se registró por autorreporte. Se midió el estado de maduración, el peso, la estatura, la circunferencia de cintura/cadera y los pliegues tricipital/ subescapular. La capacidad aeróbica, la fuerza prensil, el salto de longitud y vertical, la velocidad/agilidad y la flexibilidad fueron usados como indicadores de la CF. Resultados: las mujeres clasificadas en la categoría de AF vigorosa mostraron una relación lineal con la capacidad aeróbica (r = 0,366), y una relación inversa con el pliegue tricipital (r = -0,257) y subescapular (r = -0,237), p valores de flexibilidad (r = 0,277), mientras que los niveles de AFMV se relacionaron positivamente con la capacidad aeróbica (r = 0,347), p valores de AF moderado y vigoroso de forma objetiva presentaron mejores niveles en la CF, especialmente en la capacidad aeróbica y la flexibilidad, y menores valores en los pliegues cutáneos.

  20. Statin-associated muscular and renal adverse events: data mining of the public version of the FDA adverse event reporting system.

    Directory of Open Access Journals (Sweden)

    Toshiyuki Sakaeda

    Full Text Available OBJECTIVE: Adverse event reports (AERs submitted to the US Food and Drug Administration (FDA were reviewed to assess the muscular and renal adverse events induced by the administration of 3-hydroxy-3-methylglutaryl coenzyme A (HMG-CoA reductase inhibitors (statins and to attempt to determine the rank-order of the association. METHODS: After a revision of arbitrary drug names and the deletion of duplicated submissions, AERs involving pravastatin, simvastatin, atorvastatin, or rosuvastatin were analyzed. Authorized pharmacovigilance tools were used for quantitative detection of signals, i.e., drug-associated adverse events, including the proportional reporting ratio, the reporting odds ratio, the information component given by a Bayesian confidence propagation neural network, and the empirical Bayes geometric mean. Myalgia, rhabdomyolysis and an increase in creatine phosphokinase level were focused on as the muscular adverse events, and acute renal failure, non-acute renal failure, and an increase in blood creatinine level as the renal adverse events. RESULTS: Based on 1,644,220 AERs from 2004 to 2009, signals were detected for 4 statins with respect to myalgia, rhabdomyolysis, and an increase in creatine phosphokinase level, but these signals were stronger for rosuvastatin than pravastatin and atorvastatin. Signals were also detected for acute renal failure, though in the case of atorvastatin, the association was marginal, and furthermore, a signal was not detected for non-acute renal failure or for an increase in blood creatinine level. CONCLUSIONS: Data mining of the FDA's adverse event reporting system, AERS, is useful for examining statin-associated muscular and renal adverse events. The data strongly suggest the necessity of well-organized clinical studies with respect to statin-associated adverse events.

  1. Use of alternative sweeteners in diabetic diet.

    Science.gov (United States)

    Crapo, P A

    1988-02-01

    Alternative sweeteners are widely advocated and used. However, there is insufficient scientific information to determine whether alternative sweeteners aer of value in the management of diabetes, either in improving dietary adherence or in contributing to the achievement or maintenance of a lower body weight. Each of the available sweeteners has advantages and disadvantages; no one is preferred. Recommendations about alternative-sweetener use should be tailored to the specific dietary and life-style patterns of the individual.

  2. Aerobic and combined exercise sessions reduce glucose variability in type 2 diabetes: crossover randomized trial.

    Directory of Open Access Journals (Sweden)

    Franciele R Figueira

    Full Text Available To evaluate the effects of aerobic (AER or aerobic plus resistance exercise (COMB sessions on glucose levels and glucose variability in patients with type 2 diabetes. Additionally, we assessed conventional and non-conventional methods to analyze glucose variability derived from multiple measurements performed with continuous glucose monitoring system (CGMS.Fourteen patients with type 2 diabetes (56±2 years wore a CGMS during 3 days. Participants randomly performed AER and COMB sessions, both in the morning (24 h after CGMS placement, and at least 7 days apart. Glucose variability was evaluated by glucose standard deviation, glucose variance, mean amplitude of glycemic excursions (MAGE, and glucose coefficient of variation (conventional methods as well as by spectral and symbolic analysis (non-conventional methods.Baseline fasting glycemia was 139±05 mg/dL and HbA1c 7.9±0.7%. Glucose levels decreased immediately after AER and COMB protocols by ∼16%, which was sustained for approximately 3 hours. Comparing the two exercise modalities, responses over a 24-h period after the sessions were similar for glucose levels, glucose variance and glucose coefficient of variation. In the symbolic analysis, increases in 0 V pattern (COMB, 67.0±7.1 vs. 76.0±6.3, P = 0.003 and decreases in 1 V pattern (COMB, 29.1±5.3 vs. 21.5±5.1, P = 0.004 were observed only after the COMB session.Both AER and COMB exercise modalities reduce glucose levels similarly for a short period of time. The use of non-conventional analysis indicates reduction of glucose variability after a single session of combined exercises.Aerobic training, aerobic-resistance training and glucose profile (CGMS in type 2 diabetes (CGMS exercise. ClinicalTrials.gov ID: NCT00887094.

  3. Rift Valley Fever Virus: Molecular Biologic Studies of the M Segment RNA(Ribonucleic Acids) for Application in Disease Prevention

    Science.gov (United States)

    1989-02-01

    ORGANIZATION Molecular Genetica , Inc. S6- ADDRESS (City, Stat., and ZIP Code) 7b. ADO~tESS (City, SWOat.dd ZIP Cod.) 10320 Bren Road East Minnetonka...described, as A-ere the gene Droducts encoded theirein. The singie open reading frame wltttv, MW RNA codes for four products: tt,: too viral envetop...gene products encoded therein. The single open reading frame within this RNA codes for four products: the two viral envelope glycoproteins G2 and Gi

  4. Concentrations and emissions of gasoline and other vapors from residential vehicle garages

    Science.gov (United States)

    Batterman, Stuart; Hatzivasilis, Gina; Jia, Chunrong

    High concentrations of airborne volatile organic compounds (VOCs) may be present in residential garages due to emissions from vehicles, lawnmowers, storage containers, and many other items stored in the garage. VOC emissions will ultimately be transported into ambient air and, if the garage is attached to a residence or other building, into living spaces. This study reports on VOC concentrations and emissions at 15 residential garages in Michigan that varied in type, size, use and other characteristics. VOCs were measured in garages and in outside air using 4-day passive sampling, thermal desorption, and GC-MS analysis. Effective air exchange rates (AERs) were determined using a perfluorocarbon tracer gas and the constant injection method. A modeling analysis shows the effect of time-varying ventilation. To estimate temporal and spatial variability, concentrations were measured on 7 subsequent occasions at multiple locations in one garage. This garage was well-mixed, and the temporal variation in AERs and concentrations was modest. Across the 15 garages, 36 different VOCs in garage air, and 20 in ambient air, were quantified. Source groups identified and attributed to garage emissions included evaporated gasoline, solvents, paints, oils, and cleaners. Concentrations of gasoline-related VOCs in most garages were high, e.g., benzene levels reached 159 μg m -3 in one garage. TVOC emissions per garage averaged 3.0±4.1 g day -1, and AERs averaged 0.77±0.51 h -1. VOC concentrations and AERs were not strongly correlated to observed house, garage or meteorological factors, but appeared largely dependent on occupant activities (opening of the garage door) and VOC sources present. This study quantifies the importance of attached garages as VOC sources, and the results are significant for understanding and mitigating indoor exposures, and for estimating emissions for source inventory purposes.

  5. Fisioterapia en la fase de convalecencia: fase de esfuerzo

    OpenAIRE

    2010-01-01

    Fisioterapia en la rehabilitación cardíaca: fase de convalecencia o fase II. En la sesión de entrenamiento, la fase de esfuerzo o endurecimiento pretende aumentar la capacidad funcional, la capacidad máxima de captación de oxígeno y la capacidad aeróbica máxima del paciente.

  6. CFD Simulation of Thermal-Hydraulic Benchmark V1000CT-2 Using ANSYS CFX

    OpenAIRE

    2009-01-01

    Plant measured data from VVER-1000 coolant mixing experiments were used within the OECD/NEA and AER coupled code benchmarks for light water reactors to test and validate computational fluid dynamic (CFD) codes. The task is to compare the various calculations with measured data, using specified boundary conditions and core power distributions. The experiments, which are provided for CFD validation, include single loop cooling down or heating-up by disturbing the heat transfer in the steam gene...

  7. ASPECTOS DIFERENCIALES EN LA IMAGEN CORPORAL Y LA AUTODESCRIPCIÓN DE LA FORMA FÍSICA EN MUJERES SEDENTARIAS VS. MUJERES ACTIVAS DEPORTIVAMENTE

    OpenAIRE

    F. ARBINAGA IBARZÁBAL

    2010-01-01

     

    Se analizan las relaciones entre imagen corporal y autodescripción física en mujeres que practican danza aeróbica de forma amateur frente a un grupo de mujeres sedentarias.
    La muestra se compuso de 112 mujeres activas deportivamente y 51 mujeres sedentarias.
    Los resultados al “Body Shape Questionnaire” (B.S.Q) indican que no se presentan diferencias significativas entre las mujeres...

  8. Assembly of graphene and nickel nanoparticles on anion exchange resin microspheres for the amperometric detection of carbohydrates in combination with capillary electrophoresis.

    Science.gov (United States)

    Zhang, Ren; Lu, Sijie; Zhang, Luyan; Chen, Gang

    2014-12-29

    Graphene and nickel nanoparticles (NiNPs) were assembled on anion exchange resin (AER) microspheres based on the electrostatic interaction between graphene oxide sheets and AER and the subsequent chemical reduction. The prepared AER@graphene-NiNP composite core-shell microspheres were characterized by scanning electron microscopy, energy dispersive spectroscopy, X-ray diffraction, and Fourier transform infrared spectroscopy. Moreover, they were embedded in the bores of pipette tips to fabricate electrodes. The performance of the novel electrodes was demonstrated by measuring sucrose, glucose and fructose in combination with capillary electrophoresis. The three analytes were well separated within 8min in a 40cm long capillary at a separation voltage of 12kV. The graphene-NiNP composite microsphere electrodes exhibited higher sensitivity (213.578-317.064nAmM(-1)), lower detection limits (0.75-1.05μM) and enhanced separation efficiency in the detection of these carbohydrates. The advantages of the electrodes include ease of fabrication, low cost and pronounced electrocatalytic activity toward carbohydrates, indicating great promise for a wide range of applications.

  9. Annual Energy Review 2009

    Energy Technology Data Exchange (ETDEWEB)

    Fichman, Barbara T. [USDOE Energy Information Administration (EIA), Washington, DC (United States)

    2010-08-01

    The Annual Energy Review (AER) is the U.S. Energy Information Administration's (EIA) primary report of annual historical energy statistics. For many series, data begin with the year 1949. Included are statistics on total energy production, consumption, trade, and energy prices; overviews of petroleum, natural gas, coal, electricity, nuclear energy, renewable energy, and international energy; financial and environment indicators; and data unit conversions. Publication of this report is required under Public Law 95–91 (Department of Energy Organization Act), Section 205(c), and is in keeping with responsibilities given to the EIA under Section 205(a)(2), which states: “The Administrator shall be responsible for carrying out a central, comprehensive, and unified energy data and information program which will collect, evaluate, assemble, analyze, and disseminate data and information....” The AER is intended for use by Members of Congress, Federal and State agencies, energy analysts, and the general public. EIA welcomes suggestions from readers regarding the content of the AER and other EIA publications.

  10. Annual Energy Review 2011

    Energy Technology Data Exchange (ETDEWEB)

    Fichman, Barbara T. [USDOE Energy Information Administration (EIA), Washington, DC (United States)

    2012-09-01

    The Annual Energy Review (AER) is the U.S. Energy Information Administration's (EIA) primary report of annual historical energy statistics. For many series, data begin with the year 1949. Included are statistics on total energy production, consumption, trade, and energy prices; overviews of petroleum, natural gas, coal, electricity, nuclear energy, and renewable energy; financial and environment indicators; and data unit conversions. Publication of this report is required under Public Law 95–91 (Department of Energy Organization Act), Section 205(c), and is in keeping with responsibilities given to the EIA under Section 205(a)(2), which states: “The Administrator shall be responsible for carrying out a central, comprehensive, and unified energy data and information program which will collect, evaluate, assemble, analyze, and disseminate data and information....” The AER is intended for use by Members of Congress, Federal and State agencies, energy analysts, and the general public. EIA welcomes suggestions from readers regarding the content of the AER and other EIA publications.

  11. Global renal gene expression profiling analysis in B2-kinin receptor null mice: impact of diabetes.

    Directory of Open Access Journals (Sweden)

    Miran A Jaffa

    Full Text Available Diabetic nephropathy (DN, the leading cause of end-stage renal failure, is clinically manifested by albuminuria and a progressive decline in glomerular filtration rate. The risk factors and mechanisms that contribute to the development and progression of DN are still incompletely defined. To address the involvement of bradykinin B(2-receptors (B(2R in DN, we used a genome wide approach to study the effects of diabetes on differential renal gene expression profile in wild type and B(2R knockout (B(2R(-/- mice. Diabetes was induced with streptozotocin and plasma glucose levels and albumin excretion rate (AER were measured at predetermined times throughout the 23 week study period. Longitudinal analysis of AER indicated that diabetic B(2R(-/-D null mice had a significantly decreased AER levels compared to wild type B(2R(+/+D mice (P = 0.0005. Results from the global microarray study comparing gene expression profiles among four groups of mice respectively: (B(2R(+/+C, B(2R(+/+D, B(2R(-/-C and B(2R(-/-D highlighted the role of several altered pathological pathways in response to disruption of B(2R and to the diabetic state that included: endothelial injury, oxidative stress, insulin and lipid metabolism and inflammatory process with a marked alteration in the pro-apoptotic genes. The findings of the present study provide a global genomics view of biomarkers that highlight the mechanisms and putative pathways involved in DN.

  12. Training intensities for aerobic exercise determined on untrained healthy men.

    Directory of Open Access Journals (Sweden)

    Miura,Mochiyoshi

    1995-04-01

    Full Text Available The purpose of this study was to determine the aerobic training intensity from the maximal and submaximal running exercise in 21 untrained adult men. To accomplish this, we evaluated the relationship between physiological (oxygen intake and heart rate and physical parameters (running speed of training intensity, and determined the training intensity at the submaximal exercise. Oxygen intake and heart rate were measured by a treadmill test. The maximal oxygen intake (VO2 max, and the aerobic threshold (AerT and anaerobic threshold (AT were measured to determine respiratory gas exchange. Running capacity was measured by a 12-min running and treadmill test. For the maximal exercise, there was a significant correlation (r = 0.88, P < 0.01 between VO2 max and 12-min running distance (speed. In addition, the oxygen intake and heart rate at AerT and AT in the submaximal exercise were linearly correlated with running speed. Three levels of training intensity at the submaximal exercise were termed: light, moderate, and heavy. Since AerT was the lower limit intensity and AT was the upper limit, we took the middle of their values as the moderate intensity. The end point for the determination of the training intensity at the submaximal exercise was estimated to be 85% VO2 max and 180 beats.min-1.

  13. Annual Energy Review 2005

    Energy Technology Data Exchange (ETDEWEB)

    Seiferlein, Katherine E. [USDOE Energy Information Administration (EIA), Washington, DC (United States)

    2006-07-01

    The Annual Energy Review (AER) is the Energy Information Administration's (EIA) primary report of annual historical energy statistics. For many series, data begin with the year 1949. Included are data on total energy production, consumption, and trade; overviews of petroleum, natural gas, coal, electricity, nuclear energy, renewable energy, international energy, as well as financial and environment indicators; and data unit conversion tables. Publication of this report is required under Public Law 95–91 (Department of Energy Organization Act), Section 205(c), and is in keeping with responsibilities given to the EIA under Section 205(a)(2), which states: “The Administrator shall be responsible for carrying out a central, comprehensive, and unified energy data and information program which will collect, evaluate, assemble, analyze, and disseminate data and information....” The AER is intended for use by Members of Congress, Federal and State agencies, energy analysts, and the general public. EIA welcomes suggestions from readers regarding data series in the AER and in other EIA publications.

  14. Annual Energy Review 2006

    Energy Technology Data Exchange (ETDEWEB)

    Seiferlein, Katherine E. [USDOE Energy Information Administration (EIA), Washington, DC (United States)

    2007-06-01

    The Annual Energy Review (AER) is the Energy Information Administration's (EIA) primary report of annual historical energy statistics. For many series, data begin with the year 1949. Included are data on total energy production, consumption, and trade; overviews of petroleum, natural gas, coal, electricity, nuclear energy, renewable energy, international energy, as well as financial and environment indicators; and data unit conversion tables. Publication of this report is required under Public Law 95–91 (Department of Energy Organization Act), Section 205(c), and is in keeping with responsibilities given to the EIA under Section 205(a)(2), which states: “The Administrator shall be responsible for carrying out a central, comprehensive, and unified energy data and information program which will collect, evaluate, assemble, analyze, and disseminate data and information....” The AER is intended for use by Members of Congress, Federal and State agencies, energy analysts, and the general public. EIA welcomes suggestions from readers regarding data series in the AER and in other EIA publications.

  15. Modeling Population Exposures to Pollutants Emitted from Natural Gas Cooking Burners

    Energy Technology Data Exchange (ETDEWEB)

    Lobscheid, Agnes; Singer, Brett C.; Klepeis, Neil E.

    2011-06-01

    We developed a physics-based data-supported model to investigate indoor pollutant exposure distributions resulting from use of natural gas cooking appliances across households in California. The model was applied to calculate time-resolved indoor concentrations of CO, NO2 and formaldehyde resulting from cooking burners and entry with outdoor air. Exposure metrics include 1-week average concentrations and frequency of exceeding ambient air quality standards. We present model results for Southern California (SoCal) using two air-exchange scenarios in winter: (1) infiltration-only, and (2) air exchange rate (AER) sampled from lognormal distributions derived from measurements. In roughly 40percent of homes in the SoCal cohort (N=6634) the 1-hour USEPA NO2 standard (190 ?g/m3) was exceeded at least once. The frequency of exceeding this standard was largely independent of AER assumption, and related primarily to building volume, emission rate and amount of burner use. As expected, AER had a more substantial impact on one-week average concentrations.

  16. A comparative study between all-electron scalar relativistic calculation and all-electron calculation on the adsorption of hydrogen molecule onto small gold clusters

    Indian Academy of Sciences (India)

    Xiang-Jun Kuang; Xin-Qiang Wang; Gao-Bin Liu

    2013-03-01

    A comparative study between all-electron relativistic (AER) calculation and all-electron (AE) calculation on the H2 molecule adsorption onto small gold clusters has been performed. Compared with the corresponding AuH2 cluster obtained by AE method, the AuH2 cluster obtained by AER method has much shorter Au-H bond-length, much longer H-H distance, larger binding energy and adsorption energy, higher vertical ionization potentials (VIP), greater charge transfer, higher vibrational frequency of Au-H mode and lower vibrational frequency of H-H mode. The delocalization of the highest occupied molecular orbital (HOMO) and the lowest unoccupied molecular orbital (LUMO) for AuH2 cluster obtained by AER method is obvious. All these characteristics suggest that the scalar relativistic effect might strengthen the Au-H bond and weaken the H-H bond. It is believed that the scalar relativistic effect is favourable to the H2 molecule adsorption onto small gold cluster and the reactivity enhancement of H2 molecule. It may be one of the reasons why the dissociative adsorptions take place in some AuH2 clusters. With increasing size of AuH2 clusters, the influence of scalar relativistic effect becomes more significant. Some further studies focused on the influence of scalar relativistic effect on the adsorption behaviour of other small molecules onto gold clusters are necessary in the future.

  17. Detection and distribution of putative virulence associated genes in Aeromonas species from freshwater and wastewater treatment plant.

    Science.gov (United States)

    Igbinosa, Isoken H; Okoh, Anthony I

    2013-11-01

    The detection of genes responsible for Aeromonas virulence is a vital tool in establishing the potential pathogenicity of the bacteria, as these virulence genes may act alone or in synergy in the establishment of infections. Freshwater and wastewater mixed liquor samples were collected from Kat river and Fort Beaufort wastewater treatment plant in the Eastern Cape Province of South Africa. Polymerase chain reaction was utilized for the amplification of the different genes coding for virulence. All virulence associated genes screened (alt, lip, fla, aer, ast, hlyA) were detected in at least one Aeromonas isolates. In fresh water sample, virulence genes were distributed as follows: lip (67%), aer (43%), alt (33%), fla (62%), ast (10%), and hlyA (86%), while in wastewater samples the occurrence were as follows: lip (92%), aer (21%), alt (54%), fla (83%), ast (29%), and hlyA (88%). The presence of these virulence genes in environmental Aeromonas isolates is of concern to public health as these organisms are potential pathogens in the environment and the virulence determinants could be transferred to aquatic organisms and humans by one mechanism or the other.

  18. Annual Energy Review 1993

    Energy Technology Data Exchange (ETDEWEB)

    1994-07-14

    This twelfth edition of the Annual Energy Review (AER) presents the Energy Information Administration`s historical energy statistics. For most series, statistics are given for every year from 1949 through 1993. Because coverage spans four and a half decades, the statistics in this report are well-suited to long-term trend analyses. The AER is comprehensive. It covers all major energy activities, including consumption, production, trade, stocks, and prices, for all major energy commodities, including fossil fuels and electricity. The AER also presents Energy Information Administration (EIA) statistics on some renewable energy sources. EIA estimates that its consumption series include about half of the renewable energy used in the United States. For a more complete discussion of EIA`s renewables data, see p. xix, ``Introducing Expanded Coverage of Renewable Energy Data Into the Historical Consumption Series.`` Copies of the 1993 edition of the Annual Energy Review may be obtained by using the order form in the back of this publication. Most of the data in the 1993 edition also are available on personal computer diskette. For more information about the diskettes, see the back of this publication. In addition, the data are available as part of the National Economic, Social, and Environmental Data Bank on a CD-ROM. For more information about the data bank, contact the US Department of Commerce Economics and Statistics Administration, on 202-482-1986.

  19. Effects of Aerobic Exercise Based upon Heart Rate at Aerobic Threshold in Obese Elderly Subjects with Type 2 Diabetes

    Science.gov (United States)

    Donini, Lorenzo Maria

    2015-01-01

    In obese diabetic subjects, a correct life style, including diet and physical activity, is part of a correct intervention protocol. Thus, the aim of this study was to evaluate the effects of aerobic training intervention, based on heart rate at aerobic gas exchange threshold (AerTge), on clinical and physiological parameters in obese elderly subjects with type 2 diabetes (OT2DM). Thirty OT2DM subjects were randomly assigned to an intervention (IG) or control group (CG). The IG performed a supervised aerobic exercise training based on heart rate at AerTge whereas CG maintained their usual lifestyle. Anthropometric measures, blood analysis, peak oxygen consumption (V˙O2peak), metabolic equivalent (METpeak), work rate (WRpeak), and WRAerTge were assessed at baseline and after intervention. After training, patients enrolled in the IG had significantly higher (P < 0.001) V˙O2peak, METpeak, WRpeak, and WRAerTge and significantly lower (P < 0.005) weight, BMI, %FM, and waist circumference than before intervention. Both IG and CG subjects had lower glycated haemoglobin levels after intervention period. No significant differences were found for all the other parameters between pre- and posttraining and between groups. Aerobic exercise prescription based upon HR at AerTge could be a valuable physical intervention tool to improve the fitness level and metabolic equilibrium in OT2DM patients. PMID:26089890

  20. Predominantly vegetarian diet in patients with incipient and early clinical diabetic nephropathy: effects on albumin excretion rate and nutritional status.

    Science.gov (United States)

    Jibani, M M; Bloodworth, L L; Foden, E; Griffiths, K D; Galpin, O P

    1991-12-01

    Several studies have suggested that dietary protein quality may be an important determinant in the natural history of renal disease. We have therefore studied the effects of a predominantly vegetarian diet in eight patients with Type 1 diabetes mellitus and an albumin excretion rate (AER) in excess of 30 micrograms min-1. The AER was measured after an 8-week run-in period on the patient's usual diet, and again after 8 weeks of a predominantly vegetarian diet in which the proportion of vegetable protein was supplemented in order to minimize the reduction in total dietary protein intake. The median fractional albumin clearance fell during the study from an initial value of 188 x 10(-+) (range 58-810 x 10(-4)) at the end of the run-in period to 87 x 10(-4) (23-829 x 10(-4)) at the end of the period on low animal protein diet (difference 79 x 10(-4) (95% Cl 9-149 x 10(-4)), p less than 0.05). The AER then returned to values similar to those obtained at the beginning of the study after a further 8 weeks in those patients returning to their usual diet. No significant changes in blood glucose control or in arterial pressure were observed. A predominantly vegetarian diet may therefore have important beneficial effects on diabetic nephropathy without the need for a heavily restricted total protein intake.

  1. Annual Energy Review 2000

    Energy Technology Data Exchange (ETDEWEB)

    Seiferlein, Katherine E. [USDOE Energy Information Administration (EIA), Washington, DC (United States)

    2001-08-01

    The Annual Energy Review (AER) presents the Energy Information Administration’s historical energy statistics. For many series, statistics are given for every year from 1949 through 2000. The statistics, expressed in either physical units or British thermal units, cover all major energy activities, including consumption, production, trade, stocks, and prices, for all major energy commodities, including fossil fuels, electricity, and renewable energy sources. Publication of this report is required under Public Law 95–91 (Department of Energy Organization Act), Section 205(c), and is in keeping with responsibilities given to the Energy Information Administration under Section 205(a)(2), which states: “The Administrator shall be responsible for carrying out a central, comprehensive, and unified energy data and information program which will collect, evaluate, assemble, analyze, and disseminate data and information....” The AER is intended for use by Members of Congress, Federal and State agencies, energy analysts, and the general public. EIA welcomes suggestions from readers regarding data series in the AER and in other EIA publications.

  2. Annual Energy Review 2004

    Energy Technology Data Exchange (ETDEWEB)

    Seiferlein, Katherine E. [USDOE Energy Information Administration (EIA), Washington, DC (United States)

    2005-08-01

    The Annual Energy Review (AER) is the Energy Information Administration's (EIA) primary report of annual historical energy statistics. For many series, data begin with the year 1949. Included are data on total energy production, consumption, and trade; overviews of petroleum, natural gas, coal, electricity, nuclear energy, renewable energy, international energy, as well as financial and environment indicators; and data unit conversion tables. Publication of this report is required under Public Law 95–91 (Department of Energy Organization Act), Section 205(c), and is in keeping with responsibilities given to the EIA under Section 205(a)(2), which states: “The Administrator shall be responsible for carrying out a central, comprehensive, and unified energy data and information program which will collect, evaluate, assemble, analyze, and disseminate data and information....” The AER is intended for use by Members of Congress, Federal and State agencies energy analysts, and the general public. EIA welcomes suggestions from readers regarding data series in the AER and in other EIA publications.

  3. Annual Energy Review 1997

    Energy Technology Data Exchange (ETDEWEB)

    Seiferlein, Katherine E. [USDOE Energy Information Administration (EIA), Washington, DC (United States)

    1998-07-01

    The Annual Energy Review (AER) presents the Energy Information Administration’s historical energy statistics. For many series, statistics are given for every year from 1949 through 1997. The statistics, expressed in either physical units or British thermal units, cover all major energy activities, including consumption, production, trade, stocks, and prices, for all major energy commodities, including fossil fuels, electricity, and renewable energy sources. Publication of this report is in keeping with responsibilities given to the Energy Information Administration (EIA) in Public Law 95–91 (Department of Energy Organization Act), which states, in part, in Section 205(a)(2) that: “The Administrator shall be responsible for carrying out a central, comprehensive, and unified energy data and information program which will collect, evaluate, assemble, analyze, and disseminate data and information....” The AER is intended for use by Members of Congress, Federal and State agencies, energy analysts, and the general public. EIA welcomes suggestions from readers regarding data series in the AER and in other EIA publications.

  4. High pressure air jet in the endoscopic preparation room: risk of noise exposure on occupational health.

    Science.gov (United States)

    Chiu, King-Wah; Lu, Lung-Sheng; Wu, Cheng-Kun

    2015-01-01

    After high-level disinfection of gastrointestinal endoscopes, they are hung to dry in order to prevent residual water droplets impact on patient health. To allow for quick drying and clinical reuse, some endoscopic units use a high pressure air jet (HPAJ) to remove the water droplets on the endoscopes. The purpose of this study was to evaluate the excessive noise exposure with the use of HPAJ in endoscopic preparation room and to investigate the risk to occupational health. Noise assessment was taken during 7 automatic endoscopic reprocessors (AERs) and combined with/without HPAJ use over an 8-hour time-weighted average (TWA). Analytical procedures of the NIOSH and the ISO for noise-induced hearing loss were estimated to develop analytic models. The peak of the noise spectrum of combined HPAJ and 7 AERs was significantly higher than that of the 7 AERs alone (108.3 ± 1.36 versus 69.3 ± 3.93 dBA, P risk of hearing loss (HL > 2.5 dB) was 2.15% at 90 dBA, 11.6% at 95 dBA, and 51.3% at 100 dBA. The odds ratio was 49.1 (95% CI: 11.9 to 203.6). The noise generated by the HPAJ to work over TWA seriously affected the occupational health and safety of those working in an endoscopic preparation room.

  5. Rhodiola-induced inhibition of adipogenesis involves antioxidant enzyme response associated with pentose phosphate pathway.

    Science.gov (United States)

    Lee, Ok-Hwan; Kwon, Young-In; Apostolidis, Emmanouil; Shetty, Kalidas; Kim, Young-Cheul

    2011-01-01

    The aim of this study was to investigate whether Rhodiola crenulata extract and tyrosol, a major bioactive phenolic compound present in Rhodiola, change the activities of endogenous antioxidant enzyme response (AER) and energy pathways linked to proline-mediated pentose phosphate pathway (PPP) during adipogenesis. Treatment with Rhodiola extracts inhibited the activities of proline dehydrogenase (PDH) and glucose-6-phosphate dehydrogenase (G6PDH) as well as lipid accumulation and reactive oxygen species (ROS) production. The inhibition of PDH and G6PDH activities by Rhodiola likely prevented proline oxidation required for critical ATP generation that is coupled to AER via the PPP, leading to inhibition of adipogenesis. Rhodiola extracts dose-dependently increased superoxide dismutase (SOD) activity, resulting in a reduced ROS level during adipogenesis. Moreover, the effects of tyrosol, a major bioactive compound in Rhodiola species, were directly correlated with all observed effects by Rhodiola extracts. These results indicate that the antiadipogenic effects of Rhodiola extracts can be attributed to a phenolic tyrosol that may potentially disrupt proline-mediated energy generation and AER via PPP, resulting in the suppression of adipogenesis and lipid accumulation. This further provides a biochemical rationale to identify the roles of phenolics that modulate the cellular redox environment and therefore have relevance for obesity management.

  6. Microalbuminuria among Type 1 and Type 2 diabetic patients of African origin in Dar Es Salaam, Tanzania

    Directory of Open Access Journals (Sweden)

    Thordarson Hrafnkell

    2007-01-01

    Full Text Available Abstract Background The prevalences and risk factors of microalbuminuria are not full described among black African diabetic patients. This study aimed at determining the prevalence of microalbuminuria among African diabetes patients in Dar es Salaam, Tanzania, and relate to socio-demographic features as well as clinical parameters. Methods Cross sectional study on 91 Type 1 and 153 Type 2 diabetic patients. Two overnight urine samples per patient were analysed. Albumin concentration was measured by an automated immunoturbidity assay. Average albumin excretion rate (AER was used and were categorised as normalbuminuria (AER 200 ug/min. Information obtained also included age, diabetes duration, sex, body mass index, blood pressure, serum total cholesterol, high-density and low-density lipoprotein cholesterol, triglycerides, serum creatinine, and glycated hemoglobin A1c. Results Overall prevalence of microalbuminuria was 10.7% and macroalbuminuria 4.9%. In Type 1 patients microalbuminuria was 12% and macroalbuminuria 1%. Among Type 2 patients, 9.8% had microalbuminuria, and 7.2% had macroalbuminuria. Type 2 patients with abnormal albumin excretion rate had significantly longer diabetes duration 7.5 (0.2–24 yrs than those with normal albumin excretion rate 3 (0–25 yrs, p No significant differences in body mass index, glycaemic control, and cholesterol levels was found among patients with normal compared with those with elevated albumin excretion rate either in Type 1 or Type 2 patients. A stepwise multiple linear regression analysis among Type 2 patients, revealed AER (natural log AER as the dependent variable to be predicted by [odds ratio (95% confidence interval] diabetes duration 0.090 (0.049, 0.131, p Conclusion The prevalence of micro and macroalbuminuria is higher among African Type 1 patients with relatively short diabetes duration compared with prevalences among Caucasians. In Type 2 patients, the prevalence is in accordance with

  7. Mixed Martial Arts: rotinas de condicionamento e avaliação da aptidão física de lutadores de Pelotas/RS

    Directory of Open Access Journals (Sweden)

    Fabrício Boscolo del Vecchio

    2013-09-01

    Full Text Available O Mixed Martial Arts (MMA carece de informações acerca do sistema de treinos e da aptidão física de seus lutadores, os quais necessitam de elevado condicionamento aeróbio e neuromuscular. Assim, objetivou-se registrar as rotinas de treinamento e mensurar a aptidão física de lutadores de MMA de nível regional. Oito competidores da cidade de Pelotas/RS constituíram a amostra. Realizaram-se: i entrevista semi-estruturada, contendo dez perguntas abertas, ii avaliação neuromuscular, com testes de carga máxima (1RM no supino reto e levantamento terra, e iii avaliação do componente aeróbio, a partir da determinação da velocidade no VO2máx (vVO2máx, cálculo da potência aeróbia máxima (VO2máx e quantificação do tempo limite (TLim. Os resultados indicam que a maioria dos lutadores de Pelotas realiza apenas dois treinos semanais específicos, não utiliza o treinamento de pesos e emprega corridas nas suas sessões de treino. Acerca da aptidão física, os atletas têm IMC de 26,19±26,19 kg/m², 9,47±4,06% de gordura corporal, 1RM de 76,25±10,61 kg no supino reto e de 115±10,69 kg no levantamento terra, VO2máx de 52,5±4,95mL·kg-1·min-1, vVO2máx de 15±1,41 km·h-1 e TLim de 360,75±55 segundos. Conclui-se que a frequência de treinos aeróbios e de força destes lutadores é insuficiente para o MMA, o percentual de gordura corporal deles é baixo e, apesar da aptidão aeróbia moderada, os níveis de força absoluta e relativa destes lutadores são inferiores aos apresentados pela literatura.

  8. APTITUD FÍSICA CARDIORRESPIRATORIA Y RIESGO CARDIOMETABÓLICO EN PERSONAS ADULTAS JÓVENES

    Directory of Open Access Journals (Sweden)

    Jeremías D Secchi

    2013-01-01

    Full Text Available Fundamentos: La evaluación del VO2max permite clasificar a los sujetos según el riesgo para la salud. Sin embargo los factores que pueden afectar a las clasificaciones han sido poco estudiados. El objetivo de esta investigación fue determinar si el tipo de ecuación predictiva del VO2max y los criterios de referencia del Fitnessgram® modifican la proporción de adultos jóvenes clasificados con un nivel de capacidad aeróbica indicativo de riesgo cardiometabólico. Métodos: El diseño del estudio fue observacional, relacional y de corte transversal. Participaron voluntariamente 240 adultos jóvenes. El VO2max fue estimado mediante el test de Course Navette aplicando 9 ecuaciones predictivas. Las diferencias en las clasificaciones fueron analizadas con la prueba Q de Cochran y la de MacNemar. Resultados: El nivel de capacidad aeróbica indicativo de riesgo cardiometabólico osciló entre 7,1% y 70,4% según el tipo de ecuación predictiva y el criterio de referencia utilizado (p<0,001. Independientemente del la ecuación predictiva del VO2max y el criterio de referencia aplicado;una mayor proporción de mujeres, del 29,4% al 85,3%, fueron clasificadas con un nivel no saludable de capacidad aeróbica frente al 4,8% a 51% en varones (p<0,001. En ambos sexos, los viejos criterios de referencia clasificaron a una menor proporción de hombres (del 4,8% al 48,1% y mujeres (del 39,4% al 68,4% con capacidad aeróbica no saludable, independientemente de la ecuación aplicada (p<0,001. Conclusiones: El tipo de ecuación predictiva del VO2max y los criterios de referencia del Fitnessgram® modifican las clasificaciones de adultos jóvenes con un nivel de capacidad aeróbica saludable o de riesgo cardiometabólico.

  9. Are Medications Involved in Vision and Intracrancial Pressure Changes Seen in Spaceflight?

    Science.gov (United States)

    Faust, K. M.; Wotring, V. E.

    2014-01-01

    The Food and Drug Association Adverse Event Reports (FDA AER) from 2009-2011 were used to create a database from millions of known and suspected medication-related adverse events among the general public. Vision changes, sometimes associated with intracranial pressure changes (VIIP), have been noted in some long duration crewmembers. Changes in vision and blood pressure (which can subsequently affect intracranial pressure) are fairly common side effects of medications. The purpose of this study was to explore the possibility of medication involvement in crew VIIP symptoms. Reports of suspected medication-related adverse events may be filed with the Food and Drug Administration (FDA) by medical professionals or consumers. Quarterly compilations of these reports are available for public download. Adverse Event Reporting System (AERS) reports from 1/1/2009- 6/30/2012 were downloaded and compiled into a searchable database for this study. Reports involving individuals under the age of 18 and older than 65 were excluded from this analysis. Case reports involving chronic diseases such as cancer, diabetes, multiple sclerosis and other serious conditions were also excluded. A scan of the medical literature for medication-related VIIP-like adverse events was used to create a list of suspect medications. These medications, as well as certain medications used frequently by ISS crew, were used to query the database. Queries for use of suspected medications were run, and the nature of the symptoms reported in those cases were tabulated. Symptoms searched in the FDA AERS were chosen to include the typical symptoms noted in crewmembers with VIIP. Vision symptoms searched were: visual acuity reduced, visual impairment, and vitreous floaters. Pressure changes included: abnormal sensation in eye, intracranial pressure increased, intraocular pressure increased, optic neuritis, optic neuropathy, and papilloedema. Limited demographic information is included with the FDA AERS; relevant

  10. Data Mining of Association between Oral Terbinafine Hydrochloride and Hearing Impairment%口服盐酸特比萘芬与听力障碍相关性数据挖掘研究

    Institute of Scientific and Technical Information of China (English)

    李梅; 曹玉莹; 王丽伟

    2016-01-01

    Objective: To detect the adverse event signal between oral terbinafine hydrochloride and hearing impairment.Methods:AERS-DM is a knowledge-aggregated database of the adverse events after de-duplicating, normalizing the FDA AERS da-ta.This study used the method of proportional reporting ratio, reporting odds ratio for data mining.Using the PRR, a signal is de-tected if the number of co-occurrences is 3 or more and the PRR is 2 or more with an associated χ2 value of 4 or more.For the ROR, a signal is detected, if the lower limit of the 95% two-sided confidence interval exceeds 1.Results: The result shows ad-verse event signals PRR and ROR are detected.The PRR=3.77>2,χ2 =20.39 >4,the number of co-occurrences is more than 3, a signal is detected.The ROR=3.78, the 95% two-sided confidence interval is (2.03,7.03), the lower limit exceeds 1, a signal is detected.Conclusion:The result shows there is association between oral terbinafine hydrochloride and hearing impairment in AERS-DM by detecting the adverse event signal.%目的:检测口服盐酸特比萘芬引起听力障碍的药品不良反应信号。方法:AERS-DM是对美国不良反应报告系统AERS数据进行去重、标准化与知识聚合的不良反应数据库,本研究在AERS-DM中进行数据挖掘,计算不良反应信号比例报告比值比( proportional ADR reporting ratio,PRR)和报告比值比( reporting odds ratio,ROR)。 PRR的判定标准为:当药物引起不良反应例数>3,PRR≥2,四格表χ2≥4,则提示生成不良反应信号。 ROR的判定标准为:当ROR95%可信区间下限>1则提示生成不良反应信号。结果:检测到PRR和ROR不良反应信号。 PRR=3.77>2,χ2=20.39>4,药物引起不良反应例数>3,提示生成不良反应信号;ROR=3.78,ROR的95%可信区间(2.03,7.03),下限>1,提示生成不良反应信号。结论:基于AERS-DM数据检测不良反应信号结果表明口服盐酸特比萘

  11. Effects of quorum sensing system lasR/rhlR gene on the expression of Foxp3, TGF-β1 and IL-10 of lung tissue in tracheal intubation model rat with Pseudomonas aeruginosa biofilm infection

    Directory of Open Access Journals (Sweden)

    Qing-qing XIANG

    2016-03-01

    Full Text Available Objective  To investigate the effects of lasR/rhlR gene on Foxp3, TGF-β1 and IL-10 of lung tissue in rat tracheal intubation model with biofilm infection of Pseudomonas aeruginosa (Ps. aer wild strain (PAO1 and quorum sensing (QS deficient strain (ΔlasRΔrhlR. Methods  Twenty-one SD rats were randomly assigned into 3 groups (7 each: ΔlasRΔrhlR-treated group, PAO1-treated group and sterile control group. Biofilms (BF were cultured in vitro, and the BF coated tube (infected respectively with Ps. aer PAO1 strain, ΔlasRΔrhlR strain, or with asepsis was inserted into the trachea to establish the rat model. The rats were sacrificed on the 7th day after intubation. Colony count of lung tissue homogenate (cfu and lung HE staining were performed, and IL-10 content in bronchoalveolar lavage fluid (BALF, TGF-β1 in lung tissue, and the expression of Foxp3 mRNA in lung cells were determined. Results  The bacterial counts were significantly higher in PAO1 and ΔlasRΔrhlR groups than that in sterile control group, and the counts were obviously higher in PAO1 group (10 400.00±6313.70/g lung tissue than that in ΔlasRΔrhlR group (975.00±559.97/g lung tissue, P<0.05. There was no significant pathological changes in lung tissue in sterile control group, while the bronchi and blood vessels in PAO1 group were infiltrated by a large number of inflammatory cells and complicated with alveolar septum thickening and local abscess and necrosis. The pathological changes were milder in ΔlasRΔrhlR group than in PAO1 group; the expression of Foxp3 mRNA was higher in the two Ps. aer infected groups than that in sterile control group (0.65±0.32, and it was significantly higher in PAO1 group (4.62±1.07 than in ΔlasRΔrhlR group (2.15±1.43, P<0.05. The accumulated optical density value of TGF-β1 was significantly higher in the two Ps. aer infected groups than in sterile control group (3721.66±1412.95, and significantly higher in PAO1 group (65 090.56±33

  12. RELACIÓN ENTRE ESTATUS PONDERAL, NIVEL DE CONDICIÓN FÍSICA Y COMPONENTES DE LA PRESIÓN ARTERIAL EN MUJERES DE ENTRE 18 Y 30AÑOS DE EDAD

    Directory of Open Access Journals (Sweden)

    Ignacio Ortiz-Galeano

    2012-01-01

    Full Text Available Fundamentos: Hasta donde conocemos, la relación entre la obesidad, la capacidad aeróbica y la fuerza muscular con la presión arterial (PA no se ha analizado conjuntamente. Nuestro objetivo fue estimar la relación entre el estatus ponderal y la condición física con los componentes de la PA en mujeres jóvenes. Métodos: Estudio transversal en 407 mujeres de 18-30 años. Se evaluó: peso, talla, índice de masa corporal (IMC, presión arterial sistólica (PAS, diastólica (PAD, media (PAM:PAD+[0,333x(PASPAD], y de pulso (PP: PAS-PAD y condición física (capacidad aeróbica y fuerza muscular. Resultados: La edad media de las participantes fue de 20,1± 4,4 años. La media de la PAS, PAD, PAM y de PP fue respectivamente: en las mujeres con normopeso 108,0±8,9, 67,7±6,7, 81,1±6,8 y 40,3±6,6 mmHg; en las mujeres con obesidad 123,1±8,9, 80,5±6,2, 94,7±6,5 y 42,5±6,2 mmHg; en las que tienen capacidad aeróbica baja 110,9±9,9, 70,5±7,6, 84,0±7,7 y 40,3±7,3 mmHg; y en las que tienen capacidad aeróbica alta 107,4±9,3, 67,0±7,0, 80,4±7,2 y 40,4±6,6 mmHg. La fuerza muscular no se asoció estadísticamente con ninguno de los componentes de PA (p>0,05. En modelos de regresión lineal múltiple la PAS se asoció con el IMC y el índice de fuerza muscular (p= ≤0,05; la PAD y la PAM con el IMC, el índice de fuerza muscular y la capacidad aeróbica (p= ≤0,05; y la PP con el IMC (p= <0,05. Conclusiones: En mujeres jóvenes el IMC y la fuerza muscular mantienen una relación directa con la PA, y la capacidad aeróbica una relación inversa, si bien esta última no se asocia con la PAS ni con la PP.

  13. BMP-mediated functional cooperation between Dlx5;Dlx6 and Msx1;Msx2 during mammalian limb development.

    Directory of Open Access Journals (Sweden)

    Maxence Vieux-Rochas

    Full Text Available The Dlx and Msx homeodomain transcription factors play important roles in the control of limb development. The combined disruption of Msx1 and Msx2, as well as that of Dlx5 and Dlx6, lead to limb patterning defects with anomalies in digit number and shape. Msx1;Msx2 double mutants are characterized by the loss of derivatives of the anterior limb mesoderm which is not observed in either of the simple mutants. Dlx5;Dlx6 double mutants exhibit hindlimb ectrodactyly. While the morphogenetic action of Msx genes seems to involve the BMP molecules, the mode of action of Dlx genes still remains elusive. Here, examining the limb phenotypes of combined Dlx and Msx mutants we reveal a new Dlx-Msx regulatory loop directly involving BMPs. In Msx1;Dlx5;Dlx6 triple mutant mice (TKO, beside the expected ectrodactyly, we also observe the hallmark morphological anomalies of Msx1;Msx2 double mutants suggesting an epistatic role of Dlx5 and Dlx6 over Msx2. In Msx2;Dlx5;Dlx6 TKO mice we only observe an aggravation of the ectrodactyly defect without changes in the number of the individual components of the limb. Using a combination of qPCR, ChIP and bioinformatic analyses, we identify two Dlx/Msx regulatory pathways: 1 in the anterior limb mesoderm a non-cell autonomous Msx-Dlx regulatory loop involves BMP molecules through the AER and 2 in AER cells and, at later stages, in the limb mesoderm the regulation of Msx2 by Dlx5 and Dlx6 occurs also cell autonomously. These data bring new elements to decipher the complex AER-mesoderm dialogue that takes place during limb development and provide clues to understanding the etiology of congenital limb malformations.

  14. EFFECTS OF TRAINING AND DETRAINING ON GLYCOSYLATED HAEMOGLOBIN, GLYCAEMIA AND LIPID PROFILE IN TYPE-II DIABETICS.

    Science.gov (United States)

    Yuing Farias, Tuillang; Santos-Lozano, Alejandro; Solís Urra, Patricio; Cristi-Montero, Carlos

    2015-10-01

    Objetivo: el propósito del presente estudio fue determinar el efecto del entrenamiento y las consecuencias del desentrenamiento comparando un protocolo de entrenamiento aeróbico (E-Aer) y otro de sobrecarga (E-Sob). Métodos: participaron 30 personas entre 45-50 años de edad con diagnóstico de diabetes mellitus tipo II (DMII) sin tratamiento farmacológico. Fueron aleatorizados a un grupo de E-Aer (65% de su esfuerzo máximo) o a un grupo de E-Sob (protocolo 1 x 2 x 3 al 65% de 1RM). Se midió el peso, el índice de masa corporal, el colesterol total, HDL-C, LDL-C, triglicéridos, glucemia en ayuno y la hemoglobina glucosilada (HbA1C) al inicio, al finalizar las seis semanas de entrenamiento y tras seis semanas de desentrenamiento. Resultados: los resultados indican que ambos protocolos de entrenamiento físico son capaces de inducir modificaciones significativas en el perfil lipídico, la glicemia en ayuno y los niveles de HbA1C; sin embargo, solo el grupo E-Sob demostró mantener los beneficios logrados tras haber interrumpido el programa de entrenamiento en la reducción del LDL-C, HbA1C y en el incremento del HDL-C. Conclusiones: el ejercicio de sobrecarga en personas con DMII influye de manera importante en la salud, efecto que podría mantenerse incluso si se llega a interrumpir a corto plazo el programa de entrenamiento.

  15. The stress-buffering effect of acute exercise: Evidence for HPA axis negative feedback.

    Science.gov (United States)

    Zschucke, Elisabeth; Renneberg, Babette; Dimeo, Fernando; Wüstenberg, Torsten; Ströhle, Andreas

    2015-01-01

    According to the cross-stressor adaptation hypothesis, physically trained individuals show lower physiological and psychological responses to stressors other than exercise, e.g. psychosocial stress. Reduced stress reactivity may constitute a mechanism of action for the beneficial effects of exercise in maintaining mental health. With regard to neural and psychoneuroendocrine stress responses, the acute stress-buffering effects of exercise have not been investigated yet. A sample of highly trained (HT) and sedentary (SED) young men was randomized to either exercise on a treadmill at moderate intensity (60-70% VO2max; AER) for 30 min, or to perform 30 min of "placebo" exercise (PLAC). 90 min later, an fMRI experiment was conducted using an adapted version of the Montreal Imaging Stress Task (MIST). The subjective and psychoneuroendocrine (cortisol and α-amylase) changes induced by the exercise intervention and the MIST were assessed, as well as neural activations during the MIST. Finally, associations between the different stress responses were analysed. Participants of the AER group showed a significantly reduced cortisol response to the MIST, which was inversely related to the previous exercise-induced α-amylase and cortisol fluctuations. With regard to the sustained BOLD signal, we found higher bilateral hippocampus (Hipp) activity and lower prefrontal cortex (PFC) activity in the AER group. Participants with a higher aerobic fitness showed lower cortisol responses to the MIST. As the Hipp and PFC are brain structures prominently involved in the regulation of the hypothalamus-pituitary-adrenal (HPA) axis, these findings indicate that the acute stress-buffering effect of exercise relies on negative feedback mechanisms. Positive affective changes after exercise appear as important moderators largely accounting for the effects related to physical fitness.

  16. Factors Associated with the Decline of Kidney Function Differ among eGFR Strata in Subjects with Type 2 Diabetes Mellitus

    Directory of Open Access Journals (Sweden)

    Shu Meguro

    2012-01-01

    Full Text Available Introduction. There is no report about risk factors for renal deterioration according to the clinical stage, divided by the estimated glomerular filtration rate (eGFR in type 2 diabetes. Materials and Methods. We evaluated the factors correlated with the annual eGFR decline in 1303 subjects with type 2 diabetes whose eGFR was ≥30 mL/min/1.73 m2. eGFR strata were defined by baseline eGFR value as follows: stratum 1: ≥90, stratum 2: ≥60, <90, and stratum 3: ≥30, <60. Results. The annual eGFR decline was 2.3±5.4 mL/min/1.73 m2 in overall subjects. Multiple linear regression analysis demonstrated that age, male sex, systolic blood pressure, logarithmically transformed albumin excretion rate (AER, eGFR strata, and hemoglobin concentration were significantly correlated with the annual eGFR decline. When stratified by eGFR, the factors that showed a significant correlation were different among eGFR strata. AER was significantly correlated with annual eGFR decline in all eGFR strata. Hemoglobin concentration showed a significant correlation only in the advanced eGFR stratum. Conclusion. The factors correlated with the annual eGFR decline were different among eGFR strata in type 2 diabetes mellitus, and hemoglobin concentration and AER were important factors for renal deterioration, especially in the advanced eGFR stratum.

  17. Condición física, adiposidad y autoconcepto en adolescentes. Estudio piloto

    Directory of Open Access Journals (Sweden)

    Alejandro Garc\\u00EDa-S\\u00E1nchez

    2013-01-01

    Full Text Available Un alto índice de masa corporal y una baja capacidad aeróbica se asocia con un peor autoconcepto. Se ha observado también que personas obesas pero con buena forma física están físicamente sanos, fenómeno conocido como “fat but fit”. El presente estudio pretende: 1 determinar la relación entre cantidad de grasa corporal y principales componentes de la condición física con el autoconcepto en adolescentes; 2 testar si el fenómeno fat but fit se asocia con un mejor autoconcepto. Un total de 69 adolescentes (14.68 ± 1.36 años participaron en la evaluación de la composición corporal y la condición física (Batería ALPHA-Fitness. La capacidad aeróbica (forma vs. no en forma e índice de masa corporal (normo-peso vs. sobrepeso-obesidad fueron categorizadas usando criterios estándar. Cinco dimensiones del autoconcepto fueron evaluadas mediante el Cuestionario de Autoconcepto Forma 5. La grasa total y central se correlacionó negativamente con el autoconcepto físico, mientras que la condición física (fuerza, velocidad-agilidad y capacidad aeróbica se correlacionó positivamente (p .3. Los resultados confirman la paradoja fat but fit, el sobrepeso se asocia a un peor autoconcepto físico, pero si se tiene una buena forma física los valores de autoconcepto se igualan a los de los adolescentes con normo-peso.

  18. Impact of pulmonary vein isolation on atrial vagal activity and atrial electrical remodeling

    Institute of Scientific and Technical Information of China (English)

    Yingxue Dong; Shulong Zhang; Lianjun Gao; Hongwei Zhao; Donghui Yang; Yunlong Xia; Yanzong Yang

    2008-01-01

    Objective Mechanisms of pulmonary vein isolation (PVI) for atrial fibrillation remain controversy.This study aimed to investigate the impact of PVI on vagal modulation to atria.Methods Eighteen adult mongrel dogs under general anesthesia were randomly divided into two groups.Bilateral cervical sympathovagal trunks were decentralized and sympathetic effects was blocked by metoprolol administration.Atrial electrical remodeling (AER) was established by rapid right atrial pacing at the rate of 600 bpm for 30 minutes.PVI was performed in group A.Atrial effective refractory period (ERP),vulnerability window (VW) of atrial fibrillation,and sinus rhythm cycle length (SCL) were measured at baseline and during vagal stimulation before and after atrial rapid pacing with and without PVI at fight atrial appendage (RAA),left atrial appendage (LAA),distal coronary sinus (CSd) and proximal coronary sinus (CSp).Results (1) Effects of PVI on vagal modulation:Shortening of SCL during vagal stimulation decreased significantly after PVI compared with that before PVI in group A (P<0.001).Shortening of ERP during vagal stimulation decreaseed significantly after PVI compared with that before PVI (P<0.05).VW of atrial fibrillation during vagal stimulation decreased significantly after PVI compared with that before PVI (P<0.05).(2) Effects of PVI on AER:shortening of ERP before and after atrial rapid pacing increased significantly at baseline and vagal stimulation in group B compared with that in group A (P<0.05).VW during vagal stimulation increased significantly after atrial rapid pacing in group B (P<0.05).Conclusion PVI attenuates the vagal modulation to the atria,thereby decreases the susceptibility to atrial fibrillation mediated by vagal activity.PVI releases AER,which maybe contributes to the vagal denervation.Our study indicates that PVI not only can eradicate triggered foci but also modify substrates for AF.(J Geriatr Cardiol 2008;5:28-32)

  19. Occurrence of motile Aeromonas in municipal drinking water and distribution of genes encoding virulence factors.

    Science.gov (United States)

    Pablos, Manuel; Rodríguez-Calleja, Jose M; Santos, Jesús A; Otero, Andrés; García-López, María-Luisa

    2009-10-31

    Aeromonas-associated cases of gastroenteritis are generally considered waterborne. The purpose of this study was to evaluate the potential microbiological risk associated with the presence of these bacteria in public drinking water. Over a period of one year, 132 drinking-water samples were monitored in León (NW of Spain, 137,000 inhabitants) for mandatory drinking-water standards and the occurrence of Aeromonas spp. Samples were taken at the municipal water treatment plant, one storage facility, and two public artesian drinking-water fountains. Because of low numbers of coliforms or Clostridium perfringens, the non-compliance rate with microbial standards was 3.8% whereas the percentage of positive samples for motile mesophilic Aeromonas was 26.5%. For all but two samples, Aeromonas was recovered between October and early March when the temperature was below 14 degrees C and the residual chlorine ranged from 0.21 to 0.72 mg/l. An apparent relationship was observed between rainfall and the incidence of Aeromonas. The 35 selected Aeromonas isolates were identified as A. caviae and A. media. The alt and laf genes were present in all isolates, the aerA gene was present in six isolates, and the four remaining genes investigated (hlyA, ast, stx1 and stx2) were absent. The combinations of putative virulence genes were: aerA(-)/hlyA(-)/alt(+)/ast(-)/laf(+)/stx1(-)/stx2(-) (82.9%) and aerA(+)/hlyA(-)/alt(+)/ast(-)/laf(+)/stx1(-)/stx2(-) (17.1%). None of the isolates bore plasmids. As Aeromonas strains harbouring two or more virulence-associated genes have the potential to cause disease by direct transmission via drinking water or by water use in food preparation, it would be advisable to control excessive numbers of these bacteria in drinking-water supplies.

  20. Twist1 activity thresholds define multiple functions in limb development.

    Science.gov (United States)

    Krawchuk, Dayana; Weiner, Shoshana J; Chen, You-Tzung; Lu, Benson C; Costantini, Frank; Behringer, Richard R; Laufer, Ed

    2010-11-01

    The basic helix-loop-helix transcription factor Twist1 is essential for normal limb development. Twist1(-/-) embryos die at midgestation. However, studies on early limb buds found that Twist1(-/-) mutant limb mesenchyme has an impaired response to FGF signaling from the apical ectodermal ridge, which disrupts the feedback loop between the mesenchyme and AER, and reduces and shifts anteriorly Shh expression in the zone of polarizing activity. We have combined Twist1 null, hypomorph and conditional alleles to generate a Twist1 allelic series that survives to birth. As Twist1 activity is reduced, limb skeletal defects progress from preaxial polydactyly to girdle reduction combined with hypoplasia, aplasia or mirror symmetry of all limb segments. With reduced Twist1 activity there is striking and progressive upregulation of ectopic Shh expression in the anterior of the limb, combined with an anterior shift in the posterior Shh domain, which is expressed at normal intensity, and loss of the posterior AER. Consequently limb outgrowth is initially impaired, before an ectopic anterior Shh domain expands the AER, promoting additional growth and repatterning. Reducing the dosage of FGF targets of the Etv gene family, which are known repressors of Shh expression in anterior limb mesenchyme, strongly enhances the anterior skeletal phenotype. Conversely this and other phenotypes are suppressed by reducing the dosage of the Twist1 antagonist Hand2. Our data support a model whereby multiple Twist1 activity thresholds contribute to early limb bud patterning, and suggest how particular combinations of skeletal defects result from differing amounts of Twist1 activity.

  1. LOS EFECTOS DE UN PROGRAMA DE ACTIVIDAD FÍSICA AERÓBICA SOBRE EL ESTADO DE ÁNIMO EN MUJERES PREMENOPÁUSICAS [The effects of an aerobic exercise program on the mood states of premenopausal women

    Directory of Open Access Journals (Sweden)

    Almudena Ramírez Balas

    2012-06-01

    Full Text Available La relación entre ejercicio físico y estado de ánimo es cada vez más importante en las investigaciones. La mayoría informa de los beneficios del ejercicio sobre la salud física, y no sobre el estado de ánimo. Este estudio pretende conocer los cambios que provoca un programa de actividad física aeróbica sobre el estado de ánimo en mujeres premenopáusicas. Participaron 20 mujeres premenopáusicas, separadas en 2 grupos: menores de 35 años (n=10 y mayores de 35 años (n=10. Los sujetos fueron sometidos a una valoración del estado de ánimo antes y al final del programa. El programa de intervención duró 5 meses, con una frecuencia de 3 sesiones por semana y una duración de 60 minutos por sesión. La intensidad del ejercicio fue del 60 - 70% de la frecuencia cardíaca máxima de reserva. Los resultados indican mejoras en el vigor y en la angustia en mujeres mayores de 35 años premenopáusicas, mientras que en las menores de 35 años no hubo cambios significativos. El estudio concluye que un programa de actividad física aeróbica basado en la práctica de aeróbic, step y tonificación mejora el estado de ánimo de mujeres mayores de 35 años premenopáusicas.

  2. DETERMINAÇÃO DA QUALIDADE DO MEL

    Directory of Open Access Journals (Sweden)

    Crispin Humberto GARCIA-CRUZ

    2009-07-01

    Full Text Available

    RESUMO: Foi determinada a qualidade do mel por meio da realização de análises microbiológicas e químicas de vinte amostras de mel (100% de consumo imediato comercializadas no varejo por pequenos apicultores e feirantes da região de São José do Rio Preto, Estado de São Paulo. Foi realizada a contagem de bactérias aeróbias termófilas; contagem de bolores e leveduras e a pesquisa de Salmonella sp. Os resultados das análises microbiológicas das amostras de mel mostraram que as contagens de bactérias aeróbias mesófilas variaram de 0,5 x 101 a 2,2 x 102 UFC/g; já as contagens de bactérias aeróbias termófilas variaram de 0,5 x 101 a 1,4 x 102 UFC/g. Foi detectada a presença de salmonella sp, em apenas uma das amostras analisadas (5%, não atendendo, portanto, ao padrão de ausência em 25g de amostra. Com relação às análises químicas verificou-se que a média da acidez titulável foi de 2,28% (v/p com variação de 1,19% a 3,33% (v/p. De acordo com os resultados obtidos 40% das amostras foram classificadas como mel de mesa e 60% como mel industrial. A análise global dos resultados revelou a adição de glicose comercial em algumas amostras analisadas. PALAVRAS-CHAVE: Mel; qualidade; microbiologia; análise.

  3. Circulating thrombomodulin and hematological alterations in type 2 diabetic patients with retinopathy.

    Science.gov (United States)

    Fujiwara, Y; Tagami, S; Kawakami, Y

    1998-01-01

    To clarify the relationship between circulating thrombomodulin (TM) and endothelial cell damage in diabetes mellitus, plasma levels of TM were quantitated by an enzyme linked immunoabsorbant assay (ELISA) in 164 type 2 diabetes mellitus and 72 normal control subjects, and these levels were compared with those of von Willebrand factor antigen (vWf: Ag), thrombin antithrombin III complexes (TAT), plasmin-alpha2-plasmin inhibitor complexes (PIC), fibrinogen, D-dimer, urinary albumin excretion rate (AER), intima-media thickness (IMT) and plaque score of the common carotid artery assessed with high resolution B-mode ultrasonography. Plasma levels of TM, vWf: Ag, TAT, PIC, AER, IMT and plaque score were significantly increased in the diabetic patients compared to the normal control subjects. Plasma TM levels showed significant correlation with vWf: Ag (r=0.350, pPIC (r = 0.450, p sex, systolic and diastolic blood pressure levels, HbA,1c, or plasma lipid levels, although the plasma levels of TM, vWf: Ag, TAT, PIC, AER, IMT and the plaque score in the patients with proliferative retinopathy were significantly higher than those of the healthy controls and patients with simple retinopathy. Among the 43 normoalbuminuric patients without intima-media thickness or thickened plaque (AERPIC were significantly higher in those patients with retinopathy than in those without retinopathy. Multivariate analysis showed TM, TAT and PIC levels to be independent predictors of diabetic retinopathy. In conclusion, circulating TM reflects endothelial cell damage in patients with diabetic retinopathy, and hypercoagulability might play an important role in endothelial cell damage.

  4. Gap junction signalling mediated through connexin-43 is required for chick limb development.

    Science.gov (United States)

    Makarenkova, H; Patel, K

    1999-03-15

    During chick limb development the gap junction protein Connexin-43 (Cx43) is expressed in discrete spatially restricted domains in the apical ectodermal ridge (AER) and mesenchyme of the zone of polarising activity. Antisense oligonucleotides (ODNs) were used to investigate the role of Connexin-43 (Cx43) in the development of the chick limb bud. We have used unmodified ODNs in Pluronic F-127 gel, which is liquid at low temperature but sets at room temperature and so remains situated at the point of application. As a mild surfactant, the gel increases antisense ODN penetration and supplies ODNs to the embryo continually for 12-18 h. We have shown a strong decrease in Cx43 protein expression after application of specific antisense oligonucleotides but the abundance of a closely related protein, Connexin-32 (Cx32), was not affected. Application of antisense Cx43 ODNs at stages 8-15 HH before limb outgrowth resulted in dramatic limb phenotypes. About 40% of treated embryos exhibited defects such as truncation of the limb bud, fragmentation into two or more domains, or complete splitting of the limb bud into two or three branches. Molecular analysis of antisense treated embryos failed to detect Shh or Bmp-2 in anterior structures and suggested that extra lobes seen in nicked and split limbs were not a result of establishment of new signalling centres as found after the application of FGF to the flank. However, examination of markers for the AER showed a number of abnormalities. In severely truncated specimens we were unable to detect the expression of either Fgf-4 or Fgf-8. In both nicked and split limbs the expression of these genes was discontinuous. Down-regulation of Cx43 after the antisense application could be comparable to AER removal and results in distal truncation of the limb bud. Taken together these data suggest the existence of a feedback loop between the FGFs and signalling mediated by Cx43.

  5. Avaliação de equipamento alternativo para pasteurização lenta de leite previamente envasado Value of alternative equipment for slow pasteurization of previously packed milk

    Directory of Open Access Journals (Sweden)

    Carmem Schuster

    2006-12-01

    Full Text Available A utilização de equipamentos alternativos de comprovada eficiência pode colaborar na viabilização do uso da pasteurização lenta por pequenos produtores, melhorando a rentabilidade da atividade e diminuindo o comércio de leite informal. O presente trabalho teve por objetivo avaliar a eficiência de equipamento alternativo para pasteurização lenta de leite previamente envasado. Quatorze partidas de 30 L de leite foram processadas e analisadas. As provas realizadas foram contagens de mesófilos aeróbicos, coliformes totais e coliformes termotolerantes, cálculo da redução de mesófilos aeróbicos e pesquisa da atividade das enzimas fosfatase e peroxidase. A eficiência do processo de pasteurização em reduzir o número de mesófilos aeróbicos do leite variou de 99,97 a 99,99%. Todas as amostras de leite pasteurizado apresentaram contagens de coliformes totais e termotolerantes Alternative equipment with proved efficacy can help to make the use of slow pasteurization feasible by small producers, increasing their gain and reducing the illegal milk business. In the present study, the efficacy of alternative equipment for slow pasteurization of previously packed milk was evaluated. Fourteen lots with thirty liters of milk were studied. The analyses were mesophilic aerobes, total coliforms and thermotolerant coliform counts, reduction of the mesophilic aerobe number, and phosphatase and peroxidase activity tests. The efficiency of pasteurization to reduce the mesophilic aerobes number in milk ranged from 99.97 to 99.99%. All samples of pasteurized milk presented total and thermotolerant coliform counts <0.3 MPN/mL, and negative and positive results for phosphatase and peroxidase tests, respectively. The equipment tested was efficient at slow pasteurization of previously packed milk as the pasteurized milk complied with Brazilian legislation.

  6. Secondary organic aerosol formation by limonene ozonolysis: Parameterizing multi-generational chemistry in ozone- and residence time-limited indoor environments

    Science.gov (United States)

    Waring, Michael S.

    2016-11-01

    Terpene ozonolysis reactions can be a strong source of secondary organic aerosol (SOA) indoors. SOA formation can be parameterized and predicted using the aerosol mass fraction (AMF), also known as the SOA yield, which quantifies the mass ratio of generated SOA to oxidized terpene. Limonene is a monoterpene that is at sufficient concentrations such that it reacts meaningfully with ozone indoors. It has two unsaturated bonds, and the magnitude of the limonene ozonolysis AMF varies by a factor of ∼4 depending on whether one or both of its unsaturated bonds are ozonated, which depends on whether ozone is in excess compared to limonene as well as the available time for reactions indoors. Hence, this study developed a framework to predict the limonene AMF as a function of the ozone [O3] and limonene [lim] concentrations and the air exchange rate (AER, h-1), which is the inverse of the residence time. Empirical AMF data were used to calculate a mixing coefficient, β, that would yield a 'resultant AMF' as the combination of the AMFs due to ozonolysis of one or both of limonene's unsaturated bonds, within the volatility basis set (VBS) organic aerosol framework. Then, β was regressed against predictors of log10([O3]/[lim]) and AER (R2 = 0.74). The β increased as the log10([O3]/[lim]) increased and as AER decreased, having the physical meaning of driving the resultant AMF to the upper AMF condition when both unsaturated bonds of limonene are ozonated. Modeling demonstrates that using the correct resultant AMF to simulate SOA formation owing to limonene ozonolysis is crucial for accurate indoor prediction.

  7. Effects of engine emissions from high-speed civil transport aircraft: A two-dimensional modeling study, part 2

    Science.gov (United States)

    Ko, Malcolm K. W.; Weisenstein, Debra K.; Sze, Nein Dak; Shia, Run-Lie; Rodriguez, Jose M.; Heisey, Curtis

    1991-01-01

    The AER two-dimensional chemistry-transport model is used to study the effect of supersonic and subsonic aircraft operation in the 2010 atmosphere on stratospheric ozone (O3). The results show that: (1) the calculated O3 response is smaller in the 2010 atmosphere compared to previous calculations performed in the 1980 atmosphere; (2) with the emissions provided, the calculated decrease in O3 column is less than 1 percent; and (3) the effect of model grid resolution on O3 response is small provided that the physics is not modified.

  8. Validity of Induced Environmental Criteria

    Science.gov (United States)

    1974-11-01

    ing through design reviews, mockups and test planning. Both contractor and government test requirements are specified in this document...Adequacy* Number Title ABC 1 MIL-F-9490C (USAF) 9 Mar 66 2 MIL-F-18372 (AER) 31 Mar 55 3 MIL-C-18244A ( WEP ) 1 Dec 62 L\\ MIL-T-5955C 17...specification and that it be referenced in U.S. Army design handbooks such as AMCP 706-203. 95 —•. . ;«._■. .... NUMBER: MIL-C-18244A ( WEP ) (1 Dec 62) 3

  9. Beneficios neurocognitivos de la educación física en la salud infantil, una nueva línea de investigación

    Directory of Open Access Journals (Sweden)

    Joaquín Reverter Masià

    2012-01-01

    Full Text Available La comunidad científica siempre está en continua evolución y las Ciencias de la Actividad Física no está exentas de estos avances. Las últimas investigaciones indican que el ejercicio aeróbico tiene impacto positivo y muy saludable sobre el cerebro (Gómez-Pinilla, Vaynman & Ying, 2008. Qué tipos de ejercicios son más convenientes para que tenga un efecto mucho más positivo para el cerebro y la memoria es un nuevo campo de investigación en edades infantiles.

  10. Aptitud física relacionada con salud en los estudiantes de primer semestre académico de un programa de fisioterapia, 2007

    OpenAIRE

    Claudia Lucía Ariza-García; Milena del Carmen Boneth-Collante; Javier Parra-Patiño

    2014-01-01

    Objetivo: Evaluar la aptitud física relacionada con salud (AFRS) de las estudiantes de primer semestre de fisioterapia de una universidad privada de Santander. Metodología: Estudio descriptivo transversal realizado en 20 estudiantes (17,8 ± 1,33 años) de sexo femenino de primer semestre, seleccionadas por conveniencia. Se recolectaron las variables edad, sexo, composición corporal, la flexibilidad de la musculatura posterior, la capacidad aeróbica y la resistencia muscular de miembros superio...

  11. Dicty_cDB: Contig-U12264-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available :none) Burkholderia vietnamiensis G4 c... 323 2e-86 CP000086_311( CP000086 |pid... ... 298 9e-79 AL939113_253( AL939113 |pid:none) Streptomyces coelicolor A3(2) co...hkirik*RHLYINYIIIK--- ---QSNKQTNKQIDK**nnnaikilfininsffniinklincelqlpyfysfestgnfqv invetneavlnstlsidlqvllvygstistvsnkpifnlfvsein...tata genomic clo... 56 3e-05 2 >( BJ430083 ) Dictyostelium discoideum cDNA clone:ddv6c06, 3' end, single read. Length = 720 Sco...nstruct Peudomonas aer... 342 3e-92 CP001103_2392( CP001103 |pid:none) Alteromonas macleodii 'Deep eco

  12. Estudio sobre la influencia de la dieta y la actividad física en el perfil lipídico de sujetos vegetarianos

    OpenAIRE

    Delgado Fernández, Manuel

    2013-01-01

    La dieta lactovegetariana se presenta como más favorable para prevenir el riesgo de cardiopatía isquemica en relación a la dieta omnívora y ovolactovegetariana, para sujetos sedentarios sanos de ambos sexos. El cambio a dieta ovolactovegetariana desde dieta omnívora origina disminución de los valores de colesterol total y hdl-colesterol, sin variaciones en el perfil cineantropometrico y capacidad aeróbica. Los sujetos vegetarianos consumen menos grasa saturada y colesterol en relación a sujet...

  13. Estudio sobre la influencia de la dieta y la actividad f??sica en el perfil lip??dico de sujetos vegetarianos

    OpenAIRE

    Delgado Fern??ndez, Manuel

    1992-01-01

    La dieta lactovegetariana se presenta como m??s favorable para prevenir el riesgo de cardiopat??a isquemica en relaci??n a la dieta omn??vora y ovolactovegetariana, para sujetos sedentarios sanos de ambos sexos. El cambio a dieta ovolactovegetariana desde dieta omn??vora origina disminuci??n de los valores de colesterol total y hdl-colesterol, sin variaciones en el perfil cineantropometrico y capacidad aer??bica. Los sujetos vegetarianos consumen menos grasa saturada y colesterol en relaci??n...

  14. Ejercicio de resistencia y fuerza muscular: diseño de una sesión de fisioterapia cardiovascular hospitalaria

    OpenAIRE

    2012-01-01

    La actividad física es uno de los pilares de la Rehabilitación Cardíaca. La mayoría de estos programas incluyen sesiones de entrenamiento supervisado basadas principalmente en ejercicio aeróbico continuo o interválico, excluyendo el trabajo anaeróbico por el potencial peligro sobre el corazón del cardiópata. Sin embargo, la AACVPR y el ACSM recomiendan el entrenamiento de fuerza en estos casos. Por lo tanto, la prescripción de ejercicio físico debería incluir tanto entrenamiento cardiovascula...

  15. EFECTO DE UN PROGRAMA DE EJERCICIO AERÓBICO Y UN PROGRAMA DE CIRCUITO CON PESAS SOBRE LA CALIDAD DE VIDA, DISNEA Y RESISTENCIA CARDIORRESPIRATORIA EN SUJETOS CON ENFERMEDAD PULMONAR CRÓNICA

    OpenAIRE

    2007-01-01

    El objetivo de este estudio fue determinar el efecto de un programa de ejercicio aeróbico y un programa de circuito con pesas sobre la calidad de vida, disnea y resistencia cardiorrespiratoria en sujetos con Enfermedad Pulmonar Crónica (EPC). Metodología: el programa de rehabilitación se hizo durante ocho semanas, se realizó un pretest y un postest, se cumplió con una sesión semanal presencial, y las otras dos domiciliarias, se tuvo comunicación directa vía telefónica los días que realizab...

  16. Eficácia de Medidas de Higiene Bucal sobre a Microbiota Oral Potencialmente Patogênica para Pneumonia Aspirativa em Idosos Residentes em Instituições de Longa Permanência

    OpenAIRE

    AGUIAR, M. C. A.

    2008-01-01

    pneumonia aspirativa é um importante problema de saúde pública, devido à alta prevalência, altos índices de morbidade, mortalidade, internações e custos financeiros resultantes, especialmente em indivíduos idosos e institucionalizados. O objetivo deste estudo foi avaliar a eficácia in vivo da higiene bucal por meio de medidas mecânicas isoladas e em associação com clorexidina sobre a microbiota oral potencialmente patogênica para pneumonia aspirativa (bactérias aeróbias, Sta...

  17. Condición física del jugador de fútbol universitario en condiciones especiales del municipio de Envigado

    OpenAIRE

    Ramírez Noreña, Ana Carolina; López Sánchez, María Eugenia; Hincapié Builes, Marta Isabel; Vidarte Claros, José Armando

    2014-01-01

    Al estudiar la dinámica de un partido de fútbol, se observa que se presentan una serie de condiciones de exigencia física y fisiológica. El futbolista necesita realizar acciones de velocidad, fuerza y de resistencia (aeróbica y anaeróbica). Esto implicará una resistencia llamada resistencia especial o muy compleja, integrada por las cualidades básicas antes mencionadas y que será exclusiva del fútbol. La presente investigación tiene por objetivo determinar las características de la condición ...

  18. Condición física del jugador de fútbol universitario en condiciones especiales de la ciudad de Medellín

    OpenAIRE

    Gómez Sánchez, Walter León; Ortiz Silva, Jaime Alberto; Ruiz Rengifo, Gloria María; Vidarte Claros, José Armando

    2014-01-01

    INTRODUCCIÓN. En algunas modalidades deportivas, en especial el fútbol se presenta una serie de capacidades motrices tanto de índole física como fisiológica; para alcanzar un desempeño acorde durante la competencia el futbolista requiere ejecutar acciones donde están inmersas capacidades tales como la velocidad, la fuerza y la resistencia (aeróbica, anaeróbica láctica y anaeróbica aláctica). Objetivo. Determinar las características de la condición física de los jugadores de fútbol universitar...

  19. Estudo bacteriológico de lesões periapicais

    OpenAIRE

    ROCHA Márcia Maria de Negreiros Pinto; Moreira,José Luciano Bezerra; Dalgimar Bezerra de MENEZES; CUNHA Maria do Perpétuo Socorro Saldanha da; de Carvalho, Cibele Barreto Mano

    1998-01-01

    O tecido perirradicular de 30 casos cirúrgicos foi submetido a exame microbiológico e histopatológico. Foram isoladas 137 cepas bacterianas das 30 lesões periapicais estudadas. Do total de bactérias isoladas, 90 (65,7%) foram caracterizadas como anaeróbias estritas, 40 (29,2%) como anaeróbias facultativas e 7 (5,1%) como aeróbias estritas. Fusobacterium nucleatum, bacilos Gram-negativos pigmentados anaeróbios estritos, Peptostreptococcus sp, Streptococcus mitis e bacilos Gram-positivos não es...

  20. Signos Vitales de los CDC La actividad física y los adultos con discapacidades (Vital Signs-Physical Activity and Adults with Disabilities)

    Centers for Disease Control (CDC) Podcasts

    2014-05-06

    Este podcast se basa en el informe Signos Vitales de los CDC de mayo del 2014. Los adultos con discapacidades que no hacen actividad física aeróbica tienen un 50 % más de probabilidades de tener enfermedades cardiacas, accidentes cerebrovasculares, diabetes o cáncer. Sepa qué puede hacer para ayudar.  Created: 5/6/2014 by National Center on Birth Defects and Developmental Disabilities (NCBDDD).   Date Released: 5/6/2014.

  1. Efetividade de um programa de exercícios no condicionamento físico, perfil metabólico e pressão arterial de pacientes hipertensos

    OpenAIRE

    Monteiro, Henrique L.; Rolim, Lívia M. C. [UNESP; Squinca, Daniela A. [UNESP; Fernando C. Silva; Ticianeli,Carla C.C.; Amaral,Sandra L.

    2007-01-01

    HISTÓRICO E OBJETIVO: Tem sido mostrado que exercícios aeróbios são úteis na redução da pressão arterial. Contudo, a efetividade de um programa de exercícios ainda é controversa e não foi bem analisada em populações de baixa renda. O objetivo do presente estudo foi estabelecer um programa de condicionamento físico individualizado - Projeto Hipertensão - focado em pessoas hipertensas, pacientes da Unidade Básica de Saúde (UBS) e, logo após, investigar os efeitos deste programa no condicionamen...

  2. Predicción del motivo salud en el ejercicio físico en centros de fitness. [Prediction of health reason in physical exercise in fitness centers].

    OpenAIRE

    Ana Prieto-Vaello; Antonio Alias; Juan A. Moreno-Murcia

    2015-01-01

    El objetivo de este estudio fue comprobar si el apoyo de la autonomía, las necesidades psicológicas básicas y la motivación intrínseca predicen el motivo de práctica hacia la mejora o mantenimiento de la salud. La muestra estuvo compuesta por 602 practicantes de actividades dirigidas con ritmo coreografiados (zumba, aeróbic, step, fight box, batuka, danza contemporánea, flamenco, sevillanas y bailes latinos), a los que se midió el apoyo de autonomía, las necesidades psicológicas básicas, la m...

  3. Efeitos de exercícios aquáticos sobre a aptidão cardiorrespiratória e a pressão arterial em hipertensas Effects of aquatic exercise on cardiorespiratory fitness and blood pressure in hypertensive women

    OpenAIRE

    Lisiane Piazza; Marice Regina Menta; Cristiano Castoldi; José Basileu Caon Reolão; Rodrigo Schmidt; Leonardo Calegari

    2008-01-01

    O estudo visou avaliar a influência de um programa de exercícios aquáticos sobre a aptidão cardiorrespiratória e a pressão arterial em mulheres hipertensas. Dez hipertensas participaram do programa de exercícios aquáticos - aeróbicos, de fortalecimento, alongamento e relaxamento - duas vezes por semana durante 7 semanas, totalizando 14 sessões. Foram avaliadas pelo teste de esforço cardiorrespiratório antes e após o desenvolvimento do programa. A pressão arterial foi mensurada ao repouso e ao...

  4. El proyecto "Ciudad del Viento", Portal Bicentenario, Cerrillos: fecundidad de una idea modelo de diseño urbano sustentable

    Directory of Open Access Journals (Sweden)

    Rubén González Aguayo

    2010-06-01

    Full Text Available A propósito de la oportunidad de reconstrucción del país, post terremoto 2010, y de la evaluación del proyecto ciudad parque, se analiza la propuesta ganadora del Primer Premio del Concurso Internacional de Ideas Portal Bicentenario, “Ciudad del Viento”, emplazada en el ex Aeródromo de Cerrillos en Santiago de Chile, en cuanto modelo de urbanización sustentable. /The reconstruction after de 8.8 earthquake in Chile is an opportunity to review the winner project of the contest "Ciudad Portal Bicentenario", transformation of Cerrillos Airport into a new sustainable city.

  5. Verification of a neutronic code for transient analysis in reactors with Hex-z geometry

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalez-Pintor, S.; Verdu, G. [Departamento de Ingenieria Quimica Y Nuclear, Universitat Politecnica de Valencia, Cami de Vera, 14, 46022. Valencia (Spain); Ginestar, D. [Departamento de Matematica Aplicada, Universitat Politecnica de Valencia, Cami de Vera, 14, 46022. Valencia (Spain)

    2012-07-01

    Due to the geometry of the fuel bundles, to simulate reactors such as VVER reactors it is necessary to develop methods that can deal with hexagonal prisms as basic elements of the spatial discretization. The main features of a code based on a high order finite element method for the spatial discretization of the neutron diffusion equation and an implicit difference method for the time discretization of this equation are presented and the performance of the code is tested solving the first exercise of the AER transient benchmark. The obtained results are compared with the reference results of the benchmark and with the results provided by PARCS code. (authors)

  6. The inauguration of Modern Subjectivity: Shakespeare’s “lyrical tragedy” Richard II

    Directory of Open Access Journals (Sweden)

    John J. JOUGHIN

    2004-10-01

    Full Text Available During the theorisation of Renaissance studies in the 1980s the focus was on the punctual emergence of the early modern subject circa 1600, the “decisive transitional moment” usually hinging on a reading of Hamlet’s emergent sense of interiority (Aers, “A whisper in the ear of the early modernists” passim. There are of course huge advances in such a reading as it highlights the contingent and created nature of human experience. Post-structuralism usefully isolated the ‘human’ as an invention...

  7. Aerobic granulation of pure bacterial strain Bacillus thuringiensis

    Institute of Scientific and Technical Information of China (English)

    Sunil S ADAV; Duu-Jong LEE

    2008-01-01

    The objective of this study is to cultivate aer-obic granules by pure bacterial strain, Bacillus thuringien-sis, in a sequencing batch reactor. Stable granules sized 2.0-2.2 mm were formed in the reactor after a five-week cultivation. These granules exhibited excellent settling attributes, and degraded phenol at rates of 1.49 and concentration, respectively. Confocal laser scanning microscopic test results show that Bacillus thuringiensis was distributed over the initial small aggregates, and the outer edge of the granule was away from the core regime in the following stage.

  8. Perfil comparativo de atletas de kickboxing e jiu-jitsu: estudo multidimensional da morfologia externa, desempenho em provas maximais de curta e média duração, força muscular e orientação para a realização de objetivos

    OpenAIRE

    Silva, Miguel Alexandre Guerreiro Leitão da

    2015-01-01

    Dissertação de mestrado em Treino Desportivo para Crianças e Jovens, apresentada à Faculdade de Ciências do Desporto e Educação Física da Universidade de Coimbra O Jiu-jitsu é um desporto de combate de alta intensidade, que combina ataques intermitentes de exercício predominantemente anaeróbio intercalado com períodos curtos de menor intensidade e suportados pela via aeróbia. O presente estudo objetivou traçar o perfil do atleta e compará-lo com os seus pares de outras disciplinas de comba...

  9. Oxidación de metanol, 4-metilbencilalcohol y trietilamina mediada por metales

    OpenAIRE

    Briones Miguéns, Lucía

    2014-01-01

    La tesis doctoral titulada “Oxidación de metanol, 4-metilbencil alcohol y trietilamina mediada por metales” es un trabajo de investigación que gira en torno al estudio de nuevos sistemas metálicos que puedan actuar como mediadores en la oxidación aeróbica de metanol, 4-metilbencil alcohol y trietilamina, en condiciones de reacción suaves, y mediante procedimientos simples, poco agresivos con el medio ambiente, accesibles y económicos.

  10. Simulation, Design and Analysis of Air-Breathing Combined-Cycle Engines for High Speed Propulsion

    OpenAIRE

    Fernández Villacé, Víctor

    2013-01-01

    Desde la aparición del turborreactor, el motor aeróbico con turbomaquinaria ha demostrado unas prestaciones excepcionales en los regímenes subsónico y supersónico bajo. No obstante, la operación a velocidades superiores requiere sistemas más complejos y pesados, lo cual ha imposibilitado la ejecución de estos conceptos. Los recientes avances tecnológicos, especialmente en materiales ligeros, han restablecido el interés por los motores de ciclo combinado. La simulación numérica de estos nuevos...

  11. Análise de vibrações e estudo de conforto humano sobre pisos mistos (aço-concreto) submetidos a ações humanas rítmicas.

    OpenAIRE

    2015-01-01

    Este trabalho tem por objetivo avaliar o comportamento dinâmico de pisos mistos (aço-concreto) sob a ação de cargas provenientes das atividades humanas rítmicas, especificamente a prática de ginástica aeróbica, sob o ponto de vista do conforto humano. Tal avaliação torna-se necessária por crescentes problemas estruturais associados às vibrações excessivas, decorrentes da concepção de sistemas estruturais com baixos níveis de amortecimento e com frequências naturais cada vez ...

  12. Evaluación del estado, consumo de macronutrientes y calcio en personas que superan los 40 años con menopausia y andropausia

    OpenAIRE

    García Gumier, Tobías

    2014-01-01

    La menopausia y andropausia son etapas biológicas en la vida en las cuales hay que tomar recaudos, afrontarlas con alegría y responsabilidad. Es fundamental realizar una adecuada alimentación y un correcto aporte de macro y micro nutrientes, acompañado de actividad física, para evitar problemas óseos y musculares e incluso un estado nutricional poco saludable. Objetivo: Determinar la relación entre la actividad física con sobrecarga y aeróbica, la ingesta de macronutrientes,...

  13. The Passing on Defence Aviated Into State Aid Law

    DEFF Research Database (Denmark)

    Ølykke, Grith Skovgaard

    2015-01-01

    The two annotated judgments concern the aftermath of a differentiated taxation on travelling, which was implemented in breach of the free movement provisions in the Treaties. Airlines (Aer Lingus and Ryanair) who were identified as beneficiaries of the advantage arising from being subject...... to the low level of taxation, contested the Commission’s calculation of the amount to be recovered. The General Court found for the applicants and stated that the Commission should limit itself to ordering recovery of the advantage actually retained by the airlines, taking into account the competitive...

  14. La flauta traversa del Nuevo Mundo surgió en Tiwanaku

    OpenAIRE

    2013-01-01

    Este artículo aporta antecedentes para demostrar que el aerófono conocido como flauta traversa no es exclusivo de Europa, sino que América del Sur también produjo un modelo genuino que proviene de la cultura Tiwanaku. Esta cultura, entre el 500 y el 900 d.C., habría generado una flauta traversa y la habría exportado hacia los territorios vecinos (especialmente el oasis de San Pedro de Atacama). Los ejemplares preservados en los museos precolombinos de Sudamérica demuestran que el modelo de pí...

  15. Patrones fenotípicos de resistencia en pseudomonas aeruginosa de muestras clínicas a nivel de Sudamérica

    OpenAIRE

    Bolaños, Carlos; UNIVERSIDAD NACIONAL FEDERICO VILLARREAL; Iannacone, José; UNIVERSIDAD NACIONAL FEDERICO VILLARREAL UNIVERSIDAD RICARDO PALMA

    2016-01-01

    Pseudomonas aeruginosa, Migula 1895 es un bacilo Gram negativo, no esporulado, aeróbico estricto, además presenta diversos mecanismos de resistencia, donde las betalactamasas son la principal causa de resistencia para los  antibióticos betalactámicos. Esta bacteria posee una resistencia intrínseca a diversos betalactámicos, debido a que poseen una enzima  AMPC cromosómico inducible, pero también presenta una resistencia adquirida del tipo betalactamasa de espectro extendido (BLEE), carbapenem...

  16. Estudio de la influencia de la fatiga en las habilidades visuales

    OpenAIRE

    Castro Domínguez, Rafael

    2015-01-01

    De manera genérica, se ha dado por supuesta la hipótesis de que la fatiga ocasionada por la realización del esfuerzo físico produce modificaciones negativas de las habilidades visuales (Álvarez del Villar, 1985; Grosser y Neumayer, 1986; Martin, 1987; Moras, 1994). Esta hipótesis ha sido hasta nuestros días poco contrastada experimentalmente. En esta investigación hemos valorado la variación de las habilidades visuales con la fatiga inducida por un esfuerzo aeróbico. El ejercicio con...

  17. La cafeína. Ayuda ergogénica en el campo de la suplementación nutricional deportiva

    OpenAIRE

    Fernández Mata, María de las Nieves

    2016-01-01

    La cafeína es una sustancia que se encuentra en numerosas bebidas consumida por el ser humano a diario y es parte de la rutina diaria de numerosos deportistas. Hasta hace poco, no estaba muy claro el efecto beneficiosos que esta sustancia proporcionaba a los deportistas y hoy en día, tras numerosos estudios, se ha demostrado que es una ayuda ergogénica tanto en el ejercicio aeróbico (de larga duración) porque disminuye la percepción de fatiga y mejora el rendimiento deportivo, así como en ...

  18. 一种具有超高强度的镍钴合金

    Institute of Scientific and Technical Information of China (English)

    黄文梅(摘译)

    2010-01-01

    美国Carpenter技术公司制成了一种新型特殊钢,其强度和韧度不但可与Marage 350媲美,而且具有更优良的延展性和抗疲劳性。这种名为Carpenter AerMet 340的材料的成分是Fe-12Ni-15.6Co-2.25Cr-1.85Mo,其硬度为(HRC56),极限抗张强度为345ksi(2379MPa),

  19. Strain gradient plasticity-based modeling of hydrogen environment assisted cracking

    DEFF Research Database (Denmark)

    Martínez Pañeda, Emilio; Niordson, Christian Frithiof; P. Gangloff, Richard

    2016-01-01

    Finite element analysis of stress about a blunt crack tip, emphasizing finite strain and phenomenologicaland mechanism-based strain gradient plasticity (SGP) formulations, is integrated with electrochemical assessment of occluded-crack tip hydrogen (H) solubility and two H-decohesion models......; it is imperative to account for SGP in H cracking models. Predictions of the threshold stress intensity factor and H-diffusion limited Stage II crack growth rate agree with experimental data for a high strength austenitic Ni-Cusuperalloy (Monel®K-500) and two modern ultra-high strength martensitic steels (Aer...

  20. EFECTO DEL COBRE SOBRE LA EXCITABILIDAD ELECTRICA DE NEURONAS PIRAMIDALES DE CA 1

    OpenAIRE

    VERA BUSCHMANN, JORGE ALEJANDRO

    2010-01-01

    El cobre es un metal esencial para los organismos aeróbicos y ha sido vinculado principalmente al metabolismo celular. Además, existen evidencias para proponer que este metal tiene un rol en la modulación de la excitabilidad neuronal. Sin embargo, esta hipótesis no ha sido demostrada directamente. En nuestro laboratorio encontramos que cobre en concentraciones que pueden alcanzarse en el espacio sináptico (0,01-0,1 μM), aumenta la tasa de disparos espontáneos de neuronas pir...

  1. CONSIDERAÇÕES SOBRE A OXIDAÇÃO LIPÍDICA E SUAS LIMITAÇÕES: o possível papel do fracionamento de carboidratos

    OpenAIRE

    2012-01-01

    Os ácidos graxos estocados principalmente na forma de triacilglicerois no tecido adiposo ou em reduzidas quantidades no tecido muscular representam uma fundamental via energética em exercícios de intensidade leve a moderada. Caracterizam-se pela alta disponibilidade de trifosfato de adenosina (ATP) possuindo relevância em termos quantitativos nos exercícios de longa duração (aeróbios). De forma simplificada, a oxidação lipídica divide-se em mobilização e transporte dos ácidos graxos, β-oxida...

  2. Conciderações sobre a oxidação lipíca e seus limitações: o possível papel do fracionamento de carboidratos

    OpenAIRE

    2012-01-01

    Os ácidos graxos estocados principalmente na forma de triacilglicerois no tecido adiposo ou em reduzidas quantidades no tecido muscular representam uma fundamental via energética em exercícios de intensidade leve a moderada. Caracterizam-se pela alta disponibilidade de trifosfato de adenosina (ATP) possuindo relevância em termos quantitativos nos exercícios de longa duração (aeróbios). De forma simplificada, a oxidação lipídica divide-se em mobilização e transporte dos ácidos graxos, β-oxida...

  3. Twist1 activity thresholds define multiple functions in limb development

    OpenAIRE

    Krawchuk, Dayana; Weiner, Shoshana J; Chen, You-Tzung; Lu, Benson; Costantini, Frank; Behringer, Richard R.; Laufer, Ed

    2010-01-01

    The basic helix-loop-helix transcription factor Twist1 is essential for normal limb development. Twist1−/− embryos die at midgestation. However, studies on early limb buds found that Twist1−/− mutant limb mesenchyme has an impaired response to FGF signaling from the apical ectodermal ridge, which disrupts the feedback loop between the mesenchyme and AER, and reduces and shifts anteriorly Shh expression in the zone of polarizing activity. We have combined Twist1 null, hypomorph and conditional...

  4. Annual Energy Review 2001

    Energy Technology Data Exchange (ETDEWEB)

    Seiferlein, Katherine E. [USDOE Energy Information Administration (EIA), Washington, DC (United States)

    2002-11-01

    The Annual Energy Review (AER) is a statistical history of energy activities in the United States. It documents trends and milestones in U.S. energy production, trade, storage, pricing, and consumption. Each new year of data that is added to the time series—which now reach into 7 decades—extends the story of how Americans have acquired and used energy. It is a story of continual change as the Nation's economy grew, energy requirements expanded, resource availability shifted, and interdependencies developed among nations.

  5. REMOCIÓN DE NUTRIENTES EN AGUAS RESIDUALES DE UN MATADERO DE RESES USANDO UN REACTOR BIOLÓGICO SECUENCIAL

    OpenAIRE

    Sedolfo Jose Carrasquero Ferrer; Daniela Carolina Marquina Gelvez; John Gerardo Soto López; Stefanía Viloria Rincón; María Carolina Pire Sierra; Altamira Rosa Díaz Montiel

    2015-01-01

    Se evaluó la remoción de nutrientes en un efluente cárnico utilizando un reactor por carga secuencial (SBR) a escala laboratorio. La investigación se llevó a cabo empleando aguas residuales de un matadero de reses ubicado en el Estado Zulia, Venezuela. El experimento se realizó en un reactor por carga secuencial con un volumen útil de 2 L. El reactor fue operado bajo una secuencia operacional anaeróbica/aeróbica/anóxica, un tiempo de retención celular de 25 días y dos tiempos de retención hid...

  6. 真武汤对糖尿病肾病患者血管内皮生长因子及尿蛋白排泄率的影响%The Effects of Spleen-Yang Strengthening Decoction on Vascular Endothelial Growth Factor and Urinary Protein Excretion Rate in Patients With Diabetic Nephropathy

    Institute of Scientific and Technical Information of China (English)

    曾伟平; 徐孝容; 柳清

    2015-01-01

    Objective:To analyze the impact of Spleen-yang Strengthening Decoction on vascular endothelial growth factor and uri-nary protein excretion rate in patients with diabetic nephropathy.Methods:Seventy cases of patients with Type 2 Diabetic nephrop-athy who were received and treated in our hospital were randomly divided into the control group (35 cases)and the observation group (35 cases)according to admission order,both of the two groups received Diabetes Education,Diabetic diet,internal medi-cine oral hypoglycemic agents or subcutaneous injections of insulin (the dose were set according to blood glucose levels of the pa-tients);the patients who combined with hypertension were added nifedipine sustained release tablets,10 ~20 mg,2 times/day. The patients who combined with hyperlipidemia were added Simvastatin,20 mg/day.The observation group used Self-prepared kidney invigorating decoction on the basis of the control group.Both groups had 8 weeks for a course of treatment,urinary protein excretion rate (uAER)and the protein and mRNA change of VEGF in the two groups were compared before and after the treat-ment.Results:1)uAER improved in the two groups after treatment compared to before the treatment,the range of improvement in the observation group was more obvious (P <0.05).This illustrated that Self-prepared kidney invigorating decoction can obviously significantly improve uAER of the patients with diabetic nephropathy,inhibited the progression of diabetic nephropathy in a certain extent.2)after treatment,protein and mRNA expression of VEGF in the two groups decreased,the downward trend in the obser-vation group were more obvious than the control group (P <0.05),illustrated the combine use of prescription could suppress the VEGF in the protein and gene levels.3)uAER and VEGF levels were in abnormal distribution,correlation analysis were proceed on relevant parameters by the method of Spearman,the results found that uAER had positive correlation with the expression

  7. Valoración nutricional de una composta elaborada con subproductos avícolas para alimentar pollos de engorda

    OpenAIRE

    Ricardo Muñoz Saba; Luis Alberto Heredia; Carlos López Coello; Ernesto Ávila González

    1999-01-01

    El presente trabajo tuvo como objetivos demostrar la factibilidad de realizar una composta con subproductos avícolas, y evaluar su calidad nutricional en dietas para pollos de engorda como animal experimental con el fin de conocer su potencial en la alimentación, mediante la adición de agua a una mezcla de gallinaza, paja y cadáveres de aves en proporciones adecuadas para propiciar una fermentación aeróbica en cajones de madera bajo temperaturas de 72º C con una humedad de 55%, 5%-10% de O2 y...

  8. Efecto de la administración de antioxidantes orales en las adaptaciones al ejercicio físico.

    OpenAIRE

    2006-01-01

    RESUMEN Durante el ejercicio físico se producen radicales libres en el interior de la célula muscular. Éstos pueden actuar como señales reguladoras en diversas funciones fisiológicas del músculo, como por ejemplo su fuerza contráctil, su capacidad para generar ATP, etc Se sabe que el entrenamiento aeróbico empleando una determinada frecuencia, intensidad y duración, puede aumentar el contenido mitocondrial entre un 50% y un 100% en un período aproximado de seis semanas. E...

  9. Papel central de los citocromos P450 en el catabolismo del colesterol y su regulación en micobacterias

    OpenAIRE

    García Fernández, Esther

    2013-01-01

    El colesterol es un esteroide ampliamente distribuido en la Naturaleza, que tiene una gran importancia fisiológica porque se encuentra formando parte de las membranas de las células animales y además es precursor inmediato de vitaminas, hormonas esteroideas y ácidos biliares. La degradación del colesterol llevada a cabo por bacterias aeróbicas se divide en varias etapas que consisten en la oxidación del colesterol a 4-colesten-3-ona, la oxidación de la cadena lateral y la degradación del sist...

  10. Tunable Lasers

    Science.gov (United States)

    1975-12-31

    Air 1 and Nippon Kankoh-Shikiso Kenkyusho dye NK 1748. The dye l&aer outputs were about 5 m. with a pulse width of about ^0 ns. The linewi ths...crystal Is far from the focal polut of tha lens so that 1.(6,$) and 1,(6,$) ara essaatlally constant over the length of the crystal. Thla...34Canpondium on Hifh Po«»or Infrirod Lotor WindON« Motoriali". Spocnf Roport No. 139 Air Fore« Cwnbr«»«« 18 J.O.M.Oonn^.»trt..Edilori. C>y»W a^.2*Ed

  11. La actividad física en la prevención y tratamiento de la hipertensión arterial

    OpenAIRE

    Rodríguez Hernández, Mynor

    2012-01-01

    La hipertensión arterial (HTA), es uno de los trastornos de salud más comunes, asociado a una mayor incidencia de todas las causas cardiovasculares de mortalidad. La modificación del estilo de vida es la mejor forma de prevención, tratamiento y control de la HTA, con el ejercicio como componente esencial. Los programas de ejercicio que involucraron principalmente la actividad aeróbica combinada con el trabajo de contra-resistencia ayuda a prevenir el desarrollo de la hipertensión y ayuda a di...

  12. A Study of Aerodynamics in Kevlar-Wall Test Sections

    OpenAIRE

    Brown, Kenneth Alexander

    2014-01-01

    This study is undertaken to characterize the aerodynamic behavior of Kevlar-wall test sections and specifically those containing two-dimensional, lifting models. The performance of the Kevlar-wall test section can be evaluated against the standard of the hard-wall test section, which in the case of the Stability Wind Tunnel (SWT) at Virginia Tech can be alternately installed or replaced by the Kevlar-wall test section. As a first step towards the evaluation of the Kevlar-wall test section aer...

  13. La asociación de ejercicios de resistencia muscular localizada y su influencia en la aptitud muscular en enfermos con fibromialgia

    OpenAIRE

    Printes, Clarissa B.

    2012-01-01

    En busca del efecto provocado por el ejercicio aeróbico y el combinado en la fibromialgia, se realizó un estudio longitudinal prospectivo utilizando 2 grupos. Se monitoreó el comportamiento de las siguientes variables: 1) el estudio de los compartimientos corporales, 2) el estudio de la función respiratoria, 3) el estudio cardiorrespiratorio, 4) el estudio de la fuerza, 5) la escala visual numérica (EVN) para evaluación del dolor y 6) el cuestionario de impacto de calidad de vida (FIQ - P). F...

  14. Sensitivity of Total Protein Creatinine Ratio in Urine for Diagnosis Diabetic Nephropathy

    OpenAIRE

    Fatrinawati, .; Windarwati; Sianipar, Osman

    2017-01-01

    ABSTRACTDiabetic nephropathy is one of diabetic complication characterized by proteinuria and impaired renal function. Confirmation of diagnosis based either on urine value of albumin excretion rate (AER) 30-300 mg/24 hours or albumin creatinine ratio (ACR) 30-300 mg/g or total protein creatinine ratio (TPCR) 150-500 mg/g. It is reported that TPCR measurement is more acceptable since it is convenient, fast and does not require special preparation. The aim of this study is to investigate the a...

  15. La Necesidad de la Preparación Física en el Baile Flamenco

    OpenAIRE

    2008-01-01

    El baile flamenco requiere grandes exigencias de esfuerzo para su desarrollo, equiparable a deportes de alto nivel. En cambio, los bailaores no dedican a la preparación física la atención suficiente: el trabajo de la resistencia aeróbica junto al fortalecimiento y estiramiento de determinados grupos musculares, deberían ser un mínimo imprescindible de entrenamiento como herramienta para mejorar su nivel físico y como prevención de lesiones.

  16. Valoración física, condición física y calidad de vida en pacientes con diferentes tratamientos renales sustitutivos

    OpenAIRE

    Sonsoles Hernández Sánchez; David García López; Alejandro Santos Lozano; Gustavo González-Calvo; Mónica Brazález Tejerina; Nuria Garatachea Vallejo

    2015-01-01

    La actividad física es de vital importancia en pacientes con enfermedad renal crónica, ya que mejora la capacidad funcional de los sujetos e incrementa notablemente su calidad de vida. Para mejorar la calidad de vida en pacientes con tratamiento renal sustitutivo, dializados o trasplantados, deberían ser incluidos programas de actividad física planificados y supervisados por profesionales. Existen varios estudios sobre entrenamiento aeróbico y de fuerza en pacientes con enfermedad renal cróni...

  17. Aves, sonidos y chamanes. Estudio interdisciplinario de un instrumento musical óseo procedente de una ocupación prehispánica de las selvas meridionales del noroeste de Argentina

    OpenAIRE

    Miguez, Gabriel Eduardo; Nasif, Norma; Gudemos, Monica Lucia; Bertelli, Sara Beatriz

    2016-01-01

    Los instrumentos musicales de viento procedentes de contextos arqueológicos del noroeste de Argentina son escasos, y el conocimiento acerca de las implicaciones sociales vinculadas con su uso en tiempos prehispánicos es mínimo. En este artículo se presentan los resultados de un estudio interdisciplinario efectuado sobre un aerófono óseo hallado en el sitio Yánimas 1 (provincia de Tucumán), abordándose aspectos arqueológicos, biológicos, tecnológicos y musicológicos. Se contribuye a la compren...

  18. Revisión sobre los efectos adaptativos del entrenamiento de diferente orientación, en personas con diabetes tipo 2. Guía para la prescripción del ejercicio

    OpenAIRE

    Costa, Ignacio Alejandro

    2015-01-01

    El presente trabajo es una revisión sistemática, de investigaciones de acceso libre, publicadas en los últimos 5 años, en PubMed y DOAJ; que contemplaran en su metodología la aplicación de ejercicios de resistencia aeróbica y de fuerza muscular, en personas con diabetes mellitus tipo 2. Se buscaron las palabras: diabetes type 2, resistance, aerobic, training. Luego de aplicar criterios de exclusión, quedaron 10 artículos. De los cuales se sintetizaron las adaptaciones reportadas. El entrenami...

  19. Estudio del estrés oxidativo en un modelo animal de ejercicio físico: análisis citométrico en mitocondrias aisladas y en leucocitos

    OpenAIRE

    Parra Orenga, Marta

    2015-01-01

    Un incremento en el metabolismo aeróbico durante el ejercicio es una fuente potencial de estrés oxidativo. En el músculo, la mitocondria es una fuente importante de intermediarios reactivos. Para su estudio, se han utilizado el hígado, el músculo de diafragma y el corazón de conejos tipo control sin entrenamiento físico específico, conejos entrenados sometidos a un entrenamiento físico específico y conejos sometidos a una operación simulada. Se han obtenido mitocondrias aisladas para su estud...

  20. Flora bacteriana da cavidade oral, presas e veneno de Bothrops jararaca: possível fonte de infecção no local da picada

    OpenAIRE

    Jorge,Miguel Tanús; de Mendonça, João Silva; Ribeiro,Lindioneza Adriano; Silva,Maria Lucia Ribeiro da; Kusano,Elisa Junko Ura; Cordeiro,Carmen Lúcia dos Santos

    1990-01-01

    Materiais colhidos das presas, das bainhas das presas e do veneno de 15 Bothrops jararaca recém-capturadas, aparentemente saudáveis, foram submetidos a exame bacterioscópico e cultura aeróbia a anaeróbia. As bactérias mais freqüentemente isoladas foram os estreptococos do grupo D (1.2 serpentes), Enterobacter sp. (6), Providencia rettgeri (6), Providencia sp. (4), Escherichia coli (4), Morganella morganii (3) e Clostridium sp. (5). Como estas bactérias são semelhantes às encontradas nos absce...

  1. Flora bacteriana da cavidade oral, presas e veneno de Bothrops jararaca: possível fonte de infecção no local da picada Bacterial flora of the oral cavity, fangs and venom of Bothrops jararaca: possible source of infection at the local bite

    OpenAIRE

    Miguel Tanús Jorge; João Silva de Mendonça; Lindioneza Adriano Ribeiro; Maria Lucia Ribeiro da Silva; Elisa Junko Ura Kusano; Carmen Lúcia dos Santos Cordeiro

    1990-01-01

    Materiais colhidos das presas, das bainhas das presas e do veneno de 15 Bothrops jararaca recém-capturadas, aparentemente saudáveis, foram submetidos a exame bacterioscópico e cultura aeróbia a anaeróbia. As bactérias mais freqüentemente isoladas foram os estreptococos do grupo D (1.2 serpentes), Enterobacter sp. (6), Providencia rettgeri (6), Providencia sp. (4), Escherichia coli (4), Morganella morganii (3) e Clostridium sp. (5). Como estas bactérias são semelhantes às encontradas nos absce...

  2. Tratamento do líquido gerado no beneficiamento da casca de coco verde em sistema de lodos ativados

    OpenAIRE

    2007-01-01

    O principal impacto ambiental do processo de beneficiamento da casca de coco verde é a geração de resíduo líquido com elevada carga orgânica. Este trabalho teve como objetivo aplicar o sistema convencional de lodos ativados para o tratamento biológico do líquido gerado no beneficiamento da casca de coco verde, além de utilizar o teste de taxa de consumo de oxigênio (TCO) para avaliar a toxicidade do efluente ao lodo aeróbio. O reator de escala laboratorial foi inoculado com lodo proveniente d...

  3. Caracterização microbiológica e físico-química do leite cru de cabra produzido no estado do Paraná

    OpenAIRE

    2014-01-01

    O presente estudo teve por objetivo caracterizar a composição físico-química e microbiológica do leite cru de cabra produzido no estado do Paraná. Foram obtidas 32 amostras, logo após a ordenha, provenientes de oito propriedades, que juntas produzem cerca de 24% do leite de cabra produzido no Paraná. Para caracterização microbiológica foram quantificados micro-organismos aeróbios mesófilos, psicrotróficos, coliformes totais, Escherichia coli, Staphylococcus coagulase positiva, proteolíticos, ...

  4. Evaluation of EXPLOSAFE. Explosion Suppression System for Aircraft Fuel Tank Protection

    Science.gov (United States)

    1980-07-01

    compares the 2 mil, 3 mil and typical reticulated polyurethane foam (RPF). The 3 mil and RPF have comparable damage; the 2 mil slightly more. The test...ether (boiling range 35-60°C). The petroleum ether used had been pre-filtered through 0.45pm cellulose acetate/nitrate membrane filters while 0.50m...teflon filters were used to pre-filter isopropyl alcohol as, in this case, the cellulose acetate/nitrate filters .aere not compatible. The test and

  5. Effects of a strength endurance training program on endurance levels Efectos de un programa de entrenamiento de la fuerza-resistencia sobre los niveles de resistencia

    Directory of Open Access Journals (Sweden)

    J. C. Redondo

    2010-09-01

    Full Text Available

    The purpose of the current study was to determine whether a strength endurance training program of lower limbs isolate can increase endurance levels, both aerobic capacity and aerobic power, in order to adapt the strength training for endurance races. 20 phisically active men participated in the study. They were divided into two groups: control group (GC (n=10 and experimental group (GE (n=10. GE carried out a strength endurance training program for ten weeks. Results obtained showed that this type of training regime was useful to improve the performance in an aerobic endurance test. This could be due to an improvement in aerobic capacity, maximal dynamic strength, explosive strength and reactive strength. Moreover, there was a decrease in fat mass without increase in muscle mass.
    Key Words:  Training, strength endurance, aerobic capacity, anthropometry.

     

    El presente estudio pretende comprobar que el trabajo aislado de la fuerza resistencia en miembros inferiores produce una mejora de los niveles de resistencia, en términos tanto de potencia como de capacidad aeróbica, optimizando así el entrenamiento de la fuerza para pruebas de resistencia de media y larga duración. Para ello, veinte sujetos participaron en el estudio, dividiéndose de forma aleatoria en dos grupos: grupo control (GC (n=10 y grupo experimental (GE (n=10 el cual llevó a cabo un entrenamiento de fuerza resistencia extensivo por intervalos, de diez semanas de duración. Los resultados obtenidos muestran que este tipo de entrenamiento es efectivo para mejorar el rendimiento en una prueba de resistencia aeróbica para sujetos físicamente activos, gracias a la mejora de la capacidad aeróbica, de la fuerza máxima dinámica, elástico explosiva y elástico explosivo reactiva y a la disminución de los niveles de grasa

  6. Efectos de una dieta hipocalórica y de un programa de ejercicio físico de corta duración en el perfil lipídico y en la composición corporal de mujeres menopáusicas con sobrepeso

    Directory of Open Access Journals (Sweden)

    D. Rojano

    2014-09-01

    Conclusión: Los resultados obtenidos sugieren que la combinación de un programa de ejercicio físico aeróbico y de fuerza de 6 semanas de duración y una dieta hipocalórica en mujeres menopáusicas con sobrepeso, provoca mejoras significativas en la composición corporal y una tendencia hacia la mejora del perfil lipídico, lo que puede repercutir positivamente en la calidad de vida.

  7. La alimentación de los jugadores de baloncesto: peligros nutricionales y microbiológicos

    OpenAIRE

    Santos Badenes, Gemma

    2015-01-01

    El baloncesto tiene unos requerimientos fisiológicos altos que imponen un esfuerzo considerable en las capacidades cardiovasculares y metabólicas de los jugadores. Fisiológicamente, el baloncesto requiere fuerza/resistencia muscular, flexibilidad y energía tanto a nivel de ejercicio aeróbico como anaeróbico. El estudio de la composición corporal es un aspecto muy importante en la valoración del estado nutricional, ya que la distribución de la masa grasa y la masa magra en un individuo puede a...

  8. Perfusión tisular: consideraciones básicas y clínicas fundamentos de medicina traslacional

    OpenAIRE

    Aldana Díaz, José Luis

    2014-01-01

    La perfusión tisular es un concepto fundamental en fisiología y medicina clínica. Conceptualmente complejo por la inclusión de múltiples procesos que integran fisiología cardiovascular en términos macrohemodinámicos, fisiología del transporte de gases, distribución regional del gasto cardiaco y el flujo sanguíneo capilar, difusión capilar de oxígeno y bioenergética celular. El metabolismo aeróbico y el mantenimiento de la homeostasis dependen de la capacidad del organismo de proporcionar e...

  9. Intervención a través del ejercicio físico en persona sedentaria, fumadora y con normopeso

    OpenAIRE

    Rodríguez Landívar, Iosune

    2014-01-01

    Dados los beneficios que el ejercicio físico aporta sobre la salud de las personas, varios estudios han demostrado la efectividad de éste para la reducción del riesgo cardiovascular, problema principal de las personas que pese a tener normopeso, son fumadoras y sedentarias. OBJETIVO: Comprobar la efectividad del ejercicio físico aeróbico y de fuerza en la mejora de la calidad de vida, composición corporal, capacidad cardiovascular y reducción de los factores de riesgo y edad vascular en una p...

  10. La respuesta cardiorrespiratoria durante la segunda transición del triatlón: revisión. (Cardiorespiratory response during second transition in triathlon: review.)

    OpenAIRE

    2009-01-01

    Resumen El triatlón es un deporte de resistencia que combina sucesivamente natación, ciclismo y carrera a pie. Como en otros deportes de estas características, la capacidad aeróbica máxima y la posibilidad de mantener una fracción alta del consumo de oxígeno máximo durante la competición son determinantes para el éxito. Ahora bien, el triatlón posee algunas peculiaridades, y la segunda transición es un momento clave, pues la capacidad para enlazar las etapas de ciclismo y carrera es determina...

  11. Desarrollo de métodos de biología molecular para el análisis directo de bacterias acéticas de vinagre

    OpenAIRE

    Jara Campos, Carla Ingrid

    2009-01-01

    Las bacterias acéticas (BA) son microorganismos Gram-negativas, elipsoidales y poseen un metabolismo aeróbico estricto, suelen utilizar sustratos como la glucosa y etanol, como fuentes de energía.En general, no hay muchos antecedentes del comportamiento de las bacterias acéticas (BA) en ambientes naturales o industriales. Éstas son consideradas microorganismos fastidiosos, bebido a la falta de cultivabilidad en medios sólidos idóneos. La correcta aplicación de las técnicas independiente de c...

  12. AcEST: BP915896 [AcEST

    Lifescience Database Archive (English)

    Full Text Available : Swiss-Prot sp_hit_id Q59NY7 Definition sp|Q59NY7|CUE1_CANAL Coupling of ubiqui......done Score E Sequences producing significant alignments: (bits) Value sp|Q59NY7|CUE1_CANAL Coupling...2 OS=Saccharomyces... 30 7.4 sp|A6V1D5|RRF_PSEA7 Ribosome-recycling factor OS=Pseudomonas aer... 29 9.6 >sp|Q59NY7|CUE1_CANAL Couplin

  13. MONITORAMENTO FISÍCO-QUÍMICO E MICROBIOLÓGICA DE DIETAS ENTERAIS EM UNIDADE HOSPITALAR PÚBLICA DA REGIÃO NORDESTE DO BRASIL

    Directory of Open Access Journals (Sweden)

    E. V. CARVALHO FILHO

    2008-12-01

    Full Text Available

    O objetivo foi avaliar a qualidade microbiológica e físico-química da alimentação enteral não industrializada administrada em hospital público da região Nordeste-Brasil. A contagem de bactérias aeróbias mesófilas, bolores e leveduras, coliformes totais e fecais da água mineral e filtrada, insumos, dietas, ar ambiental, equipamentos, utensílios e manipuladores, bem como, composição centesimal de insumos e dietas. Águas mineral e filtrada não apresentaram coliformes, mas, encontrou-se 3,99±0,80 e 2,28±0,32 Log UFC/mL de bactérias aeróbias mesófilas. O farelo de arroz apresentou maior contagem de bactérias aeróbias mesófilas e o açúcar de bolores e leveduras. Na albumina em pó foi encontrada a maior quantidade de proteínas (33,10±0,64% e no suplemento protéico, a menor (14,90±1,41 %. A dieta tipo 4 apresentou o maior população de bactérias aeróbias mesófilas e na tipo 2 a menor. Nas dietas encontrou-se elevados valores de coliformes totais e nas de tipos 1 e 3 de fecais. O ar ambiental apresentou bom estado higiênico-sanitário, os equipamentos não. Nas mãos dos manipuladores foram encontrados coliformes. Foram encontrados déficits ou superávits de macronutrientes nas dietas, na densidade calórica e em Kcal não protéicas/g N. Os resultados encontrados sugerem um maior controle higiênico-sanitário e fi scalização dos insumos utilizados na produção de dietas enterais não industrializadas.

  14. Treinamento físico intervalado como ferramenta na terapia cognitivo-comportamental do transtorno de pânico

    OpenAIRE

    Aline Sardinha; Claudio Gil Soares de Araújo; Antonio Egidio Nardi

    2011-01-01

    Este trabalho consiste no relato da utilização de um programa de exercícios físicos aeró-bicos intervalados no contexto da terapia cognitivo-comportamental em um caso de transtorno de pânico e agorafobia. São descritos os procedimentos utilizados, bem como os resultados positivos obtidos na redução da ansiedade cardíaca e na ansiedade cotidiana em relação a situações que exigem esforço físico.

  15. Annual progress report, July 1, 1983-June 30, 1984

    Energy Technology Data Exchange (ETDEWEB)

    1984-01-01

    Research in the Laboratory of Biomolecular and Celluler Sciences deals with proliferation, gene expression and differentiation in normal cells and in cells exposed to pollutants, carcinogens or tumor promoters. The research program of the Laboratory of Environmental Biology presents an integrated approach to studies of the functional interactions of the physical and biotic components of arid land ecosystems. Nuclear Medicine research has focussed on development of positron emission tomography, preparation of short-lived isotopes of oxygen, nitrogen, carbon and fluorine, use of these isotopes to label physiological substrates, tracer studies of cerebral biochemistry and physiology, measurement of regional myocardial fatty acid metabolism and blood flow. (AER)

  16. La Necesidad de la Preparación Física en el Baile Flamenco

    Directory of Open Access Journals (Sweden)

    Alfonso Vargas Macías

    2008-06-01

    Full Text Available El baile flamenco requiere grandes exigencias de esfuerzo para su desarrollo, equiparable a deportes de alto nivel. En cambio, los bailaores no dedican a la preparación física la atención suficiente: el trabajo de la resistencia aeróbica junto al fortalecimiento y estiramiento de determinados grupos musculares, deberían ser un mínimo imprescindible de entrenamiento como herramienta para mejorar su nivel físico y como prevención de lesiones.

  17. Perfil oxidativo de la mujer menopáusica: Papel de los estrógenos en la prevención y tratamiento de las enfermedades

    OpenAIRE

    Carlos Escalante-Gómez; Silvia Quesada-Mora; Fernando Zeledón-Sánchez

    2009-01-01

    El balance entre la producción de radicales libres de oxigeno y el nivel de enzimas antioxidantes es permanentemente regulado por la célula. Las enzimas antioxidantes son esenciales para las células aeróbicas, puesto que mantienen en niveles aceptables las concentraciones de especies químicas conocidas como radicales libres. Durante el climaterio o etapa perimenopáusica, el cuerpo y metabolismo de una mujer cambia de forma importante, y los mecanismos que regulan el estrés oxidativo no son la...

  18. Estudio sobre el antrax humano en las fuerzas militares de Colombia y en las zonas de alto riesgo en el campo industrial

    OpenAIRE

    Torres Ch., Martha Lucía; Morlas B., Carmen; Sanabria F., Pablo; Cardoso M., Javier

    1995-01-01

    El ántrax es una zoonosis y puede ocurrir en humanos como resultado del contacto incidental con animales o productos animales infectados con al Bacillus anthracis. (L.H. Harrison et al. 1989). Esta bacteria es un bacilo gram positivo, encapsulado, formador de endoesporas y aeróbico o anaeróbico facultativo. Se transmite de los animales al hombre a través de alimentos y productos de origen animal (pieles, lanas, pelos, etc.) infectados y por contaminación del medio ambiente con la bacteria y/o...

  19. IMPACT OF STARVATION ON SURVIVAL, MEAT CONDITION AND METABOLISM OF CHLAMYS FARRERI

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    The effects of 60-day starvation on survival rate, condition index (CI), changes of nutrient composition of different tissues, respiration and excretion of scallop Chlamys farreri were studied in laboratory from Oct. 17 to Dec. 15,1997. Two groups (control and starvation with 200 individuals each) were cultured in two 2 m3 tanks, with 31 to 32 salinity water at 17℃. Starvation effects were measured after 10, 20, 40 and 60 days. There was no mass mortality of scallops of the two tanks and survival rates of the control and starvation groups were 93.5% and 92.0%, respectively. Starvation had strong effect on the meat condition of the scallops, especially after 10 days; when relative lipid percentage dropped sharply while relative protein percentage increased. The impact of starvation on the oxygen consumption rate (OCR) and the ammonia-N excretion rate (AER) was obvious. The OCR increased rapidly after 10 days but decreased after 20 days. The AER increased after 10 days and 20 days, but decreased obviously from 20 to 40 days. The O:N ratios varied to different degrees, and minimized after 20 days. The low O:N ratios implied that the protein was the main material for the metabolism of C. farreri.

  20. Laboratory {open_quotes}proof of principle{close_quotes} investigation for the acoustically enhanced remediation technology

    Energy Technology Data Exchange (ETDEWEB)

    Iovenitti, J.L.; Spencer, J.W. Jr.; Hill, D.G. [Weiss Associates, Emergyville, CA (United States)] [and others

    1995-10-01

    Weiss Associates is conducting a three phase program investigating the systematics of using acoustic excitation fields (AEFs) to enhance the in-situ remediation of contaminated soil and ground water under both saturated and unsaturated conditions: Phase I - Laboratory Scale Parametric Investigation; Phase II - Technology Scaling Study; and Phase III - Large Scale Field Tests. Phase I, the subject of this paper, consisted primarily of a laboratory proof of principle investigation. The field deployment and engineering viability of acoustically enhanced remediation (AER) technology was also examined. Phase II is a technology scaling study addressing the scale up between laboratory size samples on the order of inches, and the data required for field scale testing, on the order of hundreds of feet. Phase III will consist of field scale testing at an non-industrialized, non-contaminated site and at a contaminated site to validate the technology. Summarized herein are the results of the Phase I {open_quotes}proof-of-principle{close_quotes} investigation, and recommendations for Phase H. A general overview of AER technology along with the plan for the Phase I investigation was presented.

  1. Hipotensão pós-exercício em indivíduos hipertensos: uma revisão Hipotensión post-ejercicio en individuos hipertensos: una revisión A review on post-exercise hypotension in hypertensive individuals

    Directory of Open Access Journals (Sweden)

    Paulo Gomes Anunciação

    2011-05-01

    Full Text Available Após uma sessão de exercícios físicos, pode ocorrer hipotensão pós-exercício (HPE. Esse efeito possui elevada relevância clínica em hipertensos. Embora a literatura reporte vários estudos sobre o tema, ainda falta uma análise sobre o estado da arte, considerando-se os diferentes tipos de exercícios. Assim, o objetivo deste estudo foi verificar, por meio de uma revisão na literatura, a relação entre o exercício aeróbio e o resistido na HPE em hipertensos. Para tanto, realizaram-se buscas nas bases Scielo e Medline, considerando os estudos em inglês e a amostra de humanos adultos hipertensos os principais critérios de inclusão. Foram encontrados 126 estudos. Porém, fizeram parte das análises 32 artigos, dos quais cinco envolveram o exercício resistido, e 27, o exercício aeróbio. Sobre o exercício resistido, embora os estudos utilizassem modelos diferentes de prescrição, houve HPE principalmente no ambiente laboratorial. Após o exercício aeróbio, observou-se HPE por maiores períodos de tempo. Contudo, ocorrem conflitos sobre a melhor intensidade e duração para a prescrição dessa atividade. Portanto, aparentemente, ocorrem maiores reduções na pressão arterial após o exercício aeróbio em comparação com o exercício resistido em hipertensos. Não obstante, para maiores conclusões, são necessários estudos que acompanhem a pressão arterial de forma ambulatorial.Después de una sesión de ejercicios físicos, puede ocurrir hipotensión post-ejercicio (HPE. Ese efecto posee una elevada relevancia clínica en los hipertensos. Aunque la literatura reporte varios estudios sobre el tema, todavía nos queda realizar un análisis más profundo teniendo en cuenta los diferentes tipos de ejercicios.Por tanto, el objetivo de este estudio fue verificar, por medio de una revisión en la literatura, la relación entre el ejercicio aeróbico y el resistido en la HPE en hipertensos. Para eso se realizaron búsquedas en

  2. A pre-marketing ALT signal predicts post-marketing liver safety.

    Science.gov (United States)

    Moylan, Cynthia A; Suzuki, Ayako; Papay, Julie I; Yuen, Nancy A; Ames, Michael; Hunt, Christine M

    2012-08-01

    Drug induced liver injury during drug development is evidenced by a higher incidence of serum alanine aminotransferase (ALT) elevations in treated versus placebo populations and termed an "ALT signal". We sought to quantify whether an ALT signal in pre-marketing clinical trials predicted post-marketing hepatotoxicity. Incidence of ALT elevations (ALT ≥ 3 times upper limits normal [× ULN]) for drug and placebo of new chemical entities and approved drugs associated with hepatotoxicity was calculated using the Food and Drug Administration (FDA) website. Post-marketing liver safety events were identified using the FDA Adverse Event Reporting System (AERS). The association of FDA AERS signal score (EB05 ≥ 2) and excess risk of pre-marketing ALT elevation (difference in incidence of ALT ≥ 3× ULN in treated versus placebo) was examined. An ALT signal of ≥ 1.2% was significantly associated with a post-marketing liver safety signal (p ≤ 0.013) and a 71.4% positive predictive value. An absent ALT signal was associated with a high likelihood of post-marketing liver safety; negative predictive value of 89.7%. Daily drug dose information improved the prediction of post-marketing liver safety. A cut-off of 1.2% increase in ALT ≥ 3× ULN in treated versus placebo groups provides an easily calculated method for predicting post-marketing liver safety.

  3. [Effect of training intensity on the fat oxidation rate].

    Science.gov (United States)

    Ulloa, David; Feriche, Belén; Barboza, Paola; Padial, Paulino

    2014-01-01

    Introducción: El ejercicio físico es un importante modulador de la máxima tasa de oxidación de grasas (MFO). Sin embargo, en la relación MFO-ejercicio, las zonas de transición metabólica en la prescripción del ejercicio no son consideradas. Objetivo: Conocer el efecto del entrenamiento en diferentes zonas de transición metabólica sobre la cinética de la MFO y su localización (Fatmax) en jóvenes varones activos. Método: 97 varones fueron distribuidos en 4 grupos homogéneos, 3 experimentales y un grupo control (GC). Cada grupo experimental participó en 8 semanas de entrenamiento administrado de forma continua a intensidad de umbral aeróbico o VT1 (CCVT1), interválica en umbral anaeróbico o VT2 (ITVT2), y en potencia aeróbica máxima o VO2max (ITVO2max). Antes y después del tratamiento los sujetos fueron testados en sendas pruebas con control de gases espirados para determinar el VO2max, VT1 y VT2, y la MFO (calorimetría indirecta) y Fatmax. Resultados: Los resultados muestran un incremento (entre 16,49 y 18,51%; p.

  4. Indoor environment in Swedish passive houses

    DEFF Research Database (Denmark)

    Bekö, Gabriel; Langer, Sarka; Bloom, Erica Bloom

    2014-01-01

    The purpose of this study was to evaluate the indoor air quality (IAQ) in newly built low energy houses. Measurements were performed in 22 passive houses and 21 conventional buildings during 2012-2013 and 2013-2014 heating seasons. The measured parameters were temperature, relative humidity......, concentration of CO2, NO2, formaldehyde, volatile organic compounds, and live microbiological flora. Air exchange rates (AER) were determined from the concentration-time profiles of CO2. The median AER was slightly higher in the passive houses than in conventional buildings (0.66 h-1 vs. 0.60 h-1). The median...... concentrations in passive houses and conventional buildings were 9.7 and 11 μg/m3, respectively, for NO2, 12 and 16 μg/m3 for formaldehyde, and 230 and 145 μg/m3 for TVOC. The indoor microbiological flora did not differ, with a few exceptions, from outdoors. The IAQ in the passive buildings was judged...

  5. Nano-polyplex based on oleoyl-carboxymethy-chitosan (OCMCS) and hyaluronic acid for oral gene vaccine delivery.

    Science.gov (United States)

    Liu, Ya; Wang, Fang-Qin; Shah, Zeana; Cheng, Xiao-Jie; Kong, Ming; Feng, Chao; Chen, Xi-Guang

    2016-09-01

    Here we described nano-polyplexes (NPs) made of oleoyl-carboxymethy-chitosan (OCMCS)/hyaluronic acid (HA) as novel potential carriers for oral gene vaccines delivery. Aerolysin gene (aerA) of Aeromonas hydrophila as microbial antigen was efficiently loaded to form OCMCS-HA/aerA (OHA) NPs. OHA NPs performed the optimal parameters, i.e. smallest (154.5±9.4nm), positive charged (+7.9±0.5mV) and monodispersed system with the N/P ratio of 5 and OCMCS/HA weight ratio of 4. Upon the introduction of HA, OHA NPs was beneficial for the DNA release in intestinal environments in comparison to OA NPs. The mean fluorescence intensity detected in Caco-2 cells incubated with OHA NPs was about 2.5-fold higher than that of OA NPs; however, it decreased significantly in the presence of excess free HA. The OHA NPs and OA NPs decreased the transepithelial electric resistance (TEER) of Caco-2 monolayers obviously and induced increasing the apparent permeability coefficient (Papp) of DNA by 5.45-6.09 folds compared with free DNA. Significantly higher (P<0.05) antigen-specific antibodies were detected in serum after orally immunized with OHA NPs than that immunized with OA NPs and DNA alone in carps. These results enable the OHA NPs might resolve challenges arising from gastrointestinal damage to gene antigens, and offer an approach applicable for oral vaccination.

  6. Resposta renal à maltodextrina e ao treinamento em diferentes intensidades

    Directory of Open Access Journals (Sweden)

    Cátia Fernandes Leite

    2015-03-01

    Full Text Available O objetivo foi investigar a resposta renal à ingestão de maltodextrina e à natação de padrão aeróbio ou anaeróbio de alta intensidade em ratos. Materiais e métodos O protocolo consistiu de oito semanas de natação em padrão aeróbio (sobrecarga 5% ou intermitente (sobrecarga 10%. Durante 37 dias os animais foram suplementados, por meio de gavagem, com uma dose diária de 0,48g.Kg−1 de maltodextrina dissolvida em água ou receberam água pura, antes do treinamento. Resultados O treinamento anaeróbio ocasionou aumento nas concentrações de ácido úrico, creatinina e proteínas totais e redução no glicogênio renal. A maltodextrina causou aumento no glicogênio renal. Conclusão A maltodextrina e o treinamento anaeróbio proporcionaram alterações nos parâmetros de função renal em resposta desse órgão a esses estímulos externos.

  7. Comparison of the Respiratory Metabolism of Juvenile Litopenaeus vannamei Cultured in Seawater and Freshwater

    Institute of Scientific and Technical Information of China (English)

    DING Sen; WANG Fang; DONG Shuanglin; LI Ying

    2014-01-01

    Litopenaeus vannamei, a euryhaline species, can be cultured at a wide range of salinities. The emergence of freshwater pond-culture of L. vannamei is an important prelude to the continued development of shrimp culture in China. In this study, we com-pared the respiratory metabolism of juvenile L. vannamei cultured in freshwater and saltwater by measuring their oxygen consump-tion rate (OCR), ammonium-type nitrogen excretion rate (AER) and pyruvate kinase (PK) and lactate dehydrogenase (LDH) activi-ties at different molting stages in order to physiecologically characterize juvenile L. vannamei under freshwater conditions. The re-sults showed that OCR was significantly higher in saltwater than in freshwater at all stages of molting cycle. However, variation of OCR among molting stages in saltwater was similar with that in freshwater, and the highest OCR was observed at post-molting stage. At all stages of molting cycle, AER was significantly higher in freshwater than in saltwater, and the highest was observed at post-molting stage. The activity of PK was significantly higher in saltwater than in freshwater. Conversely, the activity of LDH was higher in freshwater than in saltwater in general. Significant variation of PK and LDH activities in molting cycle was observed in saltwater and freshwater. The results indicated that aerobic metabolism of juvenile L. vannamei was more active in saltwater than in freshwater;while its protein metabolism was more active in freshwater than in saltwater.

  8. Base aérea de Zaragoza

    Directory of Open Access Journals (Sweden)

    Editorial, Equipo

    1958-03-01

    Full Text Available De acuerdo con un plan previsto por la acción gubernamental conjunta entré los Estados Unidos y España, se ha procedido a la modernización, ampliación y reforma de los aeródromos, civil y militar, que se habían construido previamente en Zaragoza, y del nuevo aeródromo de Torrejón. Para la descripción de estas obras y de sus principales características técnicas y funcionales, nos hemos visto ayudados generosamente por el Departamento de la Marina de los Estados Unidos, a través de don Agustín Iglesia, ingeniero afecto a este servicio en España, y por don R. Sellmer, Director de Relaciones Públicas de la conocida empresa constructora Brown-Raymond-Walsh, que constituye un potente grupo de contratistas de reconocido prestigio en los Estados Unidos.

  9. Fast start-up of a pilot-scale deammonification sequencing batch reactor from an activated sludge inoculum.

    Science.gov (United States)

    Jeanningros, Y; Vlaeminck, S E; Kaldate, A; Verstraete, W; Graveleau, L

    2010-01-01

    Deammonification involves the combined application of aerobic and anoxic ammonium-oxidizing bacteria (AerAOB & AnAOB) and allows to treat wastewaters with a high ammonium concentration in a sustainable and cost-efficient way. So far, it could take more than one year to start up the process, even with the addition of AnAOB enriched inocula. In contrast, we started up a deammonifying reactor for the treatment of sludge digestate in less than four months without any AnAOB enriched inoculum. In a single sequencing batch reactor (SBR) of 3 m(3), nitritation and anammox were performed without nitrite accumulation. Larger biomass aggregates (>1.0 mm) had a typical reddish colour, but FISH also showed that small aggregates (<0.25 mm) contained a considerable amount of AnAOB. The AerAOB were related to Nitrosomonas halophila, N. eutropha and N. halophila, and the AnAOB to "Candidatus Kuenenia & Brocadia", as shown by FISH. Our results show that the deammonification inoculum does not play an important role, and that the AnAOB can quickly develop under the proper aerational conditions. Nitrogen was removed stably at high nitrogen loading rates (740 mg N/L/d) and removal efficiency (90%).

  10. ASPECTOS DIFERENCIALES EN LA IMAGEN CORPORAL Y LA AUTODESCRIPCIÓN DE LA FORMA FÍSICA EN MUJERES SEDENTARIAS VS. MUJERES ACTIVAS DEPORTIVAMENTE

    Directory of Open Access Journals (Sweden)

    F. Arbinaga Ibarzábal

    2010-10-01

    Full Text Available

     

    Se analizan las relaciones entre imagen corporal y autodescripción física en mujeres que practican danza aeróbica de forma amateur frente a un grupo de mujeres sedentarias.
    La muestra se compuso de 112 mujeres activas deportivamente y 51 mujeres sedentarias.
    Los resultados al “Body Shape Questionnaire” (B.S.Q indican que no se presentan diferencias significativas entre las mujeres sedentarias y las mujeres activas. Del conjunto de la muestra, el 18,4% de las mujeres presentaría problemas con la imagen corporal; siendo en las sedentarias el 19,6% y en las activas el 17,9%. Al valorar los resultados en el “Physical Self-Description Questionnaire” (P.S.D.Q, las mujeres sedentarias puntúan por debajo de las activas en todos los factores salvo en el de fuerza.
    Palabras Clave: imagen corporal, forma física, aeróbic, mujer, sedentarias.

  11. Inverse Levels of Adiponectin in Type 1 and Type 2 Diabetes Are in Accordance with the State of Albuminuria

    Science.gov (United States)

    Jazbec, Anamarija; Tomic, Martina; Piljac, Ante; Jurisic Erzen, Dubravka; Novak, Branko; Kastelan, Snjezana; Lovrencic, Marijana Vucic; Brkljacic, Neva

    2015-01-01

    Aims. To investigate the behaviour of adiponectin (ApN) in patients with type 1 and type 2 diabetic nephropathy. Methods. ApN and inflammatory and other markers of the metabolic syndrome were compared across diabetes types, albumin excretion rate (AER), and creatinine clearance (CrCl) categories in 219 type 1 and type 2 diabetic patients. Results. Significant differences among ApN levels according to AER were found in both types of diabetes (F = 8.45, df = 2, P < 0.001). With the progression of albuminuria, ApN increased in type 1 and decreased in type 2 diabetes. Patients with decreased CrCl had higher ApN levels than those with normal CrCl in either type of diabetes (F = 12.7, df = 1, P < 0.001). The best model for ApN (R2 = 0.9002) obtained from stepwise regression in type 1 diabetes included CrCl, BMI, WBC, CRP, and age, while in type 2 diabetes (R2 = 0.2882) it included ppPG, LDL, and UA. Conclusion. ApN behaved differently in relation to albuminuria, increasing with its progression in type 1 diabetes and decreasing in type 2 diabetes. It was however increased in the subgroups with decreased CrCl in both types of diabetes. Albuminuria seems to be more important than renal insufficiency in the definition of ApN levels in type 1 and type 2 diabetes. PMID:26089882

  12. Inverse Levels of Adiponectin in Type 1 and Type 2 Diabetes Are in Accordance with the State of Albuminuria

    Directory of Open Access Journals (Sweden)

    Spomenka Ljubic

    2015-01-01

    Full Text Available Aims. To investigate the behaviour of adiponectin (ApN in patients with type 1 and type 2 diabetic nephropathy. Methods. ApN and inflammatory and other markers of the metabolic syndrome were compared across diabetes types, albumin excretion rate (AER, and creatinine clearance (CrCl categories in 219 type 1 and type 2 diabetic patients. Results. Significant differences among ApN levels according to AER were found in both types of diabetes (F=8.45, df=2, P<0.001. With the progression of albuminuria, ApN increased in type 1 and decreased in type 2 diabetes. Patients with decreased CrCl had higher ApN levels than those with normal CrCl in either type of diabetes (F=12.7, df=1, P<0.001. The best model for ApN (R2=0.9002 obtained from stepwise regression in type 1 diabetes included CrCl, BMI, WBC, CRP, and age, while in type 2 diabetes (R2=0.2882 it included ppPG, LDL, and UA. Conclusion. ApN behaved differently in relation to albuminuria, increasing with its progression in type 1 diabetes and decreasing in type 2 diabetes. It was however increased in the subgroups with decreased CrCl in both types of diabetes. Albuminuria seems to be more important than renal insufficiency in the definition of ApN levels in type 1 and type 2 diabetes.

  13. Efeito do treinamento físico na pressão arterial de adolescentes com obesidade Efecto del entrenamiento físico en la presión arterial de adolescentes con obesidad Effect of physical training on the blood pressure of adolescents with obesity

    Directory of Open Access Journals (Sweden)

    Breno Quintella Farah

    2012-12-01

    Full Text Available OBJETIVO: Descrever, por meio de uma revisão sistemática, os efeitos do treinamento físico sobre a pressão arterial em adolescentes com obesidade. FONTES DE DADOS: Recorreu-se à revisão sistemática de ensaios clínicos randomizados que analisaram o efeito do treinamento físico sobre a pressão arterial de adolescentes obesos, publicados em periódicos indexados nas bases de dados PubMed/Medline, Lilacs, SciELO e ISI Web of KnowledgeSM. Foram incluídos os estudos que avaliaram adolescentes publicados até 2010, e que possuíam Grupo Controle. SÍNTESE DOS DADOS: Oito estudos atenderam aos critérios de inclusão. Dois deles utilizaram exercícios de força combinados com aeróbios, enquanto seis empregaram apenas os aeróbios. Cinco estudos utilizaram intervenções complementares, sendo a nutricional a mais frequente. Quatro estudos observaram redução da pressão arterial sistólica no Grupo Exercício comparado ao Controle. Nesses quatro estudos, além da redução da pressão arterial, notou-se diminuição da massa corpórea. Todos aqueles que verificaram redução da pressão arterial utilizaram 12 a 24 semanas de exercícios aeróbios, três a seis sessões semanais, com duração de 50 a 90 minutos e intensidade entre 55 e 75% da frequência cardíaca máxima. CONCLUSÕES: O efeito do treinamento físico na pressão arterial de adolescentes obesos é controverso. A redução da pressão arterial parece ocorrer com programas de treinamento aeróbios que promovam também a redução da massa corpórea.OBJETIVO: Describir, mediante una revisión sistemática, los efectos del entrenamiento físico sobre la presión arterial en adolescentes con obesidad. FUENTES DE DATOS: Se recurrió a la revisión sistemática de ensayos clínicos aleatorios que analizaron el efecto del entrenamiento físico sobre la presión arterial de adolescentes obesos, publicados en periódicos indexados en las bases de datos PubMed/MedLine, LILACS, SciELO e

  14. Detection of antibiotic resistance, virulence gene determinants and biofilm formation in Aeromonas species isolated from cattle.

    Science.gov (United States)

    Igbinosa, Isoken H; Igbinosa, Etinosa O; Okoh, Anthony I

    2015-11-01

    This study aimed to assess the antibiogram of Aeromonas strains recovered from cattle faeces and the potential pathogenic status of the isolates. The antibiogram of the Aeromonas isolates demonstrated total resistance to clindamycin oxacillin, trimethoprim, novobiocin and ticarcillin. However, Aeromonas strains were sensitive to cefotaxime, oxytetracycline and tobramycin. The Aeromonas strains from Lovedale and Fort Cox farms were found to possess some virulence genes. The percentage distribution was aer 71.4%, ast 35.7%, fla 60.7%, lip 35.7% and hlyA 25% for Lovedale farm and aer 63.1%, alt 10.5%, ast 55.2%, fla 78.9%, lip 21% and hlyA 35.9% for Fort Cox farm. Class 1 integron was present in 27% of Aeromonas isolates; the bla TEM gene was present in 34.8%, while the blaP1 class A β-lactamase gene was detected in 12.1% of the isolates. Approximately 86% of the isolates formed a biofilm on microtitre plates. The presence of multiple antibiotic resistance and virulence genes in Aeromonas isolates from cattle faeces reveals the pathogenic and infectious importance of these isolates and is of great significance to public health. The possession of a biofilm-forming capability by such isolates may lead to difficulty during the management of infection related to Aeromonas species.

  15. Cystatin C用于评估2型糖尿病患者早期肾脏损伤

    Institute of Scientific and Technical Information of China (English)

    张晓宇; 朱雪明

    2005-01-01

    目的探讨血清Cystatin C对2型糖原病患者早期肾脏损伤的诊断价值,并与传统的肌酐指标进行比较.方法对34例2型糖尿病患者按白蛋白排泄率(AER)分成三组.A组:AER200μg/min,为大量白蛋白尿组.同时测定三组的Cystatin C和血清肌酐.结果 A、B、C三组的Cystatin C和肌酐水平分别为0.73 mg/L、79.6μmol/L;1.17 mg/L、86.2μmol/L;1.43 mg/L、105.6μmol/L.B组Cystatin C水平显著高于A组 (P0.05):C组Cystatin C、肌酐水平均显著高于B组(P<0.001).结论血清Cystatin C是诊断2型糖尿病患者早期肾脏损伤的敏感指标,比肌酐更加灵敏.

  16. Effect of liquid municipal biosolid application method on tile and ground water quality.

    Science.gov (United States)

    Lapen, D R; Topp, E; Edwards, M; Sabourin, L; Curnoe, W; Gottschall, N; Bolton, P; Rahman, S; Ball-Coelho, B; Payne, M; Kleywegt, S; McLaughlin, N

    2008-01-01

    This study examined bacteria and nutrient quality in tile drainage and shallow ground water resulting from a fall land application of liquid municipal biosolids (LMB), at field application rates of 93,500 L ha(-1), to silt-clay loam agricultural field plots using two different land application approaches. The land application methods were a one-pass AerWay SSD approach (A), and surface spreading plus subsequent incorporation (SS). For both treatments, it took between 3 and 39 min for LMB to reach tile drains after land application. The A treatment significantly (p Kjeldahl N (TKN), NH(4)-N, Total P (TP), PO(4)-P, E. coli., and Clostridium perfringens. E. coli contamination resulting from application occurred to at least 2.0-m depth in ground water, but was more notable in ground water immediately beneath tile depth (1.2 m). Treatment ground water concentrations of selected nutrients and bacteria for the study period ( approximately 46 d) at 1.2-m depth were significantly higher in the treatment plots, relative to control plots. The TKN and TP ground water concentrations at 1.2-m depth were significantly (p 0.1) treatment differences for the bacteria. For the macroporous field conditions observed, pre-tillage by equipment such as the AerWay SSD, will reduce LMB-induced tile and shallow ground water contamination compared to surface spreading over non-tilled soil, followed by incorporation.

  17. A Neuro-Inspired Spike-Based PID Motor Controller for Multi-Motor Robots with Low Cost FPGAs

    Directory of Open Access Journals (Sweden)

    Anton Civit-Balcells

    2012-03-01

    Full Text Available In this paper we present a neuro-inspired spike-based close-loop controller written in VHDL and implemented for FPGAs. This controller has been focused on controlling a DC motor speed, but only using spikes for information representation, processing and DC motor driving. It could be applied to other motors with proper driver adaptation. This controller architecture represents one of the latest layers in a Spiking Neural Network (SNN, which implements a bridge between robotics actuators and spike-based processing layers and sensors. The presented control system fuses actuation and sensors information as spikes streams, processing these spikes in hard real-time, implementing a massively parallel information processing system, through specialized spike-based circuits. This spike-based close-loop controller has been implemented into an AER platform, designed in our labs, that allows direct control of DC motors: the AER-Robot. Experimental results evidence the viability of the implementation of spike-based controllers, and hardware synthesis denotes low hardware requirements that allow replicating this controller in a high number of parallel controllers working together to allow a real-time robot control.

  18. Cambio en azúcares fermentables en la remolacha azucarera almacenada en atmósferas aerobia y anaerobia para la producción de etanol

    Directory of Open Access Journals (Sweden)

    Juan Manuel Vargas Ramírez

    2014-06-01

    Full Text Available Los métodos de almacenamiento de largo plazo son necesarios para preservar los azúcares fermentables en la remolacha y permitir el funcionamiento exitoso a lo largo del año en las plantas procesadoras para la obtención de etanol. Se estudió el almacenamiento anaeróbico de la remolacha azucarera como una alternativa al almacenamiento convencional en pilas a la intemperie utilizado actualmente en fábricas de azúcar de remolacha. Los resultados experimentales indican una pérdida de <15% en el total de los azúcares fermentables en la remolacha azucarera almacenada anaeróbicamente durante 14 semanas a 4 °C. Después de 14 semanas de almacenamiento, 99 ± 4% de los azúcares fermentables iniciales fueron preservados en la remolacha almacenada en condiciones aeróbicas a 4 °C. El almacenamiento aeróbico y anaeróbico de remolacha azucarera a 25 ° C conserva 82 ± 9 y 48 ± 11% del contenido de azúcar fermentable, respectivamente. Los azúcares fermentables y etanol en exudados contribuyeron insignificantemente (<3% para el rendimiento del etanol global de remolacha azucarera después del almacenamiento.

  19. Efeito da suplementação oral de arginina sobre a secreção de GH e metabolismo de lipídios em ratos Wistar treinados

    Directory of Open Access Journals (Sweden)

    Alberto Chiyoda

    2009-12-01

    Full Text Available A Suplementação Oral de Arginina (SOA e o exercício físico são capazes de modificar a secreção do Hormônio de Crescimento (GH, interferindo no metabolismo lipídico. O objetivo do estudo foi verificar o efeito da SOA, do exercício físico aeróbio e a combinação da suplementação com o exercício sobre a secreção de GH e metabolismo lipídico em ratos. A amostra foi composta por 40 ratos machos da linhagem Wistar, divididos em grupos Controle Sedentário (CS, Arginina Sedentário (AS, Controle treinado (CT e Arginina Treinado (AT. O AS e AT receberam a suplementação oral de arginina em dias alternados e os CT e AT realizaram exercícios de natação por 1 hora/dia com sobrecarga equivalente à 5% do peso corporal 5 dias por semana durante 4 semanas. Em conclusão, os resultados demonstram que o treinamento físico aeróbio não alterou o metabolismo lipídico e diminuiu os valores séricos de GH e a SOA não alterou a concentração de GH em ratos Wistar.

  20. DIAGNÓSTICO DAS CONDIÇÕES HIGIÊNICOSANITÁRIAS DE UM BANCO DE LEITE HUMANO NA CIDADE DE SÃO LUÍS, MA, BRASIL

    Directory of Open Access Journals (Sweden)

    Viraneide Marques de ALMEIDA

    2012-01-01

    Full Text Available Avaliaram-se as condições higiênico-sanitá- rias de amostras de leite humano de um Banco de Leite Humano (BLH na cidade de São Luís - MA, por meio da análise de 50 amostras de Leite Humano (LH in natura. Realizou-se contagem de bactérias aeróbias mesófilas viá- veis, Coliformes a 35ºC e a 45°C, Staphylococcus coagulase positiva e Salmonella sp. Realizaram-se no BLH seis vistorias com preenchimento de ficha de avaliação, contendo nove atributos para obtenção de informações sobre as condições higiênicas do local e seus procedimentos. Em nenhuma das amostras de leite foi constatada a presença de Salmonella sp. e Coliformes a 45°C, entretanto foi observada a presença de micro-organismos do grupo Coliformes a 35ºC, Staphylococcus coagulase positiva e bactérias aeró- bias mesófilas viáveis. Constatou-se por meio das vistorias que o referido BLH apresentou 92,60% de conformidade aos requisitos higiênico-sanitários analisados.