WorldWideScience

Sample records for aeg pruefreaktor pr-10

  1. AEG System

    Data.gov (United States)

    Department of Transportation — The AEG System is used to create, revise, approve, and distribute text of the AEGS and Flight Standard Board (FSB)/Type Rating Report. The MMEL specifies under what...

  2. Lõigutud aeg / Vappu Thurlow

    Index Scriptorium Estoniae

    Thurlow, Vappu, 1960-

    2007-01-01

    Adamson-Ericu muuseumis kuni 25. XI avatud näitusest "Lõigutud aeg". Henri Bergsoni ajakäsitlusest. Töödest: Anu Juuraku "Suplejad", Ilkka Väätti "Kinaalda" ja "Ton", Aili Vahtrapuu "Vaagen vabale vaimule", Marje Üksise "Nii ma lähen", Annemie Bogaerts'i "Lõpp on vaikus", Siim-Tanel Annuse "24 tundi", Lynne Allen'i "Saak", Eve Kiileri "Ilu etalonide arhiivid", Ingrid Ledent'i "Mälu kestev olemine, mis muudab mineviku olevikuks", Raoul Kurvitza "Aeg ja lugu"

  3. AEgIS installation completed

    CERN Multimedia

    Katarina Anthony

    2012-01-01

    Gravity. Despite first being described over three centuries ago, it remains one of the least understood of the fundamental forces explored by physicists. At CERN’s recently completed AEgIS experiment, a team has set out to examine the effect of gravity on an as-yet-uncharted realm: antimatter.   The complete AEgIS set-up. Located in the AD hall, the AEgIS experiment plans to  make the first direct measurement of Earth’s gravitation effect on antimatter. By sending a beam of antihydrogen atoms through very thin gratings, the experiment will be able to measure how far the antihydrogen atoms fall and in how much time – giving the AEgIS team a measurement of the gravitational coupling. “By the end of 2012, we had finished by putting all the elements of the experiment together,” explains Michael Doser, AEgIS Spokesperson. “Now we have to show that they can all work together and, unfortunately, we will have no antiproton beams fo...

  4. The AEgIS experiment

    Energy Technology Data Exchange (ETDEWEB)

    Testera, G., E-mail: testera@ge.infn.it [Istituto Nazionale Fisica Nucleare (Italy); Aghion, S. [Politecnico of Milano (Italy); Amsler, C.; Ariga, A.; Ariga, T. [University of Bern, Laboratory for High Energy Physics, Albert Einstein Center for Fundamental Physics (Switzerland); Belov, A. [Institute for Nuclear Research of the Russian Academy of Science (Russian Federation); Bonomi, G. [University of Brescia, Department of Mechanical and Industrial Engineering (Italy); Braunig, P. [Heidelberg University, Kirchhoff-Institute for Physics (Germany); Bremer, J. [CERN, Physics Department (Switzerland); Brusa, R. [University of Trento, Department of Physics (Italy); Cabaret, L. [University of Paris-Sud, ENS Cachan, Laboratory Aimé Cotton, CNRS (France); Caccia, M. [INFN Milano (Italy); Caravita, R. [University of Genova, Department of Physics (Italy); Castelli, F. [INFN Milano (Italy); Cerchiari, G. [Max Planck Institute for Nuclear Physics (Germany); Chlouba, K. [Czech Technical University, Prague (Czech Republic); Cialdi, S. [INFN Milano (Italy); Comparat, D. [University of Paris-Sud, ENS Cachan, Laboratory Aimé Cotton, CNRS (France); Consolati, G. [Politecnico of Milano (Italy); Curreli, S. [Istituto Nazionale Fisica Nucleare (Italy); Collaboration: (AEgIS Collaboration); and others

    2015-08-15

    The AEgIS experiment is presently almost completely installed at CERN. It is currently taking data with antiprotons, electrons and positrons. The apparatus is designed to form a cold, pulsed beam of antihydrogen to measure the Earth’s gravitational acceleration g on antimatter and to perform spectroscopy measurements. This paper describes the main features of the apparatus and shows a selected review of some achieved results.

  5. Particle manipulation techniques in AEgIS

    International Nuclear Information System (INIS)

    The AEgIS experiment (http://aegis.web.cern.chhttp://aegis.web.cern.ch) will measure the gravitational acceleration g of antihydrogen. Once performed this could be the first direct test of the gravitational interaction between matter and antimatter. In the AEgIS experiment a beam of antihydrogen will travel horizontally along a path of about 1 m trough a moiré deflectometer followed by a position sensitive detector. The g value will be obtained measuring the vertical displacement of the annihilation patterns. Before producing the beam, several tasks have to be performed mainly involving positron and electron plasma manipulation and particles cooling in Malmberg-Penning traps. The AEgIS experiment is currently under construction at CERN, meanwhile several tests involving particle manipulation and particle cooling are in progress. In this report some experimental results involving diocotron manipulation of plasma will be presented.

  6. AEgIS experiment commissioning at CERN

    Energy Technology Data Exchange (ETDEWEB)

    Krasnicky, D. [University of Genoa, Dept of Physics, Via Dodecaneso 33, 16146 Genova, Italy and Istituto Nazionale di Fisica Nucleare, Sez. di Genova, Via Dodecaneso 33, 16146 Genova (Italy); Aghion, S. [Politecnico di Milano, LNESS and Dept of Physics, Via Anzani 42, 22100 Como, Italy and Istituto Nazionale di Fisica Nucleare, Sez. di Milano, Via Celoria 16, 20133 Milano (Russian Federation); Amsler, C.; Ariga, A.; Ariga, T.; Ereditato, A.; Kawada, J.; Kimura, M.; Pistillo, C.; Scampoli, P.; Storey, J. [Albert Einstein Center for Fundamental Physics, University of Bern, 3012 Bern (Switzerland); Belov, A. S.; Gninenko, S. N. [Institute for Nuclear Research of the Russian Academy of Sciences, Moscow 117312 (Russian Federation); Bonomi, G.; Subieta Vasquez, M. A. [University of Brescia, Dept of Mech. and Indust. Engineering, Via Branze 38, 25133 Brescia, Italy and Istituto Nazionale di Fisica Nucleare, Sez. di Pavia, Via Agostino Bassi 6, 27100 Pavia (Italy); Braeunig, P.; Oberthaler, M. K. [University of Heidelberg, Kirchhoff Institute for Physics, Im Neuenheimer Feld 227, 69120 Heidelberg (Germany); Brusa, R. S.; Di Noto, L.; Mariazzi, S. [Dipartimento di Fisica, Universita di Trento and INFN, Gruppo collegato di Trento, Via Sommarive 14, 38050 Povo, Trento (Italy); and others

    2013-03-19

    The AEgIS Experiment is an international collaboration based at CERN whose aim is to perform the first direct measurement of the gravitational acceleration g of antihydrogen in the gravitational field of the Earth. Cold antihydrogen will be produced with a pulsed charge exchange reaction in a cylindrical Penning trap where antiprotons will be cooled to 100mK. The cold antihydrogen will be produced in an excited Rydberg state and subsequently formed into a beam. The deflection of the antihydrogen beam will be measured by using Moire deflectometer gratings. After being approved in late 2008, AEgIS started taking data in a commissioning phase early 2012. This report presents an overview of the AEgIS experiment, describes its current status and shows the first measurements on antiproton catching and cooling in the 5 T Penning catching trap. We will also present details on the techniques needed for the 100mK antihydrogen production, such as pulsed positronium production and its excitation with lasers.

  7. Liikluses huligaanitsemine toob karmi karistuse / Raivo Aeg

    Index Scriptorium Estoniae

    Aeg, Raivo, 1962-

    2007-01-01

    Ilmunud ka: Põhjarannik, 22. mai 2007, lk. 2; Severnoje Poberezhje, 22. mai 2007, lk. 2; Oma Saar, 23. mai 2007, lk. 5; Postimees, 23. mai 2007, lk. 16; SL Õhtuleht, 23. mai 2007, lk. 12; Virumaa Teataja, 24. mai 2007, lk. 11; Vooremaa, 24. mai 2007, lk. 2; Koit, 24. mai 2007, lk. 6; Lõunaleht, 24. mai 2007, lk. 2; Võrumaa Teataja, 24. mai 2007, lk. 2; Den za Dnjom, 25. mai 2007, lk. 19; Harjumaa, 25. mai 2007, lk. 2; Vali Uudised, 25. mai 2007, lk. 2; Lääne Elu, 26. mai 2007, lk. 4; Järva Teataja, 29. mai 2007, lk. 2; Narvskaja Nedelja, 2. juuni 2007, lk. 4. Politseiameti peadirektor Raivo Aeg liiklusjärelevalve tõhustamisest, liikluskeskkonna ohutumaks muutmisest

  8. Erakordne aeg või valed mudelid? / Erik Aru

    Index Scriptorium Estoniae

    Aru, Erik

    2008-01-01

    Paul De Grauwe, Leonardo Iania ja Pablo Rovira Kaltwasser arvutasid välja börsidel erakordsemate päevade esinemise tõenäosuse. Nende järelduse kohaselt ei ole mitte praegune aeg erakordne, vaid finantsmudelid on valed. Lisa: Indeks Dow Jones Industrial Average oktoobrikuus

  9. Astrocyte elevated gene-1 (AEG-1 is a marker for aggressive salivary gland carcinoma

    Directory of Open Access Journals (Sweden)

    Liao Wen-Ting

    2011-12-01

    Full Text Available Abstract Background Astrocyte elevated gene-1 (AEG-1 is associated with tumorigenesis and progression in diverse human cancers. The present study was aimed to investigate the clinical and prognostic significance of AEG-1 in salivary gland carcinomas (SGC. Methods Real-time PCR and western blot analyses were employed to examine AEG-1 expression in two normal salivary gland tissues, eight SGC tissues of various clinical stages, and five pairs of primary SGC and adjacent salivary gland tissues from the same patient. Immunohistochemistry (IHC was performed to examine AEG-1 protein expression in paraffin-embedded tissues from 141 SGC patients. Statistical analyses was applies to evaluate the diagnostic value and associations of AEG-1 expression with clinical parameters. Results AEG-1 expression was evidently up-regulated in SGC tissues compared with that in the normal salivary gland tissues and in matched adjacent salivary gland tissues. AEG-1 protein level was positively correlated with clinical stage (P P = 0.008, N classification (P = 0.008 and M classifications (P = 0.006. Patients with higher AEG-1 expression had shorter overall survival time, whereas those with lower tumor AEG-1 expression had longer survival time. Conclusions Our results suggest that AEG-1 expression is associated with SGC progression and may represent a novel and valuable predictor for prognostic evaluation of SGC patients.

  10. Antihydrogen physics: gravitation and spectroscopy in AEgIS

    CERN Document Server

    Ferragut, R; Stroke, H H; Dassa, L; Rohne, O; Hogan, S D; Cialdi, S; Al-Qaradawi, I Y; Formaro, L; Sandaker, H; Testera, G; Stepanov, S V; Folegati, P; Morhard, C; Warring, U; Prelz, F; Belov, A S; Bonomi, G; Consolati, G; Ferrari, G; Lagomarsino, V; Krasnicky, D; Drobychev, G; Giammarchi, M G; Heyne, R; Zenoni, A; Castelli, F; Mariazzi, S; Cabaret, L; Fischer, A; Boscolo, I; Sillou, D; Villa, F; Perini, D; Djourelov, N; Zavatarelli, S; Oberthaler, M K; Manuzio, G; Carraro, C; Matveev, V A; Jorgensen, L V; Nedelec, P; Prevedelli, M; Comparat, D; Dupasquier, A; Turbabin, A V; Zvezhinskij, D S; Fontana, A; Kellerbauer, A; Canali, C; Dudarev, A; Petracek, V; Riccardi, C; Nebbia, G; Gninenko, S N; Brusa, R S; Rotondi, A; Sacerdoti, M; Calloni, A; Doser, M; Byakov, V M; Quasso, F; Trezzi, D

    2011-01-01

    AEgIS (Antimatter experiment: gravity, interferometry, spectroscopy) is an experiment approved by CERN with the goal of studying antihydrogen physics. In AEgIS, antihydrogen will be produced by charge exchange reactions of cold antiprotons with positronium atoms excited in a Rydberg state (n > 20). In the first phase of the experiment, controlled acceleration by an electric field gradient (Stark effect) and subsequent measurement of free fall in a Moire deflectometer will allow a test of the weak equivalence principle. In a second phase, the antihydrogen will be slowed, confined, and laser-cooled to perform CPT studies and detailed spectroscopy. In the present work, after a general description of the experiment, the present status of advancement will be reviewed, with special attention to the production and excitation of positronium atoms.

  11. Emulsion detectors for the antihydrogen detection in AEgIS

    International Nuclear Information System (INIS)

    The AEgIS experiment at CERN aims to perform the first direct measurement of gravitational interaction between matter and antimatter by measuring the deviation of a cold antihydrogen beam in the Earth gravitational field. The design of the experiment has been recently updated to include emulsion films as position sensitive detector. The submicrometric position accuracy of emulsions leads indeed to a significant improvement of the experimental sensitivity. We present results of preliminary tests and discuss perspectives for the final measurement

  12. Emulsion detectors for the antihydrogen detection in AEgIS

    Energy Technology Data Exchange (ETDEWEB)

    Pistillo, C., E-mail: ciro.pistillo@cern.ch [University of Bern, Albert Einstein Center for Fundamental Physics, Laboratory for High Energy Physics (Switzerland); Aghion, S. [Politecnico of Milano (Italy); Amsler, C.; Ariga, A.; Ariga, T. [University of Bern, Albert Einstein Center for Fundamental Physics, Laboratory for High Energy Physics (Switzerland); Belov, A. [Institute for Nuclear Research of the Russian Academy of Science (Russian Federation); Bonomi, G. [University of Brescia, Department of Mechanical and Industrial Engineering (Italy); Bräunig, P. [Heidelberg University, Kirchhoff-Institute for Physics (Germany); Bremer, J. [CERN, Physics Department (Switzerland); Brusa, R. S. [University of Trento, Department of Physics (Italy); Cabaret, L. [University of Paris-Sud, Laboratory Aim Cotton, CNRS (France); Caccia, M. [INFN Milano (Italy); Caravita, R. [University of Genova, Department of Physics (Italy); Castelli, F. [INFN Milano (Italy); Cerchiari, G. [Max Planck Institute for Nuclear Physics (Germany); Chlouba, K. [Czech Technical University (Czech Republic); Cialdi, S. [INFN Milano (Italy); Comparat, D. [University of Paris-Sud, Laboratory Aim Cotton, CNRS (France); Consolati, G. [Politecnico of Milano (Italy); Demetrio, A. [Heidelberg University, Kirchhoff-Institute for Physics (Germany); and others

    2015-08-15

    The AEgIS experiment at CERN aims to perform the first direct measurement of gravitational interaction between matter and antimatter by measuring the deviation of a cold antihydrogen beam in the Earth gravitational field. The design of the experiment has been recently updated to include emulsion films as position sensitive detector. The submicrometric position accuracy of emulsions leads indeed to a significant improvement of the experimental sensitivity. We present results of preliminary tests and discuss perspectives for the final measurement.

  13. Lõigutud aeg - "Impact 5" / Vappu Thurlow, Loit Jõekalda

    Index Scriptorium Estoniae

    Thurlow, Vappu, 1960-

    2006-01-01

    17.-21. 10. 2007 toimub Kumu Kunstimuuseumis rahvusvaheline graafikakonverents "Impact 5". Teema "Slices of Time / Lõigutud aeg" on tuletatud Henri Bergsoni filosoofiast. 4. XII toimus Adamson-Ericu muuseumis "Impact'i"-teemaline seminar. "Impact 5" logokonkursi võitis Heino Prunsvelt, II - Aapo Pukk. Kuraatorid tutvustavad küsimusi, mis võiksid olla mõtlemisaineks seoses "Impact'i" ja praeguse olukorraga ning tutvustavad lühidalt Henri Bergsoni filosoofilisi vaateid

  14. Genome sequencing and annotation of multidrug resistant Mycobacterium tuberculosis (MDR-TB PR10 strain

    Directory of Open Access Journals (Sweden)

    Mohd Zakihalani A. Halim

    2016-03-01

    Full Text Available Here, we report the draft genome sequence and annotation of a multidrug resistant Mycobacterium tuberculosis strain PR10 (MDR-TB PR10 isolated from a patient diagnosed with tuberculosis. The size of the draft genome MDR-TB PR10 is 4.34 Mbp with 65.6% of G + C content and consists of 4637 predicted genes. The determinants were categorized by RAST into 400 subsystems with 4286 coding sequences and 50 RNAs. The whole genome shotgun project has been deposited at DDBJ/EMBL/GenBank under the accession number CP010968.

  15. Evaluation of the allergenicity potential of TcPR-10 protein from Theobroma cacao.

    Directory of Open Access Journals (Sweden)

    Sara Pereira Menezes

    Full Text Available BACKGROUND: The pathogenesis related protein PR10 (TcPR-10, obtained from the Theobroma cacao-Moniliophthora perniciosa interaction library, presents antifungal activity against M. perniciosa and acts in vitro as a ribonuclease. However, despite its biotechnological potential, the TcPR-10 has the P-loop motif similar to those of some allergenic proteins such as Bet v 1 (Betula verrucosa and Pru av 1 (Prunus avium. The insertion of mutations in this motif can produce proteins with reduced allergenic power. The objective of the present work was to evaluate the allergenic potential of the wild type and mutant recombinant TcPR-10 using bioinformatics tools and immunological assays. METHODOLOGY/PRINCIPAL FINDINGS: Mutant substitutions (T10P, I30V, H45S were inserted in the TcPR-10 gene by site-directed mutagenesis, cloned into pET28a and expressed in Escherichia coli BL21(DE3 cells. Changes in molecular surface caused by the mutant substitutions was evaluated by comparative protein modeling using the three-dimensional structure of the major cherry allergen, Pru av 1 as a template. The immunological assays were carried out in 8-12 week old female BALB/c mice. The mice were sensitized with the proteins (wild type and mutants via subcutaneous and challenged intranasal for induction of allergic airway inflammation. CONCLUSIONS/SIGNIFICANCE: We showed that the wild TcPR-10 protein has allergenic potential, whereas the insertion of mutations produced proteins with reduced capacity of IgE production and cellular infiltration in the lungs. On the other hand, in vitro assays show that the TcPR-10 mutants still present antifungal and ribonuclease activity against M. perniciosa RNA. In conclusion, the mutant proteins present less allergenic potential than the wild TcPR-10, without the loss of interesting biotechnological properties.

  16. Preparing for a Professional Career in the Geosciences with AEG

    Science.gov (United States)

    Barry, T.; Troost, K. G.

    2012-12-01

    The Association of Environmental and Engineering Geologists offers multiple resources to students and faculty about careers in the geosciences, such as description of what employers are looking for, career options, mentoring, and building your professional network. Our website provides easy access to these and other resources. Most of AEG's 3000 members found their first job through association with another AEG member and more than 75% of our membership is working in applied geoscience jobs. We know that employers are looking for the following qualities: passion for your career and the geosciences, an enthusiastic personality, flexibility, responsibility, ability to communicate well in oral and written modes, and the ability to work well in teams or independently. Employers want candidates with a strong well-rounded geoscience education and the following skills/experience: attendance at field camp, working knowledge of field methodologies, strong oral and written communication skills, basic to advanced computer skills, and the ability to conduct research. In addition, skill with GIS applications, computer modeling, and 40-hour OSHA training are desired. The most successful technique for finding a job is to have and use a network. Students can start building their network by attending regular AEG or other professional society monthly meetings, volunteering with the society, attending annual meetings, going on fieldtrips and participating in other events. Students should research what kind of job they want and build a list of potential preferred employers, then market themselves to people within those companies using networking opportunities. Word-of-mouth sharing of job openings is the most powerful tool for getting hired, and if students have name recognition established within their group of preferred employers, job interviews will occur at a faster rate than otherwise.

  17. Subcellular localization and functional analyses of a PR10 protein gene from Vitis pseudoreticulata in response to Plasmopara viticola infection.

    Science.gov (United States)

    He, Mingyang; Xu, Yan; Cao, Jiangling; Zhu, Ziguo; Jiao, Yuntong; Wang, Yuejin; Guan, Xin; Yang, Yazhou; Xu, Weirong; Fu, Zhenfang

    2013-02-01

    Downy mildew, caused by the oomycete Plasmopara viticola, is a serious fungal disease in the cultivated European grapevines (Vitis vinifera L.). The class 10 of pathogenesis-related (PR) genes in grapevine leaves was reported to be accumulated at mRNA level in response to P. viticola infection. To elucidate the functional roles of PR10 genes during plant-pathogen interactions, a PR10 gene from a fungal-resistant accession of Chinese wild Vitis pseudoreticulata (designated VpPR10.2) was isolated and showed high homology to PR10.2 from susceptible V. vinifera (designated VvPR10.2). Comparative analysis displayed that there were significant differences in the patterns of gene expression between the PR10 genes from the two host species. VpPR10.2 was induced with high level in leaves infected by P. viticola, while VvPR10.2 showed a low response to this inoculation. Recombinant VpPR10.2 protein showed DNase activity against host genomic DNA and RNase activity against yeast total RNA in vitro. Meanwhile, recombinant VpPR10.2 protein inhibited the growth of tobacco fungus Alternaria alternata and over-expression of VpPR10.2 in susceptible V. vinifera enhanced the host resistance to P. viticola. The results from subcellular localization analysis showed that VpPR10.2 proteins were distributed dynamically inside or outside of host cell. Moreover, they were found in haustorium of P. viticola and nucleus of host cell which was associated with a nucleus collapse at 10 days post-inoculation. Taken together, these results suggested that VpPR10.2 might play an important role in host plant defense against P. viticola infection. PMID:22327469

  18. On the way to measuring gbar with AEgIS

    CERN Document Server

    Palchoudhuri, Paroma

    2015-01-01

    The main goal of AEgIS is to measure the fall of antihydrogen in the Earth's gravitational eld, which is a direct test of Einstein's Weak Equivalence Principle. This gravity measurement requires the production of a pulsed and cold antihydrogen beam whose vertical de ection will be observed in a set of moire de ectometer gratings. The antihydrogen detector was previously built in order to measure the produc- tion and temperature of the antihydrogen atoms and for establishing the formation of the antihydrogen beam. This detector consist of scintillating bers that are con- nected to Multi-Pixel-Photon-Counters (MPPCs) which are further connected to readout electrons. For a total of 816 MPPCs, the bias voltage was tested. It was observed that one channel out of the 816 was not functional. Additionally, in the current setup antiprotons, which are used to produce anti- hydrogen, are cooled to 4 K using electrons. A uorescence spectroscopy technique that uses C 2 molecules to more efficiently cool antiprotons i...

  19. Molecular Cloning and Expression Analysis of hyp-1 Type PR-10 Family Genes in Hypericum perforatum

    Science.gov (United States)

    Karppinen, Katja; Derzsó, Emese; Jaakola, Laura; Hohtola, Anja

    2016-01-01

    Hypericum perforatum L. is an important medicinal plant for the treatment of depression. The plant contains bioactive hypericins that accumulate in dark glands present especially in reproductive parts of the plant. In this study, pathogenesis-related class 10 (PR-10) family genes were identified in H. perforatum, including three previously unidentified members with sequence homology to hyp-1, a phenolic coupling protein that has earlier been suggested to participate in biosynthesis and binding/transportation of hypericin. The PR-10 genes showed constitutive but variable expression patterns in different H. perforatum tissues. They were all expressed at relatively high levels in leaves, variably in roots and low levels in stem and reproductive parts of the plant with no specific association with dark glands. The gene expression was up-regulated in leaves after salicylic acid, abscisic acid and wounding treatments but with variable levels. To study exact location of the gene expression, in situ hybridization of hyp-1 transcripts was performed and the accumulation of the Hyp-1 protein was examined in various tissues. The presence of Hyp-1 protein in H. perforatum tissues mostly paralleled with the mRNA levels. In situ RNA hybridization localized the hyp-1 transcripts predominantly in vascular tissues in root and stem, while in leaf the mRNA levels were high also in mesophyll cells in addition to vasculature. Our results indicate that the studied PR-10 genes are likely to contribute to the defense responses in H. perforatum. Furthermore, despite the location of the hyp-1 transcripts in vasculature, no support for the transportation of the Hyp-1 protein to dark glands was found in the current study. The present results together with earlier data question the role of the hyp-1 as a key gene responsible for the hypericin biosynthesis in dark glands of H. perforatum.

  20. Molecular Cloning and Expression Analysis of hyp-1 Type PR-10 Family Genes in Hypericum perforatum.

    Science.gov (United States)

    Karppinen, Katja; Derzsó, Emese; Jaakola, Laura; Hohtola, Anja

    2016-01-01

    Hypericum perforatum L. is an important medicinal plant for the treatment of depression. The plant contains bioactive hypericins that accumulate in dark glands present especially in reproductive parts of the plant. In this study, pathogenesis-related class 10 (PR-10) family genes were identified in H. perforatum, including three previously unidentified members with sequence homology to hyp-1, a phenolic coupling protein that has earlier been suggested to participate in biosynthesis and binding/transportation of hypericin. The PR-10 genes showed constitutive but variable expression patterns in different H. perforatum tissues. They were all expressed at relatively high levels in leaves, variably in roots and low levels in stem and reproductive parts of the plant with no specific association with dark glands. The gene expression was up-regulated in leaves after salicylic acid, abscisic acid and wounding treatments but with variable levels. To study exact location of the gene expression, in situ hybridization of hyp-1 transcripts was performed and the accumulation of the Hyp-1 protein was examined in various tissues. The presence of Hyp-1 protein in H. perforatum tissues mostly paralleled with the mRNA levels. In situ RNA hybridization localized the hyp-1 transcripts predominantly in vascular tissues in root and stem, while in leaf the mRNA levels were high also in mesophyll cells in addition to vasculature. Our results indicate that the studied PR-10 genes are likely to contribute to the defense responses in H. perforatum. Furthermore, despite the location of the hyp-1 transcripts in vasculature, no support for the transportation of the Hyp-1 protein to dark glands was found in the current study. The present results together with earlier data question the role of the hyp-1 as a key gene responsible for the hypericin biosynthesis in dark glands of H. perforatum. PMID:27148343

  1. Molecular cloning and expression analysis of hyp-1 type PR-10 family genes in Hypericum perforatum

    Directory of Open Access Journals (Sweden)

    Katja eKarppinen

    2016-04-01

    Full Text Available Hypericum perforatum L. is an important medicinal plant for the treatment of depression. The plant contains bioactive hypericins that accumulate in dark glands present especially in reproductive parts of the plant. In this study, pathogenesis-related class 10 (PR-10 family genes were identified in H. perforatum, including three previously unidentified members with sequence homology to hyp-1, a phenolic coupling protein that has earlier been suggested to participate in hypericin biosynthesis and binding/transportation. The PR-10 genes showed constitutive but variable expression patterns in different H. perforatum tissues. They were all expressed at relatively high levels in leaves, variably in roots and low levels in stem and reproductive parts of the plant with no association with dark glands. The gene expression was up-regulated in leaves after salicylic acid, abscisic acid and wounding treatments but with variable levels. To study exact location of the gene expression, in situ hybridization of hyp-1 transcripts was performed and the accumulation of the Hyp-1 protein was examined in various tissues. The presence of Hyp-1 protein in H. perforatum tissues mostly paralleled with the mRNA levels. In situ RNA hybridization localized the hyp-1 transcripts predominantly in vascular tissues in root and stem, while in leaf the mRNA levels were high also in mesophyll cells in addition to vasculature. Our results indicate that the studied PR-10 genes are likely to contribute to the defence responses in H. perforatum. Furthermore, despite the location of the hyp-1 transcripts in vasculature, no support for the transportation of the Hyp-1 protein to dark glands was found in the current study. The present results together with earlier data question the role of the hyp-1 as a key gene responsible for the hypericin biosynthesis in dark glands of H. perforatum.

  2. Improved Shoot Regeneration, Salinity Tolerance and Reduced Fungal Susceptibility in Transgenic Tobacco Constitutively Expressing PR-10a Gene

    OpenAIRE

    Agarwal, Parinita; Dabi, Mitali; More, Prashant; Patel, Khantika; Jana, Kalyanashis; Agarwal, Pradeep K.

    2016-01-01

    Plants in ecosystems are simultaneously exposed to abiotic and biotic stresses, which restrict plant growth and development. The complex responses to these stresses are largely regulated by plant hormones, which in turn, orchestrate the different biochemical and molecular pathways to maneuver stress tolerance. The PR-10 protein family is reported to be involved in defense regulation, stress response and plant growth and development. The JcPR-10a overexpression resulted in increased number of ...

  3. Pathogenesis-related gene, JcPR-10a from Jatropha curcas exhibit RNase and antifungal activity.

    Science.gov (United States)

    Agarwal, Parinita; Bhatt, Vacha; Singh, Rekha; Das, Mamali; Sopory, Sudhir K; Chikara, Jitendra

    2013-06-01

    The pathogenesis-related proteins have a broad spectrum of roles, ranging from seed germination, development to resistance. The PR-10 is a multigene family differing from other PR proteins in being intracellular, small and acidic with similar 3D structures. We have isolated JcPR-10a cDNA with an ORF of 483 bp from J. curcas, an important biofuel crop grown in the wastelands of India. JcPR-10a gets clustered with dicots in phylogenetic tree. The genomic organisation analysis of JcPR-10a revealed the presence of an intron at conserved 185 bp position. Transcript expression of JcPR-10a was upregulated in response to different stimuli such as NaCl, salicylic acid, methyl jasmonate and M. phaseolina. In response to SA and Macrophomina the transcript was found increased at 48 h, however, in case of NaCl and MeJa a strong induction was observed at 12 h which decreased at 48 h. We first time report the transcript up regulation of PR-10 gene by Macrophomina, a pathogen causing collar rot in Jatropha. The recombinant E. coli cells showed better growth in LB medium supplemented with NaCl, whereas growth of recombinant cells was inhibited in LB medium supplemented with KCl, mannitol, sorbitol, methyl jasmonate and salicylic acid. The JcPR-10a protein was overexpressed in E. coli cells, and was purified to homogeneity, the purified protein exhibited RNase and DNase activity. Furthermore, the protein also showed antifungal activity against Macrophomina, indicating that JcPR-10a can serve as an important candidate to engineer stress tolerance in Jatropha as well as other plants susceptible to collar rot by Macrophomina. PMID:22763562

  4. Pojehali, hüüab "Jääaeg 2" / Tiit Tuumalu

    Index Scriptorium Estoniae

    Tuumalu, Tiit, 1971-

    2006-01-01

    Täispikk animafilm "Jääaeg 2 : Suur sula" ("Ice Age 2 : The Meltdown") : režissöör Carlos Sandanha : eestikeelse dublaazhi režissöör Peeter Simm : Ameerika Ühendriigid 2006. Peeter Simm dublaazhi tegemisest

  5. "Jääaeg 2" : tiiger Diego kurvastas Marko Matveret / Jaanus Kulli

    Index Scriptorium Estoniae

    Kulli, Jaanus, 1955-

    2006-01-01

    Täispikk animafilm "Jääaeg 2 : Suur sula" ("Ice Age 2 : The Meltdown") : režissöör Carlos Sandanha : eestikeelse dublaazhi režissöör Peeter Simm : Ameerika Ühendriigid 2006. Filmi dubleerimisest dubleerijate kommentaaridega

  6. Molecular cloning of a pathogen/wound-inducible PR10 promoter from Pinus monticola and characterization in transgenic Arabidopsis plants.

    Science.gov (United States)

    Liu, Jun-Jun; Ekramoddoullah, Abul K M; Piggott, Nina; Zamani, Arezoo

    2005-05-01

    In Pinus monticola (Dougl. ex D. Don), the class ten pathogenesis-related (PR10) proteins comprise a family of multiple members differentially expressed upon pathogen infection and other environmental stresses. One of them, PmPR10-1.13, is studied here by investigating its transcriptional regulation in transgenic Arabidopsis plants. For functional analyses of the PmPR10-1.13 promoter, a 1,316-bp promoter fragment and three 5' deletions were translationally fused to the ss-glucuronidase (GUS) reporter gene. The 1,316-bp promoter-driven GUS activity first appeared in hypocotyls and cotyledons in 2- to 3-day-old seedlings. As transgenic plants grew, GUS activity was detected strongly in apical meristems, next in stems and leaves. No GUS activity was detected in roots and in reproductive tissues of flower organs. In adult plants, the PmPR10-1.13 promoter-directed GUS expression was upregulated following pathogen infection and by wounding treatment, which generally mimic the endogenous expression pattern in western white pine. Promoter analysis of 5' deletions demonstrated that two regions between -1,316 and -930, and between -309 and -100 were responsible for the wound responsiveness. By structural and functional comparisons with PmPR10-1.14 promoter, putative wound-responsive elements were potentially identified in the PmPR10-1.13 promoter. In conclusion, PmPR10-1.13 showed properties of a defence-responsive gene, being transcriptionally upregulated upon biotic and abiotic stresses. PMID:15609047

  7. Improved Shoot Regeneration, Salinity Tolerance and Reduced Fungal Susceptibility in Transgenic Tobacco Constitutively Expressing PR-10a Gene.

    Science.gov (United States)

    Agarwal, Parinita; Dabi, Mitali; More, Prashant; Patel, Khantika; Jana, Kalyanashis; Agarwal, Pradeep K

    2016-01-01

    Plants in ecosystems are simultaneously exposed to abiotic and biotic stresses, which restrict plant growth and development. The complex responses to these stresses are largely regulated by plant hormones, which in turn, orchestrate the different biochemical and molecular pathways to maneuver stress tolerance. The PR-10 protein family is reported to be involved in defense regulation, stress response and plant growth and development. The JcPR-10a overexpression resulted in increased number of shoot buds in tobacco (Nicotiana tabacum), which could be due to high cytokinin to auxin ratio in the transgenics. The docking analysis shows the binding of three BAP molecules at the active sites of JcPR-10a protein. JcPR-10a transgenics showed enhanced salt tolerance, as was evident by increased germination rate, shoot and root length, relative water content, proline, soluble sugar and amino acid content under salinity. Interestingly, the transgenics also showed enhanced endogenous cytokinin level as compared to WT, which, further increased with salinity. Exposure of gradual salinity resulted in increased stomatal conductance, water use efficiency, photosynthesis rate and reduced transpiration rate. Furthermore, the transgenics also showed enhanced resistance against Macrophomina fungus. Thus, JcPR-10a might be working in co-ordination with cytokinin signaling in mitigating the stress induced damage by regulating different stress signaling pathways, leading to enhanced stress tolerance. PMID:26973666

  8. Improved Shoot Regeneration, Salinity Tolerance and Reduced Fungal Susceptibility in Transgenic Tobacco Constitutively Expressing PR-10a Gene

    Science.gov (United States)

    Agarwal, Parinita; Dabi, Mitali; More, Prashant; Patel, Khantika; Jana, Kalyanashis; Agarwal, Pradeep K.

    2016-01-01

    Plants in ecosystems are simultaneously exposed to abiotic and biotic stresses, which restrict plant growth and development. The complex responses to these stresses are largely regulated by plant hormones, which in turn, orchestrate the different biochemical and molecular pathways to maneuver stress tolerance. The PR-10 protein family is reported to be involved in defense regulation, stress response and plant growth and development. The JcPR-10a overexpression resulted in increased number of shoot buds in tobacco (Nicotiana tabacum), which could be due to high cytokinin to auxin ratio in the transgenics. The docking analysis shows the binding of three BAP molecules at the active sites of JcPR-10a protein. JcPR-10a transgenics showed enhanced salt tolerance, as was evident by increased germination rate, shoot and root length, relative water content, proline, soluble sugar and amino acid content under salinity. Interestingly, the transgenics also showed enhanced endogenous cytokinin level as compared to WT, which, further increased with salinity. Exposure of gradual salinity resulted in increased stomatal conductance, water use efficiency, photosynthesis rate and reduced transpiration rate. Furthermore, the transgenics also showed enhanced resistance against Macrophomina fungus. Thus, JcPR-10a might be working in co-ordination with cytokinin signaling in mitigating the stress induced damage by regulating different stress signaling pathways, leading to enhanced stress tolerance. PMID:26973666

  9. Improved shoot regeneration, salinity tolerance and reduced fungal susceptibility in transgenic tobacco constitutively expressing PR-10a gene

    Directory of Open Access Journals (Sweden)

    Parinita eAgarwal

    2016-02-01

    Full Text Available Plants in ecosystems are simultaneously exposed to abiotic and biotic stresses, which restrict plant growth and development. The complex responses to these stresses are largely regulated by plant hormones, which in turn, orchestrate the different biochemical and molecular pathways to manoeuvre stress tolerance. The PR-10 protein family is reported to be involved in defence regulation, stress response and plant growth and development. The JcPR-10a overexpression resulted in increased number of shoot buds in tobacco (Nicotiana tabacum, which could be due to high cytokinin to auxin ratio in the transgenics. The docking analysis shows the binding of three BAP molecules at the active sites of JcPR-10a protein. JcPR-10a transgenics showed enhanced salt tolerance, as was evident by increased germination rate, shoot and root length, relative water content, proline, soluble sugar and amino acid content under salinity. Interestingly, the transgenics also showed enhanced endogenous cytokinin level as compared to WT, which, further increased with salinity. Exposure of gradual salinity resulted in increased stomatal conductance, water use efficiency, photosynthesis rate and reduced transpiration rate. Furthermore, the transgenics also showed enhanced resistance against Macrophomina fungus. Thus, JcPR-10a might be working in co-ordination with cytokinin signalling in mitigating the stress induced damage by regulating different stress signalling pathways, leading to enhanced stress tolerance.

  10. AEG-1与CXCR4对乳腺癌脑转移的影响%Effect of AEG-1 and CXCR4 Gene on Breast Cancer Brain Metastasis

    Institute of Scientific and Technical Information of China (English)

    曲明阳; 李森; 赵胜男; 邢光明

    2011-01-01

    目的 探讨AEG-1与CXCR4基因表达对乳腺癌脑转移的影响.方法 对1997~2007年收治的乳腺癌患者进行随访,以发生脑转移的33例患者作为病例组,以未发生脑转移的45例患者作为对照组.通过免疫组化法,对照分析AEG-1及CXCR4对脑转移的影响.结果 脑转移组中AEG-1及CXCR4的阳性表达率分别为63.6%和60.6%,与其在对照组中表达(31.1%和33.3%)差异显著(P<0.05).logistic回归分析结果显示,AEG-1和CXCR4回归系数分别为1.242和1.545.结论 AEG-1和CXCR4阳性表达是乳腺癌发生脑转移的独立危险因子,AEG-1及CXCR4有望成为针对乳腺癌脑转移的高特异性早期诊断指标及基因治疗靶点.%Objective Explore the effect of AEG-1 and CXCR4 gene on brain metastasis in breast cancer. Methods 33 breast cancer patients with brain metastasis and 45 patients without brain metastasis in our hospital from 1997 to 2007 were chosen randomly for the case control study by immunohisto chemical method. Results the expression rate for AEG-land CXCR4 in the two groups were 63. 6% ,60. 6% and 31. 1% ,33. 3% respectively,with a notebly difference be observed, the regression coefficient for AEG-1 and CXCR4 was 1. 242 and 1. 545. Conclusion AEG-1 and CXCR4 were independent risk factors and may be specific diagnosis index and gene treatment taget for brain metastasis in breast cancer.

  11. Expression of AEG-1 mRNA and protein in colorectal cancer patients and colon cancer cell lines

    Directory of Open Access Journals (Sweden)

    Gnosa Sebastian

    2012-05-01

    Full Text Available Abstract Background Astrocyte elevated gene 1 (AEG-1, an important oncogene, has been shown to be overexpressed in several types of cancers. In colorectal cancer (CRC, the protein level of AEG-1 is up-regulated in tumour tissue compared to normal mucosa, showing prognostic significance. Since little is known about the transcriptional level of AEG-1 expression and its biological pathway in CRC the aim of the present study was to examine the relationship of AEG-1 mRNA expression, the protein level and clinicopathological variables as well as its biology pathway in CRC. Material and methods The mRNA expression of AEG-1 was analysed by qPCR in fresh frozen patient samples including 156 primary tumours, along with the corresponding normal mucosa, and in five colon cancer cell lines, SW480, SW620, KM12C, KM12SM and KM12L4a. AEG-1 protein expression was investigated by immunohistochemistry in paraffin-embedded materials from 74 distant normal mucosa, 107 adjacent mucosa, 158 primary tumour, 35 lymph node metastasis and 9 liver metastasis samples. In addition, the AEG-1 protein expression was elucidated in the cell lines by Western blot. Results The lymph node metastatic cell line SW620 had a significantly higher AEG-1 mRNA (0.27 ± 0.02 expression compared to the primary tumour cell line SW480 (0.17 ± 0.04, p = 0.026. AEG-1 expression at the mRNA level and/or the protein level was significantly up-regulated gradually from normal mucosa to primary CRC, and then to lymph node metastasis and finally to liver metastasis (p p = 0.047, as well as mRNA and protein expression with the tumour stage (p p  Conclusion AEG-1 is up-regulated, at the mRNA and the protein level, during CRC development and aggressiveness, and is related to tumour location and stage. It may play its role in CRC through the NF-κB signaling pathway.

  12. Development of Ultra Low-Temperature Electronics for the AEgIS Experiment

    CERN Document Server

    Kaltenbacher, Thomas; Kellerbauer, Alban; Doser, Michael; Caspers, Friedhelm

    This thesis presents the development of electronics for operation at cryogenic temperatures, with particular emphasis on the cryogenic electronics required for the Antimatter Experiment: Gravity, Interferometry, Spectroscopy (AEgIS) experiment at the European Organisation for Nuclear Research (CERN). The research is focused on a highly sensitive charged particle detection system for a Penning trap, on cryogenic low-pass filters and on a low-loss DC-contact RF switch. The detection system consists of a high quality factor tuned circuit including a superconducting coil, and a low-noise amplifier. Since the experimental setup of the AEgIS experiment requires it, the developed electronics must reliably operate at 4.2 K (~269C) and in high constant magnetic field of more than 1 Tesla. Therefore, the performance of the cryogenic electronic designs were carefully evaluated at low-temperature/high magnetic field, the result of which have important implications for the AEgIS experiment. Moreover, a new possibility of ...

  13. Characterization of PR-10 genes from eight Betula species and detection of Bet v 1 isoforms in birch pollen

    Directory of Open Access Journals (Sweden)

    van't Westende Wendy PC

    2009-03-01

    Full Text Available Abstract Background Bet v 1 is an important cause of hay fever in northern Europe. Bet v 1 isoforms from the European white birch (Betula pendula have been investigated extensively, but the allergenic potency of other birch species is unknown. The presence of Bet v 1 and closely related PR-10 genes in the genome was established by amplification and sequencing of alleles from eight birch species that represent the four subgenera within the genus Betula. Q-TOF LC-MSE was applied to identify which PR-10/Bet v 1 genes are actually expressed in pollen and to determine the relative abundances of individual isoforms in the pollen proteome. Results All examined birch species contained several PR-10 genes. In total, 134 unique sequences were recovered. Sequences were attributed to different genes or pseudogenes that were, in turn, ordered into seven subfamilies. Five subfamilies were common to all birch species. Genes of two subfamilies were expressed in pollen, while each birch species expressed a mixture of isoforms with at least four different isoforms. Isoforms that were similar to isoforms with a high IgE-reactivity (Bet v 1a = PR-10.01A01 were abundant in all species except B. lenta, while the hypoallergenic isoform Bet v 1d (= PR-10.01B01 was only found in B. pendula and its closest relatives. Conclusion Q-TOF LC-MSE allows efficient screening of Bet v 1 isoforms by determining the presence and relative abundance of these isoforms in pollen. B. pendula contains a Bet v 1-mixture in which isoforms with a high and low IgE-reactivity are both abundant. With the possible exception of B. lenta, isoforms identical or very similar to those with a high IgE-reactivity were found in the pollen proteome of all examined birch species. Consequently, these species are also predicted to be allergenic with regard to Bet v 1 related allergies.

  14. Development of the Cryogenic System of AEgIS at CERN

    CERN Document Server

    Derking, J H; Burghart, G; Doser, M; Dudarev, A; Haider, S

    2014-01-01

    The AEgIS (Antimatter Experiment: Gravity, Interferometry, Spectroscopy) experiment is located at the antiproton decelerator complex of CERN. The main goal of the experiment is to perform the first direct measurement of the Earth’s gravitational acceleration on antihydrogen atoms within 1% precision. The antihydrogen is produced in a cylindrical Penning trap by combining antiprotons with positrons. To reach the precision of 1%, the antihydrogen has to be cooled to 100 mK to reduce its random velocity. A dilution refrigerator is selected to deliver the necessary cooling capacity of 100 μW at 50 mK. The AEgIS cryogenic system basically consists of cryostats for a 1-T and for a 5-T superconducting magnet, a central region cryostat, a dilution refrigerator cryostat and a measurement cryostat with a Moiré deflectometer to measure the gravitational acceleration. In autumn 2012, the 1-T cryostat, 5-T cryostat and central region cryostat were assembled and commissioned. The apparatus is cooled down in eight days ...

  15. AEgIS experiment: Towards anti-hydrogen beam production for antimatter gravity measurements

    International Nuclear Information System (INIS)

    AEgIS (Antimatter Experiment: Gravity, Interferometry, Spectroscopy) is an experiment that aims to perform the first direct measurement of the gravitational acceleration g of anti-hydrogen in the Earth's field. A cold anti-hydrogen beam will be produced by charge exchange reaction between cold antiprotons and positronium excited in Rydberg states. Rydberg positronium (with quantum number n between 20 and 30) will be produced by a two steps laser excitation. The anti-hydrogen beam, after being accelerated by Stark effect, will fly through the gratings of a 'moire' deflectometer. The deflection of the horizontal beam due to its free fall will be measured by a position sensitive detector. It is estimated that the detection of about 103 anti-hydrogen atoms is required to determine the gravitational acceleration with a precision of 1%. In this report an overview of the AEgIS experiment is presented and its current status is described. Details on the production of slow positronium and its excitation with lasers are discussed. (authors)

  16. AEgIS experiment: Towards antihydrogen beam production for antimatter gravity measurements

    CERN Document Server

    Mariazzi, Sebastiano; Amsler, Claude; Ariga, Akitaka; Ariga, Tomoko; Belov, Alexandre S; Bonomi, Germano; Bräunig, Philippe; Brusa, Roberto S; Bremer, Johan; Cabaret, Louis; Canali, Carlo; Caravita, Ruggero; Castelli, Fabrizio; Cerchiari, Giovanni; Cialdi, Simone; Comparat, Daniel; Consolati, Giovanni; Dassa, Luca; Derking, Jan Hendrik; Di Domizio, Sergio; Di Noto, Lea; Doser, Michael; Dudarev, Alexey; Ereditato, Antonio; Ferragut, Rafael; Fontana, Andrea; Genova, Pablo; Giammarchi, Marco; Gligorova, Angela; Gninenko, Sergei N; Hogan, Stephen D; Haider, Stefan; Jordan, Elena; Jørgensen, Lars V; Kaltenbacher, Thomas; Kawada, Jiro; Kellerbauer, Alban; Kimura, Mitsuhiro; Knecht, Andreas; Krasnický, Daniel; Lagomarsino, Vittorio; Lehner, Sebastian; Malbrunot, Chloe; Matveev, Viktor A; Merkt, Frederic; Moia, Fabio; Nebbia, Giancarlo; Nédélec, Patrick; Oberthaler, Markus K; Pacifico, Nicola; Petráček, Vojtech; Pistillo, Ciro; Prelz, Francesco; Prevedelli, Marco; Regenfus, Christian; Riccardi, Cristina; Røhne, Ole; Rotondi, Alberto; Sandaker, Heidi; Scampoli, Paola; Storey, James; Subieta Vasquez, Martin A.; Spaček, Michal; Czech Technical U. in Prague - FNSPE - B\\oehova 7 - 11519 - Praha 1 - Czech Aff25 Testera, Gemma; Vaccarone, Renzo; Villa, Fabio; Widmann, Eberhard; Zavatarelli, Sandra; Zmeskal, Johann

    2014-01-01

    AEgIS (Antimatter Experiment: Gravity, Interferometry, Spectroscopy) is an experiment that aims to perform the first direct measurement of the gravitational acceleration g of antihydrogen in the Earth’s field. A cold antihydrogen beam will be produced by charge exchange reaction between cold antiprotons and positronium excited in Rydberg states. Rydberg positronium (with quantum number n between 20 and 30) will be produced by a two steps laser excitation. The antihydrogen beam, after being accelerated by Stark effect, will fly through the gratings of a moir ́ e deflectometer. The deflection of the horizontal beam due to its free fall will be measured by a position sensitive detector. It is estimated that the detection of about 10 3 antihydrogen atoms is required to determine the gravitational acceleration with a precision of 1%. In this report an overview of the AEgIS experiment is presented and its current status is described. Details on the production of slow positronium and its excitation with lasers ar...

  17. Trigermanides AEGe{sub 3} (AE = Ca, Sr, Ba). Chemical bonding and superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Castillo, Rodrigo; Schnelle, Walter; Baranov, Alexey I.; Burkhardt, Ulrich; Bobnar, Matej; Cardoso-Gil, Raul; Schwarz, Ulrich; Grin, Yuri [Max-Planck-Institut fuer Chemische Physik Fester Stoffe, Dresden (Germany)

    2016-08-01

    The crystal structures of the trigermanides AEGe{sub 3}(tI32) (AE = Ca, Sr, Ba; space group I4/mmm, for SrGe{sub 3}: a = 7.7873(1), c = 12.0622(3) Aa) comprise Ge{sub 2} dumbbells forming layered Ge substructures which enclose embedded AE atoms. The chemical bonding analysis by application of the electron localizability approach reveals a substantial charge transfer from the AE atoms to the germanium substructure. The bonding within the dumbbells is of the covalent two-center type. A detailed analysis of SrGe{sub 3} reveals that the interaction on the bond-opposite side of the Ge{sub 2} groups is not lone pair-like - as it would be expected from the Zintl-like interpretation of the crystal structure with anionic Ge layers separated by alkaline-earth cations - but multi-center strongly polar between the Ge{sub 2} dumbbells and the adjacent metal atoms. Similar atomic interactions are present in CaGe{sub 3} and BaGe{sub 3}. The variation of the alkaline-earth metal has a merely insignificant influence on the superconducting transition temperatures in the s,p-electron compounds AEGe{sub 3}.

  18. 2 ühe hoobiga. "Uskumatu Hulk", "Aeg on käes..." / Helmut Jänes

    Index Scriptorium Estoniae

    Jänes, Helmut, 1972-

    2008-01-01

    Seiklusfilm "Uskumatu Hulk" ("The Incredible Hulk") : režissöör Louis Leterrier : Ameerika Ühendriigid 2008 ja ulmefilm "Aeg on käes..." ("The Happening") : režissöör M. Night Shyamalan : peaosas Mark Wahlberg : Ameerika Ühendriigid - India 2008

  19. An IgE epitope of Bet v 1 and fagales PR10 proteins as defined by a human monoclonal IgE

    DEFF Research Database (Denmark)

    Hecker, J.; Diethers, A.; Schulz, D.;

    2012-01-01

    formats including IgE. Using variants of Bet v 1, the epitope of the antibody was mapped and extrapolated to other PR10 proteins. RESULTS: The obtained antibodies exhibited pronounced reactivity with Bet v 1, but were not reactive with the homologous PR10 protein Mal d 1. The epitope as defined by the Ig......-reactivities predicted by primary structure analyses of different isoforms and PR10 proteins were verified by allergen chip-based analyses. CONCLUSIONS: The obtained results demonstrate that hybrid IgE repertoires represent a source for human antibodies with genuine paratopes. The IgE-derived information about the Ig......E epitope nature of Bet v 1 and homologues allows for detailed insights into molecular aspects of allergenicity and cross-reactivity within the PR10 protein family....

  20. Gravitational interaction of antihydrogen: the AEgIS experiment at CERN

    International Nuclear Information System (INIS)

    Full text: The AEgIS experiment aims to directly measure the gravitational acceleration g on a pulsed beam of cold antihydrogen atoms. Rydberg antihydrogen atoms produced by mixing of antiprotons with positronium atoms laser-excited into a Rydberg state (Ps*) will be accelerated horizontally. The minute vertical deflection and the flight time will be measured using a moiré deflectometer similarly to what has been done with Ar atoms. The experimental apparatus has been completed and commissioned in 2012 with antiprotons and positrons. A description of the experimental setup, of results of the 2012 data taking and of the on-going studies as well as future perspectives will be presented. (author)

  1. Combination of Nanoparticle-Delivered siRNA for Astrocyte Elevated Gene-1 (AEG-1) and All-trans Retinoic Acid (ATRA): An Effective Therapeutic Strategy for Hepatocellular Carcinoma (HCC).

    Science.gov (United States)

    Rajasekaran, Devaraja; Srivastava, Jyoti; Ebeid, Kareem; Gredler, Rachel; Akiel, Maaged; Jariwala, Nidhi; Robertson, Chadia L; Shen, Xue-Ning; Siddiq, Ayesha; Fisher, Paul B; Salem, Aliasger K; Sarkar, Devanand

    2015-08-19

    Hepatocellular carcinoma (HCC) is a fatal cancer with no effective therapy. Astrocyte elevated gene-1 (AEG-1) plays a pivotal role in hepatocarcinogenesis and inhibits retinoic acid-induced gene expression and cell death. The combination of a lentivirus expressing AEG-1 shRNA and all-trans retinoic acid (ATRA) profoundly and synergistically inhibited subcutaneous human HCC xenografts in nude mice. We have now developed liver-targeted nanoplexes by conjugating poly(amidoamine) (PAMAM) dendrimers with polyethylene glycol (PEG) and lactobionic acid (Gal) (PAMAM-PEG-Gal) which were complexed with AEG-1 siRNA (PAMAM-AEG-1si). The polymer conjugate was characterized by (1)H-NMR, MALDI, and mass spectrometry; and optimal nanoplex formulations were characterized for surface charge, size, and morphology. Orthotopic xenografts of human HCC cell QGY-7703 expressing luciferase (QGY-luc) were established in the livers of athymic nude mice and tumor development was monitored by bioluminescence imaging (BLI). Tumor-bearing mice were treated with PAMAM-siCon, PAMAM-siCon+ATRA, PAMAM-AEG-1si, and PAMAM-AEG-1si+ATRA. In the control group the tumor developed aggressively. ATRA showed little effect due to high AEG-1 levels in QGY-luc cells. PAMAM-AEG-1si showed significant reduction in tumor growth, and the combination of PAMAM-AEG-1si+ATRA showed profound and synergistic inhibition so that the tumors were almost undetectable by BLI. A marked decrease in AEG-1 level was observed in tumor samples treated with PAMAM-AEG-1si. The group treated with PAMAM-AEG-1si+ATRA nanoplexes showed increased necrosis, inhibition of proliferation, and increased apoptosis when compared to other groups. Liver is an ideal organ for RNAi therapy and ATRA is an approved anticancer agent. Our exciting observations suggest that the combinatorial approach might be an effective way to combat HCC. PMID:26079152

  2. Development of nuclear emulsions with 1μm spatial resolution for the AEgIS experiment

    International Nuclear Information System (INIS)

    The main goal of the AEgIS experiment at CERN is to test the weak equivalence principle for antimatter. We will measure the Earth's gravitational acceleration g¯ with antihydrogen atoms being launched in a horizontal vacuum tube and traversing a moiré deflectometer. We intend to use a position sensitive device made of nuclear emulsions (combined with a time-of-flight detector such as silicon μ-strips) to measure precisely their annihilation points at the end of the tube. The goal is to determine g¯ with a 1% relative accuracy. In 2012 we tested emulsion films in vacuum and at room temperature with low energy antiprotons from the CERN antiproton decelerator. First results on the expected performance for AEgIS are presented

  3. Development of nuclear emulsions with 1μm spatial resolution for the AEgIS experiment

    Energy Technology Data Exchange (ETDEWEB)

    Kimura, M. [Albert Einstein Center for Fundamental Physics, Laboratory for High Energy Physics, University of Bern, 3012 Bern (Switzerland); Aghion, S. [Politecnico di Milano, Piazza Leonardo da Vinci 32, 20133 Milano (Italy); Istituto Nazionale di Fisica Nucleare, Sez. di Milano, Via Celoria 16, 20133 Milano (Italy); Ahlén, O. [European Organisation for Nuclear Research, Physics Department, 1211 Geneva 23 (Switzerland); Amsler, C., E-mail: claude.amsler@cern.ch [Albert Einstein Center for Fundamental Physics, Laboratory for High Energy Physics, University of Bern, 3012 Bern (Switzerland); Ariga, A.; Ariga, T. [Albert Einstein Center for Fundamental Physics, Laboratory for High Energy Physics, University of Bern, 3012 Bern (Switzerland); Belov, A.S. [Institute for Nuclear Research of the Russian Academy of Sciences, Moscow 117312 (Russian Federation); Bonomi, G. [University of Brescia, Department of Mechanical and Industrial Engineering, Via Branze 38, 25133 Brescia (Italy); Istituto Nazionale di Fisica Nucleare, Sez. di Pavia, Via Agostino Bassi 6, 27100 Pavia (Italy); Bräunig, P. [University of Heidelberg, Kirchhoff Institute for Physics, Im Neuenheimer Feld 227, 69120 Heidelberg (Germany); Bremer, J. [European Organisation for Nuclear Research, Physics Department, 1211 Geneva 23 (Switzerland); Brusa, R.S. [Dipartimento di Fisica, Università di Trento and INFN, Gruppo Collegato di Trento, Via Sommarive 14, 38050 Povo, Trento (Italy); Burghart, G. [European Organisation for Nuclear Research, Physics Department, 1211 Geneva 23 (Switzerland); Cabaret, L. [Laboratoire Aimé Cotton, CNRS, Université Paris Sud, ENS Cachan, Bâtiment 505, Campus d' Orsay, 91405 Orsay Cedex (France); Canali, C. [University of Zurich, Physics Institute, Winterthurerstrasse 190, 8057 Zurich (Switzerland); and others

    2013-12-21

    The main goal of the AEgIS experiment at CERN is to test the weak equivalence principle for antimatter. We will measure the Earth's gravitational acceleration g{sup ¯} with antihydrogen atoms being launched in a horizontal vacuum tube and traversing a moiré deflectometer. We intend to use a position sensitive device made of nuclear emulsions (combined with a time-of-flight detector such as silicon μ-strips) to measure precisely their annihilation points at the end of the tube. The goal is to determine g{sup ¯} with a 1% relative accuracy. In 2012 we tested emulsion films in vacuum and at room temperature with low energy antiprotons from the CERN antiproton decelerator. First results on the expected performance for AEgIS are presented.

  4. Development of nuclear emulsions with 1 $\\mu$m spatial resolution for the AEgIS experiment

    CERN Document Server

    Kimura, M; Ahlén, O; Amsler, C; Ariga, A; Ariga, T; Belov, A.S; Bonomi, G; Bräunig, P; Bremer, J; Brusa, R.S; Burghart, G; Cabaret, L; Canali, C; Caravita, R; Castelli, F; Cerchiari, G; Cialdi, S; Comparat, D; Consolati, G; Di Domizio, S; Di Noto, L; Doser, M; Dudarev, A; Ereditato, A; Ferragut, R; Fontana, A; Genova, P; Giammarchi, M; Gligorova, A; Gninenko, S.N; Haider, S; Hogan, S.D; Huse, T; Jordan, E; Jørgensen, L.V; Kaltenbacher, T; Kawada, J; Kellerbauer, A; Knecht, A; Krasnický, D; Lagomarsino, V; Mariazzi, S; Matveev, V.A; Merkt, F; Moia, F; Nebbia, G; Nédélec, P; Oberthaler, M.K; Pacifico, N; Petrácek, V; Pistillo, C; Prelz, F; Prevedelli, M; Regenfus, C; Riccardi, C; Røhne, O; Rotondi, A; Sandaker, H; Scampoli, P; Spacek, M; Storey, J; Subieta Vasquez, M.A; Testera, G; Trezzi, D; Vaccarone, R; Zavatarelli, S

    2013-01-01

    The main goal of the AEgIS experiment at CERN is to test the weak equivalence principle for antimatter. We will measure the Earth ' s gravitational acceleration g with antihydrogen atoms being launched in a horizontal vacuum tube and traversing a moiré de fl ectometer. We intend to use a position sensitive device made of nuclear emulsions (combined with a time-of- fl ight detector such as silicon μ strips) to measure precisely their annihilation points at the end of the tube. The goal is to determine g with a 1% relative accuracy. In 2012 we tested emulsion fi lms in vacuum and at room temperature with low energy antiprotons from the CERN antiproton decelerator. First results on the expected performance for AEgIS are presented

  5. Multiple Patterns of Regulation and Overexpression of a Ribonuclease-Like Pathogenesis-Related Protein Gene, OsPR10a, Conferring Disease Resistance in Rice and Arabidopsis

    Science.gov (United States)

    He, Siou-Luan; Chen, Jyh-Lang; Jiang, Jian-Zhi; Chen, Bo-Hong; Hou, Yi-Syuan; Chen, Ruey-Shyang; Hong, Chwan-Yang; Ho, Shin-Lon

    2016-01-01

    An abundant 17 kDa RNase, encoded by OsPR10a (also known as PBZ1), was purified from Pi-starved rice suspension-cultured cells. Biochemical analysis showed that the range of optimal temperature for its RNase activity was 40–70°C and the optimum pH was 5.0. Disulfide bond formation and divalent metal ion Mg2+ were required for the RNase activity. The expression of OsPR10a::GUS in transgenic rice was induced upon phosphate (Pi) starvation, wounding, infection by the pathogen Xanthomonas oryzae pv. oryzae (Xoo), leaf senescence, anther, style, the style-ovary junction, germinating embryo and shoot. We also provide first evidence in whole-plant system, demonstrated that OsPR10a-overexpressing in rice and Arabidopsis conferred significant level of enhanced resistance to infection by the pathogen Xoo and Xanthomona campestris pv. campestris (Xcc), respectively. Transgenic rice and Arabidopsis overexpressing OsPR10a significantly increased the length of primary root under phosphate deficiency (-Pi) condition. These results showed that OsPR10a might play multiple roles in phosphate recycling in phosphate-starved cells and senescing leaves, and could improve resistance to pathogen infection and/or against chewing insect pests. It is possible that Pi acquisition or homeostasis is associated with plant disease resistance. Our findings suggest that gene regulation of OsPR10a could act as a good model system to unravel the mechanisms behind the correlation between Pi starvation and plant-pathogen interactions, and also provides a potential application in crops disease resistance. PMID:27258121

  6. Euroopa Inimõiguste konventsiooni artikli 5 3. lõige : mõistlik aeg Euroopa Inimõiguste Kohtu praktikas ja Eesti õiguskorras : [bakalaureusetöö] / Toomas Ventsli ; Tartu Ülikool, õigusteaduskond ; juhendaja: Jaan Ginter

    Index Scriptorium Estoniae

    Ventsli, Toomas

    2003-01-01

    Vabaduse võtmise kohtulik kontroll, kinnipidamise mõistlikkuse hindamine, mõistlik aeg Eesti õigussüsteemis - vahi alla võtmist ja vahi all pidamise pikendamist reguleerivad õigusallikad, eelvangistuses viibitud aeg, vahi all pidamise pikendamine, kinnipidamise põhjendatuse hindamine

  7. Particle tracking at 4 K: The Fast Annihilation Cryogenic Tracking (FACT) detector for the AEgIS antimatter gravity experiment

    Energy Technology Data Exchange (ETDEWEB)

    Storey, J., E-mail: james.storey@cern.ch [Albert Einstein Center for Fundamental Physics, Laboratory for High Energy Physics, University of Bern, 3012 Bern (Switzerland); Canali, C. [University of Zurich, Physics Institute, Winterthurerstrasse 190, 8057 Zurich (Switzerland); Aghion, S. [Politecnico di Milano, Piazza Leonardo da Vinci 32, 20133 Milano (Italy); Istituto Nazionale di Fisica Nucleare, Sez. di Milano, Via Celoria 16, 20133 Milano (Italy); Ahlén, O. [European Organisation for Nuclear Research, Physics Department, 1211 Geneva 23 (Switzerland); Amsler, C.; Ariga, A.; Ariga, T. [Albert Einstein Center for Fundamental Physics, Laboratory for High Energy Physics, University of Bern, 3012 Bern (Switzerland); Belov, A.S. [Institute for Nuclear Research of the Russian Academy of Sciences, Moscow 117312 (Russian Federation); Bonomi, G. [University of Brescia, Department of Mechanical and Industrial Engineering, Via Branze 38, 25133 Brescia (Italy); Istituto Nazionale di Fisica Nucleare, Sez. di Pavia, Via Agostino Bassi 6, 27100 Pavia (Italy); Bräunig, P. [University of Heidelberg, Kirchhoff Institute for Physics, Im Neuenheimer Feld 227, 69120 Heidelberg (Germany); Bremer, J. [European Organisation for Nuclear Research, Physics Department, 1211 Geneva 23 (Switzerland); Brusa, R.S. [Dipartimento di Fisica, Università di Trento and INFN, Gruppo Collegato di Trento, Via Sommarive 14, 38050 Povo, Trento (Italy); Burghart, G. [European Organisation for Nuclear Research, Physics Department, 1211 Geneva 23 (Switzerland); Cabaret, L. [Laboratoire Aimé Cotton, CNRS, Université Paris Sud, ENS Cachan, Bâtiment 505, Campus d' Orsay, 91405 Orsay Cedex (France); Carante, M. [Istituto Nazionale di Fisica Nucleare, Sez. di Pavia, Via Agostino Bassi 6, 27100 Pavia (Italy); Caravita, R. [University of Milano, Department of Physics, Via Celoria 16, 20133 Milano (Italy); and others

    2013-12-21

    The AEgIS experiment is an international collaboration with the main goal of performing the first direct measurement of the Earth's gravitational acceleration on antimatter. Critical to the success of AEgIS is the production of cold antihydrogen (H{sup ¯}) atoms. The FACT detector is used to measure the production and temperature of the H{sup ¯} atoms and for establishing the formation of a H{sup ¯} beam. The operating requirements for this detector are very challenging: it must be able to identify each of the thousand or so annihilations in the 1 ms period of pulsed H{sup ¯} production, operate at 4 K inside a 1 T solenoidal field and not produce more than 10 W of heat. The FACT detector consists of two concentric cylindrical layers of 400 scintillator fibres with a 1 mm diameter and a 0.6 mm pitch. The scintillating fibres are coupled to clear fibres which transport the scintillation light to 800 silicon photomultipliers. Each silicon photomultiplier signal is connected to a linear amplifier and a fast discriminator, the outputs of which are sampled continuously by Field Programmable Gate Arrays (FPGAs). In the course of the developments for the FACT detector we have established the performance of scintillating fibres at 4 K by means of a cosmic-ray tracker operating in a liquid helium cryostat. The FACT detector was installed in the AEgIS apparatus in December 2012 and will be used to study the H{sup ¯} formation when the low energy antiproton physics programs resume at CERN in the Summer of 2014. This paper presents the design requirements and construction methods of the FACT detector and provides the first results of the detector commissioning.

  8. [Kari Tarkiainen, Ülle Tarkiainen. Provinsen bortom havet : Estlands svenska historia 1561-1710; Kari Tarkiainen, Ülle Tarkiainen. Meretagune maa : Rootsi aeg Eestis 1561-1710] / Pärtel Piirimäe

    Index Scriptorium Estoniae

    Piirimäe, Pärtel, 1972-

    2015-01-01

    Arvustus: Tarkiainen Kari, Tarkiainen Ülle. Provinsen bortom havet : Estlands svenska historia 1561-1710 Verlag Atlantis. Stockholm 2013; Tarkiainen, Kari, Tarkiainen, Ülle. Meretagune maa : Rootsi aeg Eestis 1561-1710. verlag Varrak Tallinn 2014

  9. Combination of nanoparticle-delivered siRNA for Astrocyte elevated gene-1 (AEG-1) and all-trans retinoic acid (ATRA): an effective therapeutic strategy for hepatocellular carcinoma (HCC)

    OpenAIRE

    Rajasekaran, Devaraja; Srivastava, Jyoti; Ebeid, Kareem; GREDLER, RACHEL; Akiel, Maaged; Jariwala, Nidhi; Robertson, Chadia L.; Shen, Xue-Ning; Siddiq, Ayesha; Fisher, Paul B; Salem, Aliasger K.; Sarkar, Devanand

    2015-01-01

    Hepatocellular carcinoma (HCC) is a fatal cancer with no effective therapy. Astrocyte elevated gene-1 (AEG-1) plays a pivotal role in hepatocarcinogenesis and inhibits retinoic acid-induced gene expression and cell death. Combination of a lentivirus expressing AEG-1 shRNA and all-trans retinoic acid (ATRA) profoundly and synergistically inhibited subcutaneous human HCC xenografts in nude mice. We now have developed liver-targeted nanoplexes by conjugating poly(amidoamine) (PAMAM) dendrimers w...

  10. ANS complex of St John’s wort PR-10 protein with 28 copies in the asymmetric unit: a fiendish combination of pseudosymmetry with tetartohedral twinning

    Energy Technology Data Exchange (ETDEWEB)

    Sliwiak, Joanna [Polish Academy of Sciences, Poznan (Poland); Dauter, Zbigniew [National Cancer Institute, Argonne National Laboratory, Argonne, IL 60439 (United States); Kowiel, Marcin [Poznan University of Medical Sciences, Poznan (Poland); McCoy, Airlie J.; Read, Randy J. [University of Cambridge, Cambridge CB2 0XY (United Kingdom); Jaskolski, Mariusz, E-mail: mariuszj@amu.edu.pl [Polish Academy of Sciences, Poznan (Poland); A. Mickiewicz University, Poznan (Poland)

    2015-04-01

    Hyp-1, a pathogenesis-related class 10 (PR-10) protein from H. perforatum, was crystallized in complex with the fluorescent probe 8-anilino-1-naphthalene sulfonate (ANS). The asymmetric unit of the tetartohedrally twinned crystal contains 28 copies of the protein arranged in columns with noncrystallographic sevenfold translational symmetry and with additional pseudotetragonal rotational NCS. Hyp-1, a pathogenesis-related class 10 (PR-10) protein from St John’s wort (Hypericum perforatum), was crystallized in complex with the fluorescent probe 8-anilino-1-naphthalene sulfonate (ANS). The highly pseudosymmetric crystal has 28 unique protein molecules arranged in columns with sevenfold translational noncrystallographic symmetry (tNCS) along c and modulated X-ray diffraction with intensity crests at l = 7n and l = 7n ± 3. The translational NCS is combined with pseudotetragonal rotational NCS. The crystal was a perfect tetartohedral twin, although detection of twinning was severely hindered by the pseudosymmetry. The structure determined at 2.4 Å resolution reveals that the Hyp-1 molecules (packed as β-sheet dimers) have three novel ligand-binding sites (two internal and one in a surface pocket), which was confirmed by solution studies. In addition to 60 Hyp-1-docked ligands, there are 29 interstitial ANS molecules distributed in a pattern that violates the arrangement of the protein molecules and is likely to be the generator of the structural modulation. In particular, whenever the stacked Hyp-1 molecules are found closer together there is an ANS molecule bridging them.

  11. Muusika : Juubelikontserdid "ERSO 75". Tüür uuel CD-l. Muusikakonverentsid Tallinnas. Highlightsi festivalist "Eduard Tubin ja tema aeg". Hermanni päev / Vardo Rumessen

    Index Scriptorium Estoniae

    Rumessen, Vardo, 1942-2015

    2001-01-01

    ERSO saab detsembris 75. aastaseks ja sel puhul on kavas kontserdid nii Tartus kui Tallinnas. Ansambel Piano Circus on välja antud uue CD, millele annab nime avateos ئ Erkki-Sven Tüüri "Transmission". Eesti Muusikateaduse Selts korraldab 3.XII EMA-s sümpoosioni teemal Beethoveni muusika. 1. ja 2. XII EMA-s toimub konverents "Interpretatsioonipedagoogika probleeme II". Põhjamaade muusikaajakirja Highlights XI numbris ilmus ülevaade rahvusvahelisest muusikafestivalist "Eduard Tubin ja tema aeg". Eesti teatri- ja muusikamuuseumis toimub helilooja, ajakirjaniku, muusika- ja keeleteadlase, dr. Karl August Hermanni päev

  12. Silencing of the metastasis-linked gene, AEG-1, using siRNA-loaded cholamine surface-modified gelatin nanoparticles in the breast carcinoma cell line MCF-7.

    Science.gov (United States)

    Abozeid, Salma M; Hathout, Rania M; Abou-Aisha, Khaled

    2016-09-01

    Cholamine surface-modified gelatin nanoparticles prepared by the double desolvation method using acetone as a dehydrating agent were selected and potentially evaluated as non viral vectors of siRNA targeting a metastatic gene AEG-1 in MCF-7 breast carcinoma cells. The ability of modified gelatin nanoparticle to complex and deliver siRNA for gene silencing was investigated. Hence, Particle size, surface charge (zeta potential) and morphology of siRNA/Gelatin nanoparticles (siGNPs) were characterized via dynamic light scattering (DLS), scanning electron microscopy (SEM) and transmission electron microscope (TEM). Moreover, the nanoparticles cytotoxicity, loading efficiency and interaction with MCF-7 human breast carcinoma cells were evaluated. Cationized GNPs of mean size range of 174nm and PDI of 0.101 were produced. The loading efficiency of siGNPs at a Nitrogen/Phosphate (N/P) ratio (w/w) of 200:1 was approximately 96%. Cellular uptake was evaluated after FITC conjugation where the particles produced high transfection efficiency. Finally, ELISA analysis of AEG-1/MTDH expression demonstrated the gene silencing effect of siGNPs, as more than 75% MTDH protein were inhibited. Our data indicate that cholamine modified GNPs pose a promising non-viral siRNA carrier for altering gene expression in MCF-7 breast cancer cells with many advantages such as relatively high gene transfection efficiency and efficient silencing ability. PMID:27285732

  13. Positronium in the AEgIS experiment: study on its emission from nanochanneled samples and design of a new apparatus for Rydberg excitations

    CERN Document Server

    Di Noto, Lea

    This experimental thesis has been done in the framework of AEgIS (Antimatter Experiment: Gravity, Interferometry, Spectroscopy), an experiment installed at CERN, whose primary goal is the measurement of the Earth's gravitational acceleration on anti-hydrogen. The antiatoms will be produced by the charge exchange reaction, where a cloud of Ps in Rydberg states interacts with cooled trapped antiprotons. Since the charge exchange cross section depends on Ps velocity and quantum number, the velocity distribution of Ps emitted by a positron-positronium converter as well as its excitation in Rydberg states have to be studied and optimized. In this thesis Ps cooling and emission into vacuum from nanochannelled silicon targets was studied by performing Time of Flight measurements with a dedicated apparatus conceived to receive the slow positron beam as produced at the Trento laboratory or at the NEPOMUC facility at Munich. Measurements were done by varying the positron implantation energy, the sample temperature and ...

  14. In vitro tolerance to Botrytis cinerea of grapevine 41B rootstock in transgenic plants expressing the stilbene synthase Vst1 gene under the control of a pathogen‐inducible PR 10 promoterIn vitro tolerance to Botrytis cinerea of grapevine 41B rootstock in transgenic plants expressing the stilbene synthase Vst1 gene under the control of a pathogen‐inducible PR 10 promoter

    OpenAIRE

    Coutos-Thévenot, Pierre; Poinssot, Benoît; Bonomelli, A.; Yean, H.; Breda, C; Buffard, D; Esnault, R.; Hain, R; Boulay, M.

    2001-01-01

    Resveratrol is a major phytoalexin in grapevine but its synthesis in response to phytopathogen attack decreases with grape berry ripening, A chimeric gene combining an alfalfa PR 10 promoter and Vst1 (Vitis stilbene synthase 1) gene was introduced into the genome of 41B rootstock, Transgenic plants were analysed for resveratrol production in leaves infected with Botrytis using an in vitro test. Among the 50 transgenic lines analysed, some exhibited a production lower than the non-transgenic c...

  15. Aeg aias / Jaan Mettik

    Index Scriptorium Estoniae

    Mettik, Jaan

    2007-01-01

    Päikesekellade ajaloost, tüüpidest, Santiago Calatrava kavandatud jalakäijate sillast-päikesekellast Californias, Eesti päikesekelladest Kadrioru pargis, Haapsalu rannapromenaadil (Roman Haavamägi) ja Saue tammepargis (Hanno Grossschmidt, Tomoni Hayashi). Kuukelladest, Karl Linne lillekellast, libalillekelladest. Juhised päikesekella tegemiseks. Lk. 60-61 "Ajanäitajaid lillekellale"

  16. Jõhvist Tallinna / Raivo Aeg

    Index Scriptorium Estoniae

    Aeg, Raivo, 1962-

    2008-01-01

    Ilmunud ka: Postimees : na russkom jazõke 28. jaan. lk. 9. Maanteeameti lepinguliste partnerite teehooldustöödest kirjutades meenutab politseiameti peadirektor, et liiklusõnnetustes hukkus 2007. aastal 196 inimest ja küsib, kumb läheb kallimaks maksma, kas teehoolduseks kulutatav kütus ja suurem lepinguraha või hukkunud inimene. Vastuseks vt. Rain Hallimäe art. 28. jaan. Postimees lk. 17

  17. Moodne aeg : Moeuudised

    Index Scriptorium Estoniae

    2000-01-01

    Moes on puhvseelik, mis moekriitik Amanda Harlech'i arvates teeb naise keha inetuks. Londonis elava prantslanna Emma Cassid'i cool'id ridikülid. Sian Evansi toidukäruga sõrmused. Graafik James Jarvise disainitud Briti firma Silas'i Evil Martini nimeline kummilelu ning tema sõber kummikass Bubba the Car.

  18. "Eesti aeg" / Sirje Helme

    Index Scriptorium Estoniae

    Helme, Sirje, 1949-

    2002-01-01

    Välismaal avatakse kolm eesti kaasaegse kunsti näitust : Taxispalais' galeriis Innsbruckis ("The Baltic Times"), Budapestis Ludwigi muuseumis ("Breath") ja Gdanskis Laznia ("Closing the Distance") palees. Galeriide ja muuseumide tutvustus, eksponeeritavate kunstnike osaline loetelu

  19. AEg¯$\\overline {\\rm{g}}$IS Experiment: Measuring the acceleration g of the earth’s gravitational field on antihydrogen beam

    Directory of Open Access Journals (Sweden)

    Subieta Vasquez M. A.

    2014-04-01

    Full Text Available The AEg¯ $\\overline {\\rm{g}}$IS experiment [1] aims at directly measuring the gravitational acceleration g on a beam of cold antihydrogen (H¯$\\overline {\\rm{H}}$ to a precision of 1%, performing the first test with antimatter of the (WEP Weak Equivalence Principle. The experimental apparatus is sited at the Antiproton Decelerator (AD at CERN, Geneva, Switzerland. After production by mixing of antiprotons with Rydberg state positronium atoms (Ps, the H¯$\\overline {\\rm{H}}$ atoms will be driven to fly horizontally with a velocity of a few 100 ms−1 for a path length of about 1 meter. The small deflection, few tens of μm, will be measured using two material gratings (of period ∼ 80 μm coupled to a position-sensitive detector working as a moiré deflectometer similarly to what has been done with matter atoms [2]. The shadow pattern produced by the H¯$\\overline {\\rm{H}}$ beam will then be detected by reconstructing the annihilation points with a spatial resolution (∼ 2 μm of each antiatom at the end of the flight path by the sensitive-position detector. During 2012 the experimental apparatus has been commissioned with antiprotons and positrons. Since the AD will not be running during 2013,during the refurbishment of the CERN accelerators, the experiment is currently working with positrons, electrons and protons, in order to prepare the way for the antihydrogen production in late 2014.

  20. AEG评审在型号合格审定中的研究与应用%Research and Application of AEG Evaluation on Type Certification

    Institute of Scientific and Technical Information of China (English)

    段本印

    2015-01-01

    The applicant’ s work of aircraft evaluation is introduced in this paper, and 11 aircraft evaluation items are listed, including operation compliance checklist, type rating and qualification specification, MMEL, MRBR, OCAI, etc. The difference and relation between aircraft evaluation and type certification are contrasted and ana-lyzed at the same time ,and 4 suggestions are provided to the applicant in order to develop aircraft evaluation.%概述了申请人的航空器评审工作,并简要对比分析了运行符合性清单、型别等级和训练要求、MMEL、MRBR、OCAI等11个AEG工作评审项目。同时通过对比分析航空器评审组(简称AEG)评审与型号合格审定之间的区别和联系,为申请人顺利开展AEG工作提出4条建议。

  1. Sequential FDG-PET and induction chemotherapy in locally advanced adenocarcinoma of the Oesophago-gastric junction (AEG: The Heidelberg Imaging program in Cancer of the oesophago-gastric junction during Neoadjuvant treatment: HICON trial

    Directory of Open Access Journals (Sweden)

    Weichert Wilko

    2011-06-01

    Full Text Available Abstract Background 18-Fluorodeoxyglucose-PET (18F-FDG-PET can be used for early response assessment in patients with locally advanced adenocarcinomas of the oesophagogastric junction (AEG undergoing neoadjuvant chemotherapy. It has been recently shown in the MUNICON trials that response-guided treatment algorithms based on early changes of the FDG tumor uptake detected by PET are feasible and that they can be implemented into clinical practice. Only 40%-50% of the patients respond metabolically to therapy. As metabolic non-response is known to be associated with a dismal prognosis, metabolic non-responders are increasingly treated with alternative neoadjuvant chemotherapies or chemoradiation in order to improve their clinical outcome. We plan to investigate whether PET can be used as response assessment during radiochemotherapy given as salvage treatment in early metabolic non-responders to standard chemotherapy. Methods/Design The HICON trial is a prospective, non-randomized, explorative imaging study evaluating the value of PET as a predictor of histopathological response in metabolic non-responders. Patients with resectable AEG type I and II according to Siewerts classification, staged cT3/4 and/or cN+ and cM0 by endoscopic ultrasound, spiral CT or MRI and FDG-PET are eligible. Tumors must be potentially R0 resectable and must have a sufficient FDG-baseline uptake. Only metabolic non-responders, showing a 18FDG-PET scans will be performed before ( = Baseline and after 14 days of standard neoadjuvant therapy as well as after the first cycle of salvage docetaxel/cisplatin chemotherapy (PET 1 and at the end of radiochemotherapy (PET2. Tracer uptake will be assessed semiquantitatively using standardized uptake values (SUV. The percentage difference ΔSUV = 100 (SUVBaseline - SUV PET1/SUVBaseline will be calculated and assessed as an early predictor of histopathological response. In a secondary analysis, the association between the difference

  2. Sequential FDG-PET and induction chemotherapy in locally advanced adenocarcinoma of the Oesophago-gastric junction (AEG): The Heidelberg Imaging program in Cancer of the oesophago-gastric junction during Neoadjuvant treatment: HICON trial

    International Nuclear Information System (INIS)

    18-Fluorodeoxyglucose-PET (18F-FDG-PET) can be used for early response assessment in patients with locally advanced adenocarcinomas of the oesophagogastric junction (AEG) undergoing neoadjuvant chemotherapy. It has been recently shown in the MUNICON trials that response-guided treatment algorithms based on early changes of the FDG tumor uptake detected by PET are feasible and that they can be implemented into clinical practice. Only 40%-50% of the patients respond metabolically to therapy. As metabolic non-response is known to be associated with a dismal prognosis, metabolic non-responders are increasingly treated with alternative neoadjuvant chemotherapies or chemoradiation in order to improve their clinical outcome. We plan to investigate whether PET can be used as response assessment during radiochemotherapy given as salvage treatment in early metabolic non-responders to standard chemotherapy. The HICON trial is a prospective, non-randomized, explorative imaging study evaluating the value of PET as a predictor of histopathological response in metabolic non-responders. Patients with resectable AEG type I and II according to Siewerts classification, staged cT3/4 and/or cN+ and cM0 by endoscopic ultrasound, spiral CT or MRI and FDG-PET are eligible. Tumors must be potentially R0 resectable and must have a sufficient FDG-baseline uptake. Only metabolic non-responders, showing a < 35% decrease of SUV two weeks after the start of neoadjuvant chemotherapy are eligible for the study and are taken to intensified taxane-based RCT (chemoradiotherapy (45 Gy) before surgery. 18FDG-PET scans will be performed before (= Baseline) and after 14 days of standard neoadjuvant therapy as well as after the first cycle of salvage docetaxel/cisplatin chemotherapy (PET 1) and at the end of radiochemotherapy (PET2). Tracer uptake will be assessed semiquantitatively using standardized uptake values (SUV). The percentage difference ΔSUV = 100 (SUVBaseline - SUV PET1)/SUVBaseline will be

  3. Maskide langemise aeg / Taivo Parbus

    Index Scriptorium Estoniae

    Parbus, Taivo

    2005-01-01

    Res Publica Kuressaare osakonna juhataja sõnul on rahva poliitikast võõrandumise üheks peamiseks põhjuseks pidevad võimutülid Eesti poliitikas. Autor põhjendab vajadust võidelda korruptsiooniga

  4. Animeeritud fantaasiate aeg / Tiit Tuumalu

    Index Scriptorium Estoniae

    Tuumalu, Tiit, 1971-

    2006-01-01

    23. nov. algab PÖFFi raames toimuv animafilmifestifal "Animated Dreams", kus üks esimeste hulgas näidatavaid filme on inglase Phil Mulloy "Perekond Christie". Keskne on šveitsi klassiku Georges Schwizgebeli retrospektiiv, on eesti uut animatsiooni, muusikavideosid jne

  5. Veelgi kehvemate kasumite aeg / James C. Cooper

    Index Scriptorium Estoniae

    Cooper, James C.

    2008-01-01

    Finantssektorist väljaspool tegutsevate ettevõtete kasumid on hämmastavalt stabiilsed püsinud, kuid laenukriis, tõusvad toormaterjali hinnad ja välisriikide majanduste jahtumine ei jäta oma mõju avaldamata ka Ameerikale

  6. Minister Looduse aeg on otsas / Toivo Tootsen

    Index Scriptorium Estoniae

    Tootsen, Toivo, 1943-

    2001-01-01

    Ilmunud ka: Hiiumaa, 31. aug. 2001, lk. 6; Meie Maa, 31. aug. 2001, lk. 2; Kesknädal, 6. sept. 2001, lk. 4; Nädaline, 4. sept. 2001, lk. 5; Sakala, 4. sept. 2001, lk. 2; Nädaline, 4. sept. 2001, lk. 5; Vooremaa, 4. sept. 2001, lk. 2; Virumaa Teataja, 5. sept. 2001, lk. 7. Siseminister peaks tagasi astuma. Autor: Keskerakond. Parlamendisaadik

  7. Antimatter annihilation detection with AEgIS

    CERN Document Server

    Gligorova, Angela

    2015-01-01

    AE ̄ gIS (Antimatter Experiment: Gravity, Interferometry, Spectroscopy) is an antimatter exper- iment based at CERN, whose primary goal is to carry out the first direct measurement of the Earth’s gravitational acceleration on antimatter. A precise measurement of antimatter gravity would be the first precision test of the Weak Equivalence Principle for antimatter. The principle of the experiment is based on the formation of antihydrogen through a charge exchange reaction between laser excited (Rydberg) positronium and ultra-cold antiprotons. The antihydrogen atoms will be accelerated by an inhomogeneous electric field (Stark acceleration) to form a pulsed cold beam. The free fall of the antihydrogen due to Earth’s gravity will be measured using a moiré de- flectometer and a hybrid position detector. This detector is foreseen to consist of an active silicon part, where the annihilation of antihydrogen takes place, followed by an emulsion part coupled to a fiber time-of-flight detector. This overview prese...

  8. USA klaaskatuste murdmise aeg / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2008-01-01

    USA presidendivalimistel kandideeris esmakordselt afroameeriklane, presidendikandidaatide kampaanias osales naiskandidaat Hillary Clinton. Vt. samas: Obama isa kodukülas palvetati ja valmistuti suureks peoks

  9. On jõulujuttude aeg / Krista Kumberg

    Index Scriptorium Estoniae

    Kumberg, Krista, 1959-

    2007-01-01

    Arvustus: Minu jõulujutt / [koostajad Jane Liiv, Terje Puistaja, Tiia Toomet]. Tartu : Eesti Rahva Muuseum, 2007 ; Soasepp, Tiia. PPP, ehk, Pesulõksupäkapikkude projekt. Tallinn : Koolibri, 2007 ; Toompere, Harriet. Väikese põhjapõdra uued lood / illustreerinud Anu Kalm. [Tallinn] : Varrak, 2007

  10. Aeg kui heaolu faktor / Urve Kask

    Index Scriptorium Estoniae

    Kask, Urve

    2004-01-01

    Ilmunud ka: Social trends. - Tallinn, 2004, nr. 3, lk. 119-125. Ajakasutusest, kultuuritarbimisest, kulutustest vabale ajale ja kultuurikaupadele, leibkondade sidususest ning sotsiaalsest turvavõrgust. Diagrammid. Tabelid

  11. Aeg lendab nagu linnutiivul / Udo Knaps

    Index Scriptorium Estoniae

    Knaps, Udo, 1934-

    2009-01-01

    Eestlaste küüditamisest 14. juunil 1941 Põhja-Venemaale ja Siberisse, 25. märtsil 1949 Siberisse. Saarlaste küüditamisest 1. juulil 1949 Siberisse. Sõrulaste küüditamisest Saksa vägede poolt 1944. a. sügisel Saksamaale

  12. "Vaesus on disainerile parim aeg" / Masayo Ave

    Index Scriptorium Estoniae

    Ave, Masayo

    2007-01-01

    Masayo Ave oma elust Euroopas, probleemidest ja kohalike väärtuste arendamisest disainis ja sellest, et puudus paneb aju tööle. Illustratsioonidel valik tema toodetest - öövalgusti Fish Eye, täispuhutav pall-iste, laua- ja seinalamp Genesi, päevapadi Toft jt.

  13. Dostojevski aeg / Boris Tuch ; tõlk. Madis Kolk

    Index Scriptorium Estoniae

    Tuch, Boris, 1946-

    2007-01-01

    Dostojevski kangelased Eesti teatrilaval: "Onu unenägu" Vene Teatris (lavastaja Mihhail Tshumatshenko), Matthias Andersoni "Kuritöö, kodutööd, karistus, raha, pensionäri tapmine" Drugoi Teatr (lavastajad Erki Aule ja Artjom Garejev), Eesti - Läti - Leedu vene teatrite koostööprojekt "Russki smehh" (lavastaja Roman Kozak), "Sortsid" Eesti Draamateatris (lavastaja Hendrik Toompere jun.), "Krokodill" Vana Baskini Teatris (lavastaja Mark Rozovski)

  14. Peaminister Juhan Partsil on viimane aeg sisekaemuseks / Ivari Padar

    Index Scriptorium Estoniae

    Padar, Ivari, 1965-

    2004-01-01

    Ilmunud ka: Severnoje Poberezhje, 14. sept. 2004, lk. 2; Pärnu Postimees, 15. sept. 2004, lk. 15; Valgamaalane, 16. sept. 2004, lk. 2; Koit, 16. sept. 2004, lk. 6; Võrumaa Teataja, 16. sept. 2004, lk. 2; Hiiu Leht, 17. sept. 2004, lk. 2; Harjumaa, 17. sept. 2004, lk. 2; Vali Uudised, 17. sept. 2004, lk. 2; Sakala, 17. sept. 2004, lk. 2; Türi Rahvaleht, 17. sept. 2004, lk. 4; Lääne Elu, 18. sept. 2004, lk. 2. Autor arutleb valitsuse ja peaministri tegevuse üle ning leiab, et Juhan Partsile käib peaministri töö üle jõu

  15. Kahuriliha aeg on möödas / Tarmo Leinatamm

    Index Scriptorium Estoniae

    Leinatamm, Tarmo, 1957-2014

    2005-01-01

    Ilmunud ka: Türi Rahvaleht 18. nov., lk. 4, Vali Uudised 18. nov., lk. 2, Sakala 18. nov., lk. 2, Meie Maa 18. nov., lk. 2, Põhjarannik 18. nov., lk. 2, Severnoje Poberezhje 18. nov. lk. 2, Valgamaalane 19. nov., lk. 2, Lääne Elu 19. nov. lk. 2, Hiiu Leht 22. nov. lk. 2, Vooremaa 24. nov. lk. 2. Autor leiab, et kohustuslik ajateenistus Eestis ei taha vajalikku taset

  16. Hull aeg nõuab segaseid inimesi? / Margit Tõnson

    Index Scriptorium Estoniae

    Tõnson, Margit, 1978-

    2011-01-01

    Režissöör Shinya Tsikamoto film "Kotoko" (Jaapan, 2011), Urszula Antoniaki "Kood: sinine" (Taani-Hollandi 2011), Lisa Aschani "Ahviplikad" (Rootsi 2011), Oliver Hermanuse "Puhas ilu" (Lõuna-Aafrika, 2011) ja Andrei Zvjagintsevi "Jelena" (Venemaa, 2011) Pimedate Ööde Filmifestivalil

  17. Kuhu kaob õpetaja aeg? / Heikki Silvet, Katrin Raidma

    Index Scriptorium Estoniae

    Silvet, Heikki, 1942-

    2012-01-01

    Küsimusele vastasid Heikki Silvet, Tallinna 32. keskkooli inglise keele, maailmavaateõpetuse ja vanakreeka keele õpetaja ja Katrin Raidma Tartu Karlova gümnaasiumi eesti keele ja kirjanduse õpetaja

  18. Moodne aeg käib alla / Valner Valme

    Index Scriptorium Estoniae

    Valme, Valner, 1970-

    2008-01-01

    Arvustus: Beigbeder, Frédéric. Armastus kestab kolm aastat : romaan / prantsuse keelest tõlkinud Anti Saar. Tallinn : Varrak, 2008 ; Cusk, Rachel. Arlington Park / tõlkinud Kersti Unt. Tallinn : Varrak, 2007

  19. "Vana hea aeg" baltisaksa mälestusteraamatus / Ahti Saares

    Index Scriptorium Estoniae

    Saares, Ahti

    2000-01-01

    Baltisakslastest memuariste iseloomustab romantilis-patriootiline suhtumine kodumaasse ja sellest lähtuv kultuuritoojalik, kõrgemat missiooni täitev hoiak. Võrdlus Stefan Zweigi, Sven Danelli ja Kaljo Villako mälestusteraamatutega

  20. Positsioonisõja aeg / Maria-Kristiina Soomre

    Index Scriptorium Estoniae

    Soomre, Maria-Kristiina, 1978-

    2008-01-01

    Anders Härmi ja Hanno Soansi kureeritud näitusest "Uus laine. 21. sajandi eesti kunstnikud" Tallinna Kunstihoones ja Kunstihoone galeriis ning Marco Laimre näitusest "Halb nali. Bad joke" Hobusepea galeriis

  1. Positsioonisõja aeg / Maria-Kristiina Soomre

    Index Scriptorium Estoniae

    Soomre, Maria-Kristiina, 1978-

    2007-01-01

    Anders Härmi ja Hanno Soansi kureeritud näitus "Uus laine. 21. sajandi eesti kunstnikud" Tallinna Kunstihoones kuni 28. V ja Kunstihoone galeriis kuni 20. V. Marco Laimre näitus "Halb nali. Bad joke" Hobusepea galeriis kuni 21. V

  2. Dostojevski aeg / Boris Tuch ; tõlk. Maia Soom

    Index Scriptorium Estoniae

    Tuch, Boris, 1946-

    2007-01-01

    H. Toompere jun. lavastusest "Sortsid" F. Dostojevski romaani järgi, esietendus 14. veebr. Eesti Draamateatris ja M. Tshumatshenko "Onu unenägu" F. Dostojevski jutustuse järgi, esietendus 15. veebr. Vene Teatris

  3. Aeg parandada pearahasüsteemi / Tõnis Lukas

    Index Scriptorium Estoniae

    Lukas, Tõnis, 1962-

    2002-01-01

    Ilmunud ka: Virumaa Teataja 22. august lk. 7, Koit 22. august lk. 6, Põhjarannik, Severnoje Poberezhje, Meie Maa 23. august lk. 2;2, Lääne-Harju Ekspress 24. august lk. 4, Tartu : Postimees 28. august lk. 2, Nädaline 27. august lk. 4, Vooremaa 27.august lk. 8, Valgamaalane 29. august lk. 2, Pärnu Postimees 30. august lk. 10. Endine haridusminister leiab, et väikekoolidele tuleks tagada vähemalt 20% baasfinantseerimine, mis ei sõltu iga õppeaastaga kohe õpilaste arvu kahanemisest. Autor: Isamaaliit. Parlamendisaadik

  4. Araabia isevalitsejate aeg on ümber saamas

    Index Scriptorium Estoniae

    1999-01-01

    Araabia valitsejatest: Saudi Araabia kuningas Fahd, Liibüa president Muammar Kaddafi, Palestiina president Yassir Arafat, Iraagi president Saddam Hussein, Maroko president Hassan II, Süüria president Hafez Assad, Egiptuse president Hosni Mubarak

  5. Müüride langemise aeg / Reet Varblane

    Index Scriptorium Estoniae

    Varblane, Reet, 1952-

    1999-01-01

    16. jan.-ni 2000 Moderna Museetis avatud Kesk- ja Ida-Euroopa kunsti näitusest "Pärast müüri". Kuraatorid: B. Pejic, D. Elliott, I. Müller-Westermann. Osalejad Eestist: I. Josing, K. Kaljo, L. Siib, J. Toomik. D. Elliotti kataloogi eessõnast (O. Rabini ja C. Andre tööde võrdlus). D. Elliott näituse retseptsioonist Rootsis

  6. Aeg teadvustada kliimamuutuse mõju / Sirje Rank

    Index Scriptorium Estoniae

    Rank, Sirje, 1966-

    2007-01-01

    Morgan Stanley analüüsi kohaselt on kliimamuutustel maailmamajandusele shokeeriv mõju. Kaart: Kliimamuutuste võimalikud mõjud Euroopa Liidu rannikualade turismitööstusele. Diagramm: Kliimamuutustest tingitud kahjustuste osakaal riigi või regiooni SKP-st 2,5ʻC soojenemise kohta. Vt. samas: Firmade roheline pale; Kliimaturism tõusul

  7. Myanmari aitab üksnes aeg / Mihkel Mutt

    Index Scriptorium Estoniae

    Mutt, Mihkel, 1953-

    2007-01-01

    Myanmaris (Birmas) toimunud buda munkade meeleavaldusest, hunta tegevusest ja suhetest Hiinaga. Autori hinnangul võib valitsev diktatuur aru saada muutuste paratamatusest ja hakata riiki Hiina kombel ülaltpoolt reformima

  8. EVPde aeg saab otsa / Uku Hänni

    Index Scriptorium Estoniae

    Hänni, Uku, 1943-

    2006-01-01

    Erastamisväärtpaberite kehtivusaeg saab käesoleva aastaga läbi. Sama ka Vooremaa 25. nov. 2006, lk. 4 ; Vooremaa : Palamuse Valla Teataja 25. nov. 2006, lk. 3 ; Kuulutaja 24. nov. 2006, lk. 4 ; Harjumaa 24. nov. 2006, lk. 2 ; Võrumaa Teataja 23. nov. 2006, lk. 2 ; Vali Uudised 29. nov. 2006, lk. 4 ; Vooremaa : Jõgeva Valla Teataja 2. Dets. 2006, lk. 3 ; Koit 2. Dets. 2006, lk. 6 ; Pärnu Postimees 7. Dets. 2006, lk. 15 ; Sakala 28. Dets. 2006, lk. 2

  9. Kiire aeg ja mittepõgenemistsoon / Raivo Kelomees

    Index Scriptorium Estoniae

    Kelomees, Raivo, 1960-

    2000-01-01

    Baseli 20. video, filmi ja uue meedia festivalist "Viper - http://www.viper.ch". Sümpoosionist "Quick Times". Festivali serveris oli Eestist Lauri Tiidemanni video "Käed". Osalemistingimustest. Jaan Tinguely muuseumist (arhitekt Mario Botta). Ilmunud ka kogumikus "Ekraan kui membraan". Tartu, 2007, lk. 81-83

  10. On aeg taguda trumme Steadfast Jazzi toetuseks / Edward Lucas

    Index Scriptorium Estoniae

    Lucas, Edward, 1962-

    2013-01-01

    2013. a. novembris toimuvast NATO viimase 20 aasta kõige suuremast õppusest, mille käigus harjutavad liitlasväed liikmesriikide territooriumide kaitsmist. Õppus kannab nime SFJZ13 või Steadfast Jazz 2013

  11. Igal õunal oma aeg puu pealt kukkuda / Silvia Viidik

    Index Scriptorium Estoniae

    Viidik, Silvia, 1972-

    2008-01-01

    Apple tegi pühadeperioodi ostuhinnas allahindlusi 10% samal ajal, kui konkurendid tegid kuni 50 protsendilisi soodustusi. Apple'i juhi Steve Jobsi sõnul ta Macide hindu veel kärpima ei hakka, kuna pole väga mures nõudluse vähenemise pärast. Diagrammid: Apple'i aktsia hind; Majandustulemused

  12. Paljudele puhkus, noortele ärev aeg / Tõnis Lukas

    Index Scriptorium Estoniae

    Lukas, Tõnis, 1962-

    2002-01-01

    Ilmunud ka: Pärnu Postimees 1. august lk. 10, Lääne-Harju Ekspress 3. august lk. 2, Hiiumaa 1. august lk. 2, Põhjarannik ; Severnoje Poberezhje 1. august lk. 2, Elva Postipoiss 3. august lk. 6, Meie Maa 2. august lk. 2, Hiiu Leht : Käina Kuller 6. august lk. 4, Järva Teataja 6. august lk. 2, Vooremaa 6. august lk. 2, Valgamaalane 6. august lk. 2, Nädaline 8. august lk. 4, Lääne Elu 6. august lk. 4, Tartu : Postimees 9. august lk. 2, Harjumaa 13. august lk. 3, Koit 13. august lk. 6, Harju Uudised 7. august lk. 9. Riigikogu liikme sõnul võivad palgavahed korraliku hariduse ühele osale Eesti elanikest kättesaamatuks teha. Autor: Isamaaliit. Parlamendisaadik

  13. [Aktsioon "Aeg üheks luuletuseks"] / Lauri Eesmaa

    Index Scriptorium Estoniae

    Eesmaa, Lauri

    2003-01-01

    20 aastat Viinis suviti korraldatud luuletekstide eksponeerimine on tänavu laienenud ka teistele Euroopa linnadele. Tänavune teema on "Piirideta luule - kohtumised". PEN-klubi on valinud oma riiki esindama ühe luuletaja

  14. Värviline aeg / Liina Hergauk ja Evelin Samuel

    Index Scriptorium Estoniae

    Hergauk, Liina

    2015-01-01

    Värviliste triipudega pontšo, roosa lapitehnikas jakk, kollane puude ja pilvedega kampsun, kirju mantel - autor Jelena Tikunova. Õrn must-punane õlasall - autor Anna Verschik. Sinine põimribadega kampsun - autor Natalia Lill. Helelilla mantel - autor Karin Pärtel. Triibuline kampsun tütarlapsele - autor Liina Hergauk.

  15. Seminar "Fragmente eesti tõlkeloost. Nõukogude aeg" / Tõnis Vilu

    Index Scriptorium Estoniae

    Vilu, Tõnis

    2013-01-01

    Tõlkeloo seminarist Eesti Kirjandusmuuseumis 13.12.2012, mille korraldasid Tallinna Ülikooli germaani-romaani keelte ja kultuuride instituut ning Eesti Kirjandusmuuseum. Eestvedajateks olid Anne Lange ja Daniele Monticelli Tallinna Ülikoolist

  16. Aeg ei peatu, eestlane ei kao / Paul-Eerik Rummo

    Index Scriptorium Estoniae

    Rummo, Paul-Eerik, 1942-

    2005-01-01

    Rahvastiku vähenemine ja vananemine ohustab Eesti majanduslikku, sotsiaalset ja kultuurilist jätkusuutlikkust. Rahvastikuminister selgitab, mida riik on teinud nende ohtude tõrjumiseks ja mida kavatseb edasi teha

  17. ESI-PR10, Vega Alta, Puerto Rico 2000 (Environmental Sensitivity Index Map)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Environmental Sensitivity Index (ESI) maps are an integral component in oil-spill contingency planning and assessment. They serve as a source of information in the...

  18. 42. Nordische Filmtage Lübeck, vahekokkuvõtete aeg / Lauri Kärk

    Index Scriptorium Estoniae

    Kärk, Lauri, 1954-

    2000-01-01

    Lübeckis toimunud Põhjamaade filmipäevade 42. Nordische Filmtage huvitavamatest filmidest, festivali juhi vahetusest. Baltikumi esindas lühifilmide kassett "Sellised kolm lugu", mille üks autor Ervin Õunapuu ka kohal viibis

  19. On aeg mängida! / Ell-Maaja Randküla

    Index Scriptorium Estoniae

    Randküla, Ell-Maaja, 1939-2016

    2005-01-01

    Tartu Mänguasjamuuseumi (Tartu, Lutsu t. 8) sisekujundus. Autorid: Tea Tammelaan, Krista Lepland, Malle Jürgenson, OÜ Laika, Belka & Strelka. Maalitud põrandavaip: Kai Kaljo. Maalitud pitslinad: Tuuli Puhvel. Ehitaja: AS Facio Ehitus. Eesti Sisearhitektide Liidu 2004. a. aastapreemiate konkursil pälvis ajaloolise interjööri preemia. T. Tammelaanest, K. Leplandist ja M. Jürgensonist, OÜ Laika, Belka & Strelka tähtsamad tööd. Ill.: plaan, 23 värv. vaadet

  20. 50 aastat Euroopa integratsiooni: aeg uueks alguseks / Hans-Gert Pöttering

    Index Scriptorium Estoniae

    Pöttering, Hans-Gert, 1945-

    2007-01-01

    Ilmunud ka: Virumaa Teataja, 23. märts 2007, lk. 1; Pärnu Postimees, 24. märts 2007, lk. 19; Koit, 24. märts 2007, lk. 6; Põhjarannik, 24. märts 2007, lk. 2; Severnoje Poberezhje, 24. märts 2007, lk. 2. Euroopa Parlamendi presidendi Hans-Gert Pötteringi mõtted Euroopa Ühenduse asutamislepingu sõlmimise 50. aastapäeva puhul

  1. Aeg ja kosmos. Hilisantiikaja kosmoloogia zoomorfne mälestusmärk

    Directory of Open Access Journals (Sweden)

    Nikolai Sivkov

    2010-12-01

    Full Text Available The protome of the ram from West Bulgaria is a lunisolar calendar of parapegmatic type from the period of antiquity (2nd–4th century AC, which imparts encoded calendrical, cosmological and cosmogonic information.On the protome there are marked synodic, sidereal, and draconic months; lunar, solar and draconic years, as well as different time periods – seasons and cycles. One of the images on the protome’s body can be interpreted as an image of the Draco constellation around the fixed point of the North Pole in the centre of the ecliptic. The symbols of seven luminaries – the Sun, the Moon and five planets – which were known at the beginning of the first millennium are also featured on the protome.In the context of the monument, the presence of the astronomical concept of the world axis and the centre of the ecliptic means that the creators of the ram’s protome perceived it as an omphalos, the sacred centre of the world, the zoomorphic model of the world mountain and the world tree. The suggestion is confirmed by the structural particularities of the protome, by the images of mythological characters and by scenes of cosmogonic motifs. The given artefact represents the conceptualisation of the world in a generalised, syncretised and interdisciplinary way through the language of astronomy, mythology and calendaristics.In the period of antiquity, time and space were perceived as a united integer and as an endless divine beginning connected with the universe and its divine essence. The calendar is an attempt to comprehend the phenomenon of an infinite and cyclic time and use it in practice during the terrestrial life.

  2. Euroreferendumi aeg jääb veel lahtiseks / Liia Hänni

    Index Scriptorium Estoniae

    Hänni, Liia, 1946-

    2001-01-01

    Euroreferendumi korraldamisest. Autor: Rahvaerakond Mõõdukad. Parlamendisaadik. Ilmunud ka: Hiiumaa, 3. mai 2001, lk. 2; Nädaline, 3. mai 2001, lk. 4; Võrumaa Teataja, 5. mai 2001, lk. 2; Sakala, 8. mai 2001, lk. 2; Virumaa Teataja, 9. mai 2001, lk. 7; Järva Teataja, 11. mai 2001, lk. 2; Lääne Elu, 26. mai 2001, lk. 4

  3. Peter Lorange: on aeg hakata uuesti investeerima / Peter Lorange ; intervjueerinud Viljar Rääsk

    Index Scriptorium Estoniae

    Lorange, Peter, 1943-

    2009-01-01

    Šveitsis tegutseva Rahvusvahelise Juhtimiskooli endise juhi hinnangul peaksid valitsused majandusliku languse tingimustes suunama raha infrastruktuuri arendamisse, pakkuma ettevõtjatele maksuvabastusi ja vähendama bürokraatiat

  4. Pingi peal oli aeg hõredam / Mardi Valgemäe

    Index Scriptorium Estoniae

    Valgemäe, Mardi, 1935-

    2001-01-01

    Jaan Tätte "Sild" Tallinna Linnateatri esituses eesti kultuuri päevadel New Yorgis. "Silda" mängiti Manhattani 9. avenüül ja 44. tänaval asuvas Producers' Club Theater'is 12., 14. ja 15. aprillil

  5. Avinurmes uus aeg / Sulev Oll ; kommenteerinud Taavi Linnamäe

    Index Scriptorium Estoniae

    Oll, Sulev, 1964-

    2009-01-01

    Teisel jõulupühal pühitsetakse ja hakkavad Avinurmes lööma kolm uut kirikukella, mis valmisid Saksamaal firmas Rudolf Perner GmbH&Co. Kellad paigaldas Mäeväli Orelitöökoda OÜ, ehitus-puutööd tegi Rändmeister OÜ. Vana kirikukell viidi kabelisse. Toetust kellade muretsemiseks saadi PRIA vahendusel

  6. Gazprom teeb reformi: Ukrainal on aeg gaasipliidid nurka visata / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2009-01-01

    Autor leiab, et Ukraina pole 2006. a. kriisist midagi õppinud, maagaasi tarbimine on veelgi suurenenud. Gaasihinna tõusu korral hakatakse Ukrainas ilmselt üha enam loobuma gaasipliitidest ja -boileritest ning niimoodi kaotaks Gazprom ühe oma suurema turu. Gazprom üritab kõrgemat gaasihinda saavutada ka SRÜ maades. Diagrammid

  7. Nõukogude aeg elulugudes – ‘katkestus’ või ‘järjepidevus’

    Directory of Open Access Journals (Sweden)

    Tiiu Jaago

    2014-08-01

    Full Text Available The article springs from the discussion on the depiction of Estonian history in autobiographical writing, in which researchers have pointed out either the cultural continuity or cultural rupture. The author deals with ‘rupture’ and ‘continuity’ as interrelated, mutually conditioning phenomena, asking how this relation is disclosed in life writing. For research the author selected autobiographies narrated in the period from 1989 to 1998 from the life writing collection of the Estonian Cultural History Archives. The 18 analysed stories depict life in Stalinist prison camps. It is assumed that in the life narratives that are concerned with prison experiences, the cultural, everyday and political disruptions are particularly clearly outlined. The thematic analysis of the stories reveals that narrators concentrate on prison experiences related to food, work and death. The axis supporting the narratives comes to the fore through linguistic images: the narrators, former prisoners of the Stalinist camps, perceive themselves as being outside the borders of civilisation, deprived of human treatment. It is significant that the stories do not present much information about the development of the authors’ relationships with their families after the prison camp. How the prison camp period influenced later personal lives was told by only one of the authors of the studied narratives. The stories were narrated at the end of the Soviet period (during Perestroika, or in Estonia after the restitution of independence. By that time, approximately 40 years had passed since the events, and aspects of personal life had been solved and discussed. On the public level, an open discussion on these topics started namely at the end of the 1980s. Then, at the end of the Soviet period, also the rehabilitation of the repressed people started, opening a dialogue between the individual and the state institutions on the topic of repression. The studied life stories also belong to this period: it was the period when my story became our nation’s story. Ruptures in these stories are primarily associated with political upheavals, which also broke the expected sequence of personal life events. Yet, at the same time, the rupture did not interrupt the historical or cultural process, but rather, by describing self-image and situations, brought out the aspect more meaningfully. As a result of the analysis of the texts, the author came to the conclusion that in these stories the topic of humanity rather than the problem of political and cultural rupture and continuity is in the foreground.

  8. Videoinstallatsiooni aeg pole ümber : muljeid Amsterdami videofestivalilt / Kai Kaljo

    Index Scriptorium Estoniae

    Kaljo, Kai, 1959-

    1999-01-01

    17. World Wide Video Festival 15.-20. IX Amsterdamis Melkwegi keskuses ja Stedelijki muuseumis. Väljapanekust. Kai Kaljolt oli videofestivalil väljas 'One Way to See America'. Seminaride materjalid: wwvf@wwvf.demon ja www.wwvf.nl

  9. Plastmassist käekellade aeg hakkab Eestis mööda saama / Kerli Nõu

    Index Scriptorium Estoniae

    Nõu, Kerli

    2007-01-01

    Kellast on saanud staatusesümbol. Kvaliteetkellade müük on kasvamas, kohalikule turule tuleb maailma täpseim mehaaniline kell Šveitsi kaubamärgilt Zenith. Lisad: Kolm suurmängijat; Oksjonid Hongkongis

  10. Aeg on otsustada : Rail Baltica : rahvusvaheline raudtee toob Eestile kasu / Vilja Savisaar-Toomast

    Index Scriptorium Estoniae

    Savisaar-Toomast, Vilja, 1962-

    2011-01-01

    Vilja Savisaar-Toomast on kindel, et Rail Baltica projekt tuleb esitada Euroopa Liidu finantsperioodiks 2014-2020 ning eelistab marsruuti Tallinn-Pärnu-Riia-Kaunas. Tõenäoliselt on võimalik saada projektile Euroopa Liidult ka maksimumtoetus ehk määraga 60-70%

  11. Viimane aeg seksiärile lõpp teha / Kadri Jäätma

    Index Scriptorium Estoniae

    Jäätma, Kadri, 1961-

    2002-01-01

    Põhja- ja Baltimaade ühisseminarist "Naistega kaubitsemine kui kaasaegne orjakaubandus" ja Eesti Avatud Ühiskonna uuringust "Prostitutsioon ja naistekaubandus Tallinna politsei hinnangul". Autor: Isamaaliit. Parlamendisaadik

  12. Offshore-firmade müügis keeruline aeg / Anne Oja

    Index Scriptorium Estoniae

    Oja, Anne, 1970-

    2004-01-01

    Offshore-firmasid ostetakse läbi advokaadibüroode ja audiitorfirmade. 2001. aastal tehtud uuringu järgi käis Eesti ettevõtjate kontrolli all olevatest offshore-ettevõtetest läbi 6 miljardit krooni aastas

  13. A position sensitive silicon detector for AEgIS (Antimatter Experiment: Gravity, Interferometry, Spectroscopy)

    CERN Multimedia

    Gligorova, A

    2014-01-01

    The AEḡIS experiment (Antimatter Experiment: Gravity, Interferometry, Spectroscopy) is located at the Antiproton Decelerator (AD) at CERN and studies antimatter. The main goal of the AEḡIS experiment is to carry out the first measurement of the gravitational acceleration for antimatter in Earth’s gravitational field to a 1% relative precision. Such a measurement would test the Weak Equivalence Principle (WEP) of Einstein’s General Relativity. The gravitational acceleration for antihydrogen will be determined using a set of gravity measurement gratings (Moiré deflectometer) and a position sensitive detector. The vertical shift due to gravity of the falling antihydrogen atoms will be detected with a silicon strip detector, where the annihilation of antihydrogen will take place. This poster presents part of the development process of this detector.

  14. EFIKASI LARVASIDA TEMEPHOS TERHADAP AEDES AEgYPTI RESISTEN PADA BERBAGAI KONTAINER

    Directory of Open Access Journals (Sweden)

    Riyani Setiyaningsih

    2015-09-01

    Full Text Available Dengue hemorrhagic fever (DHF is a disease that causes death in Indonesia. Management DHF can be done with contol vector. One technique is the vector control with larvicides temephos. The use temephos already widely used by the people in the control larvae of Ae. aegypti. In the community can be used in applications temephos in some types of containers. The aims of the study to determine the efication of the various containers temephos against Ae. aegypti resistant. Test the efication of the various containers temephos 7 containers are carried on clay, cement, stainless steel, enamel, cans, plastics, plastics recycling and not recycling. Based on the research results temephos still effectively kill mosquito larvae Ae.aegypti resistant containers made   of clay for eight months, enamel effective container for the application of ten months, tin containers, cement and stainless steel effective until the eleventh month. In plastic containers to more effective application temephos fourteenth month=Demam berdarah dengue (DBD merupakan salah satu penyakit yang menyebabkan kematian di Indonesia. Upaya pengendalian DBD dapat dilakukan dengan pengendalian vektor. Salah satu teknik pengendalian vektor adalah dengan larvasida temephos. Penggunaan temephos sudah banyak digunakan masyarakat dalam pengendalian jentik Ae. aegypti. Aplikasi temephos di masyarakat digunakan pada berbagai jenis kontainer. Penelitian bertujuan untuk mengetahui efikasi penggunaan temephos pada berbagai kontainer terhadap Ae. aegypti resisten. Uji efikasi temephos pada berbagai kontainer dilakukan pada 7 kontainer yaitu tanah liat, semen, stainless steel, enamel, kaleng, plastik daur ulang dan plastik tidak daur ulang. Hasil penelitian menunjukkan temephos masih efektif membunuh jentik Ae.aegypti resisten pada kontainer yang terbuat dari tanah liat selama delapan bulan, enamel efektif selama sepuluh bulan, kontainer kaleng, semen dan stainless steel efektif sampai bulan kesebelas. Kontainer plastik aplikasi themephos efektif sampai empatbelas bulan.

  15. EFIKASI LARVASIDA TEMEPHOS TERHADAP AEDES AEgYPTI RESISTEN PADA BERBAGAI KONTAINER

    OpenAIRE

    Riyani Setiyaningsih; Widiarti Widiarti; Lasmiati Lasmiati

    2015-01-01

    Dengue hemorrhagic fever (DHF) is a disease that causes death in Indonesia. Management DHF can be done with contol vector. One technique is the vector control with larvicides temephos. The use temephos already widely used by the people in the control larvae of Ae. aegypti. In the community can be used in applications temephos in some types of containers. The aims of the study to determine the efication of the various containers temephos against Ae. aegypti resistant. Test the efication of the...

  16. UJI TOKSISITAS BEBERAPA EKSTRAK TANAMAN TERHADAP LARVA AEDES AEgYPTI VEKTOR DEMAM BERDARAH DENGUE

    Directory of Open Access Journals (Sweden)

    Hasan Boesri

    2015-09-01

    Full Text Available Mosquito vector control are still using insecticide  from pyrethroid, carbamates and organophosphates groups because they are effective, having fast result but having less concern for the negative impact to the environment. In order to solve the side effects the side effect, it was necessary to find bio-insecticides which are sustainable, accessible and effective to kill mosquitoes and larvae. In this study the extract of Nicotiana tabacum / tobacco with minimum concentration of 1,56 % was effective to kill larvae with of 100% mortality, with of LC90  0,628 %, LC50 0,194 %. The extract contain chemical dominant alkaloids, Euvodia gravolens / zodiac with minimum concentration 1,56 % the mortality effects 100%, is with LC90 0,628 %, and LC50 0,194 %, the extract concentration 1,56 %, the mortality effect is 100 %, is with LC90a of 0,628% and dominant chemical contains Evodiamine, Alpinia galanga/ of  / galanga with minimum concentration of 1,56 %, the mortality effects is 29,3% and LC90 8,216 %, LC50 2,980 % and dominant chemical contain flavonoids, Andropogon nardus/ lemongrass with minimum concentration of 1,56% the mortality effect is 68% and LC90 4,898 %, LC50 1,068 % and dominant chemical contain of vetivetate acid, rosemary ( Rosmarinus officinalis L with minimum concentration of 1,56% gives mortality effect 78,7% and LC90 3,175 %, LC50 0,659 %. The dominant contain of the chemical is alkaloid = Pengendalian  nyamuk vektor masih menggunakan bahan insektisida dari golongan piretroid, karbamat, dan organofosfat karena  efektif, cepat diketahui hasilnya, namun kurang memperhitungkan dampak negatif terhadap lingkungan. Oleh sebab itu perlu dicari insektisida alernatif, yaitu insektisida nabati yang ramah lingkungan, mudah diperoleh, efektif membunuh nyamuk dewasa dan pradewasa. Pada penelitian diperoleh hasil Nicotiana tabacum/tembakau konsentrasi ekstrak minimal 1,56%, mampu membunuh larva nyamuk sebesar 100 % dan LC90 0,628 %, LC50 0,194 %, (kandungan kimia dominan  alkaloid, Euvodia gravolens/ zodia dengan konsentrasi ekstrak minimal ekstrak 1,56 % mampu memberikan efek kematian 100% dan LC90 0,628.% ,LC50 0,194 % (kandungan kimia dominan  Evodiamine,. Alpinia galanga/lengkuas konsentrasi ekstrak minimal 1,56 % mampu memberikan efek kematian 29,3 % dan LC90 8,216 % ,LC50 2,980 % (kandungan kimia dominan  flavonoida, Andropogon nardus/serai wangi konsentrasi ekstrak minimal 1,56% mampu membunuh larva nyamuk sebesar 68 % dan LC90 4,898 %, LC50 1,068 % ( kandungan kimia dominan  asam vetivetate, Rosemary (Rosmarinus officinalis L konsentrasi ekstrak minimal 1,56%, memberikan efek kematian sebanyak 78,7 % dan LC90 0,659 %, LC50 3,175 % (kandungan kimia dominan alkaloid.

  17. Miks meil on kogu aeg kiire? / David Allen ; interv. Endrik Randoja

    Index Scriptorium Estoniae

    Allen, David

    2006-01-01

    Produktiivsuse ekspert vastab küsimustele ettevõetud tegevuste tulemuslikumalt lõpule viimise kohta. Lisa: Aja paremaks kasutamiseks pakub David Allen lisaks veel kolm tõhusat ja lihtsasti rakendatavat põhimõtet

  18. Henri Tamm : algul küsiti mult kogu aeg autogrammi / Henri Tamm ; interv. Ada Kallam

    Index Scriptorium Estoniae

    Tamm, Henri

    2005-01-01

    Draamaseriaali "Kodu keset linna" lapsnäitleja. Lisaks kolleegid Henrist : M. Veinmann "Tekst on tal esimesena peas", K. Maibaum "Võrdväärne partner suurtele". Artikkel pealkirjaga "Henri Tamm : nüüd saan veidi puhkust" : Linnaleht nr. 22, 3. juuni 2005, A2-A3

  19. Aeg ei küsi, kelle hinges laulab lind / Katrin Nielsen

    Index Scriptorium Estoniae

    Nielsen, Katrin

    2000-01-01

    Pärnu Mudaravilas avatud nongratalase Asta Isaku maalinäitusest "Looduses ja lootuses" ning Chaplini kunstikeskuses avatud Tammiste hooldekodu elaniku Aivar Kurvitsa maalinäitusest "Ära reosta loodust"

  20. Hea töötaja leidmine: viimane aeg on tegutseda / Mariliis Aigro

    Index Scriptorium Estoniae

    Aigro, Mariliis

    2014-01-01

    Maailma parimad ettevõtted-tööandjad panustavad töötajate arendamisse, peavad oluliseks töötajate erialast arengut ja karjääriteed, erilist tähelepanu pööratakse juhtide ja nende järelkasvu arendamisse.

  1. Sakala arhitekt Raine Karp : uus aeg nõuab teistsuguseid karpe / Ants Juske

    Index Scriptorium Estoniae

    Juske, Ants, 1956-

    2006-01-01

    Raine Karbi elust ja loomingust, mõtteid Sakala keskuse projekteerimisest, ehitamisest ja ümberehitamisest. Karin Hallas-Murula kommentaar "Tõstis paekivi taas ausse" ja Ivi Eenmaa kommentaar "Teadis raamatukogust hämmastavalt palju"

  2. Ibn Tufail : tema aeg, elu ja koht islami-araabia filosoofia ajaloos / Haljand Udam

    Index Scriptorium Estoniae

    Udam, Haljand, 1936-2005

    2001-01-01

    Varem ilmunud järelsõnana raamatus: Elav Ärganu poeg. Tallinn : Olion, 1992. 12. sajandil Araabia Hispaanias elanud filosoof Abu Bakr Muhammad ibn Abd al-Malik ibn Muhammad ibn Muhammad ibn Tufail. Tema põhiteosest, filosoofilisest jutustusest "Elav Ärganu poeg"

  3. Aeg on hakata parke ja platse arukalt täis ehitama / Tõnu Kann

    Index Scriptorium Estoniae

    Kann, Tõnu, 1957-

    2005-01-01

    Pärnu linnavalitsuse planeerimisosakonna 1996. aasta kesklinna arengu ideekavandist, tühjade kvartalinurkade täisehitamisest, vanade tänavajoonte taastamisest. Kommenteerivad Tõnu Kann ja arhitekt Rein Raie

  4. Expression of pathogenesis-related protein PR-10 in sorghum floral tissues in response to inoculation with Fusarium thapsinum and Curvularia lunata

    Science.gov (United States)

    Differences in grain mold levels among different sorghum varieties grown in the same environment imply that genes play a role in controlling mold severity. The fungi most often recovered from naturally infected sorghum grain, Fusarium thapsinum and Curvularia lunata, were inoculated on a set of res...

  5. Primary structures of two ribonucleases from ginseng calluses - New members of the PR-10 family of intracellular pathogenesis-related plant proteins

    NARCIS (Netherlands)

    Moiseyev, GP; Fedoreyeva, LI; Zhuravlev, YN; Yasnetskaya, E; Jekel, PA; Beintema, JJ

    1997-01-01

    The amino acid sequences of two ribonucleases from a callus cell culture of Panax ginseng were determined, The two sequences differ at 26% of the amino acid positions, Homology was found with a large family of intracellular pathogenesis-related proteins, food allergens and tree pollen allergens from

  6. President Arnold Rüütel : ekstensiivse arengu aeg on möödas / Arnold Rüütel

    Index Scriptorium Estoniae

    Rüütel, Arnold, 1928-

    2001-01-01

    Eesti-suguses väikeriigis saab ekstensiivset arengumudelit kasutada vaid piiratud aja jooksul ning vajalik on üleminek intensiivsele ja samaaegselt ka ühiskonnakesksele arengumudelile. Kommenteerib A. Luukas

  7. Väljastpoolt Euroopat Eestisse lendajate check-inþi aeg pikeneb / Jan Jõgis-Laats

    Index Scriptorium Estoniae

    Jõgis-Laats, Jan

    2007-01-01

    1. juulist 2007 jõustunud riigipiiri seaduse muudatusest, mille kohaselt on lennufirmadel kohustus edastada piirivalvele Euroopa Liidu välistest riikidest Eestisse saabuvate lennureisijate isikuandmed. Lisatud: seadusemuudatuse nõuab lisaandmeid

  8. Lineaarse kunstiajaloo aeg on otsas / Edit András ; intervjueerinud R[eet] V[arblane

    Index Scriptorium Estoniae

    András, Edit

    2010-01-01

    Vestlus ungari kunstiteoreetiku- ja ajaloolase Edit Andrásiga, kes osales Tallinnas USA Clarki instituudi ja EKA Kunstiteaduste Instituudi seminaril, kus arutati Kesk- ja Ida-Euroopa kunstiajaloo kirjutamisviiside üle. Seminari tekkimisest, kokkusaamise põhjustest, seminari järeldustest, Eesti ja Ungari kunstiajaloo kirjutamise erinevatest põhimõtetest jm.

  9. Ida-Virul on aeg oma võimalused välja mängida / Mart Laar

    Index Scriptorium Estoniae

    Laar, Mart, 1960-

    2008-01-01

    Ilmunud ka: Severnoje Poberezhje : Ida-Virumaa Zavtra 15. mai, lk. 4. Ekspeaministrist IRL-i esimehe Mart Laari hinnangul on Ida-Virumaa eduka arengu võtmeküsimused korruptsiooni ja kuritegevuse vähendamises ning ettevõtluskeskkonna parandamises

  10. Deleuze, filmikunst ja rahvuslik identiteet : narratiivi aeg rahvuslikes kontekstides / David Martin-Jones ; tõlkinud Eva Näripea

    Index Scriptorium Estoniae

    Martin-Jones, David

    2011-01-01

    Antakse ülevaade Gilles Deleuze'i filmitekstidest "Kino 1 : liikumispilt" (Cinếma-1 : l'image-mouvement) ja "Kino 2 : ajapilt" (Cinếma-2 : l'image-temps) ning K. Bhabha artiklist "DissemiNatsioon" kogumikust "Rahvus ja jutustamine" (Nation and Narration,1990), kus käsitletakse ideesid narratiivist, ajast ja rahvuslikust identiteedist. Uuritakse, kuidas käsitletakse narratiivi aja kaudu ajalugu ja identiteeti ning missugust toimet avaldab see rahvusliku identiteedi konstrueerimisele

  11. Rattarändurid : naistel on mõistlik mehed aeg-ajalt kodust ära lasta / Greta Kaupmees

    Index Scriptorium Estoniae

    Kaupmees, Greta

    2007-01-01

    Täna hommikul stardib Terevisiooni ärataja Priit Kuusk koos viie ränduriga Tallinnast Katmandusse, et sealt edasi asuda maid avastama jalgratastel. Seiklejatel on plaanis sõita nelja kuuga ligi 4000 kilomeetrit ehk Katmandust Teherani. Rattaretkest valmib ETV-s taas dokumentaalsari "Ehh, uhhuduur"

  12. Elutervik ja aeg : murdkem püramiidi võim / Sigmund Kvaloy ; tõlk. Tiiu Speek

    Index Scriptorium Estoniae

    Kvaloy, Sigmund

    2005-01-01

    Nüüdisaegsest ökofilosoofiast, tööstusliku kasvu ühiskonna ja eluliste vajaduste ühiskonna vastuoludest ning Norra ökopoliitikast. Lisatud lühiülevaade autori elukäigust. Vt. ka: David Rothenberg. Elutervik ja elulised vajadused: Eesti tee. Lk. 549

  13. Elutervik ja aeg : murdkem püramiidi võim / Sigmund Kvaloy ; tõlk. Tiiu Speek

    Index Scriptorium Estoniae

    Kvaloy, Sigmund

    2005-01-01

    Nüüdisaegsest ökofilosoofiast, tööstusliku kasvu ühiskonna ja eluliste vajaduste ühiskonna vastuoludest ning Norra ökopoliitikast. Lisatud lühiülevaade autori elukäigust. Vt. ka: David Rothenberg. Elutervik ja elulised vajadused: Eesti tee

  14. Professor Trechsel : Eesti e-valimiste aeg on liiga lühike / Alexander H. Trechsel ; interv. Askur Alas

    Index Scriptorium Estoniae

    Trechsel, Alexander H.

    2006-01-01

    e-valimistele pühendatud rahvusvahelisel konverentsil esinenud Genfi ülikooli e-demokraatia keskuse juhataja, poliitikateaduste professor Eesti e-valimistest ja e-valimiste tulevikust. Vt. samas: Askur Alas. Konverentsil analüüsiti e-valimiste kogemusi; Eestis hääletas digitaalselt 9317 valijat

  15. Tallinna Raekoda. Aeg ja lugu = Tallinn Town Hall - Its Story Through Time / Elvira Liiver Holmström

    Index Scriptorium Estoniae

    Liiver Holmström, Elvira

    2004-01-01

    Raekoja kujunemislugu. Esindussaalid, ameti- ja tarberuumid. Raekoda 17.-20. sajandil. Hoone ümberehitamist 1402-1404 juhtis kiviraidur Ghercke. Hinrik Hartmanni poolt valatud kell paigutati torni 1586. a. 17. sajandil tegi hilisrenessanss-stiilis torni joonised Geiger Graff, lääneviilule uue harjakivi ja tuulelippu hoidva lõvi Hans Damm, lohepeakujulised veesülitid ja tuulelipu lipu Daniel Pöppel, raesaali paigutati Johann Akeni lünettmaalid, nende all paikneva puitnikerdfriisi valmistasid Elert Thiele ja Joachim Armbrust. 1859. a. ümberehitusprojekti koostas Christoph August Gabler

  16. Apellatsioonimenetluse aeg tsiviilasjades Eesti Vabariigis ja seda mõjutavad tegurid : [magistritöö] / Sirje Viherpuu ; Tartu Ülikool, õigusteaduskond ; juhendaja: Mare Merimaa

    Index Scriptorium Estoniae

    Viherpuu, Sirje, 1969-

    2013-01-01

    Mõistlikust menetlusajast ja selle eesmärgist tsiviilkohtumenetluses, menetlusajast Eesti Vabariigis apellatsioonimenetluses tsiviilasjade läbivaatamisel, takistavatest teguritest ja võimalustest menetluse kiirendamiseks

  17. Muutuste ja jätkuvuse aeg : Euroopa Liidu teemalise diskussiooni võrdlev analüüs ajalehtedes Postimees ja Helsingin Sanomat / Sigrid Kaasik-Krogerus

    Index Scriptorium Estoniae

    Kaasik-Krogerus, Sigrid

    2007-01-01

    "Tagasi Euroopasse" on olnud viimastel kümnenditel üks olulisemaid märksõnu nii Eesti kui Soome arengus. Euroopa Liidu teema Eesti ja Soome avalikus diskussioonis võimaldab analüüsida ka kahe riigi rahvusliku identiteedi lugu, kus oluline roll on ajakirjandusel

  18. Poliitika ja poeesia eesti graafikas : Tallinna XIV graafikatriennaal ja "Impact 5" / Andri Ksenofontov

    Index Scriptorium Estoniae

    Ksenofontov, Andri, 1962-

    2007-01-01

    Tallinna XIV graafikatriennaalist "Poliitiline/Poeetiline" ning rahvusvahelisest graafikakonverentsist "Impact 5" teemal "Lõigatud aeg" ja selle raames avatud näitustest (Vappu Thurlowi kureeritud "Lõigatud aeg" Adamson-Ericu muuseumis jpt.)

  19. Ilmus väärt artiklikogumik / Arvo Tering

    Index Scriptorium Estoniae

    Tering, Arvo, 1949-

    2008-01-01

    Arvustus: Ajalookirjutaja aeg = Aetas historicum / Eesti Rahvusraamatukogu ; koost. Piret Lotman. - Tallinn, 2008. - 247 lk. - (Eesti Rahvusraamatukogu toimetised. A, Raamat ja aeg, 1736-6984 ; nr. 1) ; (Eesti Rahvusraamatukogu toimetised ; 11)

  20. Kestmine kui probleem / Marju Lauristin

    Index Scriptorium Estoniae

    Lauristin, Marju, 1940-

    1987-01-01

    Vestlus vabariikliku teatrifestivali "Tartu ' 87" žürii liikmega : A. Kitzbergi "Libahunt" Rakvere Teatris, A. H. Tammsaare-A.-E. Kerge "Aeg tulla, aeg minna" Vanemuises, T. Ajtmatovi "Ja sajandist on pikem päev" Ugalas

  1. Knockdown of astrocyte elevated gene-1 inhibits tumor growth and modifies microRNAs expression profiles in human colorectal cancer cells

    International Nuclear Information System (INIS)

    Highlights: • AEG-1 expression in CRC cell lines and down-regulation or upregulation of AEG-1 in vitro. • Knockdown of AEG-1 inhibits cell proliferation, colony formation and invasion. • Upregulation of AEG-1 enhances proliferation, invasion and colony formation. • Knockdown of AEG-1 accumulates G0/G1-phase cells and promotes apoptosis in CRC cells. • AEG-1 knockdown increases 5-FU cytotoxicity. - Abstract: Astrocyte elevated gene-1 (AEG-1), upregulated in various types of malignancies including colorectal cancer (CRC), has been reported to be associated with the carcinogenesis. MicroRNAs (miRNAs) are widely involved in the initiation and progression of cancer. However, the functional significance of AEG-1 and the relationship between AEG-1 and microRNAs in human CRC remains unclear. The aim of this study was to investigate whether AEG-1 could serve as a potential therapeutic target of human CRC and its possible mechanism. We adopted a strategy of ectopic overexpression or RNA interference to upregulate or downregulate expression of AEG-1 in CRC models. Their phenotypic changes were analyzed by Western blot, MTT and transwell matrix penetration assays. MicroRNAs expression profiles were performed using microarray analysis followed by validation using qRT-PCR. Knockdown of AEG-1 could significantly inhibit colon cancer cell proliferation, colony formation, invasion and promotes apoptosis. Conversely, upregulation of AEG-1 could significantly enhance cell proliferation, invasion and reduced apoptisis. AEG-1 directly contributes to resistance to chemotherapeutic drug. Targeted downregulation of AEG-1 might improve the expression of miR-181a-2∗, -193b and -193a, and inversely inhibit miR-31 and -9∗. Targeted inhibition of AEG-1 can lead to modification of key elemental characteristics, such as miRNAs, which may become a potential effective therapeutic strategy for CRC

  2. Knockdown of astrocyte elevated gene-1 inhibits tumor growth and modifies microRNAs expression profiles in human colorectal cancer cells

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Sujun [East Department of Gastroenterology, Institute of Geriatrics, Guangdong General Hospital, Guangdong Academy of Medical Sciences, Guangzhou, Guangdong 510080 (China); Southern Medical University, Guangzhou, Guangdong 510515 (China); Wu, Binwen, E-mail: wubinwengd@aliyun.com [East Department of Gastroenterology, Institute of Geriatrics, Guangdong General Hospital, Guangdong Academy of Medical Sciences, Guangzhou, Guangdong 510080 (China); Li, Dongfeng; Zhou, Weihong; Deng, Gang; Zhang, Kaijun; Li, Youjia [East Department of Gastroenterology, Institute of Geriatrics, Guangdong General Hospital, Guangdong Academy of Medical Sciences, Guangzhou, Guangdong 510080 (China)

    2014-02-14

    Highlights: • AEG-1 expression in CRC cell lines and down-regulation or upregulation of AEG-1 in vitro. • Knockdown of AEG-1 inhibits cell proliferation, colony formation and invasion. • Upregulation of AEG-1 enhances proliferation, invasion and colony formation. • Knockdown of AEG-1 accumulates G0/G1-phase cells and promotes apoptosis in CRC cells. • AEG-1 knockdown increases 5-FU cytotoxicity. - Abstract: Astrocyte elevated gene-1 (AEG-1), upregulated in various types of malignancies including colorectal cancer (CRC), has been reported to be associated with the carcinogenesis. MicroRNAs (miRNAs) are widely involved in the initiation and progression of cancer. However, the functional significance of AEG-1 and the relationship between AEG-1 and microRNAs in human CRC remains unclear. The aim of this study was to investigate whether AEG-1 could serve as a potential therapeutic target of human CRC and its possible mechanism. We adopted a strategy of ectopic overexpression or RNA interference to upregulate or downregulate expression of AEG-1 in CRC models. Their phenotypic changes were analyzed by Western blot, MTT and transwell matrix penetration assays. MicroRNAs expression profiles were performed using microarray analysis followed by validation using qRT-PCR. Knockdown of AEG-1 could significantly inhibit colon cancer cell proliferation, colony formation, invasion and promotes apoptosis. Conversely, upregulation of AEG-1 could significantly enhance cell proliferation, invasion and reduced apoptisis. AEG-1 directly contributes to resistance to chemotherapeutic drug. Targeted downregulation of AEG-1 might improve the expression of miR-181a-2{sup ∗}, -193b and -193a, and inversely inhibit miR-31 and -9{sup ∗}. Targeted inhibition of AEG-1 can lead to modification of key elemental characteristics, such as miRNAs, which may become a potential effective therapeutic strategy for CRC.

  3. Adenocarcinoma of the Esophagogastric Junction: The Pattern of Metastatic Lymph Node Dissemination as a Rationale for Elective Lymphatic Target Volume Definition

    International Nuclear Information System (INIS)

    Purpose: Regional nodal metastasis after neoadjuvant chemoradiation of adenocarcinoma of the esophagogastric junction (AEG) predicts survival. We aimed to clarify the lymph node (LN) distribution of AEG according to location of the tumor mass and invasion of neighboring areas for the selection of radiotherapy planning target volume (PTV) margins. Methods and Materials: Patterns of regional spread were analyzed in pathology reports of 326 patients patients with AEG who had undergone primary resection, with ≥15 lymph nodes examined. Tumors were classified into AEG types based on endoscopy and pathology reports. Fisher's exact test was used to compare nodal disease and tumor characteristics. Pulmonary dose-volume histograms were tested in 8 patients. Results: Nodes were positive in 81% of T2 to T4 tumors. Type of AEG, tumor size, lymphovascular invasion, and grading significantly influenced nodal distribution. We found that marked esophageal invasion of AEG II/III significantly correlated with paraesophageal nodal disease, and T3 to T4 AEG II/III had a significant rate of splenic hilum/artery nodes. Middle and lower paraesophageal nodes should be treated in T2 to T4 AEG I and AEG II with ≥15 mm involvement above the Z-line, and T3 to T4 AEG II. The splenic hilum and artery nodes can be spared in T2 AEG tumors, especially Type I tumors. The influence of paraesophageal nodal treatment on the risk of postoperative pulmonary complications can be estimated from dose-volume histograms. Conclusions: Accurate pretherapeutic staging predicts the risk of subclinical nodal disease and should be used to select the appropriate radiotherapeutic PTV. Careful selection of the PTV can be used to maximize the therapeutic window in multimodal therapy for AEG

  4. Ikka teel / Marian Kivila

    Index Scriptorium Estoniae

    Kivila, Marian

    2009-01-01

    Rahvusvahelise tegevuskunstifestivali "Diverse Universe 2009" üritustest Tallinna Kultuurikatlas, Tartu pärmitehases ja galeriis Ferrodrum ning Paides, kus toimus kunstifestval "Aeg. Ruum. Liikumine"

  5. Lentivirus-Mediated Knockdown of Astrocyte Elevated Gene-1 Inhibits Growth and Induces Apoptosis through MAPK Pathways in Human Retinoblastoma Cells.

    Directory of Open Access Journals (Sweden)

    Ying Chang

    Full Text Available To explore expression and function of astrocyte elevated gene-1 (AEG-1 in human retinoblastoma (RB.The expression of AEG-1 in histological sections of human RBs and in RB cell lines was examined using immunohistochemical staining and RT-PCR and Western blotting respectively. We knocked down AEG-1 gene levels by AEG-1-siRNA lentivirus transfection of human RB cell lines SO-RB50 and Y79, and using an MTT assay, we assessed the role of AEG-1 on RB cell proliferation. The biological significance of lentivirus transfection induced AEG-1 down-regulation was examined by assessing the apoptosis rate in the transfected RB cells by Annexin V-APC staining and flow cytometry. We additionally measured the expression of Bcl-2, Bax, cleaved-caspase-3 and caspase-3, and the phosphorylation and non-phosphorylation alternation of MAPKs.AEG-1 expression was detected to be strongly positive in the histological slides of 35 out of 54 (65% patients with RB. AEG-1 expression increased significantly (P<0.05 with tumor stage. In the RB cell lines SO-RB50, Y79 and WERI-RB1 as compared with retinal pigment epithelium cells, expression of AEG-1 mRNA and AEG-1 protein was significantly higher. In AEG-1-siRNA lentivirus transfected cell cultures as compared with negative control lentivirus transfected cell cultures, levels of AEG-1 mRNA and of AEG-1 protein (P<0.05 and cell growth rates (P<0.01 were significantly lower, and apoptosis rate (P<0.001, Bax/Bcl-2 ratio and cleaved-caspase-3 protein level were significantly increased. The P-ERK/ERK ratio was significantly decreased in the AEG-1-siRNA lentivirus transfected cell lines.Expression of AEG-1 was associated with RB, in histological slides of patients and in cell culture experiments. Lentivirus transfection induced knockdown of AEG-1 had a tumor suppressive effect, potentially by tumor cell apoptosis induction through inhibition of ERK.

  6. Poslednjaja totshka v dele Antropova / Kalle Laanet ; interv. Irina Kablukova

    Index Scriptorium Estoniae

    Laanet, Kalle, 1965-

    2005-01-01

    Siseminister Kalle Laanet esitas Riigikogu õiguskomisjonile politseiameti uueks peadirektori kandidaadi Raivo Aeg'i, skandaalist endise peadirektori Robert Antropovi ümber, politseiameti reformimisest

  7. Method validation and preliminary qualification of pharmacodynamic biomarkers employed to evaluate the clinical efficacy of an antisense compound (AEG35156) targeted to the X-linked inhibitor of apoptosis protein XIAP.

    Science.gov (United States)

    Cummings, J; Ranson, M; Lacasse, E; Ganganagari, J R; St-Jean, M; Jayson, G; Durkin, J; Dive, C

    2006-07-01

    Data are presented on pharmacodynamic (PD) method validation and preliminary clinical qualification of three PD biomarker assays. M65 Elisa, which quantitates different forms of circulating cytokeratin 18 (CK18) as putative surrogate markers of both apoptotic and nonapoptotic tumour cell death, was shown to be highly reproducible: calibration curve linearity r2 = 0.996, mean accuracy > 91% and mean precision < 3%, n = 27. Employing recombinant (r) CK18 and caspase cleaved CK18 (CK18 Asp396 neo-epitope) as external standards, kit to kit reproducibly was < 6% (n = 19). rCK18 was stable in plasma for 4 months at -20 degrees C and -80 degrees C, for 4 weeks at 4 degrees C and had a half-life of 2.3 days at 37 degrees C. Cytokeratin 18 Asp396 NE, the M30 Apoptosense Elisa assay antigen, was stable in plasma for 6 months at -20 degrees C and -80 degrees C, for 3 months at 4 degrees C, while its half-life at 37 degrees C was 3.8 days. Within-day variations in endogenous plasma concentrations of the M30 and M65 antigens were assessed in two predose blood samples collected from a cohort of 15 ovarian cancer patients receiving carboplatin chemotherapy and were shown to be no greater than the variability associated with methods themselves. Between-day fluctuations in circulating levels of the M30 and M65 antigens and in XIAP mRNA levels measured in peripheral blood mononuclear cells by quantitative (q) RT-PCR were evaluated in two predose blood samples collected with a 5- to 7-day gap from 23 patients with advanced cancer enrolled in a phase I trial. The mean variation between the two pretreatment values ranged from 13 to 14 to 25%, respectively, for M65, M30 and qRT-PCR. These data suggest that the M30 and M65 Elisa's and qRT-PCR as PD biomarker assays have favourable performance characteristics for further investigation in clinical trials of anticancer agents which induce tumour apoptosis/necrosis or knockdown of the anti-apoptotic protein XIAP. PMID:16804528

  8. Knockdown of astrocyte elevated gene-1 inhibits proliferation and enhancing chemo-sensitivity to cisplatin or doxorubicin in neuroblastoma cells

    Directory of Open Access Journals (Sweden)

    Xie Li

    2009-02-01

    Full Text Available Abstract Background Astrocyte elevated gene-1 (AEG-1 was originally characterized as a HIV-1-inducible gene in primary human fetal astrocyte. Recent studies highlight a potential role of AEG-1 in promoting tumor progression and metastasis. The aim of this study was to investigate if AEG-1 serves as a potential therapeutic target of human neuroblastoma. Methods We employed RNA interference to reduce AEG-1 expression in human neuroblastoma cell lines and analyzed their phenotypic changes. Results We found that the knockdown of AEG-1 expression in human neuroblastoma cells significantly inhibited cell proliferation and apoptosis. The specific downregulation induced cell arrest in the G0/G1 phase of cell cycle. In the present study, we also observed a significant enhancement of chemo-sensitivity to cisplatin and doxorubicin by knockdown of AEG-1. Conclusion Our study suggests that overexpressed AEG-1 enhance the tumorogenic properties of neuroblastoma cells. The inhibition of AEG-1 expression could be a new adjuvant therapy for neuroblastoma.

  9. Soome kogemus : meedia kasutamine kasvab ja intensiivsus väheneb / Ilkka Jauhiainen

    Index Scriptorium Estoniae

    Jauhiainen, Ilkka

    1999-01-01

    Soome Gallupi uurimistulemuste põhjal on televisiooni jälgimisele kuluv aeg kasvanud. Tabelid: Meediate jälgimisele kulunud aeg päevas (1996 ja 1998); meediate jälgimise intensiivsus, interneti kasutamise põhjused

  10. Astrocyte elevated gene-1 regulates astrocyte responses to neural injury: implications for reactive astrogliosis and neurodegeneration

    Directory of Open Access Journals (Sweden)

    Vartak-Sharma Neha

    2012-08-01

    Full Text Available Abstract Background Reactive astrogliosis is a ubiquitous but poorly understood hallmark of central nervous system pathologies such as trauma and neurodegenerative diseases. In vitro and in vivo studies have identified proinflammatory cytokines and chemokines as mediators of astrogliosis during injury and disease; however, the molecular mechanism remains unclear. In this study, we identify astrocyte elevated gene-1 (AEG-1, a human immunodeficiency virus 1 or tumor necrosis factor α-inducible oncogene, as a novel modulator of reactive astrogliosis. AEG-1 has engendered tremendous interest in the field of cancer research as a therapeutic target for aggressive tumors. However, little is known of its role in astrocytes and astrocyte-mediated diseases. Based on its oncogenic role in several cancers, here we investigate the AEG-1-mediated regulation of astrocyte migration and proliferation during reactive astrogliosis. Methods An in vivo brain injury mouse model was utilized to show AEG-1 induction following reactive astrogliosis. In vitro wound healing and cell migration assays following AEG-1 knockdown were performed to analyze the role of AEG-1 in astrocyte migration. AEG-1-mediated regulation of astrocyte proliferation was assayed by quantifying the levels of cell proliferation markers, Ki67 and proliferation cell nuclear antigen, using immunocytochemistry. Confocal microscopy was used to evaluate nucleolar localization of AEG-1 in cultured astrocytes following injury. Results The in vivo mouse model for brain injury showed reactive astrocytes with increased glial fibrillary acidic protein and AEG-1 colocalization at the wound site. AEG-1 knockdown in cultured human astrocytes significantly reduced astrocyte migration into the wound site and cell proliferation. Confocal analysis showed colocalization of AEG-1 to the nucleolus of injured cultured human astrocytes. Conclusions The present findings report for the first time the novel role of AEG-1

  11. Inhibition of Hypoxia Inducible Factor Alpha and Astrocyte-Elevated Gene-1 Mediates Cryptotanshinone Exerted Antitumor Activity in Hypoxic PC-3 Cells

    Directory of Open Access Journals (Sweden)

    Hyo-Jeong Lee

    2012-01-01

    Full Text Available Although cryptotanshinone (CT was known to exert antitumor activity in several cancers, its molecular mechanism under hypoxia still remains unclear. Here, the roles of AEG-1 and HIF-1α in CT-induced antitumor activity were investigated in hypoxic PC-3 cells. CT exerted cytotoxicity against prostate cancer cells and suppressed HIF-1α accumulation and AEG-1 expression in hypoxic PC-3 cells. Also, AEG-1 was overexpressed in prostate cancer cells. Interestingly, HIF-1α siRNA transfection enhanced the cleavages of caspase-9,3, and PAPR and decreased expression of Bcl-2 and AEG1 induced by CT in hypoxic PC-3 cells. Of note, DMOG enhanced the stability of AEG-1 and HIF-1α during hypoxia. Additionally, CT significantly reduced cellular level of VEGF in PC-3 cells and disturbed tube formation of HUVECs. Consistently, ChIP assay revealed that CT inhibited the binding of HIF-1α to VEGF promoter. Furthermore, CT at 10 mg/kg suppressed the growth of PC-3 cells in BALB/c athymic nude mice by 46.4% compared to untreated control. Consistently, immunohistochemistry revealed decreased expression of Ki-67, CD34, VEGF, carbonic anhydrase IX, and AEG-1 indices in CT-treated group compared to untreated control. Overall, our findings suggest that CT exerts antitumor activity via inhibition of HIF-1α, AEG1, and VEGF as a potent chemotherapeutic agent.

  12. Cost-effectiveness optimization of a solar hot water heater with integrated storage system

    International Nuclear Information System (INIS)

    Solar processes are generally characterized by high first cost and low operating costs. Therefore, the basic economic problem is one of comparing an initial known investment with estimated future operating cost. This paper present the cost-benefit ratio of solar collector with integrated storage system. Evaluation of the annual cost (AC) and the annual energy gain (AEG) of the collector are performed and the ratio of AC/AEG or the cost benefit ratio is presented for difference combination of mass flow rate, solar collector length and channel depth. Using these cost-effectiveness curves, the user can select optimum design features, which correspond to minimum AC/AEG

  13. Õigusterminid ja õigusharidus, erialase oskussõnavara omandamine / Merike Ristikivi

    Index Scriptorium Estoniae

    Ristikivi, Merike, 1973-

    2012-01-01

    Juristide jaoks olulise erialase oskussõnavara omandamisest kolmel perioodil: 1918-1940, nõukogude aeg ning taasiseseisvusaeg. Õigusterminoloogia omandamisest ning õppevahenditest, mille alusel ülikoolis juriidilisi termineid õpetati ja õpiti

  14. Eesti Energia, vara veel! / Väino Sarnet

    Index Scriptorium Estoniae

    Sarnet, Väino, 1952-

    2010-01-01

    Majanduskonsultant avaldab arvamust, millised on argumendid Eesti Energia kiireks börsiletulekuks, kes sellega võidaksid ja kes kaotaksid ning miks pole praegu õige aeg Eesti Energia aktsiate avalikuks müügiks

  15. Investor interest returning as economies start to stabilize

    Index Scriptorium Estoniae

    2009-01-01

    Praegu on õige aeg Baltimaadesse investeerimiseks, kuna ka sealne majandus on stabiliseerumas. Võimalik, et Baltimaade valitsused müüvad veel riigivara. East Capital Groupi osalused Baltimaade ettevõtetes

  16. Geneetiliselt muundatud? / Epp Petrone

    Index Scriptorium Estoniae

    Petrone, Epp, 1974-

    2006-01-01

    Ameerikas on geneetiliselt muundatud toitu kasvatatud 20 ja ulatuslikult toodetud kaheksa aastat, ning juba mõni aeg tagasi kadus kontroll selle üle, mis supermarketites müüdavast tavatoidust on GMO-vaba ja mis mitte

  17. JeS nas bolshe ne manit? / Viktoria Ladõnskaja

    Index Scriptorium Estoniae

    Ladõnskaja, Viktoria, 1981-

    2004-01-01

    Viimaste uuringute kohaselt sooviksid vaid 3 protsenti Eesti elanikest Euroopa Liidu riikidesse elama minna, 15 protsenti sooviksid aeg-ajalt mujal töötada. Poliitiliste uuringute keskuse Praxis uuringust

  18. Territoriaalplaneerimise õiguslik regulatsioon Eesti Vabariigis : [bakalaureusetöö] / Andrus Kattel ; Tartu Ülikool, õigusteaduskond ; juhendaja: Sirje Tael

    Index Scriptorium Estoniae

    Kattel, Andrus

    1998-01-01

    Kaasaegse territoriaalplaneerimise kujunemine, Eesti Vabariigi 1939. a. ehitusseadus, nõukogude aeg, üleminekuperiood 1989-1995, 1995. a. planeerimis- ja ehitusseadus (selle asend Eesti õigussüsteemis, kohalike omavalitsuste õigused ja kohustused, mõju maakasutusele)

  19. Estonia plans to build nuclear power plant / Jana Belugina

    Index Scriptorium Estoniae

    Belugina, Jana

    2009-01-01

    Eesti Energia on tuumaelektrijaama ehitamiseks välja valinud kuus asukohta. Seadusandlikke otsuseid tuumaelektrijaama ehitamise kohta saab vastu võtta alates 2014. aastast ning tuumareaktori valmimise aeg on 2025. aasta

  20. 3 vahvat / Margit Kilumets, Mari Öö Sarv

    Index Scriptorium Estoniae

    Kilumets, Margit, 1964-

    2014-01-01

    Aivo Lillest, kes on kandnud hoolt kvaliteetsete jalgrattateede rajamise eest Kalamajas; Laura Tederist, kelle hoole all on aeg-ajalt ühe perekonna viis last, ning Tambet Talist ja Kaisa Üprus-Talist, kes tegelevad leinalaagrites lastega

  1. Parliamentarians call for resignation of Finance Minister / Monika Hanley

    Index Scriptorium Estoniae

    Hanley, Monika

    2008-01-01

    Opositsiooni kuuluv erakond Uus Aeg leiab, et Läti rahandusminister Atis Slakteris peaks ebakompetentsuse tõttu tagasi astuma. Poliitikute arvates, ei ole Slakteris piisavalt aktiivselt püüdnud riigi finantsprobleeme lahendada

  2. Maapoisi tee linnakirjandusse / Mati Unt

    Index Scriptorium Estoniae

    Unt, Mati, 1944-2005

    1999-01-01

    Mälestusi keskkooliajast Tartus (1958-1962). Ettekanne Tartu Kirjanduse Majas 1999. a. mais toimunud Soome-Eesti ühisseminaril. Ilmunud ka kogumikus: Taasleitud aeg = Kadonneen ajan arvoitus. Tartu, 2000, lk. 24-32

  3. USA maksumaksja nuriseb HIV-ennetusraha kulutamise üle / Anti Liiv

    Index Scriptorium Estoniae

    Liiv, Anti, 1946-

    2004-01-01

    Henry J. Kaiseri perekonna sihtasutus uuris tänavu, kuidas on USA maksumaksjad rahul nende raha kinkimisega välisriikidele HIV-vastaseks võitluseks. Autori arvates oleks ka Eestis aeg selliseid uuringuid korraldada

  4. Hetk enne plahvatust : arhitektuuri tulevik / Alberto Campo Baeza

    Index Scriptorium Estoniae

    Campo Baeza, Alberto

    1997-01-01

    Teemad: Arhitektuuri tulevik on ideedes. Valgus ja gravitatsioon : küsimuse olemus. Inimene ja tabatud ilu. Aeg ja arhitektuur. Projektiliialdused ja tehnoloogia ebaadekvaatne rakendamine. Ühiskond ja kunstnik.

  5. Tegevuskunstnikud üllatavad balliga / Eero Ijavoinen ; interv. Arnika Tegelmann

    Index Scriptorium Estoniae

    Ijavoinen, Eero, 1963-

    2000-01-01

    Intervjuu tegevuskunstifestivali "Aeg Ruum Liikumine" korraldaja Eero Ijavoineniga; festivalil osalevad Leonhard Lapin, Ilmar Kruusamäe, Kaarina Ormio, Roi Vaara, David Rotenberg, Jaanika Peerna, Gert Hatsukov, vene rühmitus The Blind

  6. Targeting anthracycline-resistant tumor cells with synthetic aloe-emodin glycosides.

    Science.gov (United States)

    Breiner-Goldstein, Elinor; Evron, Zoharia; Frenkel, Michael; Cohen, Keren; Meiron, Keren Nir; Peer, Dan; Roichman, Yael; Flescher, Eliezer; Fridman, Micha

    2011-07-14

    The cytotoxic activity of aloe-emodin (AE), a natural anthranoid that readily permeates anthracycline-resistant tumor cells, was improved by the attachment of an amino-sugar unit to its anthraquinone core. The new class of AE glycosides (AEGs) showed a significant improvement in cytotoxicity-up to more than 2 orders of magnitude greater than those of AE and the clinically used anthracycline doxorubicin (DOX)-against several cancer cell lines with different levels of DOX resistance. Incubation with the synthetic AEGs induced cell death in less than one cell cycle, indicating that these compounds do not directly target the cell division mechanism. Confocal microscopy provided evidence that unlike DOX, AEGs accumulated in anthracycline-resistant tumor cells in which resistance is conferred by P-glycoprotein efflux pumps. The results of this study demonstrate that AEGs may serve as a promising scaffold for the development of cytotoxic agents capable of overcoming anthracycline resistance in tumor cells. PMID:24900344

  7. Muusika / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2005-01-01

    Muusikasündmustest Eestis: Improvizz'05, Jazz'n Motion, muusikafestivali "Eduard Tubin ja tema aeg" pressikonverents, laulumäng "Suur Munamägi" Estonia kammersaalis, modernismi pidunädal Tartu Elleri koolis

  8. Euro kasutuselevõtuks ametnikel töö tehtud / Piret Reiljan

    Index Scriptorium Estoniae

    Reiljan, Piret, 1983-

    2007-01-01

    Eesti eurole üleminekut ette valmistanud ametnike koostatud infomaterjalid ja tegevuskavad on valmis, ent euro saabumise aeg pole veel teada. Diagramm: Inflatsioonimäär. Kommenteerivad Jan Linden ja Klas Eklund

  9. New Era stands against Muiznieks / Aaron Eglitis

    Index Scriptorium Estoniae

    Eglitis, Aaron

    2005-01-01

    Läti juhtiv parempartei Uus Aeg ning rahvuslikud Isamaa Eest ja Vabadus ei toeta koalitsiooni kuuluva Läti Esimese Partei liikme Nils Muiznieksi kandidatuuri inimõiguste osakonna juhiks kuna viimane olevat ebakompetentne ja eelarvamustega

  10. Master Minimum Equipment List

    Data.gov (United States)

    Department of Transportation — The AEG System is used to create, revise, approve, and distribute text of the MMEL and Flight Standard Board (FSB)/Type Rating Report. The MMEL specifies under what...

  11. Ajamere lainetes / Jana Savi

    Index Scriptorium Estoniae

    Savi, Jana

    2012-01-01

    Psühholoogilisest aja käsitlusest - minevik, olevik, tulevik ning teraapiatest (elu)probleemide lahendamiseks. Hetkes elamisest ning neljandast mõõtmest (aeg ja ruum), aegruumi mustritest ja maiade kalendrist

  12. Proshtshai, dollar? / Kenneth Rogoff ; tõlk. Irina Sashtshenkova

    Index Scriptorium Estoniae

    Rogoff, Kenneth

    2008-01-01

    Autor kirjutab dollari nõrgenemisest ja selle alternatiividest rahvusvahelisel valuutaturul ning euro tugevnemisest. Pankurid ja rahandustegelased peaksid hakkama mõtlema, mida teha siis, kui on aeg dollari toetamine lõpetada

  13. "Impact 4" Berliinis ja Poznanis / Vappu Thurlow

    Index Scriptorium Estoniae

    Thurlow, Vappu, 1960-

    2005-01-01

    5.-10. IX Berliinis ja Poznanis toimunud neljandast rahvusvahelisest graafikakonverentsist "Impact" alapealkirjaga "Kontakt". Eestist osalesid Loit Jõekalda, Eve Kask, Karin Laansoo ja Vappu Thurlow. 2007. a. Tallinnas toimuva "Impact 5", alapealkirjaga "Slices of Time/Lõigutud aeg", kontseptsioon

  14. Saksa vastupanu ja prantsuse tundeelu / Endel Link

    Index Scriptorium Estoniae

    Link, Endel

    2005-01-01

    Berliini 55. filmifestivalist ja festivali filmidest : sakslase Marc Rothemundi "Sophie Scholl - viimased päevad", prantslase Régis Wargineri "Man to Man" ja teise prantslase André Téchiné "Muutunud aeg"

  15. Pop / Tõnu Pedaru

    Index Scriptorium Estoniae

    Pedaru, Tõnu

    2007-01-01

    Heliplaatidest: Ska Factor "Aeg on uus", M83 "Digital Shades. Vol 1", Keyshia Cole "Just Like You", Scandinavian Music Group "Missä Olet Laila?", Mick Jagger "The very best of Mick Jagger", Dave Gahan "Hourglass"

  16. Birgit Õigemeele jõulualbumi eelesitlus

    Index Scriptorium Estoniae

    2008-01-01

    Rõivabränd Pepe Jeans London korraldab Tallinnas Kristiine keskuses Birgit Õigemeele minikontserdi ja jõulualbumi "Ilus Aeg" plaadiesitluse (heliplaadil teevad kaasa ka Uku Suviste ja ETV lastekoor Lii Leitmaa juhatusel)

  17. Muinasjutt ökokatastroofist / Ilona Martson

    Index Scriptorium Estoniae

    Martson, Ilona, 1970-

    2002-01-01

    Tallinnas ja Tartus tuli ekraanile USA joonisfilm "Jääaeg" ("Ice Age"), mille dubleerimisse on režissöör Janno Põldma juhtimisel kaasatud head eesti näitlejad Anu Lamp, Lembit Ulfsak ja Marko Matvere

  18. Hea nali võib peituda raamatus / Gert Kiiler

    Index Scriptorium Estoniae

    Kiiler, Gert

    2007-01-01

    Arvustus: Leer, Jaak. Savumees Einaril on kogu aeg buss katki. Tallinn : Jutulind, 2006 ; Huber, Markus, Treichler, Robert. Keegi pole nii vinge kui meie : uimased britid, tobedad sakslased, pinges prantslased ja veel 36 lootusetut juhtumit. Tallinn : Olion, 2006

  19. Adamkus : EU might be willing to negotiate on postponing Ignalina reactor closure

    Index Scriptorium Estoniae

    2008-01-01

    President Valdas Adamkus teatas võimalusest, et EL alustab arutelu Ignalina tuumaelektrijaama sulgemise edasilükkamisest. Uue jaama valmimise aeg pole teada ning praegune reaktor on tänu rootslaste abile turvaline

  20. Raamatureisid Veneetsiasse / Margus Haav

    Index Scriptorium Estoniae

    Haav, Margus, 1969-

    2005-01-01

    Arvustus: Girardi, Robert. Vaporetto 13 / ingl. k. tlk. Karin Suursalu. Tallinn : Kultuurileht, 2005. (Loomingu Raamatukogu) ; Raittila, Hannu. Canal Grande : [romaan] / tõlkinud Aivo Lõhmus. Tallinn : Varrak, 2003 (Moodne aeg)

  1. USA-s jagati kirjandusauhindu / Kaarel Kressa

    Index Scriptorium Estoniae

    Kressa, Kaarel, 1983-

    2007-01-01

    Ameerika Ühendriikide kirjandusauhinna National Book Award laureaadid 2007. a.: parim prosaist - Denis Johnson (romaan "Suitsupuu"), parim noorsookirjanik - Sherman Alexie ("Poole kohaga indiaanlase absoluutselt tõene päevik"), parim luuletaja - Robert Hass (luulekogu "Aeg ja ained")

  2. Tardunud pilguga / Tiia Kõnnusaar

    Index Scriptorium Estoniae

    Kõnnusaar, Tiia, 1965-

    2004-01-01

    Kuidas mõjutab telerivaatamine lapse arengut. Aluseks Saksamaa antroposoofilise suunaga Pedagoogika-, Meelte- ja Meediaökoloogia Instituudi juhataja Rainer Patzlaffi raamat "Tardunud pilk". Lisaks "Elu võimalikkusest ilma telekata" ja "Kuhu kulub aeg?"

  3. Dicty_cDB: Contig-U09796-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09796-1 gap included 660 2 5976671 5976010 MINUS 1 2 U09796 1 0 0 0 0 0 0 0 0 0 0 0 0 0 ... ( DV417368 ) NADZ430TR Aedes aegypti infected with Dengue ... viru... 48 0.43 1 ( DV415657 ) NADWB62TR Aedes aeg ... ypti infected with Dengue ... viru... 48 0.43 1 ( DV353586 ) NABX906TO Aedes aeg ...

  4. Dicty_cDB: Contig-U04528-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U04528-1 no gap 115 2 3382412 3382528 PLUS 1 1 U04528 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Co ... ( DV400291 ) NADVT17TR Aedes aegypti infected with Dengue ... viru... 46 0.25 1 ( DV400290 ) NADVT17TF Aedes aeg ... ypti infected with Dengue ... viru... 46 0.25 1 ( DV346606 ) NABWS46TR Aedes aeg ...

  5. Archaeological excavations at a bronze aeg grave and a 6th - 10 th century cult site at Aunamägi in Tõnija-Põlluküla village, southern Saaremaa / Marika Mägi, Raili Allmäe, Riina Riiel ... [jt.

    Index Scriptorium Estoniae

    2015-01-01

    Kaevamised Saunamäel korraldati Tallinna Ülikooli üliõpilaste seminarkaevamistena. Kogu kaevamiste ala moodustas umbes 170 m2. Märkimisväärne Tuulingumäe ja Saunamäe kompleksi juures on see, et need olid mõeldud suhteliselt piiratud hulgale. Sellised väikesed pühapaigad viitavad rituaalidele, mida sooritasid üksikud valitud isikud. Kõik artiklis mainitud kultusekohad jäävad Läänemere põhjaosa rannikualadele, kus eelviikingiajal kujunes ühine kultuurisfäär

  6. Echinochrome A Improves Exercise Capacity during Short-Term Endurance Training in Rats

    Directory of Open Access Journals (Sweden)

    Dae Yun Seo

    2015-09-01

    Full Text Available Echinochrome A (Echi A improves mitochondrial function in the heart; however, its effects on skeletal muscle are still unclear. We hypothesized that Echi A administration during short-term exercise may improve exercise capacity. Twenty-four male Sprague-Dawley rats were randomly divided into the following groups: control group (CG, Echi A-treated group (EG, aerobic exercise group (AG, and aerobic exercise treated with Echi A group (AEG (n = 6 per group. Echi A was administered intra-peritoneally (0.1 mg/kg of Echi A in 300 µL phosphate-buffered saline daily 30 min before each exercise training. The AG and AEG groups performed treadmill running (20 m/min, 60 min/day five days/week for two weeks. The exercise capacity was significantly higher in the AG and AEG groups compared to other groups. Interestingly, the exercise capacity increased more effectively in the AEG group. The body weight in the EG tended to be slightly lower than that in the other groups. There were no significant changes in the plasma lipids among the groups. However, the gastrocnemius muscle mitochondria content was greater in the EG and AEG groups. These findings show that Echi A administration after short-term endurance training enhances exercise capacity, which was associated with an increase in skeletal muscle mitochondrial content.

  7. Six Key Topics for Automated Assessment Utilisation and Acceptance

    Directory of Open Access Journals (Sweden)

    Torsten REINERS

    2011-04-01

    Full Text Available Automated assessment technologies have been used in education for decades (e.g., computerised multiple choice tests. In contrast, Automated Essay Grading (AEG technologies: have existed for decades; are `good in theory' (e.g., as accurate as humans, temporally and financially efficient, and can enhance formative feedback, and yet; are ostensibly used comparatively infrequently in Australian universities. To empirically examine these experiential observations we conducted a national survey to explore the use of automated assessment in Australian universities and examine why adoption of AEG is limited. Quantitative and qualitative data were collected in an online survey from a sample of 265 staff and students from 5 Australian universities. The type of assessment used by the greatest proportion of respondents was essays/reports (82.6%, however very few respondents had used AEG (3.8%. Recommendations are made regarding methods to promote technology utilisation, including the use of innovative dissemination channels such as 3D Virtual Worlds.

  8. Prospects for measuring the gravitational free-fall of antihydrogen with emulsion detectors

    International Nuclear Information System (INIS)

    The main goal of the AEgIS experiment at CERN is to test the weak equivalence principle for antimatter. AEgIS will measure the free-fall of an antihydrogen beam traversing a moir and apos;e deflectometer. The goal is to determine the gravitational acceleration g-bar with an initial relative accuracy of 1% by using an emulsion detector combined with a silicon μ-strip detector to measure the time of flight. Nuclear emulsions can measure the annihilation vertex of antihydrogen atoms with a precision of ∼ 1–2 μm r.m.s. We present here results for emulsion detectors operated in vacuum using low energy antiprotons from the CERN antiproton decelerator. We compare with Monte Carlo simulations, and discuss the impact on the AEgIS project

  9. Geant4 Simulation of Annihilation and excitation of Positronium

    CERN Document Server

    Gad, Andreas

    2016-01-01

    The purpose of this report is to document the work done during the summer of 2016 (18/6- 26/8) as a part of the CERN Summer Student Programme. The work has been done at the AEgIS (Antihydrogen Experiment: Gravity, Interferometry, Spectroscopy) collaboration under the supervision of Lillian Smestad and Michael Doser. The goal of the project was to create a Monte Carlo simulation in Geant4, of Positronium annihilation and excitation in the positron test chamber of the AEgIs experiment.

  10. Igasse maaperesse viis küülikut! / Harald Tikk

    Index Scriptorium Estoniae

    Tikk, Harald, 1931-

    2003-01-01

    Kuna praegune aeg on maaelus üsna keerukas, näeb autor küülikukasvatust tootmisharuna, mis peaks olema igale maaperele jõukohane. Ülevaade sellest, millele peaks tähelepanu pöörama küülikukasvatusega alustades

  11. ERGO Jazz Session võõrustab Chris Gall Triot. Vennad Urbid ajakohaste lauludega

    Index Scriptorium Estoniae

    2008-01-01

    14. septembril alustab Jazzkaar koostöös ERGO Kindlustusega uut sarja ERGO Jazz Session, mille avaesinejaks on Chris Gall Trio (kontserdid 14. sept.Kumu auditooriumis ja 15. sept. Tartus Athena keskuses). Vendade Urbide kontserdist "Aeg" 13. sept. Vanemuise kontserdimajas

  12. Valgaskii tribunal / Josef Kats

    Index Scriptorium Estoniae

    Kats, Josef, 1977-

    2004-01-01

    Ilmunud ka: Narvskaja Gazeta, 27. mai 2004, lk. 8. Eesti peaministri, Res Publica esimehe Juhan Partsi ja Läti ekspeaministri, partei Uus Aeg juhi Einars Repshe ühisavaldusest Euroopa Parlamendile, milles nõudsid kommunismi kuritegelikuks kuulutamist ning Venemaalt okupatsiooniaegsete kuritegude avalikku tunnistamist. Poliitikute kohtumisest Valgas

  13. Kas kolm ikka on koolipoisi number? / Mare Leino

    Index Scriptorium Estoniae

    Leino, Mare, 1961-

    2009-01-01

    Artiklikogumiku ""Probleemsed" poisid või "vale" temperament?" (Tallinn, 2009) tutvustus. Kogumik osutab, et tänapäeva kool sobib tüdrukutele paremini kui poistele. On aeg hakata senisest põhjalikumalt uurima, miks see nii on

  14. IPO. Mäng suure orkestriga / Tiiu Pedaja, Gerd Laub

    Index Scriptorium Estoniae

    Pedaja, Tiiu

    2006-01-01

    Aktsiate avaliku pakkumise ehk IPO korraldamisest. Lisad: Millal on õige aeg?; Milline ettevõte sobib avalikuks pakkumiseks?; Milline avalik pakkumine on edukas?; Kuidas IPO-l aktsiaid jaotatakse? Skeemid: Aktsia hinna kujunemine avaliku pakkumise käigus; Järelturu aktsiahinda mõjutavad tegurid

  15. Uus kunstikool näitab oma nägu ja hambaid / Karen Jagodin

    Index Scriptorium Estoniae

    Jagodin, Karen, 1982-

    2004-01-01

    Positivistliku Kunsttööstuskooli kampaaniapäevad algasid Performance Week'iga Ku galeriis. Avamisel esines Mari Sobolev performance'iga "Lost in the system". Kampaaniapäevad kulmineeruvad Paide tegevuskunstifestivaliga "Aeg. Ruum. Liikumine: unplugged". Festivali kuraator on Mari Sobolev

  16. Ilmusid Rahvusraamatukogu uuenenud toimetised / Mihkel Volt

    Index Scriptorium Estoniae

    Volt, Mihkel

    2009-01-01

    Tutvustus: Ajalookirjutaja aeg = Aetas historicorum / Eesti Rahvusraamatukogu ; koostanud Piret Lotman. (Eesti Rahvusraamatukogu toimetised, nr. 11). Tallinn, 2008 ; Teenuse kvaliteet – raamatukogutöö tulemuslikkuse näitaja = Service quality – library perfomance indicator / Eesti Rahvusraamatukogu ; koostanud Anne Veinberg. (Eesti Rahvusraamatukogu toimetised ; 12). Tallinn, 2009.

  17. Mart Laar tuleb peatada / Villu Reiljan

    Index Scriptorium Estoniae

    Reiljan, Villu, 1953-

    2001-01-01

    Ilmunud ka: Vooremaa, 8. dets. 2001, lk. 2; Nädaline, 8. dets. 2001, lk. 4; Võrumaa Teataja, 11. dets. 2001, lk. 2; Järva Teataja, 13. dets. 2001, lk. 2. Kuigi ca 70% Eesti rahvast on elektrijaamade erastamise vastu, on Mart Laari valitsus ignoreerinud rahva tahet, talle on kogu aeg sekundeerinud Mihkel Pärnoja. Autor: ERL. Parlamendisaadik

  18. Töötajad hoolitsevad ise otstarbeka ajakasutuse eest / Merike Lees

    Index Scriptorium Estoniae

    Lees, Merike, 1976-

    2007-01-01

    Ilmunud ka: Delovõje Vedomosti 28. nov. lk. 38. Andes töötajatele vabaduse ise otsustada oma tööaja üle, paranevad nende töö efektiivsus ning ettevõtte majandustulemused. Lisa: Paindlik tööaeg toob kasu. Kommenteerib Aneta Jajkowska

  19. Andrus Saar: Neid inimesi, kes peavad õhtul tühja kõhuga magama minema, on ka parimatel aegadel olnud liiga palju / Andrus Saar ; intervjueerinud Katre Ratassepp

    Index Scriptorium Estoniae

    Saar, Andrus, 1946-

    2010-01-01

    Vaesuse ja sotsiaalse tõrjutuse vastu võitlemise Euroopa aasta Eesti hea tahte saadik leiab, et hirm kaotada töökoht on igati normaalne olukorras, kus inimesed ei ole informeeritud ettevõtte arengust ja perspektiividest ning et praegu oleks viimane aeg muuta toetuste süsteemi. Saar Polli poolt läbiviidud Eurobarometer Flash uuringust

  20. Kirjastusuudiseid

    Index Scriptorium Estoniae

    2006-01-01

    eesti Kunstimuuseumi kirjastatud raamatud "Vene valitsejad. Vene valitsejate portreed Eesti muuseumide kogudest" (koostajad Mai Levin, Aleksandra Murre; kujundaja Peeter Laurits), "Eros ja Surm. Felicien Ropsi looming" (toimetaja Tiina Abel, kujundaja Mari Kaljuste) ja märkmik-kalender "Inimene ja aeg. Päevaraamat" (kujundaja Jaak Peep)

  1. E-citizen in an E-state / Tarmo Loodus

    Index Scriptorium Estoniae

    Loodus, Tarmo, 1958-

    2001-01-01

    Kaanel ajak. ilmumis aeg Winter 2001/2002. Eesti peab muutuma riigiks, kus avaliku sektori asjaajamine toimub ööpäevaringselt, Interneti-ühendus koduarvuteis on tavaline, kasutusele võetakse digitaalallkiri - kõik see nõuab lisaks tehnoloogia arengule ka organisatoorseid ümberkorraldusi. Autor: Isamaaliit

  2. Allkirjade alkeemiast / Maie Kiisel

    Index Scriptorium Estoniae

    Kiisel, Maie

    2011-01-01

    Autori arvates hakkab vanamoodsate kodanikualgatuste aeg läbi saama, tõusulainel on aga Internetis allkirjade jagamine. GMO-keelu tühistamise vastu koguti 1,2 mln. allkirja. Autor leiab, et liikmesriigid on Euroopa tasandi kodanikualgatust kartma hakanud

  3. Prantsusmaa silub Ida-Euroopga suhteid / Riina Luik

    Index Scriptorium Estoniae

    Luik, Riina, 1962-

    2004-01-01

    Prantsusmaa peaminister Jean-Pierre Raffarin kohtus Pariisis Ida-Euroopa ajakirjanikega ja rääkis EL-i riikide suhetest ja majanduskoostööst. Vt. samas: Andres Kasekamp. Näpuga viibutamise aeg on möödas. Lisa: Jean-Pierre Raffarin (55)

  4. Stenbocki maja õues kuuleb põnevaid kodumaiseid artiste

    Index Scriptorium Estoniae

    2008-01-01

    Stenbocki maja õuemuusika kontserdisarja kontsertidest: 18. juunil esinevad Rein Rannap ja Tiit Kikas, 2. juulil kontsert "Jazz Emotion" (Sofia Rubina), 16. juulil eesti-ukraina folkansambel Svjata Vatra, juuli eelviimasel nädalal kontsert "Tshellopalavik" (C-Jam ja Kaire Vilgats), augustis kontsert "Hea-tuju-laulud" (Revalia kammermeeskoor), 20. aug. kontsert "Aeg ei peata" (esitusel Ott Arderi sõnadele loodud laulud)

  5. Eestlased Peipsi taga mõisavalitsejaks / Heli Raamets

    Index Scriptorium Estoniae

    Raamets, Heli, 1975-

    2008-01-01

    AS Trigon Agri Heiki Volveri juhtimisel rajab Pihkva oblastisse Gdovi linna lähedal asuvasse Dobrutshi külla kaasaegset piimafarmi, projekti maksumuseks on ligi 10 miljonit eurot. Vt. samas: Venemaal kestab Vene aeg edasi; Trigon Agril kolmes riigis 35 põllumajandusettevõtet

  6. Individual concrete panels

    DEFF Research Database (Denmark)

    2008-01-01

    DVD én formidler en workshop omhandlende udvikling, optimering og produktion af individuelle betonelementer. Workshoppen fandt sted 8. til 13. oktober 2007 i en af Peter Behren´s AEG turbinehaller i Berlin, hvor 10. arkitektstuderende fra Århus satte 10. inginiørstuderende fra tekniske universite...

  7. Hirmu teretulnud naasmine maailma rahaturgudele / Martin Wolf ; tõlk. Erik Aru

    Index Scriptorium Estoniae

    Wolf, Martin

    2007-01-01

    Ajalehe The Financial Times majanduskommentaator finantskriisist maailmamajanduses. Tõenäoliselt saabub kahjumite kokkuarvamise, karmistuvate krediiditingimuste ja laenukoormuste vähendamise aeg, mis toob kaasa tugeva surve intressimäärade järsuks langetamiseks, et kriisiohtlik süsteem hädast päästa. Sellele survele tuleks vastu hakata nii kaua kui võimalik

  8. O sudbe "Estonii" sprosite Laara / Max Kaur

    Index Scriptorium Estoniae

    Kaur, Max, 1969-

    2007-01-01

    Autor leiab, et on tulnud aeg, mil Estonia laevahuku asjus peaksid Mart Laar ja teised Eesti tolleaegsed juhid andma ausaid ja avameelseid tunnistusi; Estonia huku uurimiseks tuleks luua EL-i ja NATO egiidi all uus uurimisrühm, kus peale Eesti, Rootsi ja Soome esindajate oleksid ka Venemaa esindajad

  9. Kunstnike uus põlvkond Kumus / Ragne Nukk

    Index Scriptorium Estoniae

    Nukk, Ragne

    2008-01-01

    Eesti Kunstiakadeemia vabade kunstide osakonna magistrantide lõputööde näitusest Kumu kunstimuuseumis. Pikemalt kunstnikeduo Johnson&Johnson dokumentatsioonist, Marge Monko fotoseeriast "Uurimusi kodanlusest", Leen Võrno tööst "Aeg/koht, ajatus/kohatus", mis on kujundus lühifilmile. Näituse kuraator Maarin Ektermann

  10. USA hiiglane GE Healthcare korraldab meditsiinis revolutsiooni / Andrew Jack

    Index Scriptorium Estoniae

    Jack, Andrew

    2006-01-01

    General Electricu tütarettevõte GE Healthcare võttis üle Briti diagnostika- ja bioteaduse uurimisfirma Amersham, firma strateegia tuum on võimsa skaneerimistehnoloogia ja meditsiinilise diagnostika üksteisele lähendamine. Lisa: Aeg sorteerida andmeid infotehnoloogia abil

  11. EST Table: BP125659 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP125659 heS30204 10/09/28 54 %/181 aa ref|XP_001657166.1| lupus ... la ribonucleoprotein [Aedes aeg ... ypti] gb|EAT45048.1| lupus ... la ribonucleoprotein [Aedes aegypti] 10/08/29 50 % ... gi|91082895|ref|XP_972070.1| PREDICTED: similar to lupus ... la ribonucleoprotein [Tribolium castaneum] FS79082 ...

  12. EST Table: AV402611 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402611 heS30204 10/09/28 54 %/181 aa ref|XP_001657166.1| lupus ... la ribonucleoprotein [Aedes aeg ... ypti] gb|EAT45048.1| lupus ... la ribonucleoprotein [Aedes aegypti] 10/08/28 50 % ... gi|91082895|ref|XP_972070.1| PREDICTED: similar to lupus ... la ribonucleoprotein [Tribolium castaneum] FS79082 ...

  13. EST Table: BP118500 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP118500 ce--1980 10/09/28 55 %/143 aa ref|XP_001657165.1| lupus ... la ribonucleoprotein [Aedes aeg ... ypti] gb|EAT45047.1| lupus ... la ribonucleoprotein [Aedes aegypti] 10/08/29 57 % ... gi|91082895|ref|XP_972070.1| PREDICTED: similar to lupus ... la ribonucleoprotein [Tribolium castaneum] FS79082 ...

  14. Lapsesamm Trullist Dostojevskini / Vaapo Vaher

    Index Scriptorium Estoniae

    Vaher, Vaapo, 1945-

    2011-01-01

    Tutvustus: Raitar, Maie ; Sööt, Andres. Konrad Mägi. Kunstnik. Looming. Aeg. Tartu : Ilmamaa, 2011 ; Fitzgerald, F. Scott. Maipüha. Tallinn : Eesti Raamat, 2011 ; Trull, Ilmar. Väike viisakas kärbes. Tallinn : Varrak, 2011

  15. [Ilukirjandus ainetundi ja raamat korvpalliplatsile] / Edward Kess

    Index Scriptorium Estoniae

    Kess, Edward

    2009-01-01

    2010. aasta on kuulutatud lugemisaastaks. Raplamaal aset leidnud Eesti Emakeeleõpetajate Seltsi ja Kultuuriministeeriumi ühisseminarist "Lugemisaasta - lugemise aeg". Aruteludes koorus välja tähelepanek, et kõikide ainete õpetajad peaksid kasutama oma tundides ilukirjandust, et pakkuda õpilastele vaheldust õpiku-töövihiku tunnile

  16. Mis on kuuekümnendad eesti kirjanduses? / Mart Velsker

    Index Scriptorium Estoniae

    Velsker, Mart, 1966-

    1999-01-01

    Erinevustest lääne ja eesti kirjanduses 1960. a-tel. Ka poleemikast Tiit Hennoste loengusarjaga "Hüpped modernismi poole. Eesti 20. sajandi kirjandusest Euroopa modernismi taustal". Ettekanne Tartu Kirjanduse Majas 1999. a. mais toimunud Soome-Eesti ühisseminaril. Ilmunud ka kogumikus: Taasleitud aeg = Kadonneen ajan arvoitus. Tartu, 2000, lk. 51-59.

  17. Teenitud vanaduspuhkus

    Index Scriptorium Estoniae

    2006-01-01

    EPL arvab, et Kuna president Arnold Rüütel tervitas vabariigi aastapäeva paraadil kaitseväelasi võidupüha puhul ning avaldas pärast teleesinemist kaastunnet ETV toimetajale, pidades teda ekslikult Helle Meri'ks, siis oleks tal aeg siirduda välja teenitud vanaduspuhkusele

  18. Research into the Bronze and Early Iron Ages / Aivar Kriiska

    Index Scriptorium Estoniae

    Lang, Valter, 1958-

    2006-01-01

    19. sajandil olid mõisted pronksiaeg ja eelrooma rauaaeg praktiliselt tundmatud. Kuni 1950ndateni domineeris rooma rauaaja uurimine. Nüüd on selgunud, et seni kultuurilise depressiooni perioodiks peetud aeg (tuntud kivikirstkalmete perioodina), oli tegelikult üks dünaamilisemaid perioode Eesti esiajaloos. Eesti ala ebaühtlasest asustusest sel perioodil

  19. Kuhu kadus kurikuulus KGB märkmik? / Tiina Kaalep

    Index Scriptorium Estoniae

    Kaalep, Tiina, 1964-

    2005-01-01

    1993. a. ilmus ajalehes Eesti Aeg väidetavate KGB kaastöötajate nimed, ülevaade nimekirja avaldamisele järgnenust. Nimekirja sisaldanud märkmiku asukoht on praeguseks teadmata. Vt. samas intervjuud Tartu KGB viimase juhi Anti Taluriga

  20. Tallinn Fashion Week täidab nädala kodumaise moega / Karilin Engelbrecht

    Index Scriptorium Estoniae

    Engelbrecht, Karilin

    2009-01-01

    Tallinn Fashion Week'i üritustest. Ülevaade eesti moekunstnike loomingu esitlustest. Näitus "Uus Eesti moejoonistus" Arhitektuuri- ja Disainigaleriis. Anu Hindi moefotonäitus "Aeg maha 3" Iida galeriis. Raamatu "Eesti moepiibel 2010" esitlus Rotermanni kvartali kohvikus Platz. Oksana Tanditi ja Filippo Caroti moefotonäitus "Butterflies" Tallinna botaanikaaias

  1. A new application of emulsions to measure the gravitational force on antihydrogen

    CERN Document Server

    Amsler, C; Ariga, T; Braccini, S; Canali, C; Ereditato, A; Kawada, J; Kimura, M; Kreslo, I; Pistillo, C; Scampoli, P; Storey, J W

    2013-01-01

    We propose to build and operate a detector based on the emulsion film technology for the measurement of the gravitational acceleration on antimatter, to be performed by the AEgIS experiment (AD6) at CERN. The goal of AEgIS is to test the weak equivalence principle with a precision of 1% on the gravitational acceleration g by measuring the position of the annihilation vertex antihydrogen atoms after their free fall in a horizontal vacuum pipe. With the emulsion technology developed at the University of Bern we propose to improve the performance of AEgIS by exploiting the superior position resolution of emulsion films over other particle detectors. The idea is to use a new type of emulsion films, especially developed for applications in vacuum, to yield a spatial resolution of the order of one micron in the measurement of the sag of the antihydrogen atoms in the gravitational field. This is an order of magnitude better than what was planned in the original AEgIS proposal.

  2. Kill a brand, keep a customer / Nirmalya Kumar

    Index Scriptorium Estoniae

    Kumar, Nirmalya

    2004-01-01

    Autori hinnangul peaksid kõik ettevõtted kasumi suurendamiseks aeg-ajalt oma brändiportfelle optimeerima. Brändide hindamisest, liitmisest, müümisest, kasvatamisest ja kaotamisest. Tabel: The brand audit sheet. Lisa: Do you have too many brands?

  3. Eesti sihiks elukvaliteedi kasv / Mait Raava

    Index Scriptorium Estoniae

    Raava, Mait

    2007-01-01

    Autor näeb Eesti põhiprobleemi selge visiooni puudumises ning leiab, et sihiks tuleks võtta elukvaliteedi stabiilne kasv. Eestis on aeg küps selleks, et parteid tuleksid järgmisteks valimisteks välja järgmise 15-30 aasta visiooniga

  4. Kolmekihiline Kopli tort Märjamaal / Sulev Oll

    Index Scriptorium Estoniae

    Oll, Sulev, 1964-

    2010-01-01

    Marje Jurtšenko dokumentaalfilmist "Aeg on siin", mis räägib aastast Eesti eri paikades elava nelja 7aastase lapse elus. Filmi esilinastas filmis osalenud Fredile ja tema koolikaaslastele Märjamaa kinos Helk kinomehhaanik Hans Veimann

  5. Kogemus kui ajalugu / David Carr ; inglise keelest tõlkinud Triinu Pakk ; toimetanud Tõnu Viik

    Index Scriptorium Estoniae

    Carr, David, 1940-

    2012-01-01

    Representatsioon, mälu, kogemus. Ajalisus. Intentsionaalsus ja loomuliku hoiaku maailm. Inimmaailm ja ajalooline maailm. Sotsiaalne aeg ning laiendatud minevik ja tulevik. Osalus ja liikmelisus. Ajaloolisus. Ajaloolisus ja ajalooline teadmine. Teaduse ajaloolisus. Ajaloo metafüüsika ja epistemoloogia.

  6. Fotod Michel Sittowi loomingust

    Index Scriptorium Estoniae

    2001-01-01

    Nigulistes Michel Sittowi 475. surma-aastapäevale pühendatud õppeotstarbeline reprofotode näitus kunstniku loomingust. Koostaja Helena Risthein, kujundaja Liina Siib, fotod - Stanislav Stepashko. 20. I teabepäev ajaloo- ja kunstiõpetajatele "Michel Sittow ja tema aeg". Kava vt. lk. 22. Kunstnikust.

  7. Eestlased esitlevad Veneetsias kuivkäimlat

    Index Scriptorium Estoniae

    2004-01-01

    10. IX avatakse Veneetsias Arsenales IX arhitektuuribiennaali "Metamorfoos" raames Eesti ekspositsioon "Aeg-maha-arhitektuur". Kristjan Holmi projekt tutvustab Eesti kuivkäimla arhitektuuri. Kabli rannast on näitusesaali toodud arhitekt Agu Külma ja skulptor Jukka-Pekka Jalovaara ehitatud hobusekujuline välikäimla. Näitusega kaasneb kataloog ja dokumentaalfilm Kuukulgur Filmilt

  8. Kolmanda raamatu kiituseks / Peeter Olesk

    Index Scriptorium Estoniae

    Olesk, Peeter, 1953-

    2009-01-01

    Tutvustus: Isaacson, Walter. Einstein : tema elu ja universum / tõlkinud Matti Piirimaa. Tallinn : Eesti Raamat, 2009; Fortey, Jacqueline. Kuulsad teadlased (Silmaring) / tõlkinud Ülle Haav ja Helen Haav. Tallinn : Koolibri, 2009; Vaim ja aeg (Lehed ja tähed : looduse ja teaduse aastaraamat, 5) / koostanud Indrek Rohtmets ja Toomas Kukk. Tallinn : Loodusajakiri, 2009

  9. Kunstnikud liikusid ajas ja ruumis / Anneli Kenk

    Index Scriptorium Estoniae

    Kenk, Anneli

    2001-01-01

    5. tegevuskunstifestivalist "Aeg Ruum Liikumine", kus esinesid Urmas Sisask (trumm ja joig), duo Pink Twins (Vesa ja Juha Vehviläinen Soomest), performance'ikunstnik Biro Jozsef, soome-sloveeni kunstnik Valter Kokot, paidelane Gert Hatsukov, Sorge, sakslased Helge Meyer ja Marco Teubner. Mari Sobolevi kommentaar

  10. Valmiera teater mängib Võnnu lahingut Cēsise lossivaremetes / Jaanika Kressa

    Index Scriptorium Estoniae

    Kressa, Jaanika

    2009-01-01

    Cēsise lossivaremetes etendub Viesturs Meikšānsi vabadusvõitluse teemaline lavastus "Lätlaste aeg". Lauris Gundars kirjutas näidendi Võnnu lahingu 90. aastapäevaks, tuginedes reaalsetele ajaloolistele sündmustele. Läti-Eesti ühisprojektist "Kristjan Jaak ja Eduard"

  11. Novaja jadernaja ugroza / Louis-Rene Beres

    Index Scriptorium Estoniae

    Beres, Louis-Rene

    2007-01-01

    Tänapäeval võib terroristide käsutuses olla nii tuumarelv kui ka teisi massihävitusrelvi ning sellest tingituna on vaja ka uut julgeolekustrateegiat. On tulnud aeg välja töötada kaasaegne Manhattani projekti analoog

  12. Vtoroje dõhanije / Galina Balashova

    Index Scriptorium Estoniae

    Balashova, Galina

    2001-01-01

    Ehtekunstnik Jaan Pärna projektist Meistrite hoov. Dolomiidi kasutamist kunstis kajastavast näitusest "Pae aeg" Meistrite hoovi galeriis. Kujundas Urve Küttner. Jaan Pärna, Urve Küttneri, Andrei Balashovi ja Helmet Raja töödest näitusel

  13. Päästke mööbel! / Marko Rillo

    Index Scriptorium Estoniae

    Rillo, Marko

    2006-01-01

    Näide üle-eestilise juhtimiskonkursi "Juhtimisaju 2006" ühest ülesandest ning võistkonna "Mõistuse hääl" probleemilahendus. Lisa: Ülesanne; Vt. samas: Kas tankis põlenud poiste aeg pole mitte läbi? Lisa: Teinto Furniture'i SWOT analüüs

  14. Mind häirib edukultus. Mind häirib progressikultus. Mind kohutavalt häirib laristamine ja raiskamine / Enn Soosaar ; interv. Urmo Soonvald

    Index Scriptorium Estoniae

    Soosaar, Enn, 1937-2010

    2007-01-01

    Tõlkija, esseist ja kolumnist räägib poliitikast, Eesti ühiskonnast, Eesti suhetest Venemaaga, oma kokkupuudetest presidentide Lennart Meri, Arnold Rüütli ja Toomas Hendrik Ilvesega. Vt. samas: President Ilves tsiteerib 24. veebruaril 2007 Soosaart. Vabariigi aastapäeva kõnes tsiteeris president T. H. Ilves E. Soosaare raamatut "Isa ja Aeg"

  15. Solar cells for space flight and terrestrial use

    Energy Technology Data Exchange (ETDEWEB)

    Fischer, H. (Allgemeine Elektricitaets-Gesellschaft AEG Telefunken, Heilbronn (Germany, F.R.). Abt. Betrieb Optobauelemente)

    1979-01-01

    The development of solar cells at AEG Telefunken Heilbronn, is reviewed. Systems from Azur, Spacelab and Intelsat to Space Telescope and TV SAT are discussed and described. The increased efficiency and power per cell mass are mentioned. Costs for terrestrial solar collectors today are 55 DM/W.

  16. Sõjakurjategijad ja pooleli reformid tõkstamas Balkanil teed euroliitu / Krister Paris

    Index Scriptorium Estoniae

    Paris, Krister

    2005-01-01

    Sõjakuritegude tribunali peasüüdistaja Carla del Ponte avaldab EL-ile survet, et see ei astuks samme Horvaatia ega Serbia ja Montenegroga ühinemise suunas enne, kui nimetatud riigid pole välja andnud kõige tagaotsitumaid sõjakurjategijaid. Lisa: Reformide jaoks aeg otsa saamas

  17. Eesti tippnäitlejad andsid multikale hääle

    Index Scriptorium Estoniae

    2002-01-01

    Esimest korda dubleeritakse välismaa näitlejate hääled eesti keelde animafilmis "Jää aeg" ("Ice Age") : Ameerika Ühendriigid 2002. Dublaazhi režissöör ja tõlkija Janno Põldma, teine tõlkija Lauri Kaare

  18. Magustoit filmihuvilistele lastele / Maris Balbat

    Index Scriptorium Estoniae

    Balbat, Maris, 1936-

    2002-01-01

    25. oktoobrist tuleb Coca-Cola Plaza ekraanile USA joonisfilm "Jääaeg" ("Ice Age"), mille dubleerimisse on režissöör Janno Põldma juhtimisel kaasatud head eesti näitlejad Anu Lamp, Lembit Ulfsak, Marko Matvere jt

  19. Eesti näitlejad andsid hääle laiskloomale, mammutile ja tiigrile / Ilona Martson

    Index Scriptorium Estoniae

    Martson, Ilona, 1970-

    2002-01-01

    Neljapäeval Tallinnas kobarkinos ekraanile tuleva USA joonisfilmi "Jääaeg" ("Ice Age") dubleerimisse on režissöör Janno Põldma juhtimisel kaasatud parimad eesti näitlejad. J. Põldma filmist ja selle dubleerimisega kaasnenud seikadest

  20. Kolm jääaegset triumfi / Peep Pedmanson

    Index Scriptorium Estoniae

    Pedmanson, Peep

    2002-01-01

    Tallinnas ja Tartus tuli ekraanile USA joonisfilm "Jääaeg" ("Ice Age"), mille dubleerimisse on režissöör Janno Põldma juhtimisel kaasatud parimad eesti näitlejad. Eriti Anu Lambi meisterlikkusest laisklooma dubleerimisel ning arvutianimatsiooni kõrgest tasemest

  1. Jah-sõna Hollywoodist paneb aluse kiiduväärt tavale / Anneli Aasmäe

    Index Scriptorium Estoniae

    Aasmäe, Anneli, 1973-

    2002-01-01

    Tallinnas ja Tartus tuli ekraanile USA joonisfilm "Jääaeg" ("Ice Age"), mille dubleerimisse on režissöör Janno Põldma juhtimisel kaasatud parimad eesti näitlejad. Tallinna kobarkino pressiesindaja Lauri Kaare väidab, et see dublaazh ei jää viimaseks

  2. Töötuskindlustushüvitise suurus ületab kindlustusmaksed mitmekordselt / Anne Lauringson

    Index Scriptorium Estoniae

    Lauringson, Anne

    2008-01-01

    Ilmunud ka: Narvskaja Gazeta : Töötukassa 27. märts lk. 4, Den za Dnjom : Töötukassa 28. märts lk. 4. Töötuskindlustushüvitise eesmärgist ja saamise võimalustest. Diagramm: Hüvitise saamise aeg kuudes

  3. Keskmise suurusega akutrellid / Rakennusmaailma põhjal Ingrid Maasik

    Index Scriptorium Estoniae

    2011-01-01

    Võrdluses on 14,4 V akutrell-kruvikeerajad: AEG BS14 C; Black&Decker HP146F4L; Bosch GSR 14,4 V-LI; Bosch PSR LI-2; Einhell RT-CD; Festool T 15+3; Hitachi DS 14BDL; Makita BDF442; Metabo LT; Milwaukee C14DD; Panasonic EY 7441LR; Spit SDI 145

  4. Maadeuurijad = Landkönnu̧irnir : [luuletused] / Bragi Ólafsson ; tlk. Arvo Alas

    Index Scriptorium Estoniae

    Ólafsson, Bragi

    2004-01-01

    Sisu: Maadeuurijad = Landkönnu̧irnir; Hiilgav ehituskunst = Glجstar SmÍ̧ar; Aeg ise = Sj{u00E1lfur tÍminn; Kilud = Ansj̤sur; Raamitud maja = Innan ramma h{250}ssins; Hilissuvisel ajal = ℓ sÍşumarsdögum

  5. "igasse asjade ilmnemisse..." : [luuletused] / Jan Kaus

    Index Scriptorium Estoniae

    Kaus, Jan, 1971-

    2004-01-01

    Sisu: "igasse asjade ilmnemisse..." ; "õnn ja seebimull..." ; "jumala eest! küsige..." ; "aeg surub lõuad kokku..." ; "see kes täna küla naerutab..." ; "kui lips ongi läbi..." ; "klotse asetavast poisist..." ; "mulle ei jää..." ; Mattias ja öö

  6. Rohelisest linnast : haljas linn / Ignar Fjuk

    Index Scriptorium Estoniae

    Fjuk, Ignar, 1953-

    2006-01-01

    Linnahaljastusest Eestis, haljastuse tähtsusest linnaplaneerimises, ajaloost ja tänapäevast. Näiteks toodud Tallinna vanalinna Harju t. äärde kavandatav haljasala, mis eeldaks projektivõistlust, Kadrioru pargi alumises aias elujõuliste puude hävitamise kava jm. Autori arvates oleks aeg haklata rajama 21 sajandi parke

  7. Muuga söeterminalil on probleemide lahendamiseks aega jaanipäevani / Ulvar Käärt

    Index Scriptorium Estoniae

    Käärt, Ulvar, 1982-

    2006-01-01

    AS Coal Terminal Operatori söeterminal Muugal, kust aeg-ajalt levib ümbruskonda söetolmu, töötab nii ilma välisõhu saasteloa kui ka vee erikasutusloata. Terminal kavandab meetmeid tolmuprobleemi lahendamiseks

  8. Dr Rain Tolgi diagnoos / Hannes Rumm

    Index Scriptorium Estoniae

    Rumm, Hannes, 1968-

    2007-01-01

    Ajakirjandusel on võim kehtestada ühiskonnas need teemad, millest räägitakse rahva hulgas, kuid see võim on libisenud suuresti poliittehnoloogide ja suurettevõtete suhtekorraldajate kätte. Autori arvates on ühiskonna vaimse tervise huvides viimane aeg viia jutt nenedele asjadele, mis on olulised

  9. Järjest enam inimesi teeb alles poes ostuotsuse / Katrin Rohtla

    Index Scriptorium Estoniae

    Rohtla, Katrin, 1966-

    2007-01-01

    Ilmunud ka: Delovõje Vedomosti 7. nov. lk. 30. Sooduskampaaniad mõjutavad inimesi oma ostuotsuseid poes tegema, reklaam liigub massimeediast aina enam kauplusesse. Diagrammid: Majanduslik optimism on aeg-ajalt suurenenud ja siis vähenenud; Pärast ELiga liitumist kasvas riiete-jalatsite müük hüppeliselt. Vt. samas: Hirm tuleviku ees

  10. A retrospective comparative exploratory study on two Methylentetrahydrofolate Reductase (MTHFR) polymorphisms in esophagogastric cancer: the A1298C MTHFR polymorphism is an independent prognostic factor only in neoadjuvantly treated gastric cancer patients

    International Nuclear Information System (INIS)

    Methylentetrahydrofolate reductase (MTHFR) plays a major role in folate metabolism and consequently could be an important factor for the efficacy of a treatment with 5-fluorouracil. Our aim was to evaluate the prognostic and predictive value of two well characterized constitutional MTHFR gene polymorphisms for primarily resected and neoadjuvantly treated esophagogastric adenocarcinomas. 569 patients from two centers were analyzed (gastric cancer: 218, carcinoma of the esophagogastric junction (AEG II, III): 208 and esophagus (AEG I): 143). 369 patients received neoadjuvant chemotherapy followed by surgery, 200 patients were resected without preoperative treatment. The MTHFR C677T and A1298C polymorphisms were determined in DNA from peripheral blood lymphozytes. Associations with prognosis, response and clinicopathological factors were analyzed retrospectively within a prospective database (chi-square, log-rank, cox regression). Only the MTHFR A1298C polymorphisms had prognostic relevance in neoadjuvantly treated patients but it was not a predictor for response to neoadjuvant chemotherapy. The AC genotype of the MTHFR A1298C polymorphisms was significantly associated with worse outcome (p = 0.02, HR 1.47 (1.06-2.04). If neoadjuvantly treated patients were analyzed based on their tumor localization, the AC genotype of the MTHFR A1298C polymorphisms was a significant negative prognostic factor in patients with gastric cancer according to UICC 6th edition (gastric cancer including AEG type II, III: HR 2.0, 95% CI 1.3-2.0, p = 0.001) and 7th edition (gastric cancer without AEG II, III: HR 2.8, 95% CI 1.5-5.7, p = 0.003), not for AEG I. For both definitions of gastric cancer the AC genotype was confirmed as an independent negative prognostic factor in cox regression analysis. In primarily resected patients neither the MTHFR A1298C nor the MTHFR C677T polymorphisms had prognostic impact. The MTHFR A1298C polymorphisms was an independent prognostic factor in patients with

  11. Self-calibration for a non-central catadioptric camera with approximate epipolar geometry

    International Nuclear Information System (INIS)

    In spite of wide usage of catadioptric cameras, self-calibration for a non-central catadioptric camera remains very challenging work. In this paper, a novel self-calibration method for a non-central catadioptric camera is proposed. First, an approximate central projection is introduced. With a freely movable virtual viewpoint, the approximate central projection is able to compensate well the bias caused by the misalignment. Then a derived approximate epipolar geometry (AEG) for the non-central camera under the two-view case is given. Based on the AEG, a full self-calibration method using only two images is designed. Combined with an automatic initialization algorithm, the non-central catadioptric camera can be calibrated robustly without any manual intervention. Experiments on both synthetic data and real images verify the effectiveness of the proposed method. (paper)

  12. Investigation of silicon sensors for their use as antiproton annihilation detectors

    Energy Technology Data Exchange (ETDEWEB)

    Pacifico, N., E-mail: nicola.pacifico@cern.ch [University of Bergen, Institute of Physics and Technology, Allégaten 55, 5007 Bergen (Norway); Aghion, S. [Politecnico di Milano, Piazza Leonardo da Vinci 32, 20133 Milano (Italy); Istituto Nazionale di Fisica Nucleare, Sez. di Milano, Via Celoria 16, 20133 Milano (Italy); Ahlén, O. [European Organisation for Nuclear Research, Physics Department, 1211 Geneva 23 (Switzerland); Belov, A.S. [Institute for Nuclear Research of the Russian Academy of Sciences, Moscow 117312 (Russian Federation); Bonomi, G. [University of Brescia, Department of Mechanical and Industrial Engineering, Via Branze 38, 25133 Brescia (Italy); Istituto Nazionale di Fisica Nucleare, Sez. di Pavia, Via Agostino Bassi 6, 27100 Pavia (Italy); Bräunig, P. [Kirchhoff Institute for Physics, Im Neuenheimer Feld 227, 69120 Heidelberg (Germany); Bremer, J. [European Organisation for Nuclear Research, Physics Department, 1211 Geneva 23 (Switzerland); Brusa, R.S. [Department of Physics, University of Trento, via Sommarive 14, 38123 Povo, Trento (Italy); INFN-TIFPA, via Sommarive 14, 38123 Povo, Trento (Italy); Burghart, G. [European Organisation for Nuclear Research, Physics Department, 1211 Geneva 23 (Switzerland); Cabaret, L. [Laboratoire Aimé Cotton, CNRS, Université Paris Sud, ENS Cachan, Bâtiment 505, Campus d' Orsay, 91405 Orsay Cedex (France); Caccia, M. [University of Insubria, Dipartimento di Scienza ed Alta Tecnologia, via Valleggio 11, Como (Italy); Canali, C. [University of Zurich, Physics Institute, Winterthurerstrasse 190, 8057 Zurich (Switzerland); Caravita, R. [Istituto Nazionale di Fisica Nucleare, Sez. di Genova, Via Dodecaneso 33, 16146 Genova (Italy); University of Genoa, Department of Physics, Via Dodecaneso 33, 16146 Genova (Italy); Castelli, F. [University of Milano, Department of Physics, Via Celoria 16, 20133 Milano (Italy); and others

    2014-11-21

    We present here a new application of silicon sensors aimed at the direct detection of antinucleons annihilations taking place inside the sensor's volume. Such detectors are interesting particularly for the measurement of antimatter properties and will be used as part of the gravity measurement module in the AEg{sup ¯}IS experiment at the CERN Antiproton Decelerator. One of the goals of the AEg{sup ¯}IS experiment is to measure the gravitational acceleration of antihydrogen with 1% precision. Three different silicon sensor geometries have been tested with an antiproton beam to investigate their properties as annihilation detection devices: strip planar, 3D pixels and monolithic pixel planar. In all cases we were successfully detecting annihilations taking place in the sensor and we were able to make a first characterization of the clusters and tracks.

  13. Thermodynamic clarification of interaction between antiseptic compounds and lipids consisting of stratum corneum

    International Nuclear Information System (INIS)

    The interactions of antiseptic compounds with quaternary ammonium, such as benzalkonium chloride (BC), benzethonium chloride (BZC), dodecyldiaminoethyl-glycine hydrochloride (AEG), and chlorhexidine gluconate (CHG), with components of the stratum corneum were investigated by isothermal titration calorimetry at pH 7.5 and 25 deg. C. The different mechanisms for their permeation to stratum corneum were clarified. Cationic surfactants of BC and BZC bound to cholesterol and cholesterol sulfate with high affinity (105-106 M-1) to extract endogenous cholesterol and its derivatives from the stratum corneum and penetrated via an intercellular route. CHG also bound to cholesterol and accumulated in the stratum corneum without removing endogenous cholesterol. On the other hand, an amphoteric surfactant of AEG seemed to be incorporated into the lipid bilayer and bound to ceramide with its polar end close to the lipid polar heads by hydrophobic interaction

  14. Tuning a Schottky barrier of epitaxial graphene/4H-SiC (0001) by hydrogen intercalation

    International Nuclear Information System (INIS)

    We report the electron transport properties of epitaxial graphene (EG) grown on 4H-SiC (0001) by low energy electron-beam irradiation. As-grown EG (AEG) on SiC interface exhibits rectifying current-voltage characteristics with a low Schottky barrier (SB) of 0.55 ± 0.05 eV and high reverse current leakage. The SB of AEG/SiC junction is extremely impeded by the Fermi level pinning (FLP) above the Dirac point due to charged states at the interface. Nevertheless, a gentle hydrogen intercalation at 900 °C enables the alleviation of both FLP and carrier scattering owing to the saturation of dangling bonds as evidenced by the enhancement of SB (0.75 ± 0.05 eV) and high electron mobility well excess of 6000 cm2 V−1 s−1

  15. Thermodynamic clarification of interaction between antiseptic compounds and lipids consisting of stratum corneum

    Energy Technology Data Exchange (ETDEWEB)

    Aki, Hatsumi; Kawasaki, Yuhsuke

    2004-06-24

    The interactions of antiseptic compounds with quaternary ammonium, such as benzalkonium chloride (BC), benzethonium chloride (BZC), dodecyldiaminoethyl-glycine hydrochloride (AEG), and chlorhexidine gluconate (CHG), with components of the stratum corneum were investigated by isothermal titration calorimetry at pH 7.5 and 25 deg. C. The different mechanisms for their permeation to stratum corneum were clarified. Cationic surfactants of BC and BZC bound to cholesterol and cholesterol sulfate with high affinity (10{sup 5}-10{sup 6} M{sup -1}) to extract endogenous cholesterol and its derivatives from the stratum corneum and penetrated via an intercellular route. CHG also bound to cholesterol and accumulated in the stratum corneum without removing endogenous cholesterol. On the other hand, an amphoteric surfactant of AEG seemed to be incorporated into the lipid bilayer and bound to ceramide with its polar end close to the lipid polar heads by hydrophobic interaction.

  16. Teadus- ja erialaraamatukogudel oma päev ja aasta teo auhind / Kristina Rallmann

    Index Scriptorium Estoniae

    Rallmann, Kristina

    2008-01-01

    Esimene teadus- ja erialaraamatukogude päev toimus 22. oktoobril 2008 Tallinna majanduskoolis, teadusraamatukogu aasta teo auhind läks RR-i virtuaaalnäitusele "Meie parlament ja aeg: fakte, sündmusi, dokumente, inimesi" ning erialaraamatukogu aasta teo auhind Eesti Pimedate Raamatukogu töörühmale heliteavikute CD-plaatidele automatiseeritud paljundamise ja posti teel laenutamise süsteemi eest

  17. Die Geschichte der Neurologischen Klinik am Hansaplatz unter besonderer Berücksichtigung des Gesetzes zur Verhütung erbkranken Nachwuchses 1933/34

    OpenAIRE

    Hondros, Michael Christian

    2015-01-01

    The history of the clinic at Hansaplatz in Berlin as the first symbiosis of neurology and neurosurgery under one roof began already in 1887, when the private sanatorium was build at first. In 1926 the property was assigned to the AEG-Betriebskrankenkasse until 1932, when it became a neurological research institute originated under Friedrich Heinrich Lewy. Lewy had to emigrate in 1933, after the takeover by the National Socialists, and finally the Hansaklinik became property of the Charité. Su...

  18. Aitab hädaldamisest / Robert Antropov

    Index Scriptorium Estoniae

    Antropov, Robert, 1965-

    2006-01-01

    Endine politseijuht on seisukohal, et politseinike ja päästjate nappuses ei saa süüdistada ainult väikseid palku, küsimus on valikutes: kuidas ja millesse ressursse paigutada. Kalle Laanet ja Raivo Aeg vastavad küsimusele, mis on nende haldusalas konkreetselt kavas, et politsei saaks täita oma tegevusprioriteeti 100% ja tagada sisejulgeoleku. Vt. ka Robert Antropovi kommentaari 7. aug. Eesti Päevaleht lk. 2

  19. Omad võõraste hulgas / Viktor Matizen ; tõlk. Tamara Korts

    Index Scriptorium Estoniae

    Matizen, Viktor

    2004-01-01

    Moskvas lõppes XXVI rahvusvaheline filmifestival. Peapreemia sai venelase Dmitri Meshijevi "Omad" ("Svoi"), FIPRESCI auhinna Marina Razbezhkina "Lõikuse aeg" ("Vremja zhatvõ"), publiku auhinna Vladimir Mashkovi "Isa" ("Papa!"), vene kriitikute auhinna brasiillase Heitor Dhalia "Nina", konkursi "Perspektiiv" auhinna jaapanlane Hideta Takahata ("Hotell Veenus") ja žürii eriauhinna Hõbedase Püha Jüri eestlaste Jaak Kilmi ja Rene Reinumägi "Sigade revolutsioon"

  20. Astrocyte elevated gene-1 regulates astrocyte responses to neural injury: implications for reactive astrogliosis and neurodegeneration

    OpenAIRE

    Vartak-Sharma Neha; Ghorpade Anuja

    2012-01-01

    Abstract Background Reactive astrogliosis is a ubiquitous but poorly understood hallmark of central nervous system pathologies such as trauma and neurodegenerative diseases. In vitro and in vivo studies have identified proinflammatory cytokines and chemokines as mediators of astrogliosis during injury and disease; however, the molecular mechanism remains unclear. In this study, we identify astrocyte elevated gene-1 (AEG-1), a human immunodeficiency virus 1 or tumor necrosis factor α-inducible...

  1. Kui tulusid ei ole võimalik suurendada, tuleb piirata kulutamist / Eugen Veges

    Index Scriptorium Estoniae

    Veges, Eugen, 1955-

    2008-01-01

    Ilmunud ka: Lääne Elu 17. mai lk. 2, Põhjarannik, Severnoje Poberezhje 22. mai lk. 4, Kuulutaja 30. mai lk. 4, Meie Maa 31. mai lk. 2, Vooremaa 3. juuni lk. 2, Järva Teataja 5. juuni lk. 2. Eesti ettevõtjail on ees raske aeg, ettevõtete tulusus langeb. Autori sõnul tuleb riigi tulubaasi suurendamiseks kehtestada uusi makse või suurendada seniseid maksulaekumisi. Haldusreform on möödapääsmatu

  2. Kus asub Ouagadougou? / Reet Roos

    Index Scriptorium Estoniae

    Roos, Reet, 1973-

    2004-01-01

    Ilmunud ka: Nädaline, 21. okt. 2004, lk. 4; Lõunaleht, 21. okt. 2004, lk. 2; Põhjarannik, 22. okt. 2004, lk. 2; Severnoje Poberezhje, 22. okt. 2004, lk. 2; Meie Maa, 22. okt. 2004, lk. 6; Harjumaa, 26. okt. 2004, lk. 2; Hiiu Leht, 26. okt. 2004, lk. 2; Valgamaalane, 9. nov. 2004, lk. 2; Pärnu Postimees, 7. dets. 2004, lk. 15. Autor, arvustades Eesti haridust, leiab, et tsentraalselt ette antud mudelite alusel koolielu korraldamise aeg on lõppenud

  3. Vabariigi presidendi iseseisvuspäeva kõne / Toomas Hendrik Ilves

    Index Scriptorium Estoniae

    Ilves, Toomas Hendrik, 1953-

    2009-01-01

    Vabariigi Presidendi kõne Eesti Vabariigi 91. aastapäeva pidulikul kontserdil Jõhvi kontserdimajas 24. veebruaril 2009. Arvamust avaldavad Euroopa Parlamendi liige Siiri Oviir, suurärimees Tiit Vähi, Eesti katoliku kiriku piiskop Philippe Jourdan, Tartu Ülikooli rektor Alar Karis, Eesti Kunstiakadeemia rektor Signe Kivi ja helilooja Olav Ehala. Vt. ka lk. 1: Ilves hoiatas populismi eest; juhtkiri lk. 2: Aeg kaitsta vabadust

  4. Poeetilise utoopia meister Aino Bach

    Index Scriptorium Estoniae

    2003-01-01

    28. III-11. V Adamson-Ericu muuseumis graafik Aino Bachi loomingu ülevaatenäitus. Võrdluseks on eksponeeritud Eduard Wiiralti ja Kaarel Liimandi tööd. Näha võib Mark Soosaare filmi A. Bachist "Liblikapüüdja" (1978). Kuraator Anne Lõugas, kujundaja Virge Jõekalda. Kai Tuviku juhendamisel muuseumitunnid "Kuidas joonistada inimest?". 1. IV seminaril "Naiskunstnik ja tema aeg. Aino Bach" esinejad, ettekanded

  5. Functional and immunohistochemical characterization of CCEae3a, a carboxylesterase associated with temephos resistance in the major arbovirus vectors Aedes aegypti and Ae. albopictus.

    Science.gov (United States)

    Grigoraki, Linda; Balabanidou, Vassileia; Meristoudis, Christos; Miridakis, Antonis; Ranson, Hilary; Swevers, Luc; Vontas, John

    2016-07-01

    Temephos is a major organophosphate (OP) larvicide that has been used extensively for the control of Aedes albopictus and Aedes aegypti, the major vectors for viral diseases, such as dengue fever, zika and chikungunya. Resistance to temephos has been recently detected and associated with the upregulation of carboxylesterases (CCEs) through gene amplification, in both species. Here, we expressed the CCEae3a genes which showed the most striking up-regulation in resistant Aedes strains, using the baculovirus system. All CCEae3a variants encoded functional enzymes, with high activity and preference for p-nitrophenyl butyrate, a substrate that was shown capable to differentiate temephos resistant from susceptible Aedes larvae. Enzyme kinetic studies showed that CCEae3as from both Ae. aegypti and Ae. albopictus (CCEae3a_aeg and CCEae3a_alb, respectively) strongly interact with temephos oxon and slowly released the OP molecule, indicating a sequestration resistance mechanism. No difference was detected between resistant and susceptible CCEae3a_aeg variants (CCEae3a_aegR and CCEae3a_aegS, respectively), indicating that previously reported polymorphism is unlikely to play a role in temephos resistance. HPLC/MS showed that CCEae3as were able to metabolize temephos oxon to the temephos monoester [(4-hydroxyphenyl) sulfanyl] phenyl O,O-dimethylphosphorothioate. Western blot and immunolocalization studies, based on a specific antibody raised against the CCEae3a_alb showed that the enzyme is expressed at higher levels in resistant insects, primarily in malpighian tubules (MT) and nerve tissues. PMID:27180726

  6. Rahandusministeerium : Eestit ootab ees galopeeriv hinnatõus / Kai Kalamees

    Index Scriptorium Estoniae

    Kalamees, Kai

    2007-01-01

    Ilmunud ka: Postimees : na russkom jazõke, 23. aug. 2007, lk. 2. Rahandusministeeriumi prognoosi järgi ootab Eestit 8,1%-line majanduskasv, 2008. aastal 7,4%-line hinnatõus. Rahandusminister Ivari Padari ja üle-eelmise rahandusministri parlamendiliikme Taavi Veskimäe arvamusi palgakasvu, inflatsiooni ja lisaeelarve kohta. Vt. samas: Käes on poliitiliste valikute aeg

  7. Rahvuse mõju noorte tööturule sisenemise edukusele = The influence of ethnicity on youth labour market entry : III koht magistritööde kategoorias / Kristina Lindemann

    Index Scriptorium Estoniae

    Lindemann, Kristina, 1984-

    2009-01-01

    Magistritöö eesmärgiks oli uurida, kuidas mõjutasid rahvus ja eesti keele oskus noorte tööturule sisenemise edukust ajaperioodil 1991-2006 ning kuidas mõjutasid inimese rahvus, keeleoskus, haridustase, tööturule sisenemise aeg ja elukoht tõenäosust lülituda spetsialistide ja ametnike või sinikraede positsioonile

  8. Kümme aastat R-klubi / Maria-Maren Sepper

    Index Scriptorium Estoniae

    Sepper, Maria-Maren

    2014-01-01

    R-klubi (aeg-ajalt Tallinnas kogunev klubi, mis pakub tagasisidet eesti keele alases uurimistöös, ennekõike väitekirjauurimuste tegemisel ja artiklite publitseerimisel) 10. aastapäeva puhul peetud seminarist Tallinna Ülikoolis 21.3.2014. R-klubi sai alguse Helle Metslangi juhendatavate TLÜ kraadiõppurite tööde ühisaruteludest

  9. mRNA expression levels and genetic status of genes involved in the EGFR and NF-κB pathways in metastatic non-small-cell lung cancer patients

    Directory of Open Access Journals (Sweden)

    Viteri Santiago

    2011-09-01

    Full Text Available Abstract Background Metastatic non-small-cell lung cancer (NSCLC has a dismal prognosis. EGFR is overexpressed or mutated in a large proportion of cases. Downstream components of the EGFR pathway and crosstalk with the NF-κB pathway have not been examined at the clinical level. We explored the prognostic significance of the mRNA expression of nine genes in the EGFR and NF-κB pathways and of BRCA1 and RAP80 in patients in whom EGFR and K-ras gene status had previously been determined. In addition, NFKBIA and DUSP22 gene status was also determined. Methods mRNA expression of the eleven genes was determined by QPCR in 60 metastatic NSCLC patients and in nine lung cancer cell lines. Exon 3 of NFKBIA and exon 6 of DUSP22 were analyzed by direct sequencing. Results were correlated with outcome to platinum-based chemotherapy in patients with wild-type EGFR and to erlotinib in those with EGFR mutations. Results BRCA1 mRNA expression was correlated with EZH2, AEG-1, Musashi-2, CYLD and TRAF6 expression. In patients with low levels of both BRCA1 and AEG-1, PFS was 13.02 months, compared to 5.4 months in those with high levels of both genes and 7.7 months for those with other combinations (P = 0.025. The multivariate analysis for PFS confirmed the prognostic role of high BRCA1/AEG-1 expression (HR, 3.1; P = 0.01. Neither NFKBIA nor DUSP22 mutations were found in any of the tumour samples or cell lines. Conclusions The present study provides a better understanding of the behaviour of metastatic NSCLC and identifies the combination of BRCA1 and AEG-1 expression as a potential prognostic model.

  10. Rock'n'roll'i hotellipidaja / Ants Johanson

    Index Scriptorium Estoniae

    Johanson, Ants, 1962-

    2008-01-01

    Ansamblist Rock Hotel (ansambli 30. sünnipäeva tähistamise juubelikontsertdid toimuvad 14. okt. Pärnu Endla teatris, 15. okt. Rakvere Teatris, 16. okt. Viljandi Pärimusmuusika Aidas, 17. okt. Paide kultuurikeskuses, 18. okt. Võru kultuurimajas Kannel, 19. okt. Vanemuise väikeses majas ja 20. okt. Vene Teatris, 9. okt. toimub Tallinnas Viru Keskuse kaupluses Rahva Raamat mälestusteraamatu "Aeg meid muutnud on? - Rock-Hotel 30" esitlus)

  11. Rossii ne nuzhna milost Zapada / Jonathan Steele

    Index Scriptorium Estoniae

    Steele, Jonathan

    2007-01-01

    Autori hinnangul on Vladimir Putin andnud Venemaale sõltumatuse ja uue rolli rahvusvahelisel areenil. Aeg, mil Läänel oli võimalus avaldada mõju Venemaa sisemisele arengule, on möödas. Tuleb leppida Venemaa sõltumatusega ning mõista, et Venemaasse tuleb suhtuda vähemalt nii, nagu suhtutakse Hiinasse - kui majanduslikku ja strateegilisse giganti

  12. Tallinna sadamaala linnaruumiline arengukava : ettepanek = Urban Development Plan for the Tallinn Port Area : Proposal

    Index Scriptorium Estoniae

    2006-01-01

    Tellija: Tallinna Linnaplaneerimise Amet. Korraldaja: Eesti Arhitektide Liit. Aeg: 2006. a. veebruar. Osalejad: linnageograaf Hardo Aasmäe, arhitektid Andres Alver, Rein Hansberg, Veljo Kaasik, Ott Kadarik, Erik Konze, Margit Mutso, Tiit Sild, Villem Tomiste, TLPA juht, Tallinna peaarhitekt Igor Volkov, Tallinna Sadama esindaja Hannes Kuhlbach, TLPA projektijuht Jaan Kurm, TLPA üldplaneeringute osakonna juhataja Endrik Mänd, Logi Projekti esindaja Taimi Lokotar, Heldur Meerits

  13. Beta-N-methylamino-L-alanine (BMAA) and isomers : distribution in different food web compartments of Thau lagoon, French Mediterranean Sea

    OpenAIRE

    Reveillon, D.; Abadie, E; Sechet, V.; Masseret, Estelle; Hess, P.; Amzil, Z.

    2015-01-01

    The neurotoxin BMAA (beta-N-methylamino-L-alanine) and its isomer DAB (2,4-diaminobutyric acid) have been detected in seafood worldwide, including in Thau lagoon (French Mediterranean Sea). A cluster of amyotrophic lateral sclerosis (ALS), a neurodegenerative disease associated with BMAA, has also been observed in this region. Mussels, periphyton (i.e. biofilms attached to mussels) and plankton were sampled between July 2013 and October 2014, and analyzed using HILIC-MS/MS. BMAA, DAB and AEG ...

  14. Dicty_cDB: Contig-U06988-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U06988-1 no gap 674 4 5187737 5188417 PLUS 1 1 U06988 1 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Co ... ( DV392086 ) NADB895TR Aedes aegypti infected with Dengue ... viru... 48 0.43 1 ( DV392085 ) NADB895TF Aedes aeg ... ypti infected with Dengue ... viru... 48 0.43 1 ( DV258794 ) AEDAM08TO Aedes re- ...

  15. Moesõber, sel nädalal riisu koor Eesti rõivakunstilt! / Tanel Veenre

    Index Scriptorium Estoniae

    Veenre, Tanel, 1977-

    2009-01-01

    3. Tallinna moenädala üritustest. Tallinn Fashion Week'i korraldab Eesti Moedisaini Liit. Näitus "Uus Eesti moejoonistus" Arhitektuuri- ja Disainigaleriis. Filippo Caroti ja Oksana Tanditi moefotonäitus Tallinnas Galeriis M. Meesteehete väljapanek ja Anu Hindi moefotonäitus "Aeg maha 3" Iida galeriis. "Eesti moepiibel 2010" esitlus. Rahvusvaheline seminar Veerenni 24. Ülevaade eesti moekunstnike loomingu esitlustest

  16. A new cyclotron for biomedical research

    International Nuclear Information System (INIS)

    This paper presents the rationale for replacing the old AEG Compact Cyclotron (built in 1969/71) of the Institute for Radiology and Pathophysiology at the German Cancer Research Center by a 30 MeV H-/15 MeV D- cyclotron. A status report is followed by the scientific and technical reasoning as well as budgetary and organizational considerations. In the appendix we tried to explain the function of a cyclotron in a simple and comprehensive manner. (orig.)

  17. Maailmas pole enam ühtki riski? / Jonathan Compton ; tõlk. Villu Zirnask

    Index Scriptorium Estoniae

    Compton, Jonathan

    2006-01-01

    Autori sõnul on aktsia- ja võlakirjaturud hinnanud sõjaväelist riigipööret Tais ja Põhja-Korea saamist tuumariigiks triviaalseteks ja globaalseid riske vähendavaks. Riski hind näib praegusel ajal olevat pöördvõrdelises seoses olukorraga riigis. Kindel on, et praegu on ohtlik aeg osta arenevate turgude võlakirju, osta Bulgaaria kinnisvara, riskifondide fonde, indeksifonde ja muid investeeringuid

  18. Julgus palgata puuetega inimesi annaks töökäsi / Agne Narusk

    Index Scriptorium Estoniae

    Narusk, Agne, 1971-

    2005-01-01

    AS-is Standard töötab neli puudega töömeest. Tööandjate keskliidu infojuhi Kadri Seederi hinnangul on mööda saamas aeg, mil tööandjad pelgasid puudega töötajatega kaasnevaid lisakohustusi. Lisa: Tasuta abivahendid. 2002. aasta uuringu kohaselt töötas 27% puudega inimestest. Tugiisiku abi

  19. AcEST: DK961342 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0009_N15 678 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0009_N15. 5' end seq ... 2 (63%), Gaps = 1/192 (0%) Frame = +3 Query: 102 ASAFE HLVYKTEDLSSEEKLQELFEHWLHKHGKNYSVHSQKLSRFEIFKHNLIYLH ... INQITTGNLSSLSEQELIDCDTTFNSGCNGGLMDY 207 Query: 639 AFE WVIKNRGIN 674 AF+++I G++ Sbjct: 208 AFQYIISTGGLH 21 ... SCGSCWAFSSVGAIEGAHAIATGKLVSLSEQELVSC-VSATNGCNGGLMDPAFE WVIK 659 QGSCGSCWAFS+V A+EG + I TG L +LSEQEL+ C + N ... GCNGGLMD AFE +++K Sbjct: 156 QGSCGSCWAFSTVAAVEGINKIVTGNLTTLSEQEL ...

  20. Mineralogy and Thermal Behaviour of the Kaolinitic Clay of Loutété (Congo-Brazzaville)

    OpenAIRE

    J.M. Moutou; R. Mbedi; A. Elimbi; D. Njopwouo; Yvon, J.; Barres, O.; H.R. Ntekela

    2012-01-01

    The mineralogical and chemical composition and the technological properties of the raw material used by craftsmen of Loutete, locality in the south of Congo republic, for manufacturing fired bricks were characterized. The X-ray Diffraction, IR spectroscopy, ATD, ATG and AEG were used. The Atterberg limits and the particle size distribution were measured. The linear shrinkage, the water absorption, open porosity, apparent density and flexural strength of different bodies at temperatures from 8...

  1. Prezident na bombardirovshtshike - ne sensatsija / Viktor Juzbashev

    Index Scriptorium Estoniae

    Juzbashev, Viktor

    2005-01-01

    Lääne pressis kommenteeriti Venemaa presidendi Vladimir Putini sõitu strateegilisel pommilennukil Tu-160 kui Venemaa surveavaldust naaberriikidele, samas viibivad ka teised riigijuhid aeg-ajalt sõjalistel objektidel ja taktikaõppustel. Autor küsib, kuidas Vene ja Hiina sõdurite ühisõppus saab olla tõsine hoiatus USA-le. Raketist X-555

  2. Analüütikud soovitavad Eesti Energia börsile viia / Piret Reiljan

    Index Scriptorium Estoniae

    Reiljan, Piret, 1983-

    2008-01-01

    Kohalikud analüütikud soovitavad viia Eesti Energia börsile, kuna see elavdaks aktsiaturgu ja tõmbaks ligi välisinvestoreid. Vt. samas: Raivo Vare: raske aeg töötab Eesti Energia börsiletoomise kasuks; Analüüs ootab pääsu valitsuskabinetti; Juhid ei püsi enam Eesti Energias. Diagrammid: Majandusnäitajad; Varade maht

  3. Lugusid möödunud aegadest / Andrus Kivirähk

    Index Scriptorium Estoniae

    Kivirähk, Andrus, 1970-

    2007-01-01

    Autor toob viimasel ajal loetud kirjandusteoste hulgast välja oma põnevaimad leiud: Mart Kivastik. Külmetava kunstniku portree ; Mart Kivastik. Põrgu wärk ; Mart Kivastik. Kits õnge ja viiuliga ; Galina Vishnevskaja. Aeg ja elu ; Maurice Druon. Neetud kuningad : raudne kuningas ; Maurice Druon. Neetud kuningad : kägistatud kuninganna ; Maurice Druon. Neetud kuningad : kuningavõimu mürgitajad

  4. Uudised : "Springjazz" Moskvas. 26. märtsil on Euroraadios Bachi päev. Aarne Saluveer juhib Kooriühingut / Hugo Alter

    Index Scriptorium Estoniae

    Alter, Hugo-Eduard, 1929-2003

    2000-01-01

    20. märtsil Moskvas Eesti saatkonnas toimunud jazzkontserdist "Springjazz". 26. märtsil on Euroopa Ringhäälingute Liitu (EBU) kuuluvatel raadiojaamadel eetris muusikaprogramm "Bach ja tema aeg", millega tähistatakse käesolevat Bachi aastat. 18. märtsil toimunud Eesti Kooriühingu aruande-valimiskoosolekust, kus esitati aruandeid ühingu tegevusest ja valiti juhatuse uueks esimeheks A. Saluveer

  5. Affective Music Information Retrieval

    OpenAIRE

    Wang, Ju-Chiang; Yang, Yi-Hsuan; Wang, Hsin-Min

    2015-01-01

    Much of the appeal of music lies in its power to convey emotions/moods and to evoke them in listeners. In consequence, the past decade witnessed a growing interest in modeling emotions from musical signals in the music information retrieval (MIR) community. In this article, we present a novel generative approach to music emotion modeling, with a specific focus on the valence-arousal (VA) dimension model of emotion. The presented generative model, called \\emph{acoustic emotion Gaussians} (AEG)...

  6. The Zebra Battery: a South African contender for electric vehicle application

    Directory of Open Access Journals (Sweden)

    J. Coertzer

    1996-07-01

    Full Text Available The Zebra battery is one of the most promising power sources for electric vehicles which might be on sale before the year 2000. It is a South African development which started at the CSIR and is at present jointly managed by the Anglo American Corpora­tion of S.A. and the German company A.E.G. The chemical reaction converts common salt and nickel to nickel chloride and sodium during the charging phase.

  7. Fukuyama : kõigepealt hea valitsus, siis demokraatia ja ajaloo lõpp / Francis Fukuyama ; interv. Nathan Gardels

    Index Scriptorium Estoniae

    Fukuyama, Francis

    2005-01-01

    Francis Fukuyama sõnul vajab riik oma arenguks esmajoones head valitsemist. Kõige olulisem on, et oleks toimiv riik, mis suudab tagada julgeoleku ja majandusarengu elementaarsed tingimused. Iraagi praeguste probleemide põhjus on selles, et USA ei suutnud ette näha, kuidas riik Saddami kukkudes kokku variseb, kuid tuleb mõista, et aeg-ajalt on USA ja kogu maailma huvides kusagil maailma nurgas riigi ehitamine tõsiselt ette võtta, ütleb autor

  8. Pesakastide jaoks jääb võimsust ülegi / Rakennusmaailma põhjal Ingrid Maasik

    Index Scriptorium Estoniae

    2011-01-01

    10,8- ja 12voldised akutrell-kruvikeerajad: AEG BS 12 C 2, Biltema 17-275, Black&Decker HPL106K, Bosch GSR 10,8-Li-2, DeWalt DCD710, Einhell BT-CD, Festool CXS, Festool C12Li, Hitachi DS 10 DFL, Makita DF330D, Metabo PowerMaxx 12, Milwaukee C12DD-32C, Nutool 10,8V, Panasonic EY6409

  9. "Rääkimine tõbi ..." : [luuletused] / Juku-Kalle Raid

    Index Scriptorium Estoniae

    Raid, Juku-Kalle, 1974-

    2003-01-01

    Sisu: "Rääkimine tõbi ..." ; "valge liiv on musta mere ääres ..." ; Küsimusi ilust ; Rousseau' raamatut kinkides ; "Vaikuse leht on valge ..." ; Perefilmi dekonstruktsioon ; Tsensuurivaba mõtte lugu ; "Ootan tuttavat ..." ; "Tuul ulub tumedalt ..." ; "Öösel koputavad silmadele subtiitrid ..." ; "Tajun pakast mis tõuseb kogu aeg ..." ; "Tavaline asi seinal ..." ; "Olime ikoonimaalijad ..." ; "Adrusele konarlikule külmale liivale ..." ; Vaatan margi pilti ; Aedlinn ; Staadium

  10. Kunstikonkurss "Oma silmaga" 2009. aastal / Lili Saksing

    Index Scriptorium Estoniae

    Saksing, Lili

    2009-01-01

    Kehtna Kunstide Kooli korraldatav Raplamaa laste ja noorte kunstikonkurss "Oma silmaga" toimub 2009. a. teemal "Mõttemaja". Ülesandeks on luua tasapinnaline töö, kus kujutatakse Raplamaal asuvat mõttemaja, mille töö autor on ise kavandanud ja sobitanud valitud ümbrusse. Rändnäitus 2008. a. konkursi töödest teemal "Aeg ja mina" on jõudnud Kohila Koolituskeskusesse Tohisoo mõisas

  11. Surm kevadises Tallinnas ehk Kunstnike valuline reaktsioon meie ajale / Reet Varblane

    Index Scriptorium Estoniae

    Varblane, Reet, 1952-

    2006-01-01

    Mark Soosaare näitus "Aeg" Tallinna Kunstihoone galeriis kuni 23. IV, Jaan Paavle maalinäitus "1 minut" 3.-15. IV Draakoni galeriis, Sandra Jõgeva ja Kristin Kalamehe "Leave like a Lady" Draakoni galerii keldrisaalis 4.-15. IV, Marianne Männi näitus "Paradiis" Hobusepea galeriis 5.-17. IV. Maailma positiivsemale poolusele osutab 20. IV Tallinna Linnagaleriis avatud Mari ja Kaarel Kurismaa ruumiinstallatsioon "Teine süütus"

  12. COMPARATIVE EFFECT OF AEROBICS AND RESISTANCE EXERCISES ON SELECTED PHYSIOLOGICAL VARIABLES AMONG OBESE CHILDREN

    OpenAIRE

    M. Dhanalakshmi; Grace Helina; Senthilkumar

    2015-01-01

    The aim of this study was to find out the comparative effects of aerobics and resistance exercises on selected physiological variables among obese children. To achieve the purpose, 60 Obese children, whose BMI was greater than 30 kg/m2 were randomly selected and assigned into three groups, aerobics exercises group (AEG), resistance training group (RTG) and Control group (CG) consisting of 20 in each. After assessing physiological variables, forced vital capacity and resting heart rate init...

  13. Iirimaale : [luuletused] / Percy Bysshe Shelley ; tlk. Minni Nurme, Ants, Oras

    Index Scriptorium Estoniae

    Shelley, Percy Bysshe

    2006-01-01

    Sisu: Iirimaale ; Armastuse roos ; Harrietile ; Muutlikkus ; Vangist vabanenud sõbrale ; Minevik ; Byronile ; Kaduvik ; Laul : "Maa magas, külm kui surm..." ; Hümn vaimsele ilule ; Laul : "Too aeg on läind, mu armsam, läind..." ; Ozymandias ; Sonett ; India serenaad ; Leonardo da Vinci Medusa Firenze kunstikogus ; Armu filosoofia ; Ood läänetuulele ; Mary Shelleyle ; Laul briti meestele ; Uus rahvushümn ; Inglismaa 1819. a. ; Ära madu ärata ; Head ööd! ; Pilv ; Apolloni hümn ; Paani hümn ; Lõoke ; Vabadus ; Suvi ja talv ; Maailmarändurid ; Küsimus ; Aeg, mis hajus ; Ööle ; -le : "Üht sõna on labastand suud..." ; -le : "Kui kirg kord mööduks, aga jääks..." ; Õhtu Ponte al Marel, Pisas ; Mälestus ; Muusika ; Aeg ; Põgenejad ; Ma olla kuningas ei tahaks ; "Homne päev, kus oled praegu..." ; "Laps rahus kord on emaihus..." ; Üksik lind ; "Kui lamp pihuks langend..." ; Epitaaf ; Kutse Janeþile ; Tähed vilkusid valgust ; Leinalaul ; Pühendus. Eluloolisi andmeid autori kohta lk. 389

  14. Assessment of non-invasive time and frequency atrial fibrillation organization markers with unipolar atrial electrograms

    International Nuclear Information System (INIS)

    The standard electrocardiogram (ECG) is the most common non-invasive way to study atrial fibrillation (AF). In this respect, previous works have shown that the surface lead V1 reflects mainly the dominant atrial frequency (DAF) of the right atrium (RA), which has been widely used to study AF. In a similar way, AF organization and fibrillatory (f) wave amplitude are two recently proposed non-invasive AF markers. These markers need to be validated with invasive recordings in order to assess their capability to reliably reflect the internal fibrillatory activity dynamics. In this work, these two non-invasive metrics have been compared with similar measures recorded from two unipolar atrial electrograms (AEGs). For both ECG and AEG signals, AF organization has been computed by applying a nonlinear regularity index, such as sample entropy (SampEn), to the atrial activity (AA) and to its fundamental waveform, defined as the main atrial wave (MAW). The surface and epicardial f wave amplitude has been estimated through their mean power. Results obtained for 38 patients showed statistically significant correlations between the values measured from surface and invasive recordings, thus corroborating the usefulness of the aforesaid markers in the non-invasive study of AF. Precisely, for AF organization computed from the MAW, the correlation coefficients between surface and both AEGs were R = 0.926 (p < 0.001) and R = 0.932 (p < 0.001). For f wave amplitude, slightly lower significant relationships were noticed, the correlation coefficients being R = 0.765 (p < 0.001) and R = 0.842 (p < 0.001). These outcomes together with interesting linear relationships found among the parameters suggest that AF regularity estimated via SampEn and f wave amplitude can non-invasively characterize the epicardial activity related to AF

  15. Meie kobar PÖFFi peamises põõsas / Tarmo Teder

    Index Scriptorium Estoniae

    Teder, Tarmo, 1958-

    2007-01-01

    Pimedate Ööde Filmifestivalist, Eesti filmide võistlusprogrammist, mille auhinna rahastajaks on Scottish Leader Eesti. Konkurssprogrammis on 12 täispikka filmi: "Sügisball" (rezh. Veiko Õunpuu), "Nuga" (rezh. Marko Raat), "Dirigendi kõla" (rezh. Helle Karis, Peter Murdmaa), "Vastutuulesaal" (rezh. Priit Valkna), "Klass" (rezh. Ilmar Raag), "Kuhu põgenevad hinged" (rezh. Rainer Sarnet), "Tervitusi Nõukogude Eestist!" (rezh. Urmas Eero Liiv), "Jonathan Austraaliast" (rezh. Sulev Keedus), "Georg" (rezh. Peeter Simm), "Debora Vaarandi aeg" (rezh. Katrin Laur), "Jan Uuspõld läheb Tartusse" (rezh. Andres Maimik, Rain Tolk), "Põdra kuningriik" (rezh. Rein Maran)

  16. Trumbid on Keskerakonna käes / Andrus Villem

    Index Scriptorium Estoniae

    Villem, Andrus

    2004-01-01

    Ilmunud ka: Elva Postipoiss, 4. dets. 2004, lk. 4; Lääne Elu, 7. dets. 2004, lk. 2; Järva Teataja, 7. dets. 2004, lk. 2; Harjumaa, 7. dets. 2004, lk. 2; Vooremaa, 7. dets. 2004, lk. 2; Koit, 7. dets. 2004, lk. 6; Pärnu Postimees, 8. dets. 2004, lk. 15; Sakala, 8. dets. 2004, lk. 2; Hiiu Leht, 10. dets. 2004, lk. 2; Kesknädal, 15. dets. 2004, lk. 11. Autor leiab, et praeguse koosseisuga koalitsiooni aeg on läbi ning hetkel on Keskerakond parimas olukorras

  17. Nõukogude postmodernism = Soviet postmodernism / Ants Juske

    Index Scriptorium Estoniae

    Juske, Ants, 1956-

    2010-01-01

    Analüüsitakse, kuidas ja milliseid teid pidi igasugused "-ismid" jõudsid läbi raudse eesriide Ida-Euroopa maadesse. Esimestena haakusid postmodernismiga avangardistlikud arhitektid, seejärel toimusid nihked ka kujutavas kunstis, kunstiteaduses ja -kriitikas. Nõukogude aeg jättis jälje meie kunstile, kuid see "nõukogude" on rohkem iroonilises võtmes mõistetud, sisaldades alltekste - kas tegemist on šedöövriga või kunstnik lihtsalt lollitab - ja "nõukogude postmodernism" on seetõttu läänele raskesti mõistetav

  18. Retraso del crecimiento extrauterino en recién nacidos prematuros y su relación con factores de riesgo cardiovascular a los 2 años de edad corregida: papel de la leptina, adiponectina, perfil lipídico y adiposidad

    OpenAIRE

    Salvador Iglesias, Miriam

    2016-01-01

    La desnutrición extrauterina es un hecho frecuente entre la población de recién nacidos prematuros y no está claro si ésta acarrea un mayor riesgo de complicaciones metabólicas futuras. OBJETIVOS: Evaluar si existen diferencias en las concentraciones de adiponectina y leptina a los 2 años de edad corregida (EC) entre recién nacidos prematuros (RNPT) de 32 semanas o menos que nacen con un peso adecuado a la edad gestacional (AEG) y sufren una restricción del crecimiento extrauterino (RCEU) a l...

  19. Kraftwerk Union A.G. and its service system

    International Nuclear Information System (INIS)

    The organizational structure and the main fields of activities of the Kraftwerk Union A.G.,FRG,were presented at the KWU meeting, Budapest, 1984. KWU which has 14.000 employees and an annual turnover of about 3.4 billion DM, was founded as an affiliate company of Siemens AG and AEG in 1969. 70 fossile-fuel and 16 nuclear power plants have been designed, constructed and commissioned by KWU. The well-organized service system and the service centre at Karlstein contribute significantly to the high availability of the nuclear power plants. (V.N.)

  20. Värsse / Rudolf Rimmel

    Index Scriptorium Estoniae

    Rimmel, Rudolf, 1937-2003

    2008-01-01

    Sisu: "Elan Eestis ja selge on see..." ; "Eesti Vabariigi ajaloo lisana..." ; "ma ütlen lause Eesti vabaduse hinnast..." ; "Õiglust ja kõlblust üksainuski sõõm..." ; "Euroopa Liit on rahvuste kalmistu..." ; "meie jalge alt müüakse maad...." ; "teab setu ja soomegi hõim..." ; "poliitikas ei ole Eestis diletante..." ; "Pean salmi looma ma..." ; "Kord tuleb aeg, kui mõtte kaotab seadus..." ; "äriideid - olen päri..." ; "vanapapi kallis eestiaegses kukrus..." ; "sul häbelikkust olgu kasvõi raas..." ; "Hea lahe Eesti Vabariik on lukuta...". Rudolf Rimmeli seniavaldamata luulet saatis Kesknädalale Malle Rimmel

  1. RHEOLOGICAL BEHAVIOUR OF PSYLLIUM GUM FRACTIONS

    Directory of Open Access Journals (Sweden)

    Mohammad Hojjatoleslamyi

    2013-10-01

    Full Text Available Psyllium (Plantago psyllium is a native plant that grows widely in India, Iran and Pinjab. Studies showed psyllium gum has good rheological properties for using in wide range of food products. In this study, different fractions of psyllium gum extracted by water and alkali treatment. Rheological properties of these fractions determined by Brookfield rheometer (RV DVIII. Obtained data fitted in three temperatures 30, 60 and 80°C by Herschel-bulkly rheological model. Results showed that fractions have different behaviour during heating treatment. The most difference observed in AEG0.5 fraction.

  2. Kas tegeleda uue töölepinguseadusega või mitte? / Väino Linde

    Index Scriptorium Estoniae

    Linde, Väino, 1959-

    2008-01-01

    Töölepingu seaduse eelnõust, kehtiva töölepingu puudustest ning kompromissi vajalikkusest. Ilmunud ka Sakala 23. jaan. 2008, lk. 2, pealkiri kujul: aeg otsida kompromisse ; Vali Uudised 23. jaan. 2008, lk. 2 ; Põhjarannik 22. jaan. 2008, lk. 4 ; Meie Maa 23. jaan. 2008, lk. 2 ; Hiiu Leht 25. jaan. 2008, lk. 2 ; Vooremaa 24. jaan. 2008, lk. 2 ; Võrumaa Teataja 24. jaan. 2008, lk. 2 ; Pärnu Postimees 25. jaan. 2008, lk. 15 ; Lääne Elu 26. jaan. 2008, lk. 2, Virumaa Teataja 29. jaan. 2008, lk. 11

  3. Balti põgenike problemaatika USA poliitikas 1945-1952 / Kaja Kumer-Haukanõmm

    Index Scriptorium Estoniae

    Kumer-Haukanõmm, Kaja

    2007-01-01

    Teise maailmasõja järel lähtus enamik riike pagulaste kohta käivate otsuste langetamisel USA tegevusest. Sõjapõgenike küsimusega tegelenud organisatsioonidest. Perioodi jooksul toimunud muutustest põgenikelaagrites viibinute suhtes. Keeruline aeg Balti riikide pagulaste jaoks oli 1946. aasta ja 1947. aasta esimene pool. Tõenäoliselt ei abistanud USA balti põgenikke ainult humanistlikel kaalutlustel, vaid neid kasutati külma sõja algul Nõukogude Liiduga suheldes sageli manipuleerimisvahendina

  4. Arhitektuuriaasta 2004 = The year in architecture 2004 / Epp Lankots

    Index Scriptorium Estoniae

    Lankots, Epp, 1976-

    2005-01-01

    Arhitektuuriauhindade nominentidest ja premeeritutest. Eesti Kultuurkapitali aastapreemia sai Toomas Rank Rägavere mõisa renoveerimise eest. Arhitektuuri sihtkapitali renoveerimispreemia - Mari Kurismaa, Eesti Draamateatri interjööride renoveerimine; objektipreemia - Martin Aunin, Ülemiste hotell; interjööripreemia - Jan Joonas Graps, Ken-Kristjan Ruut, "Jungenti" büroo; arhitektuurse tegevuse preemia - Kristjan Holm, Liina Jänes, Agu Külm, Jukka-Pekka Jalovaara, Pille Epner, Madis Jürgen, Tõnu Kaalep, Ingmar Muusikus, Eesti ekspositsioon "Aeg-maha-arhitektuur" Veneetsia arhitektuuribiennaalil

  5. 17. X avati XIV rahvusvaheline Tallinna graafikatriennaal, seekord ülddeviisi "Poliitiline/Poeetiline" all / Eve Kask

    Index Scriptorium Estoniae

    Kask, Eve

    2007-01-01

    Tallinna XIV graafikatriennaalist (Anders Kreugeri koostatud näitus "1987. Baltimaade graafika ja plakatid nõukogude aja viimasest kümnendist" ja põhinäitus "Poliitiline/Poeetiline" Kumu Kunstimuuseumis, Anders Härmi kuraatorinäitus "Poliitiline/Poeetiline" Tallinna Kunstihoones ja selle galeriis, Egle Kuckaite isikunäitus Tallinna Linnagaleriis, triennaali paneel Kadrioru Kunstimuuseumis). Triennaali peaauhinna sai Oscar Munos. Triennaaliga samaaegselt Tallinnas toimuvast rahvusvahelisest graafikakonverentsist "Impact 5" teemal "Lõigatud aeg", mille raames on avatud graafikanäitused

  6. Tallinn ja Moskva austagu teineteist / Terry Davis

    Index Scriptorium Estoniae

    Davis, Terry

    2007-01-01

    Ilmunud ka: Molodjozh Estonii, 8. mai 2007, lk. 4; Postimees : na russkom jazõke, 9. mai 2007, lk. 9. Euroopa Nõukogu peasekretär mõistab hukka vandalismi ja rüüstamise Tallinna ja Moskva tänavatel Teise maailmasõja mälestusmärgi teisaldamise pärast ning ütleb, et on aeg käituda väärikalt nii teineteise kui mineviku suhtes, kuigi see võib olla vastuoluline

  7. "Ostanovimsja na mig v tishine..." : [luuletused] / Ene Mihkelson ; lühibiograafia: T. L. [Toomas Liiv

    Index Scriptorium Estoniae

    Mihkelson, Ene, 1944-

    1999-01-01

    Sisu: "Ostanovimsja na mig v tishine..." / tlk. V. Fadin ; Rekviem / tlk. Marju Lauristin ; "Dom eto tolko godõ..." ; "Dvoje bezumtsev mezh nimi treti..." ; "Eva v Tapa zhivjot / tlk. Boris Tuch ; "Ljagushka prõgnula skvoz lezvije kossõ..." ; "Vse stantsii peremeshtshalis..." ; "Dõb iz trub stekajet..." ; "Vremja neuklonno i surovo..." / tlk. M. Korol ; Pjat tshassov kogda snega net / tlk. Jelena Salkova. Orig.: Reekviem ; "Konn hüppas vikatist läbi..." ; "Kõik jaamad segunesid Valisime keeli..." ; "Suits sajab korstnaist maha..." ; "Aeg on karm ja ühepoolne Meid..."; Kell viis kui pole lund

  8. "Möödapääsmatust hädast sunnituna otsustanud ja nõustunud meid Poola Kuninglikule Majesteedile truualamlikuks teha" : Liivimaaseisuste alistumine Poola võimule 1561. aasta sügisel / Enn Tarvel

    Index Scriptorium Estoniae

    Tarvel, Enn, 1932-

    2011-01-01

    Poola-Leedu huvist ja tegevusest Liivimaa suhtes enne 1561. aastat, mil Rootsi aktiivne sekkumine Põhja-Eestis muutis otsustavamaks ka Poola-Leedu sekkumise Liivimaal. 1561. aasta sügisel pidas ordumeister Kettler poolakatega salaläbirääkimisi ja otsustas alistuda. 28. novembril 1561 andsid ordumeister, Riia peapiiskop, orduaadli ning Võnnu ja Volmari linna esindajad truudusvande Sigismund II Augustile. Tegelik Poola aeg algas Eestis 1582 ja kestis 1625. aastani. Dokument: Poola kuninga Sigismund Augusti ja ordumeister Gotthardi vahel sõlmitud alistumisleping. Vilniuses 28. novembril 1561("Pacta subjectionis")

  9. Ajaloo läbistav valgus / Andri Ksenofontov

    Index Scriptorium Estoniae

    Ksenofontov, Andri, 1962-

    2010-01-01

    Vano Allsalu näitus "Süütuse aeg" Tallinnas Hobusepea galeriis 22.09.-4.10. 2010. Franyó Aatothi (István Ferenc Tóth) näitus Ungari Instituudis 15. oktoobrini 2010. Monika Žaltauskaitė-Grašienė, Severija Inčirauskaitė-Kriaunevičienė ja Monika Järg'i näitus "Side minevikust / Connected with the past" Tallinnas galeriis Hop 10.-28. septembrini 2010

  10. Comparison of advanced high power underground cable designs

    International Nuclear Information System (INIS)

    In this paper, advanced high power underground cable designs are compared in the light of available literature, of reports and information supplied by participating industries (AEG, BICC, CGE, Pirelli, Siemens), spontaneous contributions by EdF, France, BBC and Felten and Guilleaume Kabelwerke A.G., Germany, and Hitachi, Furukawa, Fujikura and Sumitomo, Japan, and earlier studies carried out at German public research centres. The study covers cables with forced cooling by oil or water, SF6-cables, polyethylene cables, cryoresistive and superconducting cables. (orig.)

  11. 1st February 2011-CERN Cultural Board for Engaging with the Arts, visiting CMS experimental area and LHC Tunnel at Point 5

    CERN Multimedia

    Michael Hoch

    2011-01-01

    Photo 1-4: Visit to CMS Control Room with G. Tonelli,CMS Collaboration Spokesperson Photo 5-9,16-20:CMS experimental area Photo 10-15:LHC Tunnel at Point 5 Photo 21:F. Madlener,Director of IRCAM Paris+S. Dorny,Director-General Lyon Opera House+C. Bollman,Art by Genève+M. Doser,AEgIS Collaboration Spokesperson,Former Physics Department Deputy Head+A. Koek,International Arts Development+G. Tonelli+M. Monje Cano,Arts Development Assistant (part-time work experience)+B. Ruf,Director of Kunsthalle Zürich

  12. Convenient and scalable synthesis of fmoc-protected Peptide nucleic Acid backbone.

    Science.gov (United States)

    Feagin, Trevor A; Shah, Nirmal I; Heemstra, Jennifer M

    2012-01-01

    The peptide nucleic acid backbone Fmoc-AEG-OBn has been synthesized via a scalable and cost-effective route. Ethylenediamine is mono-Boc protected, then alkylated with benzyl bromoacetate. The Boc group is removed and replaced with an Fmoc group. The synthesis was performed starting with 50 g of Boc anhydride to give 31 g of product in 32% overall yield. The Fmoc-protected PNA backbone is a key intermediate in the synthesis of nucleobase-modified PNA monomers. Thus, improved access to this molecule is anticipated to facilitate future investigations into the chemical properties and applications of nucleobase-modified PNA. PMID:22848796

  13. Convenient and Scalable Synthesis of Fmoc-Protected Peptide Nucleic Acid Backbone

    OpenAIRE

    Feagin, Trevor A.; Shah, Nirmal I.; Heemstra, Jennifer M.

    2012-01-01

    The peptide nucleic acid backbone Fmoc-AEG-OBn has been synthesized via a scalable and cost-effective route. Ethylenediamine is mono-Boc protected, then alkylated with benzyl bromoacetate. The Boc group is removed and replaced with an Fmoc group. The synthesis was performed starting with 50 g of Boc anhydride to give 31 g of product in 32% overall yield. The Fmoc-protected PNA backbone is a key intermediate in the synthesis of nucleobase-modified PNA monomers. Thus, improved access to this mo...

  14. Obrashtshonnoje mgnovenije : [luuletused] / Artur Alliksaar ; lühibiograafia: A. K. [Ain Kaalep

    Index Scriptorium Estoniae

    Alliksaar, Artur, 1923-1966

    1999-01-01

    Sisu: Obrashtshonnoje mgnovenije ; Beda prihhodit moltsha, zovjot li, uhhodja? ; Vspõshka / tlk. G. Kirillov ; Vremja ; Avtoportret ; Nebõtija moglo bõ i ne bõt ; Govorju slova tebe, smert, velikomu bezmolviju i sebe samomu ; Gde-to za rekoi vremeni / tlk. Svetlan Semenenko. Orig.: Õnnetus ei hüüa tulles, aga kas ta minnes hüüab? ; Välkvisioon ; Aeg ; Autoportree ; Olematus võiks ju ka olemata olla ; Sõnad sinule, surm, suurele vaikusele ja iseendale ; Kuskil ajajõe taga

  15. Electron ray facilities for the pasteurization of sewage sludges

    International Nuclear Information System (INIS)

    Growing industrialization and the simultaneous increase in population density demand broad preventive measures in the area of waste water and sewage sludges. Electron irradiation is becoming an important tool for disinfection in this field. The AEG-Telefunken sludge pasteurization process works in continuous operation with homogenized sludge at electron energies between 1,0 to 1,5 MeV and a radiation dosage of 4 kJ/kg. The system offers the capabilities for an effective and costadvantageous disinfection of waste sludges of differing consistencies and origins and their harmless reuse as fertilizer in agriculture. (orig.)

  16. AcEST: DK955623 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0023_J15 606 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0023_J15. 5' end seq ... AMEERLQHAEQKQVQMMGFLARAMQNPDFF 214 Query: 543 PQLAHKRI HAEGFNGT 590 QL H++ +G T Sbjct: 215 HQLIHQQDKMKGLED ... AMEERISAAEQKQQQMTVFLARAMK 236 Query: 528 NSDFFPQLAHKRI HAEG 578 N F L ++ G Sbjct: 237 NPGFLQMLVDRQAGQHG 25 ... QGMELRQQQMMSF 222 Query: 510 LARALQNSDFFPQL------AHKRI HAEGFNGTKVQQ 602 LA+A+ F Q ++KRI ... AEG +++Q Sbjct: 22 ... 3 LAKAVNRPGFLAQFVQQQNESNKRI -AEGSKKRRIKQ 258 >sp|Q9LQM7|HFA1D_ARATH Heat stress ...

  17. Kinoelamus muutub kolmemõõtmeliseks / Jaanus Noormets

    Index Scriptorium Estoniae

    Noormets, Jaanus

    2008-01-01

    Sellest nädalast näidatakse Tallinnas Coca Cola Plazas tänu uuele erilisele tehnoloogiale ka kolmemõõtmelisi filme (3D-filme): detsembris 2008 - "Reis maakera südamesse" ("Journey to the Centre of the Earth"); jaanuaris 2009 - "Välk" ("Bolt"), märts 2009: "My Bloody Valentine"; aprillis 2009 - "Koletised tulnukate vastu" ("Monsters vs. Aliens") ; kevadel 2009 - "Coraline" ; juulis 2009 - "Jääaeg 3". Sellest reedest alates näidatakse kobarkinos 3D-animafilmi "Kärbsed Kuu peale" ja muusikafilmi "U2 3D"

  18. AcEST: DK954204 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0019_N05 606 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0019_N05. 5' end seq ... MCGSCWAFSATGAIEGANAVATGNLVSVSEEELVTC--SSESGCDGGLMDDAFE WVIDNG 538 CGSCWAFS GA+EG N + TG+L+++SE+ELV C S GC+ ... GGLMD AFE ++I NG Sbjct: 157 GCGSCWAFSTIGAVEGINQIVTGDLITLSEQEL ... VDCDTSYNEGCNGGLMDYAFE FIIKNG 216 Query: 539 GIATEDNYPY 568 GI T+ +YPY Sbj ... MCGSCWAFSATGAIEGANAVATGNLVSVSEEELVTCSS--ESGCDGGLMDDAFE WVIDNG 538 CGSCWAFS A+EG N + TGNL S+SE+EL+ C + SGC+ ...

  19. AcEST: DK954346 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0020_D05 628 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0020_D05. 5' end seq ... ry: 362 SATGAIEGANAVATGNLVSVSEEELVTC--SSESGCDGGLMDDAFE WVIDNGGIATEDNY 535 S GA+EG N + TG+L+++SE+ELV C S GC ... +GGLMD AFE ++I NGGI T+ +Y Sbjct: 165 STIGAVEGINQIVTGDLITLSEQEL ... VDCDTSYNEGCNGGLMDYAFE FIIKNGGIDTDKDY 224 Query: 536 PYLSYSGSSGACDTKIEEEEK ... 353 WAFSATGAIEGANAVATGNLVSVSEEELVTCSS--ESGCDGGLMDDAFE WVIDNGGIATE 526 WAFS A+EG N + TGNL S+SE+EL+ C + SGC ...

  20. AcEST: DK960157 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0006_K11 652 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0006_K11. 5' end seq ... 85 (63%), Gaps = 1/185 (0%) Frame = +3 Query: 99 ASAFE HLVYKTEDLSSEEKLQELFEHWLHKHGKNYSVHSQKLSRFEIFKHNLIYLH ... INQITTGNLSSLSEQELIDCDTTFNSGCNGGLMDY 207 Query: 636 AFE WV 650 AF+++ Sbjct: 208 AFQYI 212 >sp|Q9LM66|XCP2_A ... SCGSCWAFSSVGAIEGAHAIATGKLVSLSEQELVSC-VSATNGCNGGLMDPAFE WV 650 QGSCGSCWAFS+V A+EG + I TG L +LSEQEL+ C + NGC ... NGGLMD AFE ++ Sbjct: 156 QGSCGSCWAFSTVAAVEGINKIVTGNLTTLSEQELID ...

  1. AcEST: BP919829 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_F04 569 Adiantum capillus-veneris mRNA. clone: YMU001_000129_F04. BP919829 - Show ... FAREGYSVVILARTYEKLARLVVQLMALERTAHVSAISIDCSDP--QSVHDAFE SVS 331 A A+EG ++ ++ RT + ++ ++ AL A +A + +D Q+V E ... RRFAREGYSVVILARTYEKLARLVVQLMALERTAHVSAISIDCSDPQSVHDAFE SVSSI 325 A + AR+GY++++++R+ KL+ + ++ + +S+D S+ + +E ... RRFAREGYSVVILARTYEKLARLVVQLMALERTAHVSAISIDCSDPQSVHDAFE SVSSI 325 A + AR GY++V+++RT KL L +L + + +++D + Q D ... AREGYSVVILARTYEKL--ARLVVQLMALERTAHVSAISIDCS-DPQSVHDAFE S 337 IA ++G + ++AR +KL A+ +++ ++ V IS+D S D V + + ...

  2. AcEST: DK958883 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0003_D01 657 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0003_D01. 5' end seq ... 5 (63%), Gaps = 1/185 (0%) Frame = +1 Query: 106 ASAFE HLVYKTEDLSSEEKLQELFEHWLHKHGKNYSVHSQKLSRFEIFKHNLIYLH ... INQITTGNLSSLSEQELIDCDTTFNSGCNGGLMDY 207 Query: 643 AFE WV 657 AF+++ Sbjct: 208 AFQYI 212 >sp|Q9LM66|XCP2_A ... SCGSCWAFSSVGAIEGAHAIATGKLVSLSEQELVSC-VSATNGCNGGLMDPAFE WV 657 QGSCGSCWAFS+V A+EG + I TG L +LSEQEL+ C + NGC ... NGGLMD AFE ++ Sbjct: 156 QGSCGSCWAFSTVAAVEGINKIVTGNLTTLSEQELID ...

  3. Skype tuleb arvutist välja / Erik Aru

    Index Scriptorium Estoniae

    Aru, Erik

    2006-01-01

    Müügile tulevad telefonid ja telefoniadapterid, millega saab Skype'i teel helistada. Skype sõlmis koostöölepingu Briti mobiiltelefonioperaatoriga 3, mis opereerib 3G-võrkudega. Skype Technologies OÜ tegevjuhi Sten Tamkivi kommentaare. EMT laiendab oma 3G-võrku, alanud on ehitus 3G-võrgu rajamiseks Tartusse. Lisad: Vonage pürib börsile; Pojuke, misse skaip on? Hurraa-optimismi aeg internetiäris möödumas?

  4. Naiskunstnike invasioon : juhus või paratamatus? / Reet Varblane

    Index Scriptorium Estoniae

    Varblane, Reet, 1952-

    2006-01-01

    Christel Alliku lillemaalid Draakoni galeriis kuni 4. III; Nelly Drelli maalinäitus "Taassünd" Viviann Napa galeriis kuni 15. III; Silva Eheri maalinäitus "Midagi ei toimu" G-galeriis kuni 4. III; Jarõna Ilo joonistused "(Aasta)aeg" Hausis kuni 3. III; Kristiina Kaasiku maalinäitus "Ad astra" Ühispanga galeriis kuni 3. III; Krista Möldri "Proloog maamärkidele" Deco galeriis kuni 4. III; Eveli Variku "Sünnimärgid" Tallinna raekoja fotokeldris "Lee" kuni 6. III; Kadri Alesmaa ja Jaak Visnapi "Disainitud kunst. Kõik müügiks" Tallinna Linnagaleriis kuni 5. III

  5. Eesti Teadusfondi preemia Astrid Haljasele ja Tõnu Laasile

    Index Scriptorium Estoniae

    2000-01-01

    Eesti Teadusfondi täppisteaduste ekspertkomisjoni poolt korraldatud magistrantide ja doktorantide teadustööde konkursil määrati preemia 4000 krooni loodusteaduste osakonna teadurile Astrid Haljasele artikli Mankin, R., Ainsaar, A., Haljas, A. Trichotomous-noise-induced phase transitions for the stochastic Hongler model. Proc. Estonian Acad. Sci. Phys. Math., 2000, 49, 1, 28-39 eest. Loodusteaduste osakonna assistendile, TPÜ doktorandile Tõnu Laasile määrati preemia 7000 krooni artiklite sarja Lainete levik kõveras aeg-ruumis eest : [täistekst

  6. Short Outlines of Books by Estonian authors / Rutt Hinrikus

    Index Scriptorium Estoniae

    Hinrikus, Rutt, 1946-

    2007-01-01

    Tutvustus: Miljutina, Tamara. Inimesed minu elus. Tallinn : Varrak, 2007 ; Soosaar, Enn. Isa ja aeg. Tallinn : Kultuurileht, 2007. (Loomingu Raamatukogu ; 5) ; Paju, Imbi. Tõrjutud mälestused. Tallinn : Eesti Entsüklopeediakirjastus, 2007 ; Kaplinski, Jaan. Seesama jõgi. Tallinn : Vagabund, 2007 ; Laanem, Tiina. Väikesed vanamehed. Tallinn : Eesti Päevalehe Kirjastus, 2007 ; Vaarandi, Debora. Aastad ja päevad. Tallinn : Tänapäev, 2006 ; Berg, Maimu. Unustatud inimesed. Tallinn : Tuum, 2007 ; Heinsaar, Mehis. Rändaja õnn. Tallinn : Verb, 2007

  7. Suvi tulvil festivale

    Index Scriptorium Estoniae

    2005-01-01

    Suvel toimuvate musikafestivalide tutvustus: Eduard Tubin ja tema aeg (muusikafestival), Pärnu rahvusvaheline ooperimuusika festival 2005, Juu Jääb 2005 (retromuusikafestival), Suure-Jaani muusikapäevad 2005, Mravinski Festival 2005, Seitsme linna muusika 2005, Hiiumaa kammermuusikapäevad 2005, Saaremaa suvemuusikafestival 2005, David Oistrahhi festival 2005, Klaaspärlimäng (festival) 2005, Rapla kirikumuusika XIII festival 2005, Kuressaare ooperipäevad 2005, Pärnu ooperipäevad 2005, Tallinna XIX orelifestival, Haapsalu XII viiulimängud 2005, Viljandi vanamuusikafestival 2005, Kuressaare kammermuusikapäevad 2005, Haapsalu vanamuusikafestival 2005, Võru Muusikapäevad 2005

  8. A pathogenesis related-10 protein CaARP functions as aldo/keto reductase to scavenge cytotoxic aldehydes.

    Science.gov (United States)

    Jain, Deepti; Khandal, Hitaishi; Khurana, Jitendra Paul; Chattopadhyay, Debasis

    2016-01-01

    Pathogenesis related-10 (PR-10) proteins are present as multigene family in most of the higher plants. The role of PR-10 proteins in plant is poorly understood. A sequence analysis revealed that a large number of PR-10 proteins possess conserved motifs found in aldo/keto reductases (AKRs) of yeast and fungi. We took three PR-10 proteins, CaARP from chickpea, ABR17 from pea and the major pollen allergen Bet v1 from silver birch as examples and showed that these purified recombinant proteins possessed AKR activity using various cytotoxic aldehydes including methylglyoxal and malondialdehyde as substrates and the reduced form of nicotinamide adenine dinucleotide phosphate (NADPH) as co-factor. Essential amino acids for this catalytic activity were identified by substitution with other amino acids. CaARP was able to discriminate between the reduced and oxidized forms of NADP independently of its catalytic activity and underwent structural change upon binding with NADPH. CaARP protein was preferentially localized in cytosol. When expressed in bacteria, yeast or plant, catalytically active variants of CaARP conferred tolerance to salinity, oxidative stress or cytotoxic aldehydes. CaARP-expressing plants showed lower lipid peroxidation product content in presence or absence of stress suggesting that the protein functions as a scavenger of cytotoxic aldehydes produced by metabolism and lipid peroxidation. Our result proposes a new biochemical property of a PR-10 protein. PMID:26577640

  9. Structure-based analysis of thermodynamic and mechanical properties of cavity-containing proteins--case study of plant pathogenesis-related proteins of class 10.

    Science.gov (United States)

    Chwastyk, Mateusz; Jaskolski, Mariusz; Cieplak, Marek

    2014-01-01

    We provide theoretical comparisons of the physical properties of eighteen proteins with the pathogenesis-related proteins of class 10 (PR-10) fold, which is characterized by a large hydrophobic cavity enclosed between a curved β-sheet and a variable α-helix. Our novel algorithm to calculate the volume of internal cavities within protein structures is used to demonstrate that, although the sizes of the cavities of the investigated PR-10 proteins vary significantly, their other physical properties, such as thermodynamic and mechanical parameters or parameters related to folding, are very close. The largest variations (in the order of 20%) are predicted for the optimal folding times. We show that, on squeezing, the PR-10 proteins behave differently from typical virus capsids. PMID:24206126

  10. Development of new treatment approaches for epilepsy: unmet needs and opportunities.

    Science.gov (United States)

    French, Jacqueline A; White, H Steve; Klitgaard, Henrik; Holmes, Gregory L; Privitera, Michael D; Cole, Andrew J; Quay, Ellinor; Wiebe, Samuel; Schmidt, Dieter; Porter, Roger J; Arzimanoglou, Alexis; Trinka, Eugen; Perucca, Emilio

    2013-08-01

    A working group was created to address clinical "gaps to care" as well as opportunities for development of new treatment approaches for epilepsy. The working group primarily comprised clinicians, trialists, and pharmacologists. The group identified a need for better animal models for both efficacy and tolerability, and noted that animal models for potential disease-modifying or antiepileptogenic effect should mirror conditions in human trials. For antiseizure drugs (ASDs), current animal models have not been validated with respect to their relationship to efficacy in common epilepsy syndromes. The group performed an "expert opinion" survey of perceived efficacy of the available ASDs, and identified a specific unmet need for ASDs to treat tonic-atonic and myoclonic seizures. No correlation has as yet been demonstrated between animal models of tolerability and adverse effects (AEs), versus tolerability in humans. There is a clear opportunity for improved therapies in relation to dose-related AEs. The group identified common and rare epilepsy syndromes that could represent opportunities for clinical trials. They identified opportunities for antiepileptogenic (AEG) therapies in both adults and children, acknowledging that the presence of a biomarker would substantially improve the chances of a successful trial. However, the group acknowledged that disease-modifying therapies (given after the first seizure or after the development of epilepsy) would be easier to study than AEG therapies. PMID:23909849

  11. Side chain modified peptide nucleic acids (PNA for knock-down of six3 in medaka embryos

    Directory of Open Access Journals (Sweden)

    Dorn Sebastian

    2012-08-01

    Full Text Available Abstract Background Synthetic antisense molecules have an enormous potential for therapeutic applications in humans. The major aim of such strategies is to specifically interfere with gene function, thus modulating cellular pathways according to the therapeutic demands. Among the molecules which can block mRNA function in a sequence specific manner are peptide nucleic acids (PNA. They are highly stable and efficiently and selectively interact with RNA. However, some properties of non-modified aminoethyl glycine PNAs (aegPNA hamper their in vivo applications. Results We generated new backbone modifications of PNAs, which exhibit more hydrophilic properties. When we examined the activity and specificity of these novel phosphonic ester PNAs (pePNA molecules in medaka (Oryzias latipes embryos, high solubility and selective binding to mRNA was observed. In particular, mixing of the novel components with aegPNA components resulted in mixed PNAs with superior properties. Injection of mixed PNAs directed against the medaka six3 gene, which is important for eye and brain development, resulted in specific six3 phenotypes. Conclusions PNAs are well established as powerful antisense molecules. Modification of the backbone with phosphonic ester side chains further improves their properties and allows the efficient knock down of a single gene in fish embryos.

  12. Detection of Cyanotoxins, β-N-methylamino-L-alanine and Microcystins, from a Lake Surrounded by Cases of Amyotrophic Lateral Sclerosis

    Directory of Open Access Journals (Sweden)

    Sandra Anne Banack

    2015-01-01

    Full Text Available A cluster of amyotrophic lateral sclerosis (ALS has been previously described to border Lake Mascoma in Enfield, NH, with an incidence of ALS approximating 25 times expected. We hypothesize a possible association with cyanobacterial blooms that can produce β-N-methylamino-L-alanine (BMAA, a neurotoxic amino acid implicated as a possible cause of ALS/PDC in Guam. Muscle, liver, and brain tissue samples from a Lake Mascoma carp, as well as filtered aerosol samples, were analyzed for microcystins (MC, free and protein-bound BMAA, and the BMAA isomers 2,4-diaminobutyric acid (DAB and N-(2-aminoethylglycine (AEG. In carp brain, BMAA and DAB concentrations were 0.043 μg/g ± 0.02 SD and 0.01 μg/g ± 0.002 SD respectively. In carp liver and muscle, the BMAA concentrations were 1.28 μg/g and 1.27 μg/g respectively, and DAB was not detected. BMAA was detected in the air filters, as were the isomers DAB and AEG. These results demonstrate that a putative cause for ALS, BMAA, exists in an environment that has a documented cluster of ALS. Although cause and effect have not been demonstrated, our observations and measurements strengthen the association.

  13. Detection of cyanotoxins, β-N-methylamino-L-alanine and microcystins, from a lake surrounded by cases of amyotrophic lateral sclerosis.

    Science.gov (United States)

    Banack, Sandra Anne; Caller, Tracie; Henegan, Patricia; Haney, James; Murby, Amanda; Metcalf, James S; Powell, James; Cox, Paul Alan; Stommel, Elijah

    2015-02-01

    A cluster of amyotrophic lateral sclerosis (ALS) has been previously described to border Lake Mascoma in Enfield, NH, with an incidence of ALS approximating 25 times expected. We hypothesize a possible association with cyanobacterial blooms that can produce β-N-methylamino-L-alanine (BMAA), a neurotoxic amino acid implicated as a possible cause of ALS/PDC in Guam. Muscle, liver, and brain tissue samples from a Lake Mascoma carp, as well as filtered aerosol samples, were analyzed for microcystins (MC), free and protein-bound BMAA, and the BMAA isomers 2,4-diaminobutyric acid (DAB) and N-(2-aminoethyl)glycine (AEG). In carp brain, BMAA and DAB concentrations were 0.043 μg/g ± 0.02 SD and 0.01 μg/g ± 0.002 SD respectively. In carp liver and muscle, the BMAA concentrations were 1.28 μg/g and 1.27 μg/g respectively, and DAB was not detected. BMAA was detected in the air filters, as were the isomers DAB and AEG. These results demonstrate that a putative cause for ALS, BMAA, exists in an environment that has a documented cluster of ALS. Although cause and effect have not been demonstrated, our observations and measurements strengthen the association. PMID:25643180

  14. Tuning a Schottky barrier of epitaxial graphene/4H-SiC (0001) by hydrogen intercalation

    Energy Technology Data Exchange (ETDEWEB)

    Dharmaraj, P.; Justin Jesuraj, P.; Jeganathan, K., E-mail: kjeganathan@yahoo.com [Centre for Nanoscience and Nanotechnology, School of Physics, Bharathidasan University, Tiruchirappalli 620 024, Tamil Nadu (India)

    2016-02-01

    We report the electron transport properties of epitaxial graphene (EG) grown on 4H-SiC (0001) by low energy electron-beam irradiation. As-grown EG (AEG) on SiC interface exhibits rectifying current-voltage characteristics with a low Schottky barrier (SB) of 0.55 ± 0.05 eV and high reverse current leakage. The SB of AEG/SiC junction is extremely impeded by the Fermi level pinning (FLP) above the Dirac point due to charged states at the interface. Nevertheless, a gentle hydrogen intercalation at 900 °C enables the alleviation of both FLP and carrier scattering owing to the saturation of dangling bonds as evidenced by the enhancement of SB (0.75 ± 0.05 eV) and high electron mobility well excess of 6000 cm{sup 2} V{sup −1} s{sup −1}.

  15. The hundredth Gentner Doctoral Student has started at CERN

    CERN Multimedia

    CERN Bulletin

    2016-01-01

    Almost ten years after the start of the programme in 2007, the hundredth Gentner Doctoral Student started his PhD at CERN.   The hundredth Gentner Doctoral Student, Christian Zimmer, in front of the AEgIS detector in the AD hall, where he will spend a significant portion of the next 3 years. In 2007, the German Gentner Doctoral Student Programme was established at CERN, named in honour of the celebrated nuclear physicist Wolfgang Gentner, President of the CERN Council from 1972-74. On 1 July 2016, the 100th Gentner Doctoral Student, Christian Zimmer, started his PhD at CERN, where he will work on setting up the sympathetic laser cooling of antiprotons at the AEgIS experiment. CERN’s Doctoral Student Programme has been running for many years, with 200 students currently enrolled. The Gentner programme is fully integrated into the general CERN Doctoral Student Programme, but is entirely funded by the German Federal Ministry of Education and Research (BMBF). The programme sponsors 30 to 40...

  16. Selecting and optimizing of the heavy metal inactivator in sewage sludge composting

    Institute of Scientific and Technical Information of China (English)

    HUANG Yaxi; LI Ji; LI Guoxue; SUN Xue; HUANG Yang; XU Lianshuang

    2007-01-01

    In sewage sludge composting, adding ash from stove (FA20) inactivated active Cu effectively and the results were significantly better than control. For Zn, Mn, Pb and Cd, satisfying results was achieved by adding ash from stove and phosphorite powder (FA20, PR10), phosphorite powder and lime (PR15, CL1O), ash from stove and phosphorite powder (FA10, PR10), and ash from stove and peat (FA20, PT10). Based on their effects of inactivating available forms of heavy metals, ash from stove, phosphorite powder and peat were supposed to be effective inactivators with optimum percentages of 20%, 15% and 10% (FA20, PR15, PT10).

  17. Structural and functional characteristics of two novel members of pathogensis-related multigene family of class 10 from yellow lupine+.

    Science.gov (United States)

    Handschuh, Luiza; Femiak, Iwona; Kasperska, Alina; Figlerowicz, Marek; Sikorski, Michał M

    2007-01-01

    PR-10 proteins (pathogensis-related), ubiquitous within the plant kingdom, are usually encoded by multigene families. To date we have identified 10 homologous pr-10 genes in a yellow lupine cDNA library. Here, the structure and expression of two newly identified yellow lupine pr-10 genes (LlYpr10-2b and LlYpr10-2f) are presented. Many potential regulatory sites were found in both gene promoters including common ones as well as those unique for each gene. However, promoter deletion analysis in transgenic tobacco plants revealed similar patterns of reporter gene (gus) expression. Shortened fragments of both gene promoters studied caused high GUS activity in leaves (along vascular bundles), stamen stigma, anthers and pollen grains. When conjugated with longer LlYpr-10.2 promoter fragments, GUS was additionally present in petal edges. Only a long fragment of the LlYpr10-2b gene promoter caused GUS expression in the stem. In yellow lupine the pr-10.2 genes are present in all studied organs, but their level of expression depends on the stage of development and is affected by wounding, oxidative stress and salicylic acid treatment. Silencing of the Llpr-10.2b gene in 4-week-old yellow lupine plants did not lead to any visible symptoms, which suggests that the function of the silenced gene is supplemented by its close homologues, still present in the studied plants. PMID:18080022

  18. ISOLATION AND IDENTIFICATION OF MYCOPARASITIC ISOLATES OF TRICHODERMA ASPERELLUM WITH POTENTIAL FOR SUPRESSION OF BLACK POD DISEASE OF CACAO IN CAMEROON

    Science.gov (United States)

    Alternative measures are needed to control Phytophthora megakarya, the main causal agent of black pod disease in Africa. Precolonized plate and detached cacao pod assays were used to screen fungal isolates for mycoparasitism on P. megakarya. Only Trichoderma asperellum isolates 659-7, PR10, PR11, a...

  19. Regulatory supervision of the radiation protection and release during the dismantling of the German NPP Wuergassen

    International Nuclear Information System (INIS)

    The NPP Wuergassen (KWW) is a commercial, single unit boiling water reactor with a capacity of 670 MWel. It was commissioned by PreussenElektra and constructed by AEG/KWU between 1968 and 1971. This NPP was finally shut down in 1994. The decommissioning, started in April 1997, is still under progress. Up to now, approx. 9,500 Mg of various materials (e.g. metal scrap, cable, concrete) have been deconstructed and released from the site. In this paper we describe the contribution from the authority and the independent expert during the radiological characterisation, the dismantling work, and the material flow up to the release. Special focus will be on the necessary control steps and the documentation regarding the dismantling work and the procedure of release. There is always a close fit between the radiation protection and the release of material on the basis of the radiological characterisation. (authors)

  20. A moiré deflectometer for antimatter

    CERN Document Server

    Aghion, S; Amsler, C; Ariga, A; Ariga, T; Belov, A S; Berggren, K; Bonomi, G; Braunig, P; Bremer, J; Brusa, R S; Cabaret, L; Canali, C; Caravita, R; Castelli, F; Cerchiari, G; Cialdi, S; Comparat, D; Consolati, G; Derking, H; Di Domizio, S; Di Noto, L; Doser, M; Dudarev, A; Ereditato, A; Ferragut, R; Fontana, A; Genova, P; Giammarchi, M; Gligorova, A; Gninenko, S N; Haider, S; Huse, T; Jordan, E; Jørgensen, L V; Kaltenbacher, T; Kawada, J; Kellerbauer, A; Kimura, M; Knecht, A; Krasnicky, D; Lagomarsino, V; Lehner, S; Magnani, A; Malbrunot, C; Mariazzi, S; Matveev, V A; Moia, F; Nebbia, G; Nedelec, P; Oberthaler, M K; Pacifico, N; Petracek, V; Pistillo, C; Prelz, F; Prevedelli, M; Regenfus, C; Riccardi, C; Røhne, O; Rotondi, A; Sandaker, H; Scampoli, P; Storey, J; Subieta Vasquez, M A; Spacek, M; Testera, G; Vaccarone, R; Widmann, E; Zavatarelli, S; Zmeskal, J

    2014-01-01

    The precise measurement of forces is one way to obtain deep insight into the fundamental interactions present in nature. In the context of neutral antimatter, the gravitational inter- action is of high interest, potentially revealing new forces that violate the weak equivalence principle. Here we report on a successful extension of a tool from atom optics—the moire ́ deflectometer—for a measurement of the acceleration of slow antiprotons. The setup con- sists of two identical transmission gratings and a spatially resolving emulsion detector for antiproton annihilations. Absolute referencing of the observed antimatter pattern with a photon pattern experiencing no deflection allows the direct inference of forces present. The concept is also straightforwardly applicable to antihydrogen measurements as pursued by the AEgIS collaboration. The combination of these very different techniques from high energy and atomic physics opens a very promising route to the direct detection of the gravitational acceleratio...

  1. Short outlines of books by Estonian authors / Janika Kronberg, Rutt Hinrikus

    Index Scriptorium Estoniae

    Kronberg, Janika, 1963-

    2004-01-01

    Tutvustus: Talvik, Heiti. Legendaarne. Tartu : Ilmamaa, 2004 ; Pilter, Lauri. Lohejas pilv : romaan lühijuttudes. Tallinn : Tuum, 2004 ; Raud, Rein. Hector ja Bernard. Tallinn : Tuum, 2004 ; Ruben, Aarne. Elajas trepi eelastmel. Tallinn : Tuum, 2004 ; fs. 2004. Tallinn : Tuum, 2004 ; Normet, Dagmar. ...ainult võti taskus. Tallinn : Varrak, 2004 ; Künnap, Asko. Ja sisalikud vastasid (kolmes kirjas). Tallinn : Näo Kirik, 2003 ; Kall, Toomas. Armas aeg. Tallinn : Tänapäev, 2004 ; Õunapuu, Ervin. Eesti gootika II. Tallinn : Umara, 2004 ; Soomets, Triin. Leping number 2 : luuletusi 2000-2003. Tallinn : Tuum, 2004 ; Tuulik, Jüri. Linnusita : [jutustused, lühijutud, näidendid ja vested]. Tallinn : Maalehe Raamat, 2004 ; Raudam, Toomas. Teie. Tallinn : Eesti Keele Sihtasutus, 2003 ; Härm, Viiu. Keegi teeline : luuletused. Tallinn : Varrak, 2004 ; Härm, Viiu. Õhuaken : romaan. Tallinn : Varrak, 2004

  2. Fluorous Peptide Nucleic Acids: PNA Analogues with Fluorine in Backbone (γ-CF2-apg-PNA) Enhance Cellular Uptake.

    Science.gov (United States)

    Ellipilli, Satheesh; Ganesh, Krishna N

    2015-09-18

    Fluorous PNA analogues possessing fluorine as inherent part of aminopropylglycine (apg) backbone (γ-CF2-apg PNA) have been synthesized and evaluated for biophysical and cell penetrating properties. These form duplexes of higher thermal stability with cRNA than cDNA, although destabilized compared to duplexes of standard aeg-PNA. Cellular uptake of the fluorinated γ-CF2-apg PNAs in NIH 3T3 and HeLa cells was 2-3-fold higher compared to that of nonfluorinated apg PNA, with NIH 3T3 cells showing better permeability compared to HeLa cells. The backbone fluorinated PNAs, which are first in this class, when combined with other chemical modifications may have potential for future PNA-based antisense agents. PMID:26322827

  3. Schöneweide - neu kollagiert. Ein künstlerisches Forschungsprojekt

    Directory of Open Access Journals (Sweden)

    Albert Markert

    2015-04-01

    Full Text Available Der Berliner Stadtteil Schöneweide – einst AEG-Areal und Wiege der Elektrifizierung Berlins - war bis zur Wende einer der größten Industriestandorte Europas. Nach der Wende schlossen nahezu alle Industriebetriebe. Seitdem stehen die meisten Fabrikhallen leer. Seit einiger Zeit wandelt sich Oberschöneweide: Die Hochschule für Technik und Wirtschaft hat seit einigen Jahren hier ihren Hauptstandort; eine international expandierende Kunstgießerei hat eine neue Produktionsstätte eröffnet; der kanadische Rocksänger und Fotograf Bryan Adams plant, ein Kulturzentrum zum internationalen Austausch in einer der ehemaligen Produktionshallen zu etablieren. Seit einigen Jahren ziehen zahlreiche Designer_innen, Künstler_innen und Student_innen nach Schöneweide und prägen zunehmend das Erscheinungsbild des Stadtteils (...

  4. Liquid chromatography and mass spectrometry for the analysis of N-β-methylamino-L-alanine with 6-aminoquinolyl-N-hydroxysuccinimidyl carbamate.

    Science.gov (United States)

    Glover, W Broc; Cohen, Steven A; Murch, Susan J

    2015-01-01

    Numerous studies in the past decade have identified N-β-methylamino-L-alanine (BMAA) as a putative environmental neurotoxin. Produced by cyanobacteria and accumulated at different levels of the trophic system, BMAA has been detected in the brain tissue of human patients that died from progressive neurodegenerative disease. Research into the mechanism of neurotoxicity has been hampered by conflicting results and disagreement in the literature over analytical methods used for quantification and detection. While several research approaches have been tested, the use of the derivatizing reagent 6-aminoquinolyl-N-hydroxysuccinimidyl carbamate is presented here as an effective and selective means for the analysis of BMAA and two co-occurring biological isomers, DAB and AEG, by liquid chromatography and tandem mass spectrometry. PMID:25323521

  5. Two pioneering artists visit CERN

    CERN Multimedia

    CERN Bulletin

    2015-01-01

    On Monday, 19 January, CERN physicists welcomed musician Tim Blake - progressive rock keyboard and theremin player - and architectural lighting designer Patrice Warrener - inventor of the Chromolithe Polychromatic Illumination system, used in Lyon’s “Fête des Lumières”. Together, they make up the musical duo "Crystal Machine".   The artists visit the Antiproton Decelerator. (Image: Django Manglunki.)   Their visit began with an introduction to CERN by their friend Django Manglunki, project leader for the ion injector chain, and an improvised discussion on the LHC extraction system with Roger Barlow, kicker magnet controls expert and progressive rock fan. This was followed by a quick trip to the CCC, the server room and the SPS RF amplifiers in BA3. Next on the itinerary was a tour of the AD and anti-hydrogen experiments led by Michael Doser, AEgIS Spokesperson. A leisurely lunch followed, in the company ...

  6. "Kes kaunis on, peab andma vastse võsu..." : [sonetid] / William Shakespeare ; tlk. Harald Rajamets, Ants Oras

    Index Scriptorium Estoniae

    Shakespeare, William, 1564-1616

    2006-01-01

    Sisu: "Kes kaunis on, peab andma vastse võsu..." ; "Sa peeglist näed: need palgejooned nüüd..." ; "Seesama aeg, mis kunstipeenelt voolib..." ; "Miks muusika teeb nukraks sind, kes ise..." ; "Ei, armastust ei tunne sinu rind..." ; "Nii ruttu, kui sa hääbud, uueks sirgud..." ; "Kui kuulen, kuidas aega mõõdab kell..." ; "Kuid miks sa ise tõhusamal moel..." ; "Kas suvepäeva sarnaseks sind kiita?..." ; "Aeg, õgard, küüned lõvil tömbiks kääna... ; "Ei veena peegel mind, et olen vana..." ; "Just nagu näitleja, kel kinni keel..." ; "Mu silm kui taidur võttis pilti teha..." ; "Mu armu isand, kelle truu vasall..." ; "Ma reisist väsinuna heidan sängi..." ; "Kui õnnest hüljatuna nutan sala..." ; "Kui vaikse leebe mõtte kohtu ette..." ; "Ma olen näinud küll, kuis tõusev päike..." ; "Ma tunnistan, et meid on siiski kaks..." ; "Nii nagu isa, vanadusest nõrka..." ; "Kui sulen laud, mu silmad hästi näevad..." ; "Nii ränk on reisida mul tüütul teel..." ; "Mis on su olemus, mis tuum su, miks..." ; "Ei kuningate uhked marmorsambad..." ; "Arm, uuenda end, nii et öelda sust..." ; "Kui uut ei olegi, vaid kõik on sama..." ; "Nii nagu lained ulgumerelt randa..." ; "Neiks päeviks, kui kord aeg mu armsal palge..." ; "Et näen, kuis aja käsi kõike lõhub..." ; "Kui pronksi, kivi, maad ja merd võib neelda..." ; "Mu tusk on ränk, nüüd surma kutsuks küll..." ; "Kui suren, ära leina mind sa kaua..." ; "Sa minus seda aastaaega näed..." ; "Mul sinust kirjutades arg on meel..." ; "Oo hüvasti! Liig kallis mul su hind..." ; "Siis vihka mind, kui pead, ja kohe praegu..." ; "Mõnd uhkeks teeb ta kunst, mõnd sünnipära..." ; "Sust eemal olin kevadel, mu arm..." ; "Kui möödaläinud aja kroonikais..." ; "Mis on veel ajul paberile kanda..." ; "Jah, tõsi, olen käinus siin ja seal..." ; "Ma uskuda ei saa, et murda suudab..." ; "On parem olla halb kui halvaks peetud..." ; "Ei, aeg, sa ära hoople, et mind muudad..." ; "Mu muusika, kui muusikat sa teed

  7. Information about heat pump application in West Germany

    Energy Technology Data Exchange (ETDEWEB)

    1982-01-01

    Information about the use and application of heat pumps is compiled. This information was acquired by the main advisory body for energy management during a study tour in the Osnabrueck-Paderborn-Gelsenkirchen triangle. First of all the information centre of Siemens AG in Osnabrueck is described; a water/water heat pump was visited. A further example is the heat recovery from the outgoing air of an in door swimming pool. Reports are provided on school-heating by a heat-pump system and the use of heat pumps in blocks of flats. Experiences with a central plant are described, technical details are submitted. Furthermore the utilization of the outgoing air of a dairy-cattle shed and the AEG-training centre for energy management in Gelsenkirchen are described.

  8. Secondary emission monitor for keV ion and antiproton beams

    CERN Document Server

    Sosa, Alejandro; Bravin, Enrico; Harasimowciz, Janusz; Welsch, C P

    2013-01-01

    Beam profile monitoring of low intensity keV ion and antiproton beams remains a challenging task. A Sec- ondary electron Emission Monitor (SEM) has been de- signed to measure profiles of beams with intensities below 107 and energies as low as 20 keV. The monitor is based on a two stage microchannel plate (MCP) and a phosphor screen facing a CCD camera. Its modular design allows two different operational setups. In this contribution we present the design of a prototype and discuss results from measurements with antiprotons at the AEgIS experiment at CERN. This is then used for a characterization of the monitor with regard to its possible future use at different facilities.

  9. Mineralogy and Thermal Behaviour of the Kaolinitic Clay of Loutété (Congo-Brazzaville

    Directory of Open Access Journals (Sweden)

    J.M. Moutou

    2012-03-01

    Full Text Available The mineralogical and chemical composition and the technological properties of the raw material used by craftsmen of Loutete, locality in the south of Congo republic, for manufacturing fired bricks were characterized. The X-ray Diffraction, IR spectroscopy, ATD, ATG and AEG were used. The Atterberg limits and the particle size distribution were measured. The linear shrinkage, the water absorption, open porosity, apparent density and flexural strength of different bodies at temperatures from 800 to 1150ºC were measured. The diffraction patterns of different bodies were registered. Kaolinite is the major clay mineral in this sample. The Winkler diagram and clay workability chart allowed to consider this material convenient for roof tiles manufacturing. The open porosity and the chemical composition are close to that of stoneware. The addition of sintering agent and shortening material are necessary for improving the technological properties in stoneware, floor and wall tiles.

  10. "Ma vannun tema niuete kui paleuse nimel ..." : [luuletused] / tlk. Andres Ehin, tlk. Ly Seppel

    Index Scriptorium Estoniae

    2004-01-01

    Sisu: "Ma vannun tema niuete kui paleuse nimel ..." ; "Ta on nagu kuu, kelle kuma kõik kummuli kukutab ..." ; "Kuu südaöösel ennustab me jäävat lahkujääma ..." ; "Ei hinda naisterahvas kasinuse mulli ..." ; "Ta nõtket kaela kutsun ligemale ..." ; "Meid ühte heitma tõmbab armuköis ..." ; "Meil kahel pole mõtet lahku minna ..." ; "Ei kuuga saa võrrelda sind, sest et kuu läheb looja ..." ; "Allah ise su ilude hoob on ja kang ..." ; "Kui meesterahvale läeb korda meesterahvas ..." ; "Ja kuis ka kiremöll tal südames ei hulla ..." ; "Teie jaoks ei ole minu võlurohke kallike ..." ; "Oli see vast poisike, nägu ilu täis ..." ; "Aeg tagasi kalli las toob, et mind suisa salvata ...". Tundmatute autorite kirjutatud luuletused jutukogust "1001 ööd" (9. - 10. saj)

  11. Photoelectric energy supply plant for terrestrial use

    Energy Technology Data Exchange (ETDEWEB)

    Mertig, D. (Allgemeine Elektricitaets-Gesellschaft AEG Telefunken, Wedel (Germany, F.R.))

    1978-10-01

    This is a report on the present state and future aspects of energy supply plant on the basis of silicon solar cells for use in areas of the world blessed with abundant sunshine. The photoelectric effect, which forms the basis for this type of direct electricity generation from solar energy, has been known since the work of Becquerel in 1839. The first solar cell made of selenium with an efficiency of about 1% was described in 1883. In 1954, the first silicon solar cell with an efficiency of 5% was developed, and from 1958 onwards it was used with great success in American and Russian satellites. The first German research satellite Azur was equipped with solar cells for energy supply by AEG Telefunken in 1967.

  12. Steps towards the design of a cryogenic manipulator for an ultra-thin membrane in a 1T magnetic field

    CERN Document Server

    Vasev, Andrej

    2015-01-01

    The main purpose of my CERN's project is design, analysis and research on all conditions under which one cryogenic mechanism would produce extremely low temperatures needed for cooling down a silicon target in a closed magnetic system. Main source of the research is the AEgIS (Antihydrogen Experiment: Gravity, Interferometry, Spectroscopy) experiment of CERN, which aims to carry out the first direct measurement of a gravitational effect on an antimatter system. To reach this goal, a silicon target is bombarded by positrons in order to create positronium which is used to form antihydrogen atoms on which the experiment is going to be done. That would not be possible without the presence of a respective cooling system that secures constant extremely low temperatures in the silicon area. In the further development of the cryogenic system’s functionality, a special attention is given to its construction, used materials and interaction between each other.

  13. Preparation and characterization of porous carbon from expanded graphite for high energy density supercapacitor in aqueous electrolyte

    Science.gov (United States)

    Barzegar, Farshad; Bello, Abdulhakeem; Momodu, Damilola; Madito, Moshawe Jack; Dangbegnon, Julien; Manyala, Ncholu

    2016-03-01

    In this work, we present the synthesis of low cost carbon nanosheets derived from expanded graphite dispersed in Polyvinylpyrrolidone, subsequently activated in KOH and finally carbonized in Ar/H2 atmosphere. Interconnected sheet-like structure with low concentration of oxygen (9.0 at.%) and a specific surface area of 457 m2 g-1 was obtained. The electrochemical characterization of the carbon material as supercapacitor electrode in a 2-electrode configuration shows high specific capacitance of 337 F g-1 at a current density of 0.5 A g-1 as well as high energy density of 37.9 Wh kg-1 at a power density of 450 W kg-1. This electrical double layer capacitor electrode also exhibits excellent stability after floating test for 120 h in 6 M KOH aqueous electrolyte. These results suggest that this activated expanded graphite (AEG) material has great potential for high performance electrode in energy storage applications.

  14. Paide - paekivilinn

    Index Scriptorium Estoniae

    2004-01-01

    Juuni: Tallinna Kunstihoone kunstnike näitus, Markus Kasemaa ja Paide huvikeskuse 4.-5. klasside õpilaste maalinäitus ning Mariann Rea fotonäitus Vallitornis. Juuli: 7. Paide paepäevad 1.-10. VII (10 nime loetletud) 8. VII paekonverents "Paide paesel pinnal" Järvamaa muuseumis. Esinevad Eino Tomberg, Helle Perens jt. 10. VII 8. rahvusvaheline tegevuskunsti festival "Aeg. Ruum. Liikumine" Keskväljakul, skulptorid esitlevad valminud skulptuure Vallimäel. 1.-10. VII Eesti Kujurite Ühenduse fotonäitus "Skulptuur fotol" (lk. 19) ja rühmituse 312A näitus Vallitornis. 30. VI-08. VIII portselaninäitus "Kruus kui meene" Järvamaa muuseumis. August: G-galerii kunstnike näitus ja Salme Allikseina maalinäitus Vallitornis, Arvo Auna maalinäitus Järvamaa muuseumis

  15. Beam test results of 3D silicon pixel sensors for future upgrades

    Science.gov (United States)

    Nellist, C.; Gligorova, A.; Huse, T.; Pacifico, N.; Sandaker, H.

    2013-12-01

    3D silicon has undergone an intensive beam test programme which has resulted in the successful qualification for the ATLAS Insertable B-Layer (IBL) upgrade project to be installed in 2013-2014. This paper presents selected results from this study with a focus on the final IBL test beam of 2012 where IBL prototype sensors were investigated. 3D devices were studied with 4 GeV positrons at DESY and 120 GeV pions at the SPS at CERN. Measurements include tracking efficiency, charge sharing, time over threshold and cluster size distributions as a function of incident angle for IBL 3D design sensors. Studies of 3D silicon sensors in an anti-proton beam test for the AEgIS experiment are also presented.

  16. 27 Estonian Music Festivals 2002

    Index Scriptorium Estoniae

    2003-01-01

    2002. aastal Eestis toimunud muusikafestivalidest: opeNBaroque 2002 (muusikafestival),Akadeemilised Trompetipäevad, Klavessiinimuusika Päevad, Eesti muusika päevad 2002,Mravinski Festival, Rudolf Tobiase muusikafestival, Eduard Tubin ja tema aeg (muusikafestival), Suure-Jaani muusikapäevad 2002,Regiöö (muusikafestival), David Oistrahhi festival, Haapsalu vanamuusikafestival 2002, Viljandi vanamuusikafestival 2002, Hiiumaa kammermuusikapäevad 2002, Klaaspärlimäng (festival),Mustjala Festival, Haapsalu viiulimuusika Päevad 2002, Kuressaare ooperipäevad 2002, Leigo järvemuusika 2002, Tallinna Orelifestival, Rapla kirikumuusika X festival 2002, Kuressaare kammermuusikapäevad 2002, Mart Saare muusikafestival, Credo 2002, Tartu vanamuusika IX festival, Trialogos 2002 (kultuurifestival), Fiesta de la guitarra (kitarrimuusika festival), Klaver 2002

  17. President kutsub koostööle / Arnold Rüütel

    Index Scriptorium Estoniae

    Rüütel, Arnold, 1928-

    2002-01-01

    Ilmunud ka: Postimees (2002) 25. veebr., lk. 11, pealk.: Vajame uut ühiskondlikku lepet; SL Õhtuleht (2002) 25. veebr., lk. 10, pealk.: Aeg rahvuslikuks leppeks, vt. samas karikatuur; Virumaa Teataja (2002) 26. veebr., lk. 7, pealk.: Eestis tuleb taastada sotsiaalne tasakaal; Maaleht (2002) 28. veebr., lk. 8, pealk.: Uhkus ajab upakile; Põhjarannik (2002) 26. veebr., lk. 5, pealk.: President Arnold Rüütli kõne Eesti Vabariigi 84. aastapäeval; Severnoje Poberezhje (2002) 26. veebr., lk. 5; Meie Maa (2002) 26. veebr., lk. 2, pealk.: Vajame põlvkondlikku järjepidevust ja uut ühiskondlikku lepet. President Arnold Rüütli kõne Eesti Vabariigi 84. aastapäeval Estonia teatris 24. veebruaril 2002. Lühendatult

  18. Determination of β-N-methylamino-L-alanine, N-(2-aminoethyl)glycine, and 2,4-diaminobutyric acid in Food Products Containing Cyanobacteria by Ultra-Performance Liquid Chromatography and Tandem Mass Spectrometry: Single-Laboratory Validation.

    Science.gov (United States)

    Glover, W Broc; Baker, Teesha C; Murch, Susan J; Brown, Paula N

    2015-01-01

    A single-laboratory validation study was completed for the determination of β-N-methylamino-L-alanine (BMAA), N-(2-aminoethyl)glycine (AEG), and 2,4-diaminobutyric acid (DAB) in bulk natural health product supplements purchased from a health food store in Canada. BMAA and its isomers were extracted with acid hydrolysis to free analytes from protein association. Acid was removed with the residue evaporated to dryness and reconstituted with derivatization using 6-aminoquinolyl-N-hydroxysuccinimidyl carbamate (AccQ-Fluor). Chromatographic separation and detection were achieved using RP ultra-performance LC coupled to a tandem mass spectrometer operated in multiple reaction monitoring mode. Data from biological samples were evaluated for precision and accuracy across different days to ensure repeatability. Accuracy was assessed by spike recovery of biological samples using varying amino acid concentrations, with an average recovery across all samples of 108.6%. The analytical range was found to be 764-0.746 ng/mL prior to derivatization, thereby providing a linear range compatible with potentially widely varying analyte concentrations in commercial health food products. Both the U. S. Food and Drug Administration (FDA) and U. S. Pharmacopeia definitions were evaluated for determining method limits, with the FDA approach found to be most suitable having an LOD of 0.187 ng/mL and LLOQ of 0.746 ng/mL. BMAA in the collected specimens was detected at concentrations lower than 1 μg/g, while AEG and DAB were found at concentrations as high as 100 μg/g. Finding these analytes, even at low concentrations, has potential public health significance and suggests a need to screen such products prior to distribution. The method described provides a rapid, accurate, and precise method to facilitate that screening process. PMID:26651568

  19. Strategy for quantifying trace levels of BMAA in cyanobacteria by LC/MS/MS.

    Science.gov (United States)

    Jiang, Liying; Johnston, Eric; Aberg, K Magnus; Nilsson, Ulrika; Ilag, Leopold L

    2013-02-01

    The cyanobacterial neurotoxin β-N-methylamino-L-alanine (BMAA) is an amino acid that is putatively associated with the pathology of amyotrophic lateral sclerosis/Parkinsonism-dementia complex (ALS-PDC) disease. It raises serious health risk concerns since cyanobacteria are ubiquitous thus making human exposure almost inevitable. The identification and quantification of BMAA in cyanobacteria is challenging because it is present only in trace amounts and occurs alongside structurally similar compounds such as BMAA isomers. This work describes an enhanced liquid chromatography/tandem mass spectrometry platform that can distinguish BMAA from its isomers β-amino-N-methyl-alanine, N-(2-aminoethyl) glycine (AEG), and 2,4-diaminobutyric acid, thus ensuring confident identification of BMAA. The method's sensitivity was improved fourfold by a post-column addition of acetonitrile. The instrument and method limits of detection were shown to be 4.2 fmol/injection (or 0.5 pg/one column) and 0.1 μg/g dry weight of cyanobacteria, respectively. The quantification method uses synthesized deuterated BMAA as an internal standard and exhibits good linearity, accuracy, and precision. Matrix effects were also investigated, revealing an ion enhancement of around 18 %. A lab-cultured cyanobacterial sample (Leptolyngbya PCC73110) was analyzed and shown to contain about 0.73 μg/g dry weight BMAA. The isomer AEG, whose chromatographic properties closely resemble those of BMAA, was also detected. These results highlight the importance of distinguishing BMAA from its isomers for reliable identification as well as providing a sensitive and accurate quantification method for measuring trace levels of BMAA in cyanobacterial samples. PMID:23180086

  20. Comparative study on toxic effects induced by oral or intravascular administration of commonly used disinfectants and surfactants in rats.

    Science.gov (United States)

    Xue, Yuying; Zhang, Shanshan; Tang, Meng; Zhang, Ting; Wang, Yiqing; Hieda, Yoko; Takeshita, Haruo

    2012-07-01

    Accidental ingestion or injection of household products sometimes occurs due to their accessibility, but the toxic manifestations have not been well characterized when they are internally administered. The aim of this study was to investigate the toxic effects induced by ingestion or injection of different ionic surfactants and disinfectants in rats. The test drugs involved benzalkonium and benzethonium (BZK and BZT, both cationic surfactants used as disinfectants), alkyldiaminoethylglycine (AEG, an amphoteric surfactant used as a disinfectant), linear alkylbenzenesulfonate (LAS, an anionic surfactant), polyoxyethylene cetylether (PEC, a nonionic surfactant), chlorhexidine (CHX, not a surfactant but a disinfectant) and saline (control). Male Sprague-Dawley rats were administered one of the test drugs orally (p.o.), intravenously (i.v.) or intraarterially (i.a.). The fatal effects appeared rapidly (5 h) in i.a./p.o.-administered rats after a dose of around LD(50) , although the progress and degree of toxic effects varied among the drugs tested. In intravascular administration, BZK and BZT were fatal at doses of 15-20 mg kg(-1) . Higher concentrations in lung and kidney than in blood were determined. CHX showed a high toxic effect compared with cationic surfactants. The rats administered anionic (LAS) or amphoteric (AEG) surfactant died in less than 24 h at doses over 100 mg kg(-1) . In p.o. administration, the toxic effects were concentration/dose-dependent, and all rats administered high doses of surfactants except for PEC died at 5-20 h. The overall toxic ranks could be: cationic surfactant/CHX> anionic/amphoteric surfactant > nonionic surfactant. PMID:21387348

  1. Birch pollen allergy: molecular characterization and hypoallergenic products

    OpenAIRE

    Schenk, M.F.

    2008-01-01

    Allergic diseases, such as hay fever and food allergy, affect a substantial part of the population in westernized countries. Pollen of the European white birch (Betula pendula) is a considerable cause of hay fever (seasonal allergic rhinitis) in northern and central Europe. The major birch pollen allergen is Bet ν 1, which is the conventional allergen name for the birch pollen proteins of a large group of proteins otherwise known as PR-10 proteins. Individuals that suffer from birch pollen al...

  2. Structural and bioinformatic analysis of the kiwifruit allergen Act d 11, a member of the family of ripening-related proteins.

    Science.gov (United States)

    Chruszcz, Maksymilian; Ciardiello, Maria Antonietta; Osinski, Tomasz; Majorek, Karolina A; Giangrieco, Ivana; Font, Jose; Breiteneder, Heimo; Thalassinos, Konstantinos; Minor, Wladek

    2013-12-01

    The allergen Act d 11, also known as kirola, is a 17 kDa protein expressed in large amounts in ripe green and yellow-fleshed kiwifruit. Ten percent of all kiwifruit-allergic individuals produce IgE specific for the protein. Using X-ray crystallography, we determined the first three-dimensional structures of Act d 11, produced from both recombinant expression in Escherichia coli and from the natural source (kiwifruit). While Act d 11 is immunologically correlated with the birch pollen allergen Bet v 1 and other members of the pathogenesis-related protein family 10 (PR-10), it has low sequence similarity to PR-10 proteins. By sequence Act d 11 appears instead to belong to the major latex/ripening-related (MLP/RRP) family, but analysis of the crystal structures shows that Act d 11 has a fold very similar to that of Bet v 1 and other PR-10 related allergens regardless of the low sequence identity. The structures of both the natural and recombinant protein include an unidentified ligand, which is relatively small (about 250 Da by mass spectrometry experiments) and most likely contains an aromatic ring. The ligand-binding cavity in Act d 11 is also significantly smaller than those in PR-10 proteins. The binding of the ligand, which we were not able to unambiguously identify, results in conformational changes in the protein that may have physiological and immunological implications. Interestingly, the residue corresponding to Glu45 in Bet v 1 (Glu46), which is important for IgE binding to the birch pollen allergen, is conserved in Act d 11, even though it is not in other allergens with significantly higher sequence identity to Bet v 1. We suggest that the so-called Gly-rich loop (or P-loop), which is conserved in all PR-10 allergens, may be responsible for IgE cross-reactivity between Bet v 1 and Act d 11. PMID:23969108

  3. Performance and cost benefits analysis of double-pass solar collector with and without fins

    International Nuclear Information System (INIS)

    Highlights: • The thermal performances and cost analysis of the double-pass solar collector with and without fins absorber were discussed. • The theoretical and experimental study on the double-pass solar air collector with and without fins absorber was conducted. • The ratio of AC/AEG or the cost benefit ratio was presented. • The double-pass solar collector with fins absorber is more cost-effective compared to without fins absorber. - Abstract: The performance and cost benefit analysis of double-pass solar collector with and without fins have been conducted. The theoretical model using steady state analysis has been developed and compared with the experimental results. The performance curves of the double-pass solar collector with and without fins, which included the effects of mass flow rate and solar intensity on the thermal efficiency of the solar collector, were obtained. Results indicated that the thermal efficiency is proportional to the solar intensity at a specific mass flow rate. The thermal efficiency increased by 9% at a solar intensity of 425–790 W/m2 and mass flow rate of 0.09 kg/s. The theoretical and experimental analysis showed a similar trend as well as close agreement. Moreover, a cost-effectiveness model has been developed examine the cost benefit ratio of double-pass solar collector with and without fins. Evaluation of the annual cost (AC) and the annual energy gain (AEG) of the collector were also performed. The results show that the double-pass solar collector with fins is more cost-effective compared to the double-pass solar collector without fins for mass flow rate of 0.01–0.07 kg/s. Also, simulations were obtained for the double-pass solar collector with fins at Nusselt number of 5.42–36.21. The energy efficiency of collector increases with the increase of Nusselt number. The results show that by increasing the Nusselt number simultaneously would drop the outlet temperature at any solar intensity. Increase in Nusselt number

  4. RESTRICCIÓN DEL CRECIMIENTO INTRAUTERINO COMO FACTOR DE RIESGO PARA MALFORMACIONES CONGÉNITAS

    Directory of Open Access Journals (Sweden)

    Julio Nazer H

    2009-01-01

    Full Text Available Antecedentes: La restricción del crecimiento intrauterino (RCIU se estima que está presente en el 5% de los nacimientos y es la manifestación de procesos aberrantes que impiden el desarrollo normal del feto. Objetivos: Estimar la frecuencia de esta patología en la maternidad del Hospital Clínico de la Universidad de Chile. Obtener la tasa prevalencia al nacimiento de malformaciones congénitas (MFC y comparar la frecuencia en recién nacidos pequeños (PEG con los adecuados (AEG y grandes (GEG para la edad gestacional. Método: Se estudian todos los nacimientos, vivos y mortinatos, ocurridos entre enero de 1997 a diciembre de 2008, contenidos en la base de datos del ECLAMC (Estudio Colaborativo Latino Americano de Malformaciones Congénitas desde 1969 a la fecha. Se excluyen los recién nacidos con malformaciones como hidrocefalia, anencefalia e hidrops, que por sus características dificultan la posibilidad de clasificación en PEG, AEG o GEG. Resultados: 10,1% de los nacimientos del período eran PEG. Entre los nacidos vivos 10% fueron PEG, mientras que 33,5% de los mortinatos eran PEG (pBackground: Fetal growth restriction (FGR is the result of anomalies that prevent the normal development of the fetus, it is present in about the 5% of births. Objectives: To estímate the frequency of FGR in the Clini-cal Hospital of the University of Chile. To estímate the congenital malformation prevalence rate at birth and compare it among small (SGE, adequate (AGE and large (LGE newborns according their gestational age. Methods: All live births and stillbirths included in the ECLAMC (Estudio Colaborativo Latino Americano de Malformaciones Congénitas registered from January 1997 and December 2008 were considered. Newborns with congenital malformations that modified per se the size of the child, like hydrocephaly anencephaly and hydrops were excluded. Results: 10.1% of newborns were SGE. Among live births 10% were SGE instead of the 33.5% found in

  5. Tripper car 952 - a new machine for Hambach opencast mine; Bandschleifenwagen 952 - ein neues Geraet fuer den Tagebau Hambach

    Energy Technology Data Exchange (ETDEWEB)

    Friebe, J.

    1995-01-01

    In December 1991 Rheinbraun AG placed an order with the firm of TAKRAF Anlagen GmbH in Leipzig for the mechanical equipment of the new tripper car 952. An order for the electrical equipment was placed with AEG. As fas as outer dimensions and operating conditions are concerned, the new tripper car for Hambach opencast mine resembles its predecessors. Significant changes have however been introduced as regards certain details, and to some extent entirely new measures have been adopted, in particular with respect to the travel gear dynamics, the design and dimensions of the steel structure as regards fatigue strength, the belt alignment devices and the noise and dust emission control devices. On other respects, too, this tripper car is an innovation inasmuch as it is the first large opencast machine to be ordered by Rheinbraun directly from a manufacturer in the new Federal states. During construction, which took nearly 3 years, various differences of opinion between the contracting parties became evident as regards order handling, design and construction; the cause of these differences of opinion often only lies in the different developments that took place during the 40 years in which Germany was divided. Thanks to mutual efforts to overcome these differences as quickly as possible, the completion of the new tripper car 952 represents a project that has contributed to cooperation within the entire German brown coal industry and among its contractors. (orig.) [Deutsch] Im Dezember 1991 bestellte die Rheinbraun AG bei der Fa. TAKRAF Anlagen GmbH, Leipzig, den maschinentechnischen Teil des neuen Bandschleifenwagens 952. Fuer die elektrotechnische Ausruestung wurde der Auftrag an AEG vergeben. Der neue Bandschleifenwagen fuer den Tagebau Hambach entspricht in den aeusseren Abmessungen und in den Einsatzbedingungen den Vorgaengergeraeten. Im Detail sind jedoch wesentliche Aenderungen vorgenommen und zum Teil auch neue Wege beschritten worden, insbesondere im Bereich der

  6. Antioxidant capacity and fatty acid profile of Centaurea kotschyi (Boiss. & Heldr. Hayek var. persica (Boiss. Wagenitz from Turkey

    Directory of Open Access Journals (Sweden)

    Aktumsek, Abdurrahman

    2011-03-01

    Full Text Available The antioxidant capacity of the methanolic extract and the fatty acid composition of C. kotschyi var. persica were investigated. Six different chemical methods were used to determine the antioxidant capacity. The fatty acid composition was analyzed using gas chromatography. The IC50 value of the extract was determined as 37.09 μg/ml (in the DPPH assay. In the β-carotene/linoleic acid system, the extract exhibited 65.22% inhibition against linoleic acid oxidation. The amount of total phenolic content and total antioxidant capacity were detected as 36.52 mg gallic acid equivalent (GAE/g and 74.93 mg ascorbic acid equivalent (AE/g, respectively. The major fatty acid in the composition of C. kotschyi var. persica was found to be C 18:3 ω3 (α-linolenic acid by GC analysis. The results presented here indicate that C. kotschyi var. persica possess strong antioxidant properties. Therefore, the species can be used as a natural additive in food, cosmetic and pharmaceutical industries.La capacidad antioxidante de extractos metanólicos y composición de ácidos grasos de C. kotschyi var. pérsica fueron investigados. Seis métodos químicos diferentes fueron realizados para la determinación de la capacidad antioxidante. La composición de ácidos grasos fue analizada por cromatografía de gases. Los valores de IC50 de los extractos fueron 37.09 μg/ml (en el ensayo con DPPH. En el sistema β-carotene/ácido linoleico, el extracto mostró un 65.22% de inhibición frente a la oxidación del ácido linoleico. La cantidad total de contenido fenólico y capacidad antioxidante total fueron 36.52 mg equivalentes de ácido gallico (GAE/g y 74.93 mg equivalentes de ácido ascórbico (AE/g, respectivamente. El principal ácidos graso encontrado, por análisis de CG, en C. kotschyi var. pérsica fue el C 18:3 ω3 (ácido α-linolenico. Los resultados presentados aquí indican que C. kotschyi var. pérsica posee unas fuertes propiedades antioxidantes. Adem

  7. Mathematical Descriptions of Axially Varying Penning Traps for the Antimatter Experiment: gravity, Interferometry, and Spectroscopy

    CERN Document Server

    Stephanie, Brown

    2015-01-01

    Antimatter, though proposed in 1933, is still not well understood. AEgIS aims to study the interaction of antihydrogen with the earth's gravitational field. This information will add to our understanding of the matter-antimatter asymmetry present in our universe. This paper discusses a Penning-Malmberg with a magnetic mirror that will hold $C_{2}^{-}$ that will be used for sympathetic cooling of antiprotons before the antihydrogen is created. The trap, which is critical to the cooling process of the antihydrogen, can be characterized by the separatrix between trapped and untrapped particles. This paper applies analytical processes used to define the separatrix of pure electron plasmas to a molecular plasma. Our work is based on the desire conditions (density, particle number, field strength, trap size) of the high field region. The initial application of a semi-analytical method applied to our trap defines the trap potential difference at \\~ 0.6V. The separatrix is defined in both the high and low fiel...

  8. Me saame hakkama! / Toomas Hendrik Ilves

    Index Scriptorium Estoniae

    Ilves, Toomas Hendrik, 1953-

    2009-01-01

    Vabariigi Presidendi tervitus 2008/2009. aastavahetusel. Ilmunud ka: Postimees 3. jaan. 2009, lk. 3, pealk.: President Toomas Hendrik Ilvese uusaastatervitus; Eesti Päevaleht 3. jaan. 2009, lk. 3, pealk.: Sajandi keerulisim aasta. Vt. samas: Muutunud aeg. Väljavõte presidendi uusaastakõnest 2007. aasta 31. detsembril; Oma Saar 3. jaan. 2009, lk. 5, pealk.: Armas rahvas!; Pärnu Postimees 3. jaan. 2009, lk. 5, pealk.: Vabariigi presidendi aastavahetuse tervitus; Võrumaa Teataja 3. jaan. 2009, lk. 2, pealk.: Vabariigi presidendi tervitus aastavahetusel 2008/2009; Virumaa Teataja 3. jaan. 2009, lk. 11, pealk.: Homne on meie teha; Järva Teataja 3. jaan. 2009, lk. 2, pealk.: Me tuleme toime; Hiiu Leht : Nädalalõpp 9. jaan. 2009, lk. 6, pealk.: Armas rahvas!; Meie Maa 3. jaan. 2009, lk. 2 (tsitaat kõnest); Vaba Eesti Sõna 8. jaan. 2009, lk. 3, pealk.: Vabariigi Presidendi tervitus aastavahetusel; Eesti Päevaleht (Stockholm) 14. jaan. 2009, lk. 1, pealk.: Toomas Hendrik Ilves: Jäägem raskuste kiuste ausaks; Eesti Elu 9. jaan. 2009, lk. 2, pealk.: Vabariigi Presidendi tervitus 2008/2009. aastavahetusel; Meie Kodu 21. jaan. 2009, lk. 1, pealk.: Vabariigi Presidendi tervitus 2008/2009. aastavahetusel; Eesti Hääl 24. jaan. 2009, lk. 1, pealk.: EV Presidendi kõne

  9. Antioxidant capacity and fatty acid profile of Centaurea kotschyi (Boiss. and Heldr.) Hayek var. persica (Boiss.) Wagenitz from Turkey

    International Nuclear Information System (INIS)

    The antioxidant capacity of the methanolic extract and the fatty acid composition of C. Kotschyi var. persica were investigated. Six different chemical methods were used to determine the antioxidant capacity. The fatty acid composition was analyzed using gas chromatography. The IC50 value of the extract was determined as 37.09 ig/ml (in the DPPH assay). In the βcarotene/linoleic acid system, the extract exhibited 65.22% inhibition against linoleic acid oxidation. The amount of total phenolic content and total antioxidant capacity were detected as 36.52 mg gallic acid equivalent (GAE)/g and 74.93 mg ascorbic acid equivalent (AE)/g, respectively. The major fatty acid in the composition of C. kotschyi var. persica was found to be C 18:3 u3 (β-linolenic acid) by GC analysis. The results presented here indicate that C. kotschyi var. persica possess strong antioxidant properties. Therefore, the species can be used as a natural additive in food, cosmetic and pharmaceutical industries. (Author).

  10. Motif mediated protein-protein interactions as drug targets.

    Science.gov (United States)

    Corbi-Verge, Carles; Kim, Philip M

    2016-01-01

    Protein-protein interactions (PPI) are involved in virtually every cellular process and thus represent an attractive target for therapeutic interventions. A significant number of protein interactions are frequently formed between globular domains and short linear peptide motifs (DMI). Targeting these DMIs has proven challenging and classical approaches to inhibiting such interactions with small molecules have had limited success. However, recent new approaches have led to the discovery of potent inhibitors, some of them, such as Obatoclax, ABT-199, AEG-40826 and SAH-p53-8 are likely to become approved drugs. These novel inhibitors belong to a wide range of different molecule classes, ranging from small molecules to peptidomimetics and biologicals. This article reviews the main reasons for limited success in targeting PPIs, discusses how successful approaches overcome these obstacles to discovery promising inhibitors for human protein double minute 2 (HDM2), B-cell lymphoma 2 (Bcl-2), X-linked inhibitor of apoptosis protein (XIAP), and provides a summary of the promising approaches currently in development that indicate the future potential of PPI inhibitors in drug discovery. PMID:26936767

  11. Atom optical tools for antimatter experiments

    Energy Technology Data Exchange (ETDEWEB)

    Braeunig, Philippe H.M.

    2014-12-17

    The direct measurement of the gravitational acceleration of antimatter in the earth's field, which represents a test of the weak equivalence principle, is in the focus of several ongoing experimental attempts. This thesis investigates tools and techniques known from the field of atom optics that can be utilised for such a measurement with antihydrogen atoms as envisioned by the AEgIS collaboration. A first experimental step is presented, in which a detection due to an electromagnetic force acting on antiprotons is measured with a Moire deflectometer. This device, which can be described with classical particle trajectories, consists of two gratings and a spatially resolving detector. Key elements of this measurement are the use of an emulsion detector with high spatial resolution and an absolute reference technique based on an interferometric fringe pattern of light, which is not deflected by forces. For future realisations, a new detection and evaluation scheme to measure gravity based on a three-grating system enclosed by a vertex-reconstructing detector is discussed. This allows the use of a grating periodicity that is smaller than the resolution of the detector while making efficient use of the particle flux. Smaller periodicities are favourable to increase the inertial sensitivity of the measurement apparatus but require to take effects of diffraction into account. To explore this near-field regime with antimatter, a Talbot-Lau interferometer for antiprotons is proposed and its possible experimental implementation is discussed.

  12. Accuracy-Energy Configurable Sensor Processor and IoT Device for Long-Term Activity Monitoring in Rare-Event Sensing Applications

    Directory of Open Access Journals (Sweden)

    Daejin Park

    2014-01-01

    Full Text Available A specially designed sensor processor used as a main processor in IoT (internet-of-thing device for the rare-event sensing applications is proposed. The IoT device including the proposed sensor processor performs the event-driven sensor data processing based on an accuracy-energy configurable event-quantization in architectural level. The received sensor signal is converted into a sequence of atomic events, which is extracted by the signal-to-atomic-event generator (AEG. Using an event signal processing unit (EPU as an accelerator, the extracted atomic events are analyzed to build the final event. Instead of the sampled raw data transmission via internet, the proposed method delays the communication with a host system until a semantic pattern of the signal is identified as a final event. The proposed processor is implemented on a single chip, which is tightly coupled in bus connection level with a microcontroller using a 0.18 μm CMOS embedded-flash process. For experimental results, we evaluated the proposed sensor processor by using an IR- (infrared radio- based signal reflection and sensor signal acquisition system. We successfully demonstrated that the expected power consumption is in the range of 20% to 50% compared to the result of the basement in case of allowing 10% accuracy error.

  13. Constraints on exotic dipole-dipole couplings between electrons at the micron scale

    Science.gov (United States)

    Kotler, Shlomi; Ozeri, Roee; Jackson Kimball, Derek

    2015-05-01

    Until recently, the magnetic dipole-dipole coupling between electrons had not been directly observed experimentally. This is because at the atomic scale dipole-dipole coupling is dominated by the exchange interaction and at larger distances the dipole-dipole coupling is overwhelmed by ambient magnetic field noise. In spite of these challenges, the magnetic dipole-dipole interaction between two electron spins separated by 2.4 microns was recently measured using the valence electrons of trapped Strontium ions [S. Kotler, N. Akerman, N. Navon, Y. Glickman, and R. Ozeri, Nature 510, 376 (2014)]. We have used this measurement to directly constrain exotic dipole-dipole interactions between electrons at the micron scale. For light bosons (mass 0.1 eV), we find that coupling constants describing pseudoscalar and axial-vector mediated interactions must be | gPegPe/4 πℏc | <= 1 . 5 × 10-3 and | gAegAe/4 πℏc | <= 1 . 2 × 10-17 , respectively, at the 90% confidence level. These bounds significantly improve on previous constraints in this mass range: for example, the constraints on axial-vector interactions are six orders of magnitude stronger than electron-positron constraints based on positronium spectroscopy. Supported by the National Science Foundation, I-Core: the Israeli excellence center, and the European Research Council.

  14. Search for solar axions emitted in the M1-transition of 7Li* with Borexino CTF

    International Nuclear Information System (INIS)

    Results of background measurements with a prototype of the Borexino detector were used to search for 478 keV solar axions emitted in the M1-transitions of 7Li*. The Compton conversion of axion to a photon A+e→e+γ, axioelectric effect A+e+Z→e+Z, decay of axion in two photons A→2γ and Primakoff conversion on nuclei A+Z→γ+Z are considered. The upper limit on constants of interaction of axion with electrons, photons and nucleons -gAegAN≤(1.0-2.4) x 10-10 at mA≤450 keV and gAγgAN≤5 x 10-9 GeV-1 at mA≤10 keV are obtained (90%c.l.). For heavy axions with mass at 100AAe-8 and gAγ-9-10-8 are obtained in assumption that gAN depends on mA as for KSVZ axion model. These limits are stronger than obtained in previous laboratory-based experiments using nuclear reactor and artificial radioactive sources. (orig.)

  15. Fragmente "Lüürikast" / Wendy Saloman ; inglise keelest tlk. Doris Kareva

    Index Scriptorium Estoniae

    Saloman, Wendy

    2001-01-01

    Sisu : "Kannikesed olid kreeklaste surmalilled..."; "Foto kannikestest on hakanud äärtest keerduma. Leidsid nad lumest sel..."; "Kujutle Isist kogumas surnud Osirise tükke..."; "Kujutlus on igaviku tööriist..."; "Mäletada tuba tähendab mäletada mis tahes tuba hommikuvalgusega läbi..."; "Aeg muutis su ujedaks. Eebenipuust kell kaminasimsil meenutas sulle..."; "Kuidas saaksin mäletada tuba, mäletamata su puudumist..."; "Mälestus uhub üle su kuju nagu valguse mäng veel. Ometi, kui mõtlen..."; "Armastasime võimalust endis..."; "Kummaline on meenutada käte intiimsust: hoidjad ja avastajad, sõnade..."; "Vahel öeldakse, et kaamera on surma tööriist..."; "Nostalgia koondub su kujus..."; "Tamariskipuu hõrk hõng tõmbas Isise Byblosse..."; "Aprillis on hetki, mil koobaltsinine taevas on südame saadik..."; "Ja mõnegi meelest on Mercurius kaamera vaim ja fotograafia alkeemia..."; Isis öeldakse olevat muusadest esimene..."; "Suveregati kiirusel ummistab mälu Herakleitose jõe..."; "Möödunud ööl üllatasid mind unes..."; "Sõnad kargavad meelde, kaovad, kujutud fragmendid igavesest kogemusest..."

  16. NATO Advanced Study Institute on Physical Processes in Laser-Materials Interaction, which was the 9th course of the Europhysics School of Quantum Electronics

    CERN Document Server

    1983-01-01

    It is a pleasure to write a few words as an introduction to the proceedings of the 1980 NATO ASI on "Physical Processes in Laser­ Naterial Interaction." This ASI is the ninth course of a series devoted to lasers and their applications, held under the responsibility of the Quantum Electronics Division of the European Physical Society, and for this reason known as the "Europhysics School of Quantum Electronics." Since 1971 the School has been operating with the joint direc­ tion of myself as representative of the academic research, and Dr. D. Roess (formerly with Siemens AEG, Munich, and now with Sick, Optik und Electronik, GmbH, Munich) for the industrial applications. Indeed the aim of the School is to alternate fundamental and applied frontier topics in the area of quantum electronics and modern optics, in order to introduce young research people from universities and industrial R&D laboratories to the new aspects of research opened by the laser.

  17. Cegelec Germany

    International Nuclear Information System (INIS)

    Cegelec is a group of companies acting internationally and one of Europe's biggest plant engineering firms in the fields of power generation and distribution with the focus on engineering and technical services. Cegelec's competences in Germany are mainly in planning, installation and maintenance of plants and facilities in all key industries and for public clients. The main areas of activity are industry, infrastructure and power, for which Cegelec offers comprehensive project and service work. While the Industry business area covers chemistry, steel, paper, automotive, re-engineering, and mining industries, Cegelec's Infrastructure unit performs services to airports, in tunnel construction, for railways and waterways. The Power market segment comprises gas, refuse incineration, power supply, sugar, power plants, and nuclear final storage. Cegelec is represented in Germany on roughly 30 locations with a staff of 1,700. The origins of Cegelec are in Germany, i.e. in AEG founded 1896. The Plant and Automation Technology sector was divested in 1996 and moved to Alstom where, in 2001, a management buyout led to the independent Cegelec group of companies. When the strategic partnership between Qatari Diar and Vinci took shape, Cegelec became a subsidiary of the Vinci group in April 2010. (orig.)

  18. The possible correlation between electromagnetic earth fields and future earthquakes

    CERN Document Server

    Mavrodiev, S C

    2001-01-01

    From 23 - 27 July 2001 in the Institute of Nuclear Research and Nuclear Energy, Bulgarian Academy of Sciences, Sofia was held a seminar under the title: "Possible correlations between electromagnetic earth fields and future earthquakes" organized by the Institute's Department of "Astrophysical Objects and Environment". As a main result of the first two days seminar work was the prediction of the direction and the day of the Skyros, Greece earthquake, that was confirned in the next day: Aeg. Sea, 07/26 00:21:37, 39.06N 24.34E, Depth 19 km, Mag 6.3- http://www.noa.gr/English/home-en.html. Analogously, a month later the day of Yambol, Bulgaria eartquake was predicted. The papers of A.M.Galper et al (2001), "High- energy charged particle flux variations in vicinity of Earth as earthquakes precursors", http://www.pereplet.ru/pops/quakes.html, and http://science.rambler.ru/db/msg.html?mid=1168269&uri=galper.html, the analysis of NASA data from http://www.sel.noaa.gov, explained why the Seminar main hypothesis w...

  19. Accuracy-energy configurable sensor processor and IoT device for long-term activity monitoring in rare-event sensing applications.

    Science.gov (United States)

    Park, Daejin; Cho, Jeonghun

    2014-01-01

    A specially designed sensor processor used as a main processor in IoT (internet-of-thing) device for the rare-event sensing applications is proposed. The IoT device including the proposed sensor processor performs the event-driven sensor data processing based on an accuracy-energy configurable event-quantization in architectural level. The received sensor signal is converted into a sequence of atomic events, which is extracted by the signal-to-atomic-event generator (AEG). Using an event signal processing unit (EPU) as an accelerator, the extracted atomic events are analyzed to build the final event. Instead of the sampled raw data transmission via internet, the proposed method delays the communication with a host system until a semantic pattern of the signal is identified as a final event. The proposed processor is implemented on a single chip, which is tightly coupled in bus connection level with a microcontroller using a 0.18 μm CMOS embedded-flash process. For experimental results, we evaluated the proposed sensor processor by using an IR- (infrared radio-) based signal reflection and sensor signal acquisition system. We successfully demonstrated that the expected power consumption is in the range of 20% to 50% compared to the result of the basement in case of allowing 10% accuracy error. PMID:25580458

  20. Recent GPS Results at SLAC

    International Nuclear Information System (INIS)

    The Alignment Engineering Group (AEG) makes use of GPS technology for fulfilling part of its above ground surveying tasks at SLAC since early 2002. A base station (SLAC M40) has been set up at a central location of the SLAC campus serving both as master station for real-time kinematic (RTK) operations and as datum point for local GPS campaigns. The Leica RS500 system is running continuously and the GPS data are collected both externally (logging PC) and internally (receiver flashcard). The external logging is facilitated by a serial to Ethernet converter and an Ethernet connection at the station. Internal logging (ring buffer) is done for data security purposes. The weatherproof boxes for the instrumentation are excellent shelters against rain and wind, but do heat up considerably in sun light. Whereas the GPS receiver showed no problems, the Pacific Crest PDL 35 radio shut down several times due to overheating disrupting the RTK operations. In order to prevent heat-induced shutdowns, a protection against direct sun exposure (shading) and a constant air circulation system (ventilation) were installed. As no further shutdowns have occurred so far, it appears that the two measures successfully mended the heat problem

  1. Vikergallup : eesti kirjandus 2008 / Peeter Helme, Ott Kilusk, Igor Kotjuh... [jt.

    Index Scriptorium Estoniae

    2009-01-01

    21 arvustaja vastus küsimusele, milline oli 2008. aasta parim uudisteos ja debüüt. Ära nimetati fs-i luulekogu "Alasti ja elus", Andrei Hvostovi proosaraamatut "Võõrad lood", Maarja Kangro luulekogu "Heureka", Kalju Kruusa luulekogu "Pilvedgi mindgi liigutavadgi", Asko Künnapi luulekogu "Su ööd on loetud", Elo Viidingu proosaraamatut "Püha Maama", Mart Juure luulekogu "Pane Eesti peale tagasi", Jaan Kaplisnki luulekogu "Teiselpool järve", Mart Kivastiku proosaraamatut "Kurb raamat", Leo Kunnase romaani "Gort Ashryn I", Andres Langemetsa luulekogu "Vooder", Erkki Luugi "Valitud luuletusi", Rein Põdra romaani "Juba olnud", Rein Raua lühiromaani "Vend" ja Jaan Tangsoo romaani "Méduse'i parv". Parima debüüdina mainiti Andrus Kasemaa luulekogu "Poeedirahu", Barthol Lo Mejori proosaraamatut "Popdada" ja Chaneldiori proosaraamatut "Kontrolli alt väljas", Lauri Saatpalu laulutekstiraamatut "Nähtused ja tehtused", Tamur Kusnetsi romaani "Hundipäikese aeg" ja Jaanika Merilo luulekogu "Rütmist väljas"

  2. Beta-N-Methylamino-l-Alanine: LC-MS/MS Optimization, Screening of Cyanobacterial Strains and Occurrence in Shellfish from Thau, a French Mediterranean Lagoon

    Directory of Open Access Journals (Sweden)

    Damien Réveillon

    2014-11-01

    Full Text Available β-N-methylamino-l-alanine (BMAA is a neurotoxic non-protein amino acid suggested to be involved in neurodegenerative diseases. It was reported to be produced by cyanobacteria, but also found in edible aquatic organisms, thus raising concern of a widespread human exposure. However, the chemical analysis of BMAA and its isomers are controversial, mainly due to the lack of selectivity of the analytical methods. Using factorial design, we have optimized the chromatographic separation of underivatized analogues by a hydrophilic interaction chromatography coupled to tandem mass spectrometry (HILIC-MS/MS method. A combination of an effective solid phase extraction (SPE clean-up, appropriate chromatographic resolution and the use of specific mass spectral transitions allowed for the development of a highly selective and sensitive analytical procedure to identify and quantify BMAA and its isomers (in both free and total form in cyanobacteria and mollusk matrices (LOQ of 0.225 and 0.15 µg/g dry weight, respectively. Ten species of cyanobacteria (six are reported to be BMAA producers were screened with this method, and neither free nor bound BMAA could be found, while both free and bound DAB were present in almost all samples. Mussels and oysters collected in 2009 in the Thau Lagoon, France, were also screened, and bound BMAA and its two isomers, DAB and AEG, were observed in all samples (from 0.6 to 14.4 µg/g DW, while only several samples contained quantifiable free BMAA.

  3. β-N-methylamino-l-alanine (BMAA) and isomers: Distribution in different food web compartments of Thau lagoon, French Mediterranean Sea.

    Science.gov (United States)

    Réveillon, Damien; Abadie, Eric; Séchet, Véronique; Masseret, Estelle; Hess, Philipp; Amzil, Zouher

    2015-09-01

    The neurotoxin BMAA (β-N-methylamino-l-alanine) and its isomer DAB (2,4-diaminobutyric acid) have been detected in seafood worldwide, including in Thau lagoon (French Mediterranean Sea). A cluster of amyotrophic lateral sclerosis (ALS), a neurodegenerative disease associated with BMAA, has also been observed in this region. Mussels, periphyton (i.e. biofilms attached to mussels) and plankton were sampled between July 2013 and October 2014, and analyzed using HILIC-MS/MS. BMAA, DAB and AEG (N-(2-aminoethyl)glycine) were found in almost all the samples of the lagoon. BMAA and DAB were present at 0.58 and 0.83, 2.6 and 3.3, 4.0 and 7.2 μg g(-1) dry weight in plankton collected with nets, periphyton and mussels, respectively. Synechococcus sp., Ostreococcus tauri, Alexandrium catenella and eight species of diatoms were cultured and screened for BMAA and analogs. While Synechococcus sp., O. tauri and A. catenella did not produce BMAA under our culture conditions, four diatoms species contained both BMAA and DAB. Hence, diatoms may be a source of BMAA for mussels. Unlike other toxins produced by microalgae, BMAA and DAB were detected in significant amounts in tissues other than digestive glands in mussels. PMID:26254582

  4. Beta-N-methylamino-L-alanine: LC-MS/MS optimization, screening of cyanobacterial strains and occurrence in shellfish from Thau, a French Mediterranean lagoon.

    Science.gov (United States)

    Réveillon, Damien; Abadie, Eric; Séchet, Véronique; Brient, Luc; Savar, Véronique; Bardouil, Michèle; Hess, Philipp; Amzil, Zouher

    2014-11-01

    β-N-methylamino-L-alanine (BMAA) is a neurotoxic non-protein amino acid suggested to be involved in neurodegenerative diseases. It was reported to be produced by cyanobacteria, but also found in edible aquatic organisms, thus raising concern of a widespread human exposure. However, the chemical analysis of BMAA and its isomers are controversial, mainly due to the lack of selectivity of the analytical methods. Using factorial design, we have optimized the chromatographic separation of underivatized analogues by a hydrophilic interaction chromatography coupled to tandem mass spectrometry (HILIC-MS/MS) method. A combination of an effective solid phase extraction (SPE) clean-up, appropriate chromatographic resolution and the use of specific mass spectral transitions allowed for the development of a highly selective and sensitive analytical procedure to identify and quantify BMAA and its isomers (in both free and total form) in cyanobacteria and mollusk matrices (LOQ of 0.225 and 0.15 µg/g dry weight, respectively). Ten species of cyanobacteria (six are reported to be BMAA producers) were screened with this method, and neither free nor bound BMAA could be found, while both free and bound DAB were present in almost all samples. Mussels and oysters collected in 2009 in the Thau Lagoon, France, were also screened, and bound BMAA and its two isomers, DAB and AEG, were observed in all samples (from 0.6 to 14.4 µg/g DW), while only several samples contained quantifiable free BMAA. PMID:25405857

  5. Improvements to electrical circuits by means of fast reactive current compensation. Verbesserung der elektrischen Netztechnik mittels schneller Blindstromkompensation

    Energy Technology Data Exchange (ETDEWEB)

    Schenke, G.

    1986-01-01

    Reactive current compensation systems relieve reactive-current load of the network and thus less voltage drop, reduced losses in cables and lines and higher power factor. The additional advantages of rapid reactive-current compensation in the low voltage network are described within a computer program based systems analysis. In coal winning this means higher torques delivered by the asynchronous motors in the starting phase, and sensible relief of the inby transformers from high starting currents. The thyristor switch allowing rapid and frequent on-off switching of condensors without compensation, and a suited rapidly-acting power factor compensator create the prerequisites for a compensation system. The reactive-current measuring method and the exactly phased on-off switching of the condensors by the thyristor switch are described. Messrs. AEG constructed the phototype of an explosion-proof rapid-action thyristor controlled reactive-current compensation unit and this is described in the paper. When tested for compensating the starting current of a 160 kW asynchronous motor fitted to a scraper bar conveyor, the current in the network could be reduced by 40%. The prototype is to be tested in a S5OV network of a production district and problems of compensation at 1000 V are going to be investigated in the future.

  6. A Radiation Service Centre for Research and Large-Scale Irradiation

    International Nuclear Information System (INIS)

    In the near future radiation processing of food may change from the present laboratoryscale to large industrial application. This step will require large irradiation facilities with high flexibility, a safe dose control system and simple food-handling systems. Some design parameters of such an irradiation facility have already been realized at the AEG-Telefunken Radiation Service Centre in Wedel. This centre came into operation in autumn 1976. It is equipped with one research-type high-power X-ray unit (200 kV/32 mA) and one industrial-type Dynamitron® electron accelerator (1500 kV/37.5 kW). Handling systems are available for radiation crosslinking of wire and cable insulations, of plastic films, for irradiation treatment of components and parts of different types and coatings as also of sewage sludge and waste water. Some of these handling systems can be used for food irradiation too. Other handling systems will be added sometime later. As an additional service the Company's existing material and environmental testing laboratory will be available. The centre is already being used by many interested companies to investigate the effects of radiation on a broad range of organic and inorganic materials, to develop special processing equipment, to process supplied products and to perform R and D work and contracts. The service centre fills an existing gap and will have an impact on the commercialization of radiation processing techniques in Europe. (author)

  7. FameLab International Final: a triumph for Switzerland and CERN

    CERN Document Server

    CERN Bulletin

    2015-01-01

    Oskari Vinko, from ETH Zurich, who won the Swiss finals organised at CERN last May, is the winner of the 2015 FameLab competition. The CERN winner Lillian Smestad, member of the AEgIS collaboration from the Norwegian Research Council, shared second place with François-Xavier Joly from France, who also was among the trainees at the FameLab Master Classes organised by CERN in April.     CERN's Lillian Smestad (left) and Oskari Vinko from ETH Zurich, during the Swiss and CERN joint final, organised at CERN in May 2015. The 2015 FameLab International Final, which took place on 4 June in Cheltenham, UK, was a triumph for Switzerland and CERN! The competition was very hard this year, with 27 countries participating in the international semifinals and only nine making it through to the finals. This was also the first year that CERN took part as a “country”.  Congratulations to all the winners! To experience the international Famelab ...

  8. Space Power Program Semiannual Progress Report for period ending June 30, 1963

    Energy Technology Data Exchange (ETDEWEB)

    Miller, A. J. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    1963-10-11

    This is a report of progress on the Oak Ridge National Laboratory's research and development program on nuclear power plants for electrical power production in space vehicles. The work is carried out under AEG Reactor Experiments, Fuels, and Materials, and Reactor Component programs. Research and development work is under way on the stainless steel boiling-potassium reactor and the Medium Power Reactor Experiment, boiling alkali metal heat transfer, high-temperature and refractory alloys, fuel material, and space reactor shielding, particularly in connection with SNAP 2, 8, 10, and 50. Many of these OREL efforts are directed toward the development of a specific type of power plant, but they also furnish a significant contribution of scientific and engineering information needed in other programs on advanced SNAP systems. Progress on research and development directly related to the Medium Power Reactor Experiment (MPRE) is presented mostly in Part I of this report. Progress on the MPRE will, in the future, be reported on a quarterly basis. The form of the reporting will alternate from MPRE Quarterly Progress Reports to Space Power Semiannual Progress Reports.

  9. Antioxidant capacity and fatty acid profile of Centaurea kotschyi (Boiss. and Heldr.) Hayek var. persica (Boiss.) Wagenitz from Turkey

    Energy Technology Data Exchange (ETDEWEB)

    Zengin, G.; Guler, G.O.; Cakmak, Y.S.; Aktumseka, A.

    2011-07-01

    The antioxidant capacity of the methanolic extract and the fatty acid composition of C. kotschyi var. persica were investigated. Six different chemical methods were used to determine the antioxidant capacity. The fatty acid composition was analyzed using gas chromatography. The IC50 value of the extract was determined as 37.09 ig/ml (in the DPPH assay). In the {beta}carotene/linoleic acid system, the extract exhibited 65.22% inhibition against linoleic acid oxidation. The amount of total phenolic content and total antioxidant capacity were detected as 36.52 mg gallic acid equivalent (GAE)/g and 74.93 mg ascorbic acid equivalent (AE)/g, respectively. The major fatty acid in the composition of C. kotschyi var. persica was found to be C 18:3 u3 ({beta}-linolenic acid) by GC analysis. The results presented here indicate that C. kotschyi var. persica possess strong antioxidant properties. Therefore, the species can be used as a natural additive in food, cosmetic and pharmaceutical industries. (Author).

  10. Molecular analysis of acute and chronic reactive astrocytes in the pilocarpine model of temporal lobe epilepsy.

    Science.gov (United States)

    Clasadonte, Jerome; Morel, Lydie; Barrios-Camacho, Camila M; Chiang, Ming Sum R; Zhang, Jinhua; Iyer, Lakshmanan; Haydon, Philip G; Yang, Yongjie

    2016-07-01

    Astroglia, the most abundant glial cells in the mammalian central nervous system (CNS), are considered an emerging key player in seizure induction and progression. Although astrocytes undergo reactive gliosis in temporal lobe epilepsy (TLE) with dramatic morphological and molecular changes, specific astrocyte targets/molecular pathways that contribute to the induction and progression of seizure remain largely unknown. By combining translating ribosomal affinity purification (TRAP) with the pilocarpine model of TLE in BAC aldh1l1 TRAP mice, we profiled translating mRNAs from hippocampal or cortical astrocytes at different phases (3days, 30days, and 60days post-pilocarpine injections) of pilocarpine-induced epilepsy models. Our results found that hippocampal (but not cortical) astrocytes undergo early and unique molecular changes at 3days post-pilocarpine injections. These changes indicate a potentially primary pathogenic role of hippocampal astrocytes in seizure induction and progression and provide new insights about the involvement of specific astrocytic pathways/targets in epilepsy. In particular, we validated expression changes of ocrl and aeg1 in pilocarpine models. Follow-up studies on these genes may reveal new roles of hippocampal astrocytes in TLE. PMID:27060558

  11. The transcription factor VvWRKY33 is involved in the regulation of grapevine (Vitis vinifera) defense against the oomycete pathogen Plasmopara viticola.

    Science.gov (United States)

    Merz, Patrick R; Moser, Tina; Höll, Janine; Kortekamp, Andreas; Buchholz, Günther; Zyprian, Eva; Bogs, Jochen

    2015-03-01

    Grapevine (Vitis vinifera ssp. vinifera) is one of the most important fruit species; however, it is highly susceptible to various pathogens, which can cause severe crop losses in viticulture. It has been shown that several WRKY class transcription factors (TFs) are part of the signal transduction cascade, which leads to the activation of plant defense reactions against various pathogens. In the present investigation, a full-length cDNA was isolated from V. vinifera leaf tissue encoding a predicted protein, designated VvWRKY33, which shows the characteristics of group I WRKY protein family. VvWRKY33 induction correlates with the expression of VvPR10.1 (pathogenesis-related 10.1) gene in the leaves of the resistant cultivar 'Regent' after infection with Plasmopara viticola, whereas in the susceptible cultivar 'Lemberger' VvWRKY33 and VvPR10.1 are not induced. Corresponding expression of the TF and VvPR10.1 was even obtained in uninfected ripening berries. In planta, analysis of VvWRKY33 has been performed by ectopic expression of VvWRKY33 in grapevine leaves of greenhouse plants mediated via Agrobacterium tumefaciens transformation. In consequence, VvWRKY33 strongly increases resistance to P. viticola in the susceptible cultivar 'Shiraz' and reduces pathogen sporulation of about 50-70%, indicating a functional role for resistance in grapevine. Complementation of the resistance-deficient Arabidopsis thaliana Columbia-0 (Col-0) mutant line wrky33-1 by constitutive expression of VvWRKY33 restores resistance against Botrytis cinerea to wild-type level and in some complemented mutant lines even exceeds the resistance level of the parental line Col-0. Our results support the involvement of VvWRKY33 in the defense reaction of grapevine against different pathogens. PMID:25132131

  12. The landscape of cytokinin binding by a plant nodulin

    Energy Technology Data Exchange (ETDEWEB)

    Ruszkowski, M.; Szpotkowski, K.; Sikorski, M. [Polish Academy of Sciences, Poznan (Poland); Jaskolski, M., E-mail: mariuszj@amu.edu.pl [Polish Academy of Sciences, Poznan (Poland); A. Mickiewicz University, Poznan (Poland)

    2013-12-01

    The crystal structures of complexes of M. truncatula nodulin 13 with four cytokinins, trans-zeatin, N{sup 6}-isopentenyladenine, kinetin and N{sup 6}-benzyladenine, show an unusual mode of dimerization of this PR-10-fold plant protein. The cytokinin-binding mode in the internal cavity of the protein is the same in each complex and resembles the pattern found in the cytokinin receptor protein. Nodulation is an extraordinary symbiotic interaction between leguminous plants and nitrogen-fixing bacteria (rhizobia) that assimilate atmospheric nitrogen (in root nodules) and convert it into compounds suitable for the plant host. A class of plant hormones called cytokinins are involved in the nodulation process. In the model legume Medicago truncatula, nodulin 13 (MtN13), which belongs to the pathogenesis-related proteins of class 10 (PR-10), is expressed in the outer cortex of the nodules. In general, PR-10 proteins are small and monomeric and have a characteristic fold with an internal hydrophobic cavity formed between a seven-stranded antiparallel β-sheet and a C-terminal α-helix. Previously, some PR-10 proteins not related to nodulation were found to bind cytokinins such as trans-zeatin. Here, four crystal structures of the MtN13 protein are reported in complexes with several cytokinins, namely trans-zeatin, N{sup 6}-isopentenyladenine, kinetin and N{sup 6}-benzyladenine. All four phytohormones are bound in the hydrophobic cavity in the same manner and have excellent definition in the electron-density maps. The binding of the cytokinins appears to be strong and specific and is reinforced by several hydrogen bonds. Although the binding stoichiometry is 1:1, the complex is actually dimeric, with a cytokinin molecule bound in each subunit. The ligand-binding site in each cavity is formed with the participation of a loop element from the other subunit, which plugs the only entrance to the cavity. Interestingly, a homodimer of MtN13 is also formed in solution, as confirmed

  13. The landscape of cytokinin binding by a plant nodulin

    International Nuclear Information System (INIS)

    The crystal structures of complexes of M. truncatula nodulin 13 with four cytokinins, trans-zeatin, N6-isopentenyladenine, kinetin and N6-benzyladenine, show an unusual mode of dimerization of this PR-10-fold plant protein. The cytokinin-binding mode in the internal cavity of the protein is the same in each complex and resembles the pattern found in the cytokinin receptor protein. Nodulation is an extraordinary symbiotic interaction between leguminous plants and nitrogen-fixing bacteria (rhizobia) that assimilate atmospheric nitrogen (in root nodules) and convert it into compounds suitable for the plant host. A class of plant hormones called cytokinins are involved in the nodulation process. In the model legume Medicago truncatula, nodulin 13 (MtN13), which belongs to the pathogenesis-related proteins of class 10 (PR-10), is expressed in the outer cortex of the nodules. In general, PR-10 proteins are small and monomeric and have a characteristic fold with an internal hydrophobic cavity formed between a seven-stranded antiparallel β-sheet and a C-terminal α-helix. Previously, some PR-10 proteins not related to nodulation were found to bind cytokinins such as trans-zeatin. Here, four crystal structures of the MtN13 protein are reported in complexes with several cytokinins, namely trans-zeatin, N6-isopentenyladenine, kinetin and N6-benzyladenine. All four phytohormones are bound in the hydrophobic cavity in the same manner and have excellent definition in the electron-density maps. The binding of the cytokinins appears to be strong and specific and is reinforced by several hydrogen bonds. Although the binding stoichiometry is 1:1, the complex is actually dimeric, with a cytokinin molecule bound in each subunit. The ligand-binding site in each cavity is formed with the participation of a loop element from the other subunit, which plugs the only entrance to the cavity. Interestingly, a homodimer of MtN13 is also formed in solution, as confirmed by small-angle X

  14. CO and Soot Oxidation over Ce-Zr-Pr Oxide Catalysts

    Science.gov (United States)

    Andana, Tahrizi; Piumetti, Marco; Bensaid, Samir; Russo, Nunzio; Fino, Debora; Pirone, Raffaele

    2016-06-01

    A set of ceria, ceria-zirconia (Ce 80 at.%, Zr 20 at.%), ceria-praseodymia (Ce 80 at.%, Pr 20 at.%) and ceria-zirconia-praseodymia (Ce 80 at.%, Zr 10 at.% and Pr 10 at.%) catalysts has been prepared by the solution combustion synthesis (SCS). The effects of Zr and Pr as dopants on ceria have been studied in CO and soot oxidation reactions. All the prepared catalysts have been characterized by complementary techniques, including XRD, FESEM, N2 physisorption at -196 °C, H2-temperature-programmed reduction, and X-ray photoelectron spectroscopy to investigate the relationships between the structure and composition of materials and their catalytic performance. Better results for CO oxidation have been obtained with mixed oxides (performance scale, Ce80Zr10Pr10 > Ce80Zr20 > Ce80Pr20) rather than pure ceria, thus confirming the beneficial role of multicomponent catalysts for this prototypical reaction. Since CO oxidation occurs via a Mars-van Krevelen (MvK)-type mechanism over ceria-based catalysts, it appears that the presence of both Zr and Pr species into the ceria framework improves the oxidation activity, via collective properties, such as electrical conductivity and surface or bulk oxygen anion mobility. On the other hand, this positive effect becomes less prominent in soot oxidation, since the effect of catalyst morphology prevails.

  15. Cor a 14 is the superior serological marker for hazelnut allergy in children, independent of concomitant peanut allergy

    DEFF Research Database (Denmark)

    Eller, Esben; Mortz, Charlotte G; Bindslev-Jensen, Carsten

    2016-01-01

    BACKGROUND: Hazelnut is the most frequent cause of tree-nut allergy, but up to half of all children with hazelnut allergy additionally suffers from peanut allergy. Our aim was to identify diagnostic values of the most promising serological markers (Cor a 9 and Cor a 14) and to address the influen...... children sensitized to birch pollen protein Bet v 1. This article is protected by copyright. All rights reserved.......BACKGROUND: Hazelnut is the most frequent cause of tree-nut allergy, but up to half of all children with hazelnut allergy additionally suffers from peanut allergy. Our aim was to identify diagnostic values of the most promising serological markers (Cor a 9 and Cor a 14) and to address the influence...... of concomitant peanut allergy and PR10 sensitization. METHOD: We included 155 children suspected off hazelnut allergy and challenged according to guidelines. Concomitant allergy to peanuts was verified or ruled out by challenge. Skin Prick Test, s-IgE and CRD to hazelnut, peanut, PR10 and LPT protein...

  16. CO and Soot Oxidation over Ce-Zr-Pr Oxide Catalysts.

    Science.gov (United States)

    Andana, Tahrizi; Piumetti, Marco; Bensaid, Samir; Russo, Nunzio; Fino, Debora; Pirone, Raffaele

    2016-12-01

    A set of ceria, ceria-zirconia (Ce 80 at.%, Zr 20 at.%), ceria-praseodymia (Ce 80 at.%, Pr 20 at.%) and ceria-zirconia-praseodymia (Ce 80 at.%, Zr 10 at.% and Pr 10 at.%) catalysts has been prepared by the solution combustion synthesis (SCS). The effects of Zr and Pr as dopants on ceria have been studied in CO and soot oxidation reactions. All the prepared catalysts have been characterized by complementary techniques, including XRD, FESEM, N2 physisorption at -196 °C, H2-temperature-programmed reduction, and X-ray photoelectron spectroscopy to investigate the relationships between the structure and composition of materials and their catalytic performance. Better results for CO oxidation have been obtained with mixed oxides (performance scale, Ce80Zr10Pr10 > Ce80Zr20 > Ce80Pr20) rather than pure ceria, thus confirming the beneficial role of multicomponent catalysts for this prototypical reaction. Since CO oxidation occurs via a Mars-van Krevelen (MvK)-type mechanism over ceria-based catalysts, it appears that the presence of both Zr and Pr species into the ceria framework improves the oxidation activity, via collective properties, such as electrical conductivity and surface or bulk oxygen anion mobility. On the other hand, this positive effect becomes less prominent in soot oxidation, since the effect of catalyst morphology prevails. PMID:27255898

  17. Screening Rice Cultivars for Resistance to Bacterial Leaf Blight.

    Science.gov (United States)

    Fred, Agaba Kayihura; Kiswara, Gilang; Yi, Gihwan; Kim, Kyung-Min

    2016-05-28

    Bacterial leaf blight (BLB) caused by Xanthomonas oryzae pv. oryzae (Xoo) is one of the most serious threats to rice production. In this study, screening of rice for resistance to BLB was carried out at two different times and locations; that is, in a greenhouse during winter and in an open field during summer. The pathogenicity of Xoo race K1 was tested on 32 Korean rice cultivars. Inoculation was conducted at the maximum tillering stage, and the lesion length was measured after 14 days of inoculation. Five cultivars, Hanareum, Namcheon, Samgdeok, Samgang, and Yangjo, were found to be resistant in both the greenhouse and open-field screenings. Expression of the plant defense-related genes JAmyb, OsNPR1, OsPR1a, OsWRKY45, and OsPR10b was observed in resistant and susceptible cultivars by qRT-PCR. Among the five genes tested, only OsPR10b showed coherent expression with the phenotypes. Screening of resistance to Xoo in rice was more accurate when conducted in open fields in the summer cultivation period than in greenhouses in winter. The expression of plant defenserelated genes after bacterial inoculation could give another perspective in elucidating defense mechanisms by using both resistant and susceptible individuals. PMID:26869604

  18. Prospecting plant growth promoting bacteria and cyanobacteria as options for enrichment of macro- and micronutrients in grains in rice–wheat cropping sequence

    Directory of Open Access Journals (Sweden)

    Anuj Rana

    2015-12-01

    Full Text Available The influence of plant growth promoting bacteria (PGPB and cyanobacteria, alone and in combination, was investigated on micronutrient enrichment and yield in rice–wheat sequence, over a period of two years. Analysis of variance (ANOVA in both crops indicated significant differences in soil dehydrogenase activity and micronutrient enrichment in grains (Fe, Zn in rice, and Cu, Mn in wheat. The combined inoculation of Anabaena oscillarioides CR3, Brevundimonas diminuta PR7, and Ochrobactrum anthropi PR10 (T6 significantly increased nitrogen, phosphorus, and potassium (NPK content and improved rice yield by 21.2%, as compared to the application of recommended dose of NPK fertilizers (T2. The treatment T5 (Providencia sp. PR3 + B. diminuta PR7 + O. anthropi PR10 recorded an enhancement of 13–16% in Fe, Zn, Cu, and Mn concentrations, respectively, in rice grains. In wheat, Providencia sp. PW5 (T6 recorded the highest yield (5.23 Mg ha−1 and significantly higher enrichment of Fe and Cu (44–45% in the grains. This study highlighted the promise of combinations of cyanobacteria/bacteria and their synergistic action in biofortification and providing savings of 40–60 kg N ha−1. Future focus needs to be towards integrating such promising environment-friendly and environmentally sustainable options in nutrient management strategies for this cropping sequence.

  19. Proteomic analysis of the compatible interaction between Vitis vinifera and Plasmopara viticola.

    Science.gov (United States)

    Milli, Alberto; Cecconi, Daniela; Bortesi, Luisa; Persi, Anna; Rinalducci, Sara; Zamboni, Anita; Zoccatelli, Gianni; Lovato, Arianna; Zolla, Lello; Polverari, Annalisa

    2012-02-01

    We analyzed the proteome of grapevine (Vitis vinifera) leaves 24, 48 and 96 h post infection (hpi) with the downy mildew pathogen Plasmopara viticola. Total proteins were separated on 2-DE gels. By MS analysis, we identified 82 unique grapevine proteins differentially expressed after infection. Upregulated proteins were often included in the functional categories of general metabolism and stress response, while proteins related to photosynthesis and energy production were mostly downregulated. As expected, the activation of a defense reaction was observed more often at the late time point, consistent with the establishment of a compatible interaction. Most proteins involved in resistance were isoforms of different PR-10 pathogenesis-related proteins. Although >50 differentially expressed protein isoforms were observed at 24 and 96 hpi, only 18 were detected at 48 hpi and no defense-related proteins were among this group. This profile suggests a transient breakdown in defense responses accompanying the onset of disease, further supported by gene expression analyses and by a western blot analysis of a PR-10 protein. Our data reveal the complex modulation of plant metabolism and defense responses during compatible interactions, and provide insight into the underlying molecular processes which may eventually yield novel strategies for pathogen control in the field. PMID:22120121

  20. Development of integrated superconducting devices for signal preprocessing. Final report; Entwicklung supraleitender Bausteine der Signalvorverarbeitung. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Biehl, M.; Koch, R.; Neuhaus, M.; Scherer, T.; Jutzi, W.

    1998-02-01

    SPICE and CADENCE based tools for designing, simulating and optimizing SFQ and RSFQ circuits have been developed as well as a standard cell library corresponding to the fabrication technology established at the IEGI. A 12 bit flux shuttle shift register using Nb/Al Josephson junctions with a new write and readout gate has been fabricated and tested successfully; the power dissipation is 9 nW/bit/GHz. A pseudo random pulse generator was developed correspondingly. Simulations of RSFQ toggle flipflops during a large number of clock cycles demonstrated that the digital performance of counters is limited to clock frequencies below 100 GHz by dynamic effects, especially of parasitic inductances. Therefore dc measurements based on the voltage-frequency Josephson relationship must be followed by real time measurements of single SFQ word pulses. A four stage Nb based RSFQ counter in a coplanar waveguide test jig was tested up to a frequency of 2 GHz, limited by the available 32 bit pattern generator and the bandwith of the sampling oscilloscope, yielding bit error rates of about 10{sup -12}. Using YBCO technology, a 4 bit SFQ shift register (T=40 K) as well as miniaturized coplanar microwave devices for satellite and communication applications at 10 GHz (T=77 K) have been designed and fabricated. A 4 bit instantaneous real time frequency meter (IFM) and a microwave filter with a 3-dB bandwidth of only 1.8% have been mounted on the cold head of a split-cycle Stirling cooler (AEG, 1.5 W rate at 80 K) and tested successfully. Hybrid devices, e.g. amplifiers and oscillators, combining active semiconductor components and low loss coplanar YBCO transmission lines operated at 77 K seem very promising. (orig.) [Deutsch] Werkzeuge der Auslegung, Simulation und Optimierung von SFQ- und RSFQ-Schaltungen auf der Basis von SPICE und CADENCE wurden am IEGI entwickelt und eingesetzt. Eine auf die Technologien des Instituts zugeschnittene Bibliothek von Zellen ist vorhanden. Mit der

  1. The natural non-protein amino acid N-β-methylamino-L-alanine (BMAA) is incorporated into protein during synthesis.

    Science.gov (United States)

    Glover, W Broc; Mash, Deborah C; Murch, Susan J

    2014-11-01

    N-β-methylamino-L-alanine (BMAA) is an amino acid produced by cyanobacteria and accumulated through trophic levels in the environment and natural food webs. Human exposure to BMAA has been linked to progressive neurodegenerative diseases, potentially due to incorporation of BMAA into protein. The insertion of BMAA and other non-protein amino acids into proteins may trigger protein misfunction, misfolding and/or aggregation. However, the specific mechanism by which BMAA is associated with proteins remained unidentified. Such studies are challenging because of the complexity of biological systems and samples. A cell-free in vitro protein synthesis system offers an excellent approach for investigation of changing amino acid composition in protein. In this study, we report that BMAA incorporates into protein as an error in synthesis when a template DNA sequence is used. Bicinchoninic acid assay of total protein synthesis determined that BMAA effectively substituted for alanine and serine in protein product. LC-MS/MS confirmed that BMAA was selectively inserted into proteins in place of other amino acids, but isomers N-(2-aminoethyl)glycine (AEG) and 2,4-diaminobutyric acid (DAB) did not share this characteristic. Incorporation of BMAA into proteins was significantly higher when genomic DNA from post-mortem brain was the template. About half of BMAA in the synthetic proteins was released with denaturation with sodium dodecylsulfonate and dithiothreitol, but the remaining BMAA could only be released by acid hydrolysis. Together these data demonstrate that BMAA is incorporated into the amino acid backbone of proteins during synthesis and also associated with proteins through non-covalent bonding. PMID:25096519

  2. Ma tean, et päike liigub : [luuletused] / Hando Runnel

    Index Scriptorium Estoniae

    Runnel, Hando, 1938-

    1998-01-01

    Sisu: Ma tean et päike liigub ; Ma tean, et ma tulen kord jälle ; Jaanipäevaks kõrgeks kasvab rohi ; Luigelaul ; Pühapäev lastepargis ; Kui päike loojub ; Kohvik ; "Kui veel..." ; Muruks kummel, muruks linnurohi ; Ei mullast sul olegi enam suurt lugu ; Vanaema ; Hauakiri ; Testament ; Üks veski seisab vete pääl ; Kui sa tuled ; Töölispoiss ; Sõbrad ; Mõnitus ; Naine naturaalne ; Kõigevägevam ja kõigelahjem ; Kehv kõhn poiss ; Keldrikakand ; Loogikaloksed ; Tume rahvas ; Võllalaul ; Kodu ; Ei ole ma käinud Komorras ; Mäletaja ; Hingede aeg ; Kui pidud on peetud ; Muusikat olgu ; Kaua sa kannatad ; Üle maa, üle mäda ; Jutt ; "Mis on me pääl, kas jumalate viha..." ; Jälle hakkab ; Müüt ; Vähid ; Muuda ennast ; Mõistmine ; Lindprii ; Kolm külameest 1-3 ; Meie õnn on kindel ; Ei saa me läbi Lätita ; Saadik ; Jälle ; Unistus ; Mets on kõrge ; "Marssis majja majuline..." ; "Üks väga vana rahvas..." ; "Ma polegi isa näinud..." ; "Ilus on ikkagi isamaa pale ; "Kiri algab kirikust..." ; "Mehepoegi läheb pätiks..." ; "Isa oli joodik..." "Hiired veavad pabereid..." ; "Talisman on Talli-Mannil..." ; "Täna ma luuletan läbi öö..." ; "Küll ma ootasin sind tollel tuulisel õhtul..." ; "Me liigume loogeldes loojangu poole... 1-10"

  3. Design and characterizations of two novel cellulases through single-gene shuffling of Cel12A (EG3) gene from Trichoderma reseei.

    Science.gov (United States)

    Yenenler, Aslı; Sezerman, Osman Uğur

    2016-06-01

    Cellulases have great potential to be widely used for industrial applications. In general, naturally occurring cellulases are not optimized and limited to meet the industrial needs. These limitations lead to demand for novel cellulases with enhanced enzymatic properties. Here, we describe the enzymatic and structural properties of two novel enzymes, EG3_S1 and EG3_S2, obtained through the single-gene shuffling approach of Cel12A(EG3) gene from Trichoderma reseei EG3_S1 and EG3_S2 shuffled enzymes display 59 and 75% identity in protein sequence with respect to native, respectively. Toward 4-MUC, the minimum activity of EG3_S1 was reported as 5.9-fold decrease in native at 35°C, whereas the maximum activity of EG3_S2 was reported as 15.4-fold increase in native activity at 40°C. Also, the diminished enzyme activity of EG3_S1 was reported within range of 0.6- to 0.8-fold of native and within range of 0.5- to 0.7-fold of native toward CMC and Na-CMC, respectively. For EG3_S2 enzyme, the improved enzymatic activities within range of 1.1- to 1.4-fold of native and within range of 1.1- to 1.6-fold of native were reported toward CMC and Na-CMC, respectively. Moreover, we have reported 6.5-fold increase in the kcat/Km ratio of EG3_S2 with respect to native and suggested EG3_S2 enzyme as more efficient catalysis for hydrolysis reactions than its native counterpart. PMID:27129352

  4. 52 years of Kahl pilot nuclear power station. A special chapter in German technology history come to an end; 52 Jahre Versuchsatomkraftwerk Kahl. Ein besonderes Kapitel deutscher Technikgeschichte ist zu Ende

    Energy Technology Data Exchange (ETDEWEB)

    Hackel, Walter [VAK GmbH, Karlstein am Main (Germany)

    2011-06-15

    Since October 2010, the site of the former Kahl Experimental Nuclear Power Station (VAK) has been returned to the desired green-field condition. A special chapter in the German history of the use of nuclear power, which has played a major role in the technical and economic development of this energy resource, has come to an end after 52 years. When nuclear power pioneer Heinrich Mandel ordered VAK from AEG in 1958, the mood associated with using this source of energy was different from what it is now. Politicians of all parties were euphoric about the use of nuclear power, while power plant operators were more reluctant. Finally, also RWE was convinced and planned the construction of VAK as a joint venture with the Bayernwerk AG (now E.ON) utility in Grosswelzheim, Bavaria. The objective was clear: 'The order was placed so that the atomic power plant to be built could be used to accumulate experience in planning, operation, in capital cost and operating cost.' After a construction period of only 29 months, VAK was commissioned on November 13, 1960 as the first German nuclear power plant. The US-designed boiling water reactor had been designed for a power of 16,000 kilowatt. After synchronization with the power grid, the first electricity produced from nuclear power in Germany was fed into the interconnected grid system on June 17, 1961. In its 25 years of operation, VAK proved to be a valuable experimental facility. The plant was decommissioned on November 25, 1985 as planned. In order to maintain its experimental character also beyond the operating phase, the operators had agreed from the beginning to demolish VAK completely to green-field conditions immediately after the end of operations. This became official on May 17, 2010, when the plant was released from the scope of the Atomic Energy Act and was granted a permit for demolition under conventional building law. (orig.)

  5. Determination of BMAA and three alkaloid cyanotoxins in lake water using dansyl chloride derivatization and high-resolution mass spectrometry.

    Science.gov (United States)

    Roy-Lachapelle, Audrey; Solliec, Morgan; Sauvé, Sébastien

    2015-07-01

    A new analytical method was developed for the detection of alkaloid cyanotoxins in harmful algal blooms. The detection of the nonproteinogenic amino acid β-N-methylamino-L-alanine (BMAA) and two of its conformation isomers, 2,4-diaminobutyric acid (DAB) and N-(2-aminoethyl) glycine (AEG), as well as three alkaloid cyanotoxins, anatoxin-a (ANA-a), cylindrospermopsin (CYN), and saxitoxin (STX), is presented. The use of a chemical derivatization with dansyl chloride (DNS) allows easier separation with reversed phase liquid chromatography. Detection with high-resolution mass spectrometry (HRMS) with the Q-Exactive enables high selectivity with specific fragmentation as well as exact mass detection, reducing considerably the possibilities of isobaric interferences. Previous to analysis, a solid phase extraction (SPE) step is used for purification and preconcentration. After DNS derivatization, samples are submitted to ultra high-performance liquid chromatography coupled with heated electrospray ionisation and the Q-Exactive mass spectrometer (UHPLC-HESI-HRMS). With an internal calibration using isotopically-labeled DAB-D3, the method was validated with good linearity (R (2)  > 0.998), and method limits of detection and quantification (MLD and MLQ) for target compounds ranged from 0.007 to 0.01 μg L(-1) and from 0.02 to 0.04 μg L(-1), respectively. Accuracy and within-day/between-days variation coefficients were below 15%. SPE recovery values ranged between 86 and 103%, and matrix effects recovery values ranged between 75 and 96%. The developed analytical method was successfully validated with 12 different lakes samples, and concentrations were found ranging between 0.009 and 0.3 μg L(-1) except for STX which was not found in any sample. PMID:25935679

  6. A study on nitroimidazole-99mTc(CO)3 complexes as hypoxia marker: Some observations towards possible improvement in in vivo efficacy

    International Nuclear Information System (INIS)

    Introduction: Hypoxia plays a negative role in the clinical management of cancer. Detection of hypoxic status of a cancer is important for selecting patients for hypoxia directed therapy. Though [18 F]fluoromisonidazole ([18 F]FMISO), a PET radiopharmaceutical, is presently being used in the clinic for the detection of hypoxia, considering the logistical advantages of 99mTc and wider availability of SPECT scanners, a radiopharmaceutical based on this isotope may find wider applicability. Methods: Nine nitroimidazole (2-, 4- and 5-nitroimidazole) ligands were synthesized and radiolabeled using [99mTc(CO)3(H2O)3]+ precursor to obtain a group of complexes possessing different single electron reduction potential (SERP), overall charge and lipophilicity, the three attributes which decide the efficacy of the complex to detect hypoxic cells in vivo. The nitroimidazole-99mTc(CO)3 complexes as well as [18 F]FMISO were evaluated in fibrosarcoma tumor bearing mice. Results: The 99mTc(CO)3 complexes of nitroimidazole iminodiacetic acid (IDA) showed better tumor uptake and retention than nitroimidazole diethylenetriamine (DETA) and nitroimidazole aminoethylglycine (AEG) complexes. Tumor uptake observed with [18 F]FMISO was higher than any of the nitroimidazole-IDA- 99mTc(CO)3 complexes. However, [18 F]FMISO clearance from tumor was found to be faster compared to 2-nitroimidazole-IDA-99mTc(CO)3 complex. Observed tumor uptake and retention of the radiotracers evaluated could be correlated to its blood clearance pattern and SERP. Conclusions: Results of the present study indicated that uptake of the radiotracer in tumor is closely associated with its rate of clearance from blood. The study also indicated that along with SERP, clearance of radiotracer from blood (net effect of charge and lipophilicity) is a critical factor which decides the in vivo efficacy of the hypoxia detecting radiopharmaceutical

  7. Mu isamaa on minu arm : [luuletused] / Lydia Koidula ; [Impressioonid]: Viiu Härm

    Index Scriptorium Estoniae

    Koidula, Lydia, pseud., 1843-1886

    2004-01-01

    Sisu: Mu isamaa on minu arm! ; Eestimaa ; Eestimaa, su hiilgav rada ; Õpetus ; Veel! ; Ülesse unest! ; Ta aina sirgub usalduse rinnal ; Igatsus ; Isamaast ikka! ; Õige! ; Halasta! ; Teretus ; See on su isamaa! ; Üks ; Kaebus ; Kallim kingitus ; Eesti naine ; Kodu ; Miks sa nutad? ; Jutt ; Puhtad pihud ; Mul seisab meeles alati ; Ei jäänud ; Üht eesti laulu ; Mu isamaa, nad olid matnud ; Üksmeel ; Neid austa! ; Emajõe kaldal ; Eesti kotkas ; Sind surmani ; Tulge! ; Eesti muld ja eesti süda ; Sinu külge! ; Isamaa, usk, rahvas! ; Laulu sisu ; Tule! ; Teretus ; Jälle isamaa! ; Mõtted Toomemäel ; Ära looda, et sind usun ; Pühapäeva kellad ; Kosjakased ; Kaks selget silma ; Kõik muutunud ; Kase varjul kogemata ; Laulupisarad ; Kui ta teaks ; Kui vähe! ; Kadunud ; Laulu allikas ; Kaljukiri ; Näed kõrgeid pilvi - ; Ööbik ; Pikalt kiigub paadike ; Tee lahti! ; Aeg ; Ilu ; Noormehe igatsus ; Kolm sõna ; Hoia oma õnne! ; Kui sa kuulsid ; Igatsus ; Haual ; Kurtes ; Neiu kanga juures ; Hällilaul ; Õnn ; Südame põhjas ; Ülejäänud ; Puhkama ; Õhtul ; Lootus ; Lähedal ; Ema süda ; Saeveski ; Sügisemõtteid ; Kasepuu ; Kevade on sala tulnud ; Kuu ja künnilind ; Linnu lennul ; Ööbik ; Õhtu rahu ; Kuningas kevade ; Tühi pesa ; Järv ; Täis laulu ; Õhtu pühitsus ; Rüütli mõrsja ; Narva neitsi ; Akadeemik dr. F. J. Wiedemann'ile ; Sõber ; Palu andeks! ; Kuningatel kümme kinki ; Tasa, tasa! ; Küsimused ; Mälestus ; Koidula õnn ; Ümber ühe ilmakera; Ise ; Enne surma Eestimaale

  8. 52 years of Kahl pilot nuclear power station. A special chapter in German technology history come to an end

    International Nuclear Information System (INIS)

    Since October 2010, the site of the former Kahl Experimental Nuclear Power Station (VAK) has been returned to the desired green-field condition. A special chapter in the German history of the use of nuclear power, which has played a major role in the technical and economic development of this energy resource, has come to an end after 52 years. When nuclear power pioneer Heinrich Mandel ordered VAK from AEG in 1958, the mood associated with using this source of energy was different from what it is now. Politicians of all parties were euphoric about the use of nuclear power, while power plant operators were more reluctant. Finally, also RWE was convinced and planned the construction of VAK as a joint venture with the Bayernwerk AG (now E.ON) utility in Grosswelzheim, Bavaria. The objective was clear: 'The order was placed so that the atomic power plant to be built could be used to accumulate experience in planning, operation, in capital cost and operating cost.' After a construction period of only 29 months, VAK was commissioned on November 13, 1960 as the first German nuclear power plant. The US-designed boiling water reactor had been designed for a power of 16,000 kilowatt. After synchronization with the power grid, the first electricity produced from nuclear power in Germany was fed into the interconnected grid system on June 17, 1961. In its 25 years of operation, VAK proved to be a valuable experimental facility. The plant was decommissioned on November 25, 1985 as planned. In order to maintain its experimental character also beyond the operating phase, the operators had agreed from the beginning to demolish VAK completely to green-field conditions immediately after the end of operations. This became official on May 17, 2010, when the plant was released from the scope of the Atomic Energy Act and was granted a permit for demolition under conventional building law. (orig.)

  9. Cyanobacteria and cyanotoxins are present in drinking water impoundments and groundwater wells in desert environments.

    Science.gov (United States)

    Chatziefthimiou, Aspassia D; Metcalf, James S; Glover, W Broc; Banack, Sandra A; Dargham, Soha R; Richer, Renee A

    2016-05-01

    Desert environments and drylands experience a drastic scarcity of water resources. To alleviate dependence on freshwater for drinking water needs, countries have invested in infrastructure development of desalination plants. Collectively, the countries of the Arabian Gulf produce 45% of the world's desalinated water, which is stored in dams, mega-reservoirs and secondary house water tanks to secure drinking water beyond daily needs. Improper storage practices of drinking water in impoundments concomitant with increased temperatures and light penetration may promote the growth of cyanobacteria and accumulation of cyanotoxins. To shed light on this previously unexplored research area in desert environments, we examined drinking and irrigation water of urban and rural environments to determine whether cyanobacteria and cyanotoxins are present, and what are the storage and transportation practices as well as the environmental parameters that best predict their presence. Cyanobacteria were present in 80% of the urban and 33% of the rural water impoundments. Neurotoxins BMAA, DAB and anatoxin-a(S) were not detected in any of the water samples, although they have been found to accumulate in the desert soils, which suggests a bioaccumulation potential if they are leached into the aquifer. A toxic BMAA isomer, AEG, was found in 91.7% of rural but none of the urban water samples and correlated with water-truck transportation, light exposure and chloride ions. The hepatotoxic cyanotoxin microcystin-LR was present in the majority of all sampled impoundments, surpassing the WHO provisional guideline of 1 μg/l in 30% of the urban water tanks. Finally, we discuss possible management strategies to improve storage and transportation practices in order to minimize exposure to cyanobacteria and cyanotoxins, and actions to promote sustainable use of limited water resources. PMID:26921462

  10. Transcriptional profiling of pea ABR17 mediated changes in gene expression in Arabidopsis thaliana

    Directory of Open Access Journals (Sweden)

    Deyholos Michael K

    2008-09-01

    Full Text Available Abstract Background Pathogenesis-related proteins belonging to group 10 (PR10 are elevated in response to biotic and abiotic stresses in plants. Previously, we have shown a drastic salinity-induced increase in the levels of ABR17, a member of the PR10 family, in pea. Furthermore, we have also demonstrated that the constitutive expression of pea ABR17 cDNA in Arabidopsis thaliana and Brassica napus enhances their germination and early seedling growth under stress. Although it has been reported that several members of the PR10 family including ABR17 possess RNase activity, the exact mechanism by which the aforementioned characteristics are conferred by ABR17 is unknown at this time. We hypothesized that a study of differences in transcriptome between wild type (WT and ABR17 transgenic A. thaliana may shed light on this process. Results The molecular changes brought about by the expression of pea ABR17 cDNA in A. thaliana in the presence or absence of salt stress were investigated using microarrays consisting of 70-mer oligonucleotide probes representing 23,686 Arabidopsis genes. Statistical analysis identified number of genes which were over represented among up- or down-regulated transcripts in the transgenic line. Our results highlight the important roles of many abscisic acid (ABA and cytokinin (CK responsive genes in ABR17 transgenic lines. Although the transcriptional changes followed a general salt response theme in both WT and transgenic seedlings under salt stress, many genes exhibited differential expression patterns when the transgenic and WT lines were compared. These genes include plant defensins, heat shock proteins, other defense related genes, and several transcriptional factors. Our microarray results for selected genes were validated using quantitative real-time PCR. Conclusion Transcriptional analysis in ABR17 transgenic Arabidopsis plants, both under normal and saline conditions, revealed significant changes in abundance of

  11. Fampridine-PR (prolonged released 4-aminopyridine) is not effective in patients with inflammatory demyelination of the peripheral nervous system.

    Science.gov (United States)

    Leussink, Verena-Isabell; Stettner, Mark; Warnke, Clemens; Hartung, Hans-Peter

    2016-06-01

    Fampridine-PR is a voltage-gated potassium channel inhibitor potentially improving nerve conduction in demyelinated axons. Based on its established clinical efficacy in patients with demyelination in the central nervous system, we assessed if fampridine-PR is also effective in patients with inflammatory demyelination of the peripheral nerve. In this small open-label study, 10 patients with chronic inflammatory demyelinating polyradiculoneuropathy (CIDP) were treated with fampridine-PR 10 mg BID for 28 days and assessed clinically as well as by nerve conduction studies. In this study, Fampridine-PR failed to improve CIDP based on clinical measures and nerve conduction studies. Our findings suggest that Fampridine-PR appears to be ineffective in demyelinating polyneuropathies. These observations may indicate a more complex mode of action beyond improving action potential conduction in demyelinated axons. PMID:26968589

  12. Overexpression of Rice Wall-Associated Kinase 25 (OsWAK25) Alters Resistance to Bacterial and Fungal Pathogens.

    Science.gov (United States)

    Harkenrider, Mitch; Sharma, Rita; De Vleesschauwer, David; Tsao, Li; Zhang, Xuting; Chern, Mawsheng; Canlas, Patrick; Zuo, Shimin; Ronald, Pamela C

    2016-01-01

    Wall-associated kinases comprise a sub-family of receptor-like kinases that function in plant growth and stress responses. Previous studies have shown that the rice wall-associated kinase, OsWAK25, interacts with a diverse set of proteins associated with both biotic and abiotic stress responses. Here, we show that wounding and BTH treatments induce OsWAK25 transcript expression in rice. We generated OsWAK25 overexpression lines and show that these lines exhibit a lesion mimic phenotype and enhanced expression of rice NH1 (NPR1 homolog 1), OsPAL2, PBZ1 and PR10. Furthermore, these lines show resistance to the hemibiotrophic pathogens, Xanthomonas oryzae pv. oryzae (Xoo) and Magnaporthe oryzae, yet display increased susceptibility to necrotrophic fungal pathogens, Rhizoctonia solani and Cochliobolus miyabeanus. PMID:26795719

  13. Solid state chemistry of rare earth oxides. Technical progress report, 1975--1976

    International Nuclear Information System (INIS)

    It has been demonstrated that electron microscope images obtained at about 3A resolution for Pr7O12 are in agreement with calculated images based upon known structures. This establishes the efficacy of crystal structure image interpretation in structural terms, including the defect structure and mechanism of phase reactions, for these types of related phases whose structures are as yet beyond conventional means to determine. Further work on the epsilon (Pr10O18) phase is reported both utilizing electron optical methods and single crystal X-ray techniques. The ternary ceramic system HfO2.xEr2O3 is being examined using electron optical techniques and ordering not hitherto reported is being observed. An interactive crystal structure image calculation system is being developed which will permit the immediate comparison of enhanced images synthesized from trial structures (including defects) and displayed in juxtaposition on a graphics unit. 22 fig

  14. Prandtl and Rayleigh number dependence of heat transport in high Rayleigh number thermal convection

    CERN Document Server

    Stevens, Richard J A M; Verzicco, Roberto

    2011-01-01

    Results from direct numerical simulation for three-dimensional Rayleigh-B\\'enard convection in samples of aspect ratio $\\Gamma=0.23$ and $\\Gamma=0.5$ up to Rayleigh number $Ra=2\\times10^{12}$ are presented. This includes the largest spatially resolved turbulent flow simulation ever performed in a closed system, setting a benchmark also for experiments. In addition, the broad range of Prandtl numbers $0.5<Pr<10$ is considered. We do not see any increase in $Nu/Ra^{1/3}$, neither due to $Pr$ number effects, nor due to a constant heat flux boundary condition at the bottom plate instead of constant temperature boundary conditions.

  15. R-CHOP方案初治B细胞非霍奇金淋巴瘤34例临床分析%Clinical analysis of initial CHOP regimen treatment for 34 cases of B cell non-Hodgkin lymphoma

    Institute of Scientific and Technical Information of China (English)

    王华; 姚红霞; 吴巨峰

    2010-01-01

    目的 观察R-CHOP方案治疗初治B细胞非霍奇金淋巴瘤(NHL)的疗效、安全性及不良反应.方法 回顾性分析2003年1月至2008年1月采用R-CHOP方案治疗34例初治B细胞NHL的疗效、安全性及不良反应.结果 CR21例(61.8%),PR 10例(29.4%),CR+PR 31例(91.2%),SD 1例,PD 2例.结论 R-CHOP方案治疗初治B细胞NHL疗效显著,效价比高,不良反应小,耐受好.

  16. Analysis of microstructure and properties of multilayer coatings produced by laser cladding

    Science.gov (United States)

    Bykovskiy, D. P.; Petrovskiy, V. N.; Dzhumaev, P. S.; Polskiy, V. I.; Yermachenko, V. M.

    2016-02-01

    Purpose of the work is to prepare multilayer coatings corresponding to specified requirements to recovery and improvement of surface details. Requirements to coatings: providing durable and reliable adhesion base and filler materials, absence of pores, cracks, delaminations, reducing mixing metal base and cladding. We used iron-based PR-10R6M5 and tungsten carbide Hoganas 44712 powders. Experimental determination of the optimal technological mode of application of the single track, the coefficient of overlapping tracks to create a full layer, the angle of the second cladding layer, relative to the first one and, finally, the determination of the optimal additive tungsten carbide to achieve increased durability were produced to fulfill these requirements.

  17. Ferroelectric and dielectric properties of Sr2-x(Na, K)xBi4Ti5O18 lead-free piezoelectric ceramics

    International Nuclear Information System (INIS)

    (Na, K)-doped Sr2Bi4Ti5O18 (SBTi) bismuth layer structure ferroelectric ceramics were prepared by the solid-state reaction method. Pure bismuth-layered structural Sr2-x(Na, K)xBi4Ti5O18 (x=0.1, 0.2, 0.3, and 0.4) ceramics with uniform grain size were obtained in this work. The effects of (Na, K)-doping on the dielectric, ferroelectric and piezoelectric properties of SBTi ceramics were investigated. Results showed that (Na, K)-doping caused the Curie temperature of SBTi ceramics to shift to higher temperature and enhanced the ferroelectric and piezoelectric properties. At x=0.2, the ceramics exhibited optimum properties with d33=20 pC/N, Pr=10.3 μC/cm2, and Tc=324 oC.

  18. Entropy and energy spectra in low-Prandtl-number convection with rotation

    CERN Document Server

    Pharasi, Hirdesh K; Bhattacharjee, Jayanta K

    2014-01-01

    We present results for entropy and kinetic energy spectra computed from direct numerical simulations for low-Prandtl-number ($Pr 10^3$ for the rotation rates considered here. The entropy in the upper branch also shows scaling behavior with $k$, but the scaling exponent decreases with increasing $Ta$ for all $r$. The energy spectrum $E_v(k)$ is also found to scale with the wave number $k$ as $k^{-1.4\\pm 0.1}$ for $r > 10^3$. The scaling exponent for the energy spectrum and the lower branch of the entropy spectrum vary between $-1.7$ to $-2.4$ for lower values of $r$ ($< 10^3$). We also provide some simple arguments based on the variation of the Kolmogorov picture to support the results of simulations.

  19. Seltenerdethenidhalogenide Ln2n+6(C2)n+4X2n+2: Darstellung, Struktur, Verwachsung und Verzwilligung

    OpenAIRE

    Mattausch, Hansjürgen; Kienle, Lorenz; Duppel, Viola; Hoch, Constantin; Simon, Arndt

    2009-01-01

    Abstract The compounds Ln10(C2)6X6 are formed by heating mixtures of LnX3, Ln und C in tantalum capsules under Ar atmosphere with the ratio LnX3:Ln:C = 2:4:6 for La10(C2)6Br6 at 1040 ?C, 30 d (yield ca. 20 %), Ce10(C2)6Br6 at 1200 ?C, 12 d, (80 %), Pr10(C2)6Br6 at 1140 ?C, 5 d, (20 %) and 2:8:12 for Gd10(C2)6Cl6 at 1170 ?C, 39 d, (100 %). They crystallize isotypical in a new structure type in C2/m with a = 22.809(5) ?, b = 3.9855(8) ?, c = 16.599(3) ?, ? = 123.32(3)? (La10(C2)6Br6)...

  20. Expression of genes involved in the salicylic acid pathway in type h1 thioredoxin transiently silenced pepper plants during a begomovirus compatible interaction.

    Science.gov (United States)

    Luna-Rivero, Marianne S; Hernández-Zepeda, Cecilia; Villanueva-Alonzo, Hernán; Minero-García, Yereni; Castell-González, Salvador E; Moreno-Valenzuela, Oscar A

    2016-04-01

    The type-h thioredoxins (TRXs) play a fundamental role in oxidative stress tolerance and defense responses against pathogens. In pepper plants, type-h TRXs participate in the defense mechanism against Cucumber mosaic virus. The goal of this study was to analyze the role of the CaTRXh1-cicy gene in pepper plants during compatible interaction with a DNA virus, the Euphorbia mosaic virus-Yucatan Peninsula (EuMV-YP). The effects of a transient silencing of the CaTRXh1-cicy gene in pepper plants wëre evaluated by observing the accumulation of viral DNA and the visible symptoms of pepper plants under different treatments. The accumulation of salicylic acid (SA) and the relative expression of the defense genes NPR1 and PR10 were also evaluated. Results showed that viral DNA accumulation was higher in transiently CaTRXh1-cicy silenced plants that were also infected with EuMV-YP. Symptoms in these plants were more severe compared to the non-silenced plants infected with EuMV-YP. The SA levels in the EuMV-YP-infected plants were rapidly induced at 1 h post infection (hpi) in comparison to the non-silenced plants inoculated with EuMV-YP. Additionally, in pepper plants infected with EuMV-YP, the expression of NPR1 decreased by up to 41 and 58 % at 28 days post infection (dpi) compared to the non-silenced pepper plants infected with only EuMV-YP and healthy non-inoculated pepper plants, respectively. PR10 gene expression decreased by up to 70 % at 28 dpi. Overall, the results indicate that the CaTRXh1-cicy gene participates in defense mechanisms during the compatible interaction of pepper plants with the EuMV-YP DNA virus. PMID:26606929

  1. Pr2Fe14B/α-Fe nanocomposites for thermal applications

    International Nuclear Information System (INIS)

    In this work, PrxFe94-xB6 (x = 6, 8, 10 and 12) nanostructured powders were prepared by a combination of hydrogenation, disproportionation, desorption and recombination (HDDR) process with high energy milling applied to the mixture of an as-cast alloy (Pr14Fe80B6) and α-Fe. The produced nanoparticles showed magnetic properties comparable to those reported in hyperthermia studies. The optimal time to obtain the magnetic nanoparticles is 5 hours (at 900 rpm). It was verified that longer milling times cause an increase in carbon percentage on the particles. The carbon is derived from oleic acid added as a surfactant in the milling step. The nanocomposites exhibit coercive force ranging from 80 Oe (6.5 kAm-1) to 170 Oe (13.5 kAm-1) and magnetic moments in the range of 81 129 Am2kg-1. From the X-ray diffraction analyses, only two phases were found in all samples: α-Fe and the magnetic phase Pr2Fe14B. Individual nanoparticles with diameter of about 20 nm were verified. The samples studied presented heating when exposed to an alternating magnetic field (f = 222 kHz e Hmax ∼3.7 kAm-1) comparable to reported in literature. Temperature variations (ΔT) of the powders were: 51 K for Pr6Fe88B6, 41 K for Pr8Fe86B6, 38 K for Pr10Fe84B6 and T = 34 K for Pr12Fe82B6. The specific absorption rates (SARs) of the powders were 201 Wkg-1 for Pr6Fe88B6 composition, 158 Wkg-1 on the composition Pr8Fe86B6, and 114 Wkg-1 for Pr10Fe84B6 and Pr12Fe82B6 compositions. (author)

  2. Characterization of Withania somnifera leaf transcriptome and expression analysis of pathogenesis-related genes during salicylic acid signaling.

    Directory of Open Access Journals (Sweden)

    Modhumita Ghosh Dasgupta

    Full Text Available Withania somnifera (L. Dunal is a valued medicinal plant with pharmaceutical applications. The present study was undertaken to analyze the salicylic acid induced leaf transcriptome of W. somnifera. A total of 45.6 million reads were generated and the de novo assembly yielded 73,523 transcript contig with average transcript contig length of 1620 bp. A total of 71,062 transcripts were annotated and 53,424 of them were assigned GO terms. Mapping of transcript contigs to biological pathways revealed presence of 182 pathways. Seventeen genes representing 12 pathogenesis-related (PR families were mined from the transcriptome data and their pattern of expression post 17 and 36 hours of salicylic acid treatment was documented. The analysis revealed significant up-regulation of all families of PR genes by 36 hours post treatment except WsPR10. The relative fold expression of transcripts ranged from 1 fold to 6,532 fold. The two families of peroxidases including the lignin-forming anionic peroxidase (WsL-PRX and suberization-associated anionic peroxidase (WsS-PRX recorded maximum expression of 377 fold and 6532 fold respectively, while the expression of WsPR10 was down-regulated by 14 fold. Additionally, the most stable reference gene for normalization of qRT-PCR data was also identified. The effect of SA on the accumulation of major secondary metabolites of W. somnifera including withanoside V, withaferin A and withanolide A was also analyzed and an increase in content of all the three metabolites were detected. This is the first report on expression patterns of PR genes during salicylic acid signaling in W. somnifera.

  3. International Association for Promoting Geoethics (IAPG): an update on activities

    Science.gov (United States)

    Di Capua, Giuseppe; Bobrowsky, Peter; Kieffer, Susan; Peppoloni, Silvia; Tinti, Stefano

    2016-04-01

    The International Association for Promoting Geoethics (IAPG: http://www.geoethics.org) was founded on August 2012 to unite global geoscientists to raise the awareness of the scientific community regarding the importance of the ethical, social and cultural implications of geoscience research, education, and practice. IAPG is an international, multidisciplinary and scientific platform for discussion on ethical problems and dilemmas in Earth Sciences, promoting geoethical themes through scientific publications and conferences, strengthening the research base on geoethics, and focusing on case-studies as models for the development of effective and operative strategies. IAPG is legally recognized as a not-for-profit organization. It is a non-governmental, non-political, non-party institution, at all times free from racial, gender, religious or national prejudices. Its network continues to grow with more than 900 members in 103 countries, including 20 national sections. IAPG operates exclusively through donations and personal funds of its members. The results achieved since inception have been recognized by numerous international organizations. In particular, IAPG has obtained the status of affiliated organization by the International Union of Geological Sciences (IUGS), American Geosciences Institute (AGI), Geological Society of America (GSA), and the Geological Society of London (GSL). IAPG has enlarged its official relationships also through agreements on collaboration with other organizations, such as the American Geophysical Union (AGU), EuroGeoSurveys (EGS), European Federation of Geologists (EFG), Association of Environmental & Engineering Geologists (AEG), International Geoscience Education Organisation (IGEO), African Association of Women in Geosciences (AAWG), and others. IAPG considers publications as an indispensable activity to strengthen geoethics from a scientific point of view, so members are active in the publication of articles and editing of books on

  4. Lasteaia ja lõbumaja vahel : eesti proosa 2008 / Vaapo Vaher

    Index Scriptorium Estoniae

    Vaher, Vaapo, 1945-

    2009-01-01

    Ülevaade 2008. aasta eesti proosast. Pikemalt käsitletakse järgmisi autoreid ja nende teoseid: Mihkel Raud "Musta pori näkku", Olev Remsu "Musketäride muundumised", Rein Põder "Juba olnud", Juhan Nurme "Ligimene", Jaan Tangsoo "Méduse'i parv", Esta Aksli "Tare poole tõttaja", Mari Saat "Lasnamäe lunastaja", Peeter Morgen "Sõnum", Mait Raun "Dr. Mööbi seiklused Inglismaal", Andrei Hvostov "Võõrad lood" ja "Projektijuht Posse", Chaneldior "Kontrolli alt väljas", Vahur Afanasjev "Kosmos", Egon Ilisson "Isased", Jaak Leer "Kaks kabanossi ja Maaja", Kärt Hellerma "Sinine missa", Elo Viiding "Püha Maama", Toomas Raudam "Miks ma ei taha olla kirjanik?", Mart Kivastik "Kurb raamat", Jüri Tuulik "Räim, pisike kena kala", Tarmo Teder "12 jõulujuttu", Dagmar Lamp (koostaja) "Tule, ma jutustan sulle loo", Eia Uus "Kahe näoga jumal", Barthol Lo Mejor "Popdada 2007-2008", Anti Saar "Nemad kaks", Ketlin Priilinn "Liiseli võti" ja "Vaim", Aita Kivi "Lähedal", Marje Ernits "Hoia mu kätt", Kati Murutar "Naisena sündinud : kakskümmend aastat hiljem", Tuule Lind "Pööratud tuul", Siiri Laidla "Lihtne lugu, ehk, Senta suvepuhkus", Kätlin Padesaar "Veel üks paradiis", Aimée Beekman "Proovielu", Lehte Hainslau "Kolmkõla, ehk, 3 kõla", Ira Lember "Ööviiulid", Tamur Kusnets "Hundipäikese aeg : metsiku jahi algus", Kaupo Pähkel "Ehatähe rüütel", Arvo Valton "Ülemiste vanake", Tiit Aleksejev "Palveränd", Ants Eret "Afgaanide vang", Mario Merirand "Afganistani päevik", Leo Kunnas "Gort Ashryn", Rein Raud "Vend", Peeter Sauter "Beibi bluu", Marion Andra "Pimend", Kristjan Sander "13 talvist hetke", Helga Nõu "Peaaegu geenius, ehk, Schrödingeri kassi otsimas", Tiit Sepa "Eefa hüüdnimega Siug", Kaarel ja Klaara Kivi "Varandus seinal", Merike Jürjo "Mälestusteta maja", Rein Vahisalu "Viies kabinet", Aarne Biin "Mees otsib naist", Erik Tohvri "Ümberasujad" ja "Sulasest sai peremees", Arnold Laugus "Elav maa", Jüri v. Grauberg "Selguse poole", J

  5. Lasteaia ja lõbumaja vahel : Eesti proosa 2008 / Vaapo Vaher

    Index Scriptorium Estoniae

    Vaher, Vaapo, 1945-

    2012-01-01

    Ülevaade 2008. aasta eesti proosast. Pikemalt käsitletakse järgmisi autoreid ja nende teoseid: Mihkel Raud "Musta pori näkku", Olev Remsu "Musketäride muundumised", Rein Põder "Juba olnud", Juhan Nurme "Ligimene", Jaan Tangsoo "Méduse'i parv", Esta Aksli "Tare poole tõttaja", Mari Saat "Lasnamäe lunastaja", Peeter Morgen "Sõnum", Mait Raun "Dr. Mööbi seiklused Inglismaal", Andrei Hvostov "Võõrad lood" ja "Projektijuht Posse", Chaneldior "Kontrolli alt väljas", Vahur Afanasjev "Kosmos", Egon Ilisson "Isased", Jaak Leer "Kaks kabanossi ja Maaja", Kärt Hellerma "Sinine missa", Elo Viiding "Püha Maama", Toomas Raudam "Miks ma ei taha olla kirjanik?", Mart Kivastik "Kurb raamat", Jüri Tuulik "Räim, pisike kena kala", Tarmo Teder "12 jõulujuttu", Dagmar Lamp (koostaja) "Tule, ma jutustan sulle loo", Eia Uus "Kahe näoga jumal", Barthol Lo Mejor "Popdada 2007-2008", Anti Saar "Nemad kaks", Ketlin Priilinn "Liiseli võti" ja "Vaim", Aita Kivi "Lähedal", Marje Ernits "Hoia mu kätt", Kati Murutar "Naisena sündinud : kakskümmend aastat hiljem", Tuule Lind "Pööratud tuul", Siiri Laidla "Lihtne lugu, ehk, Senta suvepuhkus", Kätlin Padesaar "Veel üks paradiis", Aimée Beekman "Proovielu", Lehte Hainslau "Kolmkõla, ehk, 3 kõla", Ira Lember "Ööviiulid", Tamur Kusnets "Hundipäikese aeg : metsiku jahi algus", Kaupo Pähkel "Ehatähe rüütel", Arvo Valton "Ülemiste vanake", Tiit Aleksejev "Palveränd", Ants Eret "Afgaanide vang", Mario Merirand "Afganistani päevik", Leo Kunnas "Gort Ashryn", Rein Raud "Vend", Peeter Sauter "Beibi bluu", Marion Andra "Pimend", Kristjan Sander "13 talvist hetke", Helga Nõu "Peaaegu geenius, ehk, Schrödingeri kassi otsimas", Tiit Sepa "Eefa hüüdnimega Siug", Kaarel ja Klaara Kivi "Varandus seinal", Merike Jürjo "Mälestusteta maja", Rein Vahisalu "Viies kabinet", Aarne Biin "Mees otsib naist", Erik Tohvri "Ümberasujad" ja "Sulasest sai peremees", Arnold Laugus "Elav maa", Jüri v. Grauberg "Selguse poole", J

  6. Identifying Patient-Specific Epstein-Barr Nuclear Antigen-1 Genetic Variation and Potential Autoreactive Targets Relevant to Multiple Sclerosis Pathogenesis.

    Directory of Open Access Journals (Sweden)

    Monika Tschochner

    Full Text Available Epstein-Barr virus (EBV infection represents a major environmental risk factor for multiple sclerosis (MS, with evidence of selective expansion of Epstein-Barr Nuclear Antigen-1 (EBNA1-specific CD4+ T cells that cross-recognize MS-associated myelin antigens in MS patients. HLA-DRB1*15-restricted antigen presentation also appears to determine susceptibility given its role as a dominant risk allele. In this study, we have utilised standard and next-generation sequencing techniques to investigate EBNA-1 sequence variation and its relationship to HLA-DR15 binding affinity, as well as examining potential cross-reactive immune targets within the central nervous system proteome.Sanger sequencing was performed on DNA isolated from peripheral blood samples from 73 Western Australian MS cases, without requirement for primary culture, with additional FLX 454 Roche sequencing in 23 samples to identify low-frequency variants. Patient-derived viral sequences were used to predict HLA-DRB1*1501 epitopes (NetMHCII, NetMHCIIpan and candidates were evaluated for cross recognition with human brain proteins.EBNA-1 sequence variation was limited, with no evidence of multiple viral strains and only low levels of variation identified by FLX technology (8.3% nucleotide positions at a 1% cut-off. In silico epitope mapping revealed two known HLA-DRB1*1501-restricted epitopes ('AEG': aa 481-496 and 'MVF': aa 562-577, and two putative epitopes between positions 502-543. We identified potential cross-reactive targets involving a number of major myelin antigens including experimentally confirmed HLA-DRB1*15-restricted epitopes as well as novel candidate antigens within myelin and paranodal assembly proteins that may be relevant to MS pathogenesis.This study demonstrates the feasibility of obtaining autologous EBNA-1 sequences directly from buffy coat samples, and confirms divergence of these sequences from standard laboratory strains. This approach has identified a number of

  7. Sisseminekuks : [luuletused] / Anna Haava ; [Impressioonid]: Viiu Härm

    Index Scriptorium Estoniae

    Haava, Anna, pseud., 1864-1957

    2004-01-01

    Sisu: Sisseminekuks ; Kartus ; Ööbikule ; Käokene, kuldalindu ; Mis sa tahad, kevade? ; Ei tule uni ; Hoia ennast; Tuksuv süda ; Sina oled kelm ; Hinge hellal' igatsusel' ; Kõik kallile ; Soov ; Unes nägin ; Võin ; Sinu silmad ; Sinu silmist pilk ; Kallis, sul on kuldne süda ; Sa kõige armsam mulle ; Oh võiksin ; Lill ; Nõmmelill ; Meie Mihkel ; Koidulale ; Ehitage rahukojad ; Emakeel ; Isamaja ; Väsinud ; Oh kuhu ma lähen? ; Ööbiku surm ; Ei saa mitte vaiki olla ; Ma olen näinud ; Südameta ; Sellepärast ; See oli ilusal õiekuul; Esimese lume ajal ; Mina vaat'sin muru pääle ; Ikka kurjalt sa mind vaatad ; Oh ma isegi ei tea ; Mis on luule paljalt sõnas? ; Oh oleksin ära surnud ; Lee ääres ; Sinu nimi ; Hoia vahest aken lahti ; Jumalaga jättes vaat'sid ; Ma laulan ; Ei oma õnne peita ; Küll oli ilus mu õieke ; Oh ära sa küsi ; Ei tule luule tuulest ; Köögis seisab ; Järv leegib eha paistel ; Sinu vanaema ; Nii ta on ; Tead küll, mu kuldkallis ; Ma lähen üle nõmme ; Lenda, lepatriinuke ; Vesi voolab, vesi kohab ; Üks ainus kord ; Oh kevade, oh õie-aeg ; Suur kontsert ; Kuupaistel ; Mets kohiseb ; Lind läks magama ; Kui sa tuled, too mull' lilli ; Sinilillekesed ; Ei ole sina minu ingel ; Ei mina õnne usu ; Viimast laulu ei saa laulda ; Kõige ilusam luule ; Üks on minul püham koda! ; Sa oled suurem kui su saatus ; Mu kodumaa, kus oled sa? ; Eest ära! ; Kui kandlekeeled katkevad ; Ma kõnnin koiduvalgel ; Mu mured kõik matsin ma maha ; Kui ma sulle armas olen ; Kas tahad tulla minuga? ; Sa vaata ette, süda! ; Truus sõpruses ma tahan ; Su silmade sügavuses ; Siis mine! ; See oli siis ; Mu süda usub ; Sind teretame, kuldapäike ; Mind jumalaga jätsid ; Sääl kord kasvab kaunis kodu ; Me oleme põhjamaa lapsed ; Hilised lilled ; Sa küsid, kus mu kodu ; külm ; Sina vaikiv, sügav öö ; Ju õitsvad kõik hellerheinad ; Öösünges kohab ; Kui saaks mullegi kord kodu ; On püha mulle mu kodumaa muld ; Oma hind vaid vaba

  8. Recém-nascido pequeno para a idade gestacional: repercussão nas habilidades motoras finas Pequeño para la edad gestacional: repercusión en las habilidades motoras finas Small-for-gestational-age newborn infant: repercussion on fine motor skills

    Directory of Open Access Journals (Sweden)

    Amabile Vessoni Arias

    2011-03-01

    Full Text Available OBJETIVO: Comparar as habilidades motoras finas de lactentes nascidos a termo pequenos para a idade gestacional (PIG com as habilidades dos nascidos adequados para a idade gestacional (AIG no terceiro mês de vida. MÉTODOS: Realizou-se um estudo observacional de corte transversal. Avaliaram-se 67 lactentes (21 PIG e 46 AIG no terceiro mês de vida. Portadores de síndromes genéticas, malformações congênitas, infecções congênitas e aqueles que necessitaram de unidade de terapia intensiva neonatal foram excluídos. As Escalas Bayley II de Desenvolvimento Infantil foram utilizadas, com ênfase nos itens que avaliam as habilidades motoras finas. RESULTADOS: Não se observaram diferenças entre os grupos na escala motora (p=0,21 e mental (p=0,45 no terceiro mês de vida. No item "Alcança o Aro Suspenso", houve diferença significativa (teste Exato de Fisher; p=0,02, demonstrando maior frequência de execução para o grupo PIG no terceiro mês de vida. CONCLUSÕES: Supõe-se que a diferença encontrada no item "Alcança o Aro Suspenso" possa ser atribuída à grande ocorrência de movimentos dos braços observada no grupo PIG e não a uma condição melhor de desenvolvimento desse grupo.OBJETIVO: Comparar las habilidades motoras finas de lactantes nacidos a término pequeños para la edad gestacional (PEG con adecuados para la edad gestacional (AEG en el 3er mes de vida. MÉTODOS: Se realizó un estudio observacional de corte transversal. Se evaluaron a 67 lactantes (21 PEG y 46 AEG en el 3er mes de vida. Síndromes genéticos, malformaciones congénitas, infecciones congénitas y aquellos que necesitaron de unidad de terapia intensiva neonatal fueron excluidos. Las Escalas Bayley II y de Desarrollo Infantil fueron utilizadas, con énfasis en los ítems que evalúan las habilidades motoras finas. RESULTADOS: No se observaron diferencias entre los grupos en la escala motora (p=0,21 y mental (p=0,45 en el 3er mes de vida. En el ítem "alcanza

  9. Boron, lithium and methane isotope composition of hyperalkaline waters (Northern Apennines, Italy): Terrestrial serpentinization or mixing with brine?

    International Nuclear Information System (INIS)

    Highlights: ► First data on boron and lithium isotope on waters from ophiolites are described. ► High boron and lithium isotope composition may be related to terrestrial serpentinization. ► Methane isotope data show unusual biotic signature. - Abstract: Spring waters issuing from serpentinized ultramafic rocks of the Taro-Ceno Valleys (Northern Apennine, Emilia-Romagna region, Italy) were analyzed for major element, trace element and dissolved gas concentrations and δ11B, δ7Li, δ18O(H2O), δ2H(H2O), δ13C(CH4) and δ2H(CH4) isotope compositions. Similar to other springs worldwide that issue from serpentinites, the chemical composition of the waters evolves with water–rock interaction from Ca-HCO3, through Mg-HCO3 and ultimately to a hyperalkaline Na-(Ca)-OH composition. Most of the Ca- and Mg-HCO3 springs have δ11B ranging between +16.3‰ and +23.7‰, consistent with the range of low P–T serpentinites. Very high δ11B in two springs from Mt. Prinzera (PR10: +39‰; PR01: +43‰) can be related to isotopic fractionation during secondary phase precipitation, as also inferred from δ7Li values. In contrast to typical abiogenic isotope signatures of CH4 from serpentinized rocks, dissolved CH4 from the Taro-Ceno hyperalkaline springs has an apparent biotic (thermogenic and/or mixed thermogenic-microbial) signature with δ13C(CH4) ranging from −57.5‰ to −40.8‰, which is similar to that of hydrocarbons from production wells and natural seeps in adjacent hydrocarbon systems. The data suggest that CH4 in the hyperalkaline springs investigated in this study may derive from organic matter of the sedimentary (flysch and arenaceous) formations underlying the ophiolite unit. However, small amounts of H2 were detected in one hyperalkaline spring (PR10), but for two springs with very low CH4 concentrations (PR01 and UM15) the δ2H value could not be measured, so the occurrence of some abiotic CH4 cannot be excluded. The occurrence of thermogenic CH4 in

  10. Tumor response and clinical outcome in metastatic gastrointestinal stromal tumors under sunitinib therapy: Comparison of RECIST, Choi and volumetric criteria

    Energy Technology Data Exchange (ETDEWEB)

    Schramm, N., E-mail: Nicolai.schramm@med.uni-muenchen.de [Institute for Clinical Radiology, Ludwig-Maximilians-University Hospital Munich, Marchioninistrasse 15, 81377 Munich (Germany); Englhart, E., E-mail: Elisabeth.Englhart@gmx.de [Institute for Clinical Radiology, Ludwig-Maximilians-University Hospital Munich, Marchioninistrasse 15, 81377 Munich (Germany); Schlemmer, M., E-mail: Marcus.Schlemmer@med.uni-muenchen.de [Department of Medicine III, Ludwig-Maximilians-University Hospital Munich, Marchioninistrasse 15, 81377 Munich (Germany); Hittinger, M., E-mail: Markus.Hittinger@uksh.de [Institute for Clinical Radiology, Ludwig-Maximilians-University Hospital Munich, Marchioninistrasse 15, 81377 Munich (Germany); Übleis, C., E-mail: Christopher.Uebleis@med.uni-muenchen.de [Department of Nuclear Medicine, Ludwig-Maximilians-University Hospital Munich, Marchioninistrasse 15, 81377 Munich (Germany); Becker, C.R., E-mail: Christoph.becker@med.uni-muenchen.de [Institute for Clinical Radiology, Ludwig-Maximilians-University Hospital Munich, Marchioninistrasse 15, 81377 Munich (Germany); Reiser, M.F., E-mail: Maximilian.Reiser@med.uni-muenchen.de [Institute for Clinical Radiology, Ludwig-Maximilians-University Hospital Munich, Marchioninistrasse 15, 81377 Munich (Germany); Berger, F., E-mail: Frank.Berger@med.uni-muenchen.de [Institute for Clinical Radiology, Ludwig-Maximilians-University Hospital Munich, Marchioninistrasse 15, 81377 Munich (Germany)

    2013-06-15

    Purpose: Purpose of the study was to compare radiological treatment response according to RECIST, Choi and volumetry in GIST-patients under 2nd-line-sunitinib-therapy and to correlate the results of treatment response assessment with disease-specific survival (DSS). Patients and methods: 20 patients (mean: 60.7 years; 12 male/8 female) with histologically proven GIST underwent baseline-CT of the abdomen under imatinib and follow-up-CTs 3 months and 1 year after change to sunitinib. 68 target lesions (50 hepatic, 18 extrahepatic) were investigated. Therapy response (partial response (PR), stable disease (SD), progressive disease (PD)) was evaluated according to RECIST, Choi and volumetric criteria. Response according to the different assessment systems was compared and correlated to the DSS of the patients utilizing Kaplan–Meier statistics. Results: The mean DSS (in months) of the response groups 3 months after therapy change was: RECIST: PR (0/20); SD (17/20): 30.4 (months); PD (3/20) 11.6. Choi: PR (10/20) 28.6; SD (8/20) 28.1; PD (2/20) 13.5. Volumetry: PR (4/20) 29.6; SD (11/20) 29.7; PD (5/20) 17.2. Response groups after 1 year of sunitinib showed the following mean DSS: RECIST: PR (3/20) 33.6; SD (9/20) 29.7; PD (8/20) 20.3. Choi: PR (10/20) 21.5; SD (4/20) 42.9; PD (6/20) 23.9. Volumetry: PR (6/20) 27.3; SD (5/20) 38.5; PD (9/20) 19.3. Conclusion: One year after modification of therapy, only partial response according to RECIST indicated favorable survival in patients with GIST. The value of alternate response assessment strategies like Choi criteria for prediction of survival in molecular therapy still has to be demonstrated.

  11. Effectiveness of boron neutron capture therapy for recurrent head and neck malignancies

    Energy Technology Data Exchange (ETDEWEB)

    Kato, Itsuro [Department of Oral and Maxillofacial Surgery, II Osaka University, Graduate School of Dentistry, Osaka (Japan)], E-mail: katoitsu@dent.osaka-u.ac.jp; Fujita, Yusei [Department of Oral and Maxillofacial Surgery, II Osaka University, Graduate School of Dentistry, Osaka (Japan); Maruhashi, Akira [Radiation Oncology Research Laboratory, Research Reactor Institut, Kyoto University, Osaka (Japan); Kumada, Hiroaki [Japan Atomic Energy Agency, Tokai Research and Development Center, Ibaraki (Japan); Ohmae, Masatoshi [Department of Oral and Maxillofacial Surgery, Izimisano Municipal Hospital, Rinku General Hospital, Izumisano, Osaka (Japan); Kirihata, Mitsunori [Graduate School of Environment and Life Science, Osaka prefectural University, Osaka (Japan); Imahori, Yoshio [Department of Neurosurgery, Kyoto Prefectural University, Kyoto (Japan); CEO of Cancer Intelligence Care Systems, Inc., Tokyo (Japan); Suzuki, Minoru [Radiation Oncology Research Laboratory, Research Reactor Institut, Kyoto University, Osaka (Japan); Sakrai, Yoshinori [Graduate School of Medicine, Sapporo Medical University of Medicine, Hokkaido (Japan); Sumi, Tetsuro; Iwai, Soichi; Nakazawa, Mitsuhiro [Department of Oral and Maxillofacial Surgery, II Osaka University, Graduate School of Dentistry, Osaka (Japan); Murata, Isao; Miyamaru, Hiroyuki [Division of Electrical, Electronic and Information Engineering, Graduate School of Engineering, Osaka University (Japan); Ono, Koji [Radiation Oncology Research Laboratory, Research Reactor Institut, Kyoto University, Osaka (Japan)

    2009-07-15

    It is necessary to explore new treatments for recurrent head and neck malignancies (HNM) to avoid severe impairment of oro-facial structures and functions. Boron neutron capture therapy (BNCT) is tumor-cell targeted radiotherapy that has significant superiority over conventional radiotherapies in principle. We have treated with BNCT 42 times for 26 patients (19 squamous cell carcinomas (SCC), 4 salivary gland carcinomas and 3 sarcomas) with a recurrent and far advanced HNM since 2001. Results of (1) {sup 10}B concentration of tumor/normal tissue ratios (T/N ratio) of FBPA-PET studies were SCC: 1.8-5.7, sarcoma: 2.5-4.0, parotid tumor: 2.5-3.7. (2) Therapeutic effects were CR: 12 cases, PR: 10 cases, PD: 3 cases NE (not evaluated): 1 case. Response rate was 85%. (3) Improvement of QOL such as a relief of severe pain, bleeding, and exudates at the local lesion, improvement of PS, disappearance of ulceration, covered with normal skin and preserved oral and maxillofacial functions and tissues. (4) Survival periods after BNCT were 1-72 months (mean: 13.6 months). Six-year survival rate was 24% by Kaplan-Meier analysis. (5) Adverse-events were transient mucositis and alopecia in most of the cases; three osteomyelitis and one brain necrosis were recognized. These results indicate that BNCT represents a new and promising treatment approach for advanced HNM.

  12. The Short Series of the Oxygen-Poor Lanthanide Oxide Selenides M10OSe14 with M = La–Nd

    Directory of Open Access Journals (Sweden)

    Frank A. Weber

    2012-08-01

    Full Text Available Single crystals and phase pure samples of oxygen-poor ternary lanthanide oxide selenides with the composition M10OSe14 (M = La–Nd; tetragonal, I41/acd; a = 1592.0–1559.8 pm, c = 2106.5–2062.9 pm could be obtained by reacting the corresponding metals, selenium and selenium dioxide as oxygen source. Their crystal structures are isotypic with Pr10OS14 and thus contain isolated [OM4]10+ tetrahedra (d(O2––M3+ = 243–248 pm embedded in a complex anionic {[M6Se14]10–} lanthanide selenide matrix (d(M3+–Se2– = 288–358 pm. All three crystallographically independent M3+ cations exhibit eight contacts to chalcogenide anions (O2– and/or Se2– resulting in the formation of bicapped trigonal prismatic coordination polyhedra. The optical band gaps of the oxide selenides M10OSe14 amount to values between 1.89 and 2.04 eV indicating wide band-gap semiconductors.

  13. Transcriptome Analysis of Early Responsive Genes in Rice during Magnaporthe oryzae Infection

    Directory of Open Access Journals (Sweden)

    Yiming Wang

    2014-12-01

    Full Text Available Rice blast disease caused by Magnaporthe oryzae is one of the most serious diseases of cultivated rice (Oryza sativa L. in most rice-growing regions of the world. In order to investigate early response genes in rice, we utilized the transcriptome analysis approach using a 300 K tilling microarray to rice leaves infected with compatible and incompatible M. oryzae strains. Prior to the microarray experiment, total RNA was validated by measuring the differential expression of rice defense-related marker genes (chitinase 2, barwin, PBZ1, and PR-10 by RT-PCR, and phytoalexins (sakuranetin and momilactone A with HPLC. Microarray analysis revealed that 231 genes were up-regulated (>2 fold change, p < 0.05 in the incompatible interaction compared to the compatible one. Highly expressed genes were functionally characterized into metabolic processes and oxidation-reduction categories. The oxidative stress response was induced in both early and later infection stages. Biotic stress overview from MapMan analysis revealed that the phytohormone ethylene as well as signaling molecules jasmonic acid and salicylic acid is important for defense gene regulation. WRKY and Myb transcription factors were also involved in signal transduction processes. Additionally, receptor-like kinases were more likely associated with the defense response, and their expression patterns were validated by RT-PCR. Our results suggest that candidate genes, including receptor-like protein kinases, may play a key role in disease resistance against M. oryzae attack.

  14. Experience in treatment of patients with locally advanced or recurrent breast cancer. Intraarterial infusion chemotherapy combined with radiotherapy

    International Nuclear Information System (INIS)

    For the purpose of local control and breast conservation, intraarterial infusion chemotherapy combined with radiotherapy has been indicated in patients with locally advanced breast cancer both in primary and recurrent cases. The present series, evaluated during the past 4 years, consisted of 15 patients 35-83 years of age, with invasive ductal carcinoma, including 10 with primary breast cancer (stage IIIb: 1, IV: 9) and 5 with postoperative recurrence (stage IIIb: 2, IV: 3). Intraarterial chemotherapy is started, basically infusing ADM 50 mg, MMC 10 mg and CDDP 50 mg into the internal thoracic and/or subclavian artery 1-3 times, followed by reduction surgery (quadrantectomy: 4, wide resection: 2) and radiotherapy to the breast, supraclavicular, parasternal and cervical regions according to tumor extent. Local response after arterial infusion was CR: 2, PR: 10, NC: 3 (response rate: 73% ). The response rate of distant metastases after arterial infusion was 73%. Of 10 patients with primary breast cancer, recurrence was noted in 1. Breast conservation was successful in 8 of 10 patients. One of them, in stage IIIb, has survived for 4.5 years with no evidence of disease and with breast conservation. Five patients with postoperative recurrence showed CR with no recurrence after intraarterial chemotherapy and radiotherapy. Acute skin reaction occurred in 6 patients, and was especially frequent in patients with postoperative recurrence (4 of 5). According to these results, combined therapy affords breast conservation even in patients with locally advanced breast cancer, and improves patient's QOL in stage IV. (author)

  15. Effectiveness of boron neutron capture therapy for recurrent head and neck malignancies

    International Nuclear Information System (INIS)

    It is necessary to explore new treatments for recurrent head and neck malignancies (HNM) to avoid severe impairment of oro-facial structures and functions. Boron neutron capture therapy (BNCT) is tumor-cell targeted radiotherapy that has significant superiority over conventional radiotherapies in principle. We have treated with BNCT 42 times for 26 patients (19 squamous cell carcinomas (SCC), 4 salivary gland carcinomas and 3 sarcomas) with a recurrent and far advanced HNM since 2001. Results of (1) 10B concentration of tumor/normal tissue ratios (T/N ratio) of FBPA-PET studies were SCC: 1.8-5.7, sarcoma: 2.5-4.0, parotid tumor: 2.5-3.7. (2) Therapeutic effects were CR: 12 cases, PR: 10 cases, PD: 3 cases NE (not evaluated): 1 case. Response rate was 85%. (3) Improvement of QOL such as a relief of severe pain, bleeding, and exudates at the local lesion, improvement of PS, disappearance of ulceration, covered with normal skin and preserved oral and maxillofacial functions and tissues. (4) Survival periods after BNCT were 1-72 months (mean: 13.6 months). Six-year survival rate was 24% by Kaplan-Meier analysis. (5) Adverse-events were transient mucositis and alopecia in most of the cases; three osteomyelitis and one brain necrosis were recognized. These results indicate that BNCT represents a new and promising treatment approach for advanced HNM.

  16. Electrochemical synthesis, structural characterization, and decomposition of rhenium oxoethoxide, Re4O4(OEt)12. Ligand influence on the structure and bonding in the high-valent tetranuclear planar rhenium alkoxide clusters.

    Science.gov (United States)

    Nikonova, Olesya A; Jansson, Kjell; Kessler, Vadim G; Sundberg, Margareta; Baranov, Alexei I; Shevelkov, Andrei V; Drobot, Dmitrii V; Seisenbaeva, Gulaim A

    2008-02-18

    Anodic oxidation of rhenium in ethanol in the presence of LiCl as a conductive additive results with high yield in formation of a new oxoethoxide cluster, Re(4)O(4)(OEt)(12). The structure of the planar centrosymmetric metal-oxygen core of this molecule is composed of four edge-sharing Re(V)O(6) octahedra. Eight electrons are available for the formation of metal-metal bonds indicated by five relatively short Re-Re distances within the Re 4-rhombus, a "planar butterfly" type cluster. The theoretical calculations are indicating relatively low contribution of metal-metal bonding in the stability of the core. The stability of the +V-oxidation state, unusual for rhenium alkoxides can be at least partially attributed to the size effects in the packing of ligands. The X-ray powder study indicates that treatment of Re(4)O(4)(OEt)(12). in ambient atmosphere rapidly transforms it into a mixed-valence derivative Re(4)O(6)(OEt)(10) with a structure related to the earlier investigated cluster Re(4)O(6)(O(i)Pr)(10). Thermal decomposition of the latter rhenium oxoethoxide results in reduction to rhenium metal at as low temperatures as 380 degrees C, producing aggregates of metal nanoparticles with the average size of 3 nm. PMID:18220343

  17. Rice WRKY4 acts as a transcriptional activator mediating defense responses toward Rhizoctonia solani, the causing agent of rice sheath blight.

    Science.gov (United States)

    Wang, Haihua; Meng, Jiao; Peng, Xixu; Tang, Xinke; Zhou, Pinglan; Xiang, Jianhua; Deng, Xiaobo

    2015-09-01

    WRKY transcription factors have been implicated in the regulation of transcriptional reprogramming associated with various plant processes but most notably with plant defense responses to pathogens. Here we demonstrate that expression of rice WRKY4 gene (OsWRKY4) was rapidly and strongly induced upon infection of Rhizoctonia solani, the causing agent of rice sheath blight, and exogenous jasmonic acid (JA) and ethylene (ET). OsWRKY4 is localized to the nucleus of plant cells and possesses transcriptional activation ability. Modulation of OsWRKY4 transcript levels by constitutive overexpression increases resistance to the necrotrophic sheath blight fungus, concomitant with elevated expression of JA- and ET-responsive pathogenesis-related (PR) genes such as PR1a, PR1b, PR5 and PR10/PBZ1. Suppression by RNA interference (RNAi), on the other hand, compromises resistance to the fungal pathogen. Yeast one-hybrid assay and transient expression in tobacco cells reveal that OsWRKY4 specifically binds to the promoter regions of PR1b and PR5 which contain W-box (TTGAC[C/T]), or W-box like (TGAC[C/T]) cis-elements. In conclusion, we propose that OsWRKY4 functions as an important positive regulator that is implicated in the defense responses to rice sheath blight via JA/ET-dependent signal pathway. PMID:26275661

  18. Silencing of sterol glycosyltransferases modulates the withanolide biosynthesis and leads to compromised basal immunity of Withania somnifera.

    Science.gov (United States)

    Singh, Gaurav; Tiwari, Manish; Singh, Surendra Pratap; Singh, Surendra; Trivedi, Prabodh Kumar; Misra, Pratibha

    2016-01-01

    Sterol glycosyltransferases (SGTs) catalyse transfer of glycon moiety to sterols and their related compounds to produce diverse glyco-conjugates or steryl glycosides with different biological and pharmacological activities. Functional studies of SGTs from Withania somnifera indicated their role in abiotic stresses but details about role under biotic stress are still unknown. Here, we have elucidated the function of SGTs by silencing SGTL1, SGTL2 and SGTL4 in Withania somnifera. Down-regulation of SGTs by artificial miRNAs led to the enhanced accumulation of withanolide A, withaferin A, sitosterol, stigmasterol and decreased content of withanoside V in Virus Induced Gene Silencing (VIGS) lines. This was further correlated with increased expression of WsHMGR, WsDXR, WsFPPS, WsCYP710A1, WsSTE1 and WsDWF5 genes, involved in withanolide biosynthesis. These variations of withanolide concentrations in silenced lines resulted in pathogen susceptibility as compared to control plants. The infection of Alternaria alternata causes increased salicylic acid, callose deposition, superoxide dismutase and H2O2 in aMIR-VIGS lines. The expression of biotic stress related genes, namely, WsPR1, WsDFS, WsSPI and WsPR10 were also enhanced in aMIR-VIGS lines in time dependent manner. Taken together, our observations revealed that a positive feedback regulation of withanolide biosynthesis occurred by silencing of SGTLs which resulted in reduced biotic tolerance. PMID:27146059

  19. Personal and behavioral factors associated with bicycling in adults from Curitiba, Parana State, Brazil

    Directory of Open Access Journals (Sweden)

    Marilson Kienteka

    2014-01-01

    Full Text Available Bicycling is an important form of physical activity that can promote health benefits. The objective of this study was to analyze the association between personal and behavioral aspects in transportation bicycling and leisure time bicycling in adults. Data was drawn from a household survey involving 677 adults (53.1% female in Curitiba, Paraná State, Brazil. The prevalence of bicycling was 11.2% for transportation and 16.7% for leisure. The frequency of leisure time bicycling was higher among men (PR = 2.08; p < 0.001, young people < 30 and adults aged between 30 and 39.9, bicycle owners (PR = 8.76; p < 0.001 and among the physically active. Transportation bicycling occurred more frequently among men (PR = 3.63; p < 0.001, individuals aged 30 to 39.9, those with a low socioeconomic status (PR = 5.00; p = 0.006, bicycle owners (PR = 10.2; p < 0.001 and individuals with a negative perception of their quality of life. The prevalence of bicycling is low in Curitiba considering its potential as a means of physical activity. Personal and behavioral factors were associated with each form of bicycling.

  20. Spanking, corporal punishment and negative long-term outcomes: a meta-analytic review of longitudinal studies.

    Science.gov (United States)

    Ferguson, Christopher J

    2013-02-01

    Social scientists continue to debate the impact of spanking and corporal punishment (CP) on negative child outcomes including externalizing and internalizing behavior problems and cognitive performance. Previous meta-analytic reviews have mixed long- and short-term studies and relied on bivariate r, which may inflate effect sizes. The current meta-analysis focused on longitudinal studies, and compared effects using bivariate r and better controlled partial r coefficients controlling for time-1 outcome variables. Consistent with previous findings, results based on bivariate r found small but non-trivial long-term relationships between spanking/CP use and negative outcomes. Spanking and CP correlated .14 and .18 respectively with externalizing problems, .12 and .21 with internalizing problems and -.09 and -.18 with cognitive performance. However, when better controlled partial r coefficients (pr) were examined, results were statistically significant but trivial (at or below pr = .10) for externalizing (.07 for spanking, .08 for CP) and internalizing behaviors (.10 for spanking, insufficient studies for CP) and near the threshold of trivial for cognitive performance (-.11 for CP, insufficient studies for spanking). It is concluded that the impact of spanking and CP on the negative outcomes evaluated here (externalizing, internalizing behaviors and low cognitive performance) are minimal. It is advised that psychologists take a more nuanced approach in discussing the effects of spanking/CP with the general public, consistent with the size as well as the significance of their longitudinal associations with adverse outcomes. PMID:23274727

  1. Changes in leaf proteome profile of Arabidopsis thaliana in response to salicylic acid

    Indian Academy of Sciences (India)

    Riddhi Datta; Ragini Sinha; Sharmila Chattopadhyay

    2013-06-01

    Salicylic acid (SA) has been implicated in determining the outcome of interactions between many plants and their pathogens. Global changes in response to this phytohormone have been observed at the transcript level, but little is known of how it induces changes in protein abundance. To this end we have investigated the effect of 1 mM SA on soluble proteins of Arabidopsis thaliana leaves by proteomic analysis. An initial study at transcript level has been performed on temporal landscape, which revealed that induction of most of the SA-responsive genes occurs within 3 to 6 h post treatment (HPT) and the expression peaked within 24 HPT. Two-dimensional gel electrophoresis (2-DE) coupled with MALDI-TOF MS/MS analysis has been used to identify differentially expressed proteins and 63 spots have been identified successfully. This comparative proteomic profiling of SA treated leaves versus control leaves demonstrated the changes of many defence related proteins like pathogenesis related protein 10a (PR10a), disease-resistance-like protein, putative late blight-resistance protein, WRKY4, MYB4, etc. along with gross increase in the rate of energy production, while other general metabolism rate is slightly toned down, presumably signifying a transition from ‘normal mode’ to ‘defence mode’.

  2. CCNU, etoposide and methotrexate (CEM) plus/minus radiotherapy - a low toxicity induction therapy for small cell lung cancer patients with cardiac disease, advanced age or poor performance status

    International Nuclear Information System (INIS)

    In order to reduce treatment-related morbidity, an alternative chemotherapy regimen consisting of CCNU, etoposide and methotrexate (CEM) was given to 45 previously untreated SCLC patients, who all showed at least one adverse prognostic parameter. Treatment cycles were repeated every 3 weeks for a total of at least 3 courses. After chemotherapy, limited disease (LD) patients received an additional thoracic irradiation with 36-50 Gy. Objective responses were observed in 70% of the 43 evaluable patients. Complete remission was achieved in 8/22 (36%) patients with LD and 3/21 (14%) patients with extensive disease (ED). Median survival was 11 months in LD (CR: 15 months, PR: 10 months) and 7 months in ED (CR: 15 months, PR: 6 months) patients. The one-, two- and three-year survival rates were 41%, 10% and 4% for LD or 13%, 5%, and 0% for ED patients, respectively. Side effects were generally mild with 8% of the patients demonstrating leukocyte nadirs of less than 100/μl and none developing thrombocytopenia below 100 000/μl. Infection episodes (WHO grade > 2) and toxic deaths did not occur. (orig./MG)

  3. Comparative analysis of cyanobacterial superoxide dismutases to discriminate canonical forms

    Directory of Open Access Journals (Sweden)

    Prabaharan Dharmar

    2007-11-01

    different signatures G-F-H-[ILV]-H-x-[NGT]-[GPDA]-[SQK]-C and G-[GA]-G-G-[AEG]-R-[FIL]-[AG]-C-G, while Ni isoform has an nickel containing SOD domain containing a Ni-hook HCDGPCVYDPA. Conclusion The present analysis unravels the ambiguity among cyanobacterial SOD isoforms. NiSOD is the only SOD found in lower forms; whereas, Fe and Mn occupy the higher orders of cyanobacteria. In conclusion, cyanobacteria harbor either Ni alone or a combination of Fe and Ni or Fe and Mn as their catalytic active metal while Cu/Zn is rare.

  4. Autoportree : [luuletused] / Artur Alliksaar ; [Impressioonid] : Viiu Härm

    Index Scriptorium Estoniae

    Alliksaar, Artur, 1923-1966

    2004-01-01

    õmbeid kottpimedas galeriis ; Ärklituba ; Hommik ei oota õhtut ; Improvisatsioone harfil ; Morbiidseid maastikke ; Sõnad sinule, surm, suurele vaikusele ja iseendale ; Õhtute kollane tolm ; Kõik on kõige peegeldus ; Kas süvenev sügis viib sinugi ?... ; Kolm kosmogoonilist etüüdi ; Interregnum ; Neli etüüdi ; Üks vari laulis apelsinisalus. Ta vaevalt lõpetas, kui unus, kes ja kus ; Ürgmetsas ; Tuleb ingel ja puudutab vett ; Lahkusid, kui loojus kuu ; Rändur on teel... ; Mis saab sellest loomusevalust? ; Läbi selle metsa olen näinud ; Kuskil ajajõe taga ; Aeg

  5. Long-term changes in net radiation and its components above a pine forest and a grass surface in Germany

    International Nuclear Information System (INIS)

    Long-term measurements (1974–1993 and 1996, respectively) of the net radiation (Q), global radiation (G), reflected global radiation (R), long-wave atmospheric radiation (A) and thermal radiation (E) of a pine forest in Southern Germany (index p) and of a grass surface in Northern Germany (index g) are compared. The influence of changes in surface properties is discussed. There are, in the case of the pine stand, forest growth and forest management and in the case of the grass surface, the shifting of the site from a climatic garden to a horizontal roof. Both series of radiant fluxes are analyzed with respect to the influences of the weather (cloudiness, heat advection). To eliminate the different influence of the solar radiation of the two sites, it is necessary to normalize by means of the global radiation G, yielding the radiation efficiency Q/G, the albedo R/G=α and the normalized long-wave net radiation (A+E)/G. Furthermore, the long-term mean values and the long-term trend of yearly mean values are discussed and, moreover, a comparison is made of individual monthly values. Qp is twice as large as Qg. The reason for this is the higher values of G and A above the pine forest and half values of αp compared to αg. Ep is only a little greater than Eg. The time series of the radiation fluxes show the following trends: Qp declines continuously despite a slight increase of Gp. This is mainly due to the long-wave radiation fluxes. The net radiation of the grass surface Qg shows noticeably lower values after the merging of the site. This phenomenon is also dominated by the long-wave radiation processes. Although the properties of both site surfaces alter, Ep and Eg remain relatively stable. Ap and Ag show a remarkable decrease however. The reason for this is to be found in a modification of the heat advection, showing a more pronounced impact on the more continentally exposed site (pine forest). Compared to αg, αp shows only a small variability. The changes of

  6. Expressão gênica nos estigmas e estiletes de plantas da família Solanaceae: seqüências relacionadas com a patogênese Gene expression in Solanaceae stigmas and styles: pathogenesis related sequences

    Directory of Open Access Journals (Sweden)

    Paula Cristina da Silva Angelo

    2005-01-01

    Full Text Available O florescimento é uma mudança fundamental no desenvolvimento das plantas. A evocação do florescimento é a transição entre a fase vegetativa e a reprodutiva, durante a qual ocorre a especialização dos meristemas apicais. Nas plantas com flores completas, como aquelas da família Solanaceae, células meristemáticas na camada mais externa, dão origem às sépalas e aquelas na segunda camada originam as pétalas; na terceira camada, as células tornam-se estames e aquelas na quarta e mais interna camada dão origem aos carpelos (ovários, estiletes e estigmas. O surgimento desses órgãos florais é relativamente recente na história evolutiva das plantas e demandou o desenvolvimento de padrões de expressão tecido-específicos. Um desses padrões específicos, em flores de Solanaceae, inclui a expressão de genes relacionados com os processos de defesa, cuja atividade é induzida por infecção com patógenos ou por ferimentos nos órgãos vegetativos da planta, mas que são constitutivamente expressos nas flores sadias, onde os transcritos se acumulam seguindo padrões vinculados ao desenvolvimento. Neste trabalho, são revistas e compiladas as informações publicadas sobre os genes relacionados com as reações de defesa, denominados Sp41, PR10a, SK2 e sobre uma adenosina-metiltransferase, que também pode estar relacionada com a reação aos patógenos, e que seguem esse modelo de expressão. Algumas das hipóteses existentes para explicar este modelo também são apresentadas.Flowering is a fundamental process in plant development. Flower evocation is the transition from the vegetative to the reproductive phase, when the specialization of apical meristems takes place. In plants, such as the Solanaceae, which present complete flowers, the meristematic cells in the most external first series bring out the sepals and those cells in the second series turn to be the petals; in the third series the cells become stamens and the cells in

  7. Preliminary Research of Mechanisms underlying Bacillus cereus AR156-mediated Resistance to Rhizoctonia solani in Rice%蜡质芽孢杆菌AR156防治水稻纹枯病机理初探

    Institute of Scientific and Technical Information of China (English)

    陈刘军; 俞仪阳; 王超; 柯红娇; 刘红霞; 郭坚华

    2014-01-01

    Bacillus cereus AR156, a biocontrol agent against a variety of soil-borne pathogens, could effectively control rice sheath blight in field. Here, the biocontrol efficacy and growth-promoting role of strain AR156 on rice was tested under greenhouse conditions, and the primary mechanism of strain AR156 in controlling rice sheath blight was also studied on both cellular and gene levels. The results revealed that AR156 could control Rhizoctonia solani with an efficiancy of 73.06%, and there was a 14.45% biomass increase in AR156-treated rice plants compared with those non-treated ones. Strain AR156 increased the activities of defensive enzymes SOD, PAL, POD and CAT, and the expression of defense related genes OsPR1b、OsPR10、OsNPR1 and ZB8. In rice plants pretreated with strain AR156 before inoculated with R. solani HNW-21, SOD or PAL activity peak reached in advance by four and two days, respectively, and the accumulation of defense related genes transcripts was rapid and extended. As a result, the resistance of those plants to rice sheath blight was strengthened.%蜡质芽孢杆菌AR156是一种防治多种土传病害的生物制剂,对水稻纹枯病具有较好的防治效果。本研究通过温室试验方面验证菌株 AR156的防病效果和促生作用,从细胞水平和基因水平初步揭示了菌株AR156防治水稻纹枯病的机理。结果表明,菌株AR156对水稻纹枯病的温室防效达73.06%,同时促进水稻生物量增加14.45%。菌株AR156处理提高了水稻植株SOD、PAL、POD和CAT等防御酶活性,增强了OsPR1b、OsPR10、OsNPR1和ZB8等防卫相关基因的表达。接种立枯丝核菌Rhizoctonia solani HNW-21之前用菌株AR156预处理的水稻植株,SOD和PAL分别提前4、2 d出现活性峰;防卫相关基因均提前表达,且表达时间延长,从而提高水稻对纹枯病的抗性。

  8. 转TaPIMP1基因小麦纹枯病抗性的基因表达%Expression profiling of TaPIMP1 gene for resistance to sharp eyespot in transgenic wheat

    Institute of Scientific and Technical Information of China (English)

    周小青; 周淼平; 张增艳; 陈怀谷; 姚金保; 马鸿翔

    2011-01-01

    The TaPIMPl gene had been transferred to wheat cultivar Yangmai 158 in order to increase the resistance to wheat sharp eye spot. To investigate the TaPIMPl gene function and response to wheat sharp eyespot, the expressions in different organs and growth periods of wheat, and the expressions induced by salicylic acid (SA) , methyl jas-roonate (MeJA), ethylene (ET) and inoculation of Rhizoctonia cerealis of TaPIMPl gene in transgenic lines were analyzed by semi-quantitative RT-PCR. The expressions of PR1, PR2, PR5 and PR10 genes were also analyzed. The results showed that the expressions of endogenesis TaPIMPl could be detected in root, leaf, spike and flower in wheat and the expressiondecreased with the plant growth. The expression of TaPIMPl was upregulated by Rhizoctonia cerealis inoculating, and by application of salicylic acid, methyl jasmonate and ethylene. The expressions of PR1 and PR5 in transgenic plants were higher than those in control. It was speculated that salicylic acid cumulated in wheat plant after the infection by Rhizoctonia cerealis, and then the transcript of TaPIMPl was upregulated, which led to the massive expressions of PR1 and PRS in wheat plant andmade the plant against the pathogen. Because of constitutive expression of TaPlMPl, the expressions of PR1 and PR5 in the transgenic plant were stronger and lasted longer than those in the control, and hence the transgenic plant was more resistant to Rhizoctonia cerealis than control.%为了阐明TaPIMP1基因在小麦抗纹枯病反应中所起的作用,以转TaPIMP1基因小麦及其受体亲本为材料,采用半定量RT-PCR方法研究该基因的表达特性及其对水杨酸(SA)、茉莉酸甲酯(MeJA)、乙烯(ET)和纹枯病病菌诱导的应答,分析了受体亲本和转基因植株中PR1、PR2、PR5和PR10的表达异同.结果表明,小麦内源TaPIMP1基因在根、叶、穗、花和籽粒中均能表达,随着植株的生长发育表达量逐渐降低;水杨酸、茉莉酸甲酯

  9. [Treatment of advanced renal cell carcinoma with a combination of interferon alpha and gamma].

    Science.gov (United States)

    Naito, S; Yasumasu, T; Kumazawa, J; Hiratsuka, Y; Sakamoto, K; Iguchi, A; Masaki, Z; Hasui, Y; Osada, Y; Kurozumi, T

    1995-08-01

    A total of 29 patients with advanced renal cell carcinoma entered a pilot study of combination therapy with interferon alpha (IFN-alpha) and interferon gamma (IFN-gamma). IFN-alpha (HLBI: 3 x 10(6) IU, BALL 1:5 x 10(6) IU, IFN-alpha-2a: 9 x 10(6) IU or IFN-alpha-2b: 6 x 10(6) IU) was given intramuscularly every day and IFN-gamma (IFN-gamma-1a: 3 x 10(6) JRU) was given intravenously by drip infusion 3 times a week (every 2-3 days). The treatment was continued for 3 months as the induction therapy, and then the tumor response was evaluated. Of the 22 evaluable patients, 4 achieved a partial response (PR), 10 showed no change (NC), and in 8 the disease had progressed (PD) during the therapy. Thus, the overall response rate was 18.2% [95% confidence interval (CI) 2.1-34.3%]. A favorable response tended to be obtained in patients with good performance status or small pulmonary metastases, or in those who had no prior therapy with IFN-alpha, who received this treatment immediately subsequent to radical nephrectomy, or who received IFN-gamma as much as possible according to this regimen. Toxicity was evaluated in 28 patients: fever, general fatigue, anorexia, leukocytopenia and impaired liver function were frequently noted, and 3 patients were withdrawn from the study because of such adverse effects. In patients who had a PR or NC, the same dosage of IFN-alpha was continued to be given intramuscularly 2-3 times a week (every 2-4 days) as the maintenance therapy.(ABSTRACT TRUNCATED AT 250 WORDS) PMID:7474618

  10. Co-inoculation with rhizobia and AMF inhibited soybean red crown rot: from field study to plant defense-related gene expression analysis.

    Directory of Open Access Journals (Sweden)

    Xiang Gao

    Full Text Available BACKGROUND: Soybean red crown rot is a major soil-borne disease all over the world, which severely affects soybean production. Efficient and sustainable methods are strongly desired to control the soil-borne diseases. PRINCIPAL FINDINGS: We firstly investigated the disease incidence and index of soybean red crown rot under different phosphorus (P additions in field and found that the natural inoculation of rhizobia and arbuscular mycorrhizal fungi (AMF could affect soybean red crown rot, particularly without P addition. Further studies in sand culture experiments showed that inoculation with rhizobia or AMF significantly decreased severity and incidence of soybean red crown rot, especially for co-inoculation with rhizobia and AMF at low P. The root colony forming unit (CFU decreased over 50% when inoculated by rhizobia and/or AMF at low P. However, P addition only enhanced CFU when inoculated with AMF. Furthermore, root exudates of soybean inoculated with rhizobia and/or AMF significantly inhibited pathogen growth and reproduction. Quantitative RT-PCR results indicated that the transcripts of the most tested pathogen defense-related (PR genes in roots were significantly increased by rhizobium and/or AMF inoculation. Among them, PR2, PR3, PR4 and PR10 reached the highest level with co-inoculation of rhizobium and AMF. CONCLUSIONS: Our results indicated that inoculation with rhizobia and AMF could directly inhibit pathogen growth and reproduction, and activate the plant overall defense system through increasing PR gene expressions. Combined with optimal P fertilization, inoculation with rhizobia and AMF could be considered as an efficient method to control soybean red crown rot in acid soils.

  11. Risk of dengue for tourists and teams during the World Cup 2014 in Brazil.

    Directory of Open Access Journals (Sweden)

    Willem G van Panhuis

    Full Text Available BACKGROUND: This year, Brazil will host about 600,000 foreign visitors during the 2014 FIFA World Cup. The concern of possible dengue transmission during this event has been raised given the high transmission rates reported in the past by this country. METHODOLOGY/PRINCIPAL FINDINGS: We used dengue incidence rates reported by each host city during previous years (2001-2013 to estimate the risk of dengue during the World Cup for tourists and teams. Two statistical models were used: a percentile rank (PR and an Empirical Bayes (EB model. Expected IR's during the games were generally low (<10/100,000 but predictions varied across locations and between models. Based on current ticket allocations, the mean number of expected symptomatic dengue cases ranged from 26 (PR, 10th-100th percentile: 5-334 cases to 59 (EB, 95% credible interval: 30-77 cases among foreign tourists but none are expected among teams. These numbers will highly depend on actual travel schedules and dengue immunity among visitors. Sensitivity analysis for both models indicated that the expected number of cases could be as low as 4 or 5 with 100,000 visitors and as high as 38 or 70 with 800,000 visitors (PR and EB, respectively. CONCLUSION/SIGNIFICANCE: The risk of dengue among tourists during the World Cup is expected to be small due to immunity among the Brazil host population provided by last year's epidemic with the same DENV serotypes. Quantitative risk estimates by different groups and methodologies should be made routinely for mass gathering events.

  12. Treatment Outcome of Mucosa Associated Lymphoid Tissue (MALT) Marginal Zone Non-Hodgkin's Lymphoma. Single Institutional Experience

    International Nuclear Information System (INIS)

    To evaluate the treatment outcome in patients with mucosa associated lymphoid tissue (MALT) lymphoma in terms of response to treatment, progression-free and overall survivals as well as prognostic factors. Patients and Methods: Between 1995 and 2002,40 patients with clinical stages (CS) I-IV MALT lymphoma were treated at NEMROCK. The progression free survival (PFS) and overall survival (OAS) were calculated using the Kaplan Meier technique. Thirty-one patients (77.5%) had CS I-II and 9 (22.5%) had CS III-IV disease. Twenty of the 31 CS I-II patients received radiation therapy alone, five patients received chemotherapy, while three patients were treated by triple therapy (Amoxicillin, Omeperazole, Clarithromycin). Among the 9 CS III-IV patients, treatment included chemotherapy alone (6 patients), chemo radiation (2 patients) and surgery (one patient). The median followup period was 40 months. 19 out of twenty patients with CS I-II treated by radiation therapy alone had a 95% response rate (CR 85% - PR 10%). Among the study population (40 patients), the 5 year OAS and PFS were 86% and 66%, respectively. The 5 year OAS was 86% and PFS was 72% among CS III patients; the corresponding estimates in CS III-IV patients were 70% and 28%, respectively. Using multivariate analysis, there was a significant correlation between the stage of the disease, site of presentation (non GIT) and the overall survival. Modest doses of radiation therapy provide better local control in patients with early stage MALT lymphoma. The poor PFS in advanced staged disease suggests the need for further clinical trials evaluating novel drug approaches taking into consideration the biological behavior and the indolent nature of such disease entity

  13. Plant root transcriptome profiling reveals a strain-dependent response during Azospirillum-rice cooperation

    Directory of Open Access Journals (Sweden)

    Benoît eDrogue

    2014-11-01

    Full Text Available Cooperation involving Plant Growth-Promoting Rhizobacteria results in improvements of plant growth and health. While pathogenic and symbiotic interactions are known to induce transcriptional changes for genes related to plant defence and development, little is known about the impact of phytostimulating rhizobacteria on plant gene expression. This study aims at identifying genes significantly regulated in rice roots upon Azospirillum inoculation, considering possible favored interaction between a strain and its original host cultivar. Genome-wide analyses of Oryza sativa japonica cultivars Cigalon and Nipponbare were performed, by using microarrays, seven days post inoculation with A. lipoferum 4B (isolated from Cigalon or Azospirillum sp. B510 (isolated from Nipponbare and compared to the respective non-inoculated condition. A total of 7,384 genes were significantly regulated, which represent about 16 % of total rice genes. A set of 34 genes is regulated by both Azospirillum strains in both cultivars, including a gene orthologous to PR10 of Brachypodium, and these could represent plant markers of Azospirillum-rice interactions. The results highlight a strain-dependent response of rice, with 83 % of the differentially expressed genes being classified as combination-specific. Whatever the combination, most of the differentially expressed genes are involved in primary metabolism, transport, regulation of transcription and protein fate. When considering genes involved in response to stress and plant defence, it appears that strain B510, a strain displaying endophytic properties, leads to the repression of a wider set of genes than strain 4B. Individual genotypic variations could be the most important driving force of rice roots gene expression upon Azospirillum inoculation. Strain-dependent transcriptional changes observed for genes related to auxin and ethylene signalling highlight the complexity of hormone signalling networks in the Azospirillum

  14. Highly symmetric organic ligand-capped Lindqvist structures derived from 3d-elements.

    Science.gov (United States)

    Seisenbaeva, Gulaim A; Mallah, Talal; Kessler, Vadim G

    2010-09-01

    Interaction of M(acac)(2) with Ti(OEt)(4) associated with hydrolysis or thermolysis provides with high yields, through the decomposition of the initially formed M(2)Ti(2)(acac)(4)(OEt)(8), M = Ni (1), Co (2), poorly soluble Lindqvist-type products with the formula M(5)TiO(acac)(6)(OEt)(6), M = Ni (3), Co (4), Mg (5). The compounds 3-5 are isostructural and display a perfect statistical disorder between the OEt groups and 1/2 of the beta-diketonate, acac, ligand. The metal atoms constitute a regular octahedron, centered by the oxo-oxygen atom. There is only one symmetrically independent metal site, which imposes it to contain 1/6 of titanium and 5/6 of the divalent metal atom. The oxygen atoms on the surface of the octahedron are doubly bridging and are located above the twelve edges of the octahedron, as is usual for the Lindqvist-type structures. The coordination of the metal atoms is completed by a single terminal oxygen atom. The complexes 3-5 are volatile with decomposition, releasing only homometallic products into the gas phase in the case of 3 and 4, but with a considerable contribution of molecular evaporation in the case of 5. The intermediates 1 and 2 belong to the tetramolybdate, M(4)O(16), structure type. Highly soluble 1 and 2 can be considered as attractive molecular precursors for the incorporation of 3 and 4 into porous matrices for the preparation of combustion catalysts. Application of the same synthetic approach to n-propoxide complexes offers in a Co-Ti system a derivative with a different composition and resolved metal and ligand disorder, Co(4)Ti(2)O(acac)(4)(O(n)Pr)(10) (6), which, however, still follows the Lindquist type and displays high (tetragonal) symmetry for both the molecule and the crystal structure. PMID:20648394

  15. Biocontrol activity and primed systemic resistance by compost water extracts against anthracnoses of pepper and cucumber.

    Science.gov (United States)

    Sang, Mee Kyung; Kim, Ki Deok

    2011-06-01

    We investigated direct and indirect effects of compost water extracts (CWEs) from Iljuk-3, Iljuk-7, Shinong-8, and Shinong-9 for the control of anthracnoses caused by Colletotrichum coccodes on pepper and C. orbiculare on cucumber. All tested CWEs significantly (P anthracnose severities; Iljuk-3, Shinong-9, and BABA for pepper and Iljuk-7 for cucumber had more protective activities than curative activities. In addition, root treatment of CWEs suppressed anthracnoses on the plants by the pathogens; however, CWE treatment on lower leaves failed to reduce the diseases on the upper leaves of the plants. The CWE root treatments enhanced not only the expression of the pathogenesis-related (PR) genes CABPR1, CABGLU, CAChi2, CaPR-4, CAPO1, and CaPR-10 in pepper and PR1-1a, PR-2, PR-3, and APOX in cucumber but also the activity of β-1,3-glucanase, chitinase, and peroxidase and the generation of hydrogen peroxide in pepper and cucumber under pathogen-inoculated conditions. However, the CWE treatments failed to induce the plant responses under pathogen-free conditions. These results indicated that the CWEs had direct effects, reducing anthracnoses by C. coccodes on pepper leaves and C. orbiculare on cucumber leaves through protective and curative effects. In addition, CWE root treatments could induce systemic resistance in the primed state against pathogens on plant leaves that enhanced PR gene expression, defense-related enzyme production, and hydrogen peroxide generation rapidly and effectively immediately after pathogen infection. Thus, the CWEs might suppress anthracnoses on leaves of both pepper and cucumber through primed (priming-mediated) systemic resistance. PMID:21281115

  16. Interspecific proteomic comparisons reveal ash phloem genes potentially involved in constitutive resistance to the emerald ash borer.

    Directory of Open Access Journals (Sweden)

    Justin G A Whitehill

    Full Text Available The emerald ash borer (Agrilus planipennis is an invasive wood-boring beetle that has killed millions of ash trees since its accidental introduction to North America. All North American ash species (Fraxinus spp. that emerald ash borer has encountered so far are susceptible, while an Asian species, Manchurian ash (F. mandshurica, which shares an evolutionary history with emerald ash borer, is resistant. Phylogenetic evidence places North American black ash (F. nigra and Manchurian ash in the same clade and section, yet black ash is highly susceptible to the emerald ash borer. This contrast provides an opportunity to compare the genetic traits of the two species and identify those with a potential role in defense/resistance. We used Difference Gel Electrophoresis (DIGE to compare the phloem proteomes of resistant Manchurian to susceptible black, green, and white ash. Differentially expressed proteins associated with the resistant Manchurian ash when compared to the susceptible ash species were identified using nano-LC-MS/MS and putative identities assigned. Proteomic differences were strongly associated with the phylogenetic relationships among the four species. Proteins identified in Manchurian ash potentially associated with its resistance to emerald ash borer include a PR-10 protein, an aspartic protease, a phenylcoumaran benzylic ether reductase (PCBER, and a thylakoid-bound ascorbate peroxidase. Discovery of resistance-related proteins in Asian species will inform approaches in which resistance genes can be introgressed into North American ash species. The generation of resistant North American ash genotypes can be used in forest ecosystem restoration and urban plantings following the wake of the emerald ash borer invasion.

  17. Likelihood-based molecular-replacement solution for a highly pathological crystal with tetartohedral twinning and sevenfold translational noncrystallographic symmetry

    Energy Technology Data Exchange (ETDEWEB)

    Sliwiak, Joanna [Institute of Bioorganic Chemistry, Polish Academy of Sciences, Noskowskiego 12/14, 61-704 Poznan (Poland); Jaskolski, Mariusz, E-mail: mariuszj@amu.edu.pl [Institute of Bioorganic Chemistry, Polish Academy of Sciences, Noskowskiego 12/14, 61-704 Poznan (Poland); A. Mickiewicz University, Grunwaldzka 6, 60-780 Poznan (Poland); Dauter, Zbigniew [National Cancer Institute, Argonne National Laboratory, Argonne, IL 60439 (United States); McCoy, Airlie J.; Read, Randy J., E-mail: mariuszj@amu.edu.pl [University of Cambridge, Wellcome Trust/MRC Building, Hills Road, Cambridge CB2 0XY (United Kingdom); Institute of Bioorganic Chemistry, Polish Academy of Sciences, Noskowskiego 12/14, 61-704 Poznan (Poland)

    2014-02-01

    With the implementation of a molecular-replacement likelihood target that accounts for translational noncrystallographic symmetry, it became possible to solve the crystal structure of a protein with seven tetrameric assemblies arrayed translationally along the c axis. The new algorithm found 56 protein molecules in reduced symmetry (P1), which was used to resolve space-group ambiguity caused by severe twinning. Translational noncrystallographic symmetry (tNCS) is a pathology of protein crystals in which multiple copies of a molecule or assembly are found in similar orientations. Structure solution is problematic because this breaks the assumptions used in current likelihood-based methods. To cope with such cases, new likelihood approaches have been developed and implemented in Phaser to account for the statistical effects of tNCS in molecular replacement. Using these new approaches, it was possible to solve the crystal structure of a protein exhibiting an extreme form of this pathology with seven tetrameric assemblies arrayed along the c axis. To resolve space-group ambiguities caused by tetartohedral twinning, the structure was initially solved by placing 56 copies of the monomer in space group P1 and using the symmetry of the solution to define the true space group, C2. The resulting structure of Hyp-1, a pathogenesis-related class 10 (PR-10) protein from the medicinal herb St John’s wort, reveals the binding modes of the fluorescent probe 8-anilino-1-naphthalene sulfonate (ANS), providing insight into the function of the protein in binding or storing hydrophobic ligands.

  18. Overexpression of mtDNA-associated AtWhy2 compromises mitochondrial function

    Directory of Open Access Journals (Sweden)

    Abou-Rached Charbel

    2008-04-01

    Full Text Available Abstract Background StWhy1, a member of the plant-specific Whirly single-stranded DNA-binding protein family, was first characterized as a transcription factor involved in the activation of the nuclear PR-10a gene following defense-related stress in potato. In Arabidopsis thaliana, Whirlies have recently been shown to be primarily localized in organelles. Two representatives of the family, AtWhy1 and AtWhy3 are imported into plastids while AtWhy2 localizes to mitochondria. Their function in organelles is currently unknown. Results To understand the role of mitochondrial Whirlies in higher plants, we produced A. thaliana lines with altered expression of the atwhy2 gene. Organellar DNA immunoprecipitation experiments demonstrated that AtWhy2 binds to mitochondrial DNA. Overexpression of atwhy2 in plants perturbs mitochondrial function by causing a diminution in transcript levels and mtDNA content which translates into a low activity level of respiratory chain complexes containing mtDNA-encoded subunits. This lowered activity of mitochondria yielded plants that were reduced in size and had distorted leaves that exhibited accelerated senescence. Overexpression of atwhy2 also led to early accumulation of senescence marker transcripts in mature leaves. Inactivation of the atwhy2 gene did not affect plant development and had no detectable effect on mitochondrial morphology, activity of respiratory chain complexes, transcription or the amount of mtDNA present. This lack of phenotype upon abrogation of atwhy2 expression suggests the presence of functional homologues of the Whirlies or the activation of compensating mechanisms in mitochondria. Conclusion AtWhy2 is associated with mtDNA and its overexpression results in the production of dysfunctional mitochondria. This report constitutes the first evidence of a function for the Whirlies in organelles. We propose that they could play a role in the regulation of the gene expression machinery of organelles.

  19. Partial Activation of SA- and JA-Defensive Pathways in Strawberry upon Colletotrichum acutatum Interaction.

    Science.gov (United States)

    Amil-Ruiz, Francisco; Garrido-Gala, José; Gadea, José; Blanco-Portales, Rosario; Muñoz-Mérida, Antonio; Trelles, Oswaldo; de Los Santos, Berta; Arroyo, Francisco T; Aguado-Puig, Ana; Romero, Fernando; Mercado, José-Ángel; Pliego-Alfaro, Fernando; Muñoz-Blanco, Juan; Caballero, José L

    2016-01-01

    Understanding the nature of pathogen host interaction may help improve strawberry (Fragaria × ananassa) cultivars. Plant resistance to pathogenic agents usually operates through a complex network of defense mechanisms mediated by a diverse array of signaling molecules. In strawberry, resistance to a variety of pathogens has been reported to be mostly polygenic and quantitatively inherited, making it difficult to associate molecular markers with disease resistance genes. Colletotrichum acutatum spp. is a major strawberry pathogen, and completely resistant cultivars have not been reported. Moreover, strawberry defense network components and mechanisms remain largely unknown and poorly understood. Assessment of the strawberry response to C. acutatum included a global transcript analysis, and acidic hormones SA and JA measurements were analyzed after challenge with the pathogen. Induction of transcripts corresponding to the SA and JA signaling pathways and key genes controlling major steps within these defense pathways was detected. Accordingly, SA and JA accumulated in strawberry after infection. Contrastingly, induction of several important SA, JA, and oxidative stress-responsive defense genes, including FaPR1-1, FaLOX2, FaJAR1, FaPDF1, and FaGST1, was not detected, which suggests that specific branches in these defense pathways (those leading to FaPR1-2, FaPR2-1, FaPR2-2, FaAOS, FaPR5, and FaPR10) were activated. Our results reveal that specific aspects in SA and JA dependent signaling pathways are activated in strawberry upon interaction with C. acutatum. Certain described defense-associated transcripts related to these two known signaling pathways do not increase in abundance following infection. This finding suggests new insight into a specific putative molecular strategy for defense against this pathogen. PMID:27471515

  20. EAACI Molecular Allergology User's Guide.

    Science.gov (United States)

    Matricardi, P M; Kleine-Tebbe, J; Hoffmann, H J; Valenta, R; Hilger, C; Hofmaier, S; Aalberse, R C; Agache, I; Asero, R; Ballmer-Weber, B; Barber, D; Beyer, K; Biedermann, T; Bilò, M B; Blank, S; Bohle, B; Bosshard, P P; Breiteneder, H; Brough, H A; Caraballo, L; Caubet, J C; Crameri, R; Davies, J M; Douladiris, N; Ebisawa, M; EIgenmann, P A; Fernandez-Rivas, M; Ferreira, F; Gadermaier, G; Glatz, M; Hamilton, R G; Hawranek, T; Hellings, P; Hoffmann-Sommergruber, K; Jakob, T; Jappe, U; Jutel, M; Kamath, S D; Knol, E F; Korosec, P; Kuehn, A; Lack, G; Lopata, A L; Mäkelä, M; Morisset, M; Niederberger, V; Nowak-Węgrzyn, A H; Papadopoulos, N G; Pastorello, E A; Pauli, G; Platts-Mills, T; Posa, D; Poulsen, L K; Raulf, M; Sastre, J; Scala, E; Schmid, J M; Schmid-Grendelmeier, P; van Hage, M; van Ree, R; Vieths, S; Weber, R; Wickman, M; Muraro, A; Ollert, M

    2016-05-01

    The availability of allergen molecules ('components') from several protein families has advanced our understanding of immunoglobulin E (IgE)-mediated responses and enabled 'component-resolved diagnosis' (CRD). The European Academy of Allergy and Clinical Immunology (EAACI) Molecular Allergology User's Guide (MAUG) provides comprehensive information on important allergens and describes the diagnostic options using CRD. Part A of the EAACI MAUG introduces allergen molecules, families, composition of extracts, databases, and diagnostic IgE, skin, and basophil tests. Singleplex and multiplex IgE assays with components improve both sensitivity for low-abundance allergens and analytical specificity; IgE to individual allergens can yield information on clinical risks and distinguish cross-reactivity from true primary sensitization. Part B discusses the clinical and molecular aspects of IgE-mediated allergies to foods (including nuts, seeds, legumes, fruits, vegetables, cereal grains, milk, egg, meat, fish, and shellfish), inhalants (pollen, mold spores, mites, and animal dander), and Hymenoptera venom. Diagnostic algorithms and short case histories provide useful information for the clinical workup of allergic individuals targeted for CRD. Part C covers protein families containing ubiquitous, highly cross-reactive panallergens from plant (lipid transfer proteins, polcalcins, PR-10, profilins) and animal sources (lipocalins, parvalbumins, serum albumins, tropomyosins) and explains their diagnostic and clinical utility. Part D lists 100 important allergen molecules. In conclusion, IgE-mediated reactions and allergic diseases, including allergic rhinoconjunctivitis, asthma, food reactions, and insect sting reactions, are discussed from a novel molecular perspective. The EAACI MAUG documents the rapid progression of molecular allergology from basic research to its integration into clinical practice, a quantum leap in the management of allergic patients. PMID:27288833

  1. Partial Activation of SA- and JA-Defensive Pathways in Strawberry upon Colletotrichum acutatum Interaction

    Science.gov (United States)

    Amil-Ruiz, Francisco; Garrido-Gala, José; Gadea, José; Blanco-Portales, Rosario; Muñoz-Mérida, Antonio; Trelles, Oswaldo; de los Santos, Berta; Arroyo, Francisco T.; Aguado-Puig, Ana; Romero, Fernando; Mercado, José-Ángel; Pliego-Alfaro, Fernando; Muñoz-Blanco, Juan; Caballero, José L.

    2016-01-01

    Understanding the nature of pathogen host interaction may help improve strawberry (Fragaria × ananassa) cultivars. Plant resistance to pathogenic agents usually operates through a complex network of defense mechanisms mediated by a diverse array of signaling molecules. In strawberry, resistance to a variety of pathogens has been reported to be mostly polygenic and quantitatively inherited, making it difficult to associate molecular markers with disease resistance genes. Colletotrichum acutatum spp. is a major strawberry pathogen, and completely resistant cultivars have not been reported. Moreover, strawberry defense network components and mechanisms remain largely unknown and poorly understood. Assessment of the strawberry response to C. acutatum included a global transcript analysis, and acidic hormones SA and JA measurements were analyzed after challenge with the pathogen. Induction of transcripts corresponding to the SA and JA signaling pathways and key genes controlling major steps within these defense pathways was detected. Accordingly, SA and JA accumulated in strawberry after infection. Contrastingly, induction of several important SA, JA, and oxidative stress-responsive defense genes, including FaPR1-1, FaLOX2, FaJAR1, FaPDF1, and FaGST1, was not detected, which suggests that specific branches in these defense pathways (those leading to FaPR1-2, FaPR2-1, FaPR2-2, FaAOS, FaPR5, and FaPR10) were activated. Our results reveal that specific aspects in SA and JA dependent signaling pathways are activated in strawberry upon interaction with C. acutatum. Certain described defense-associated transcripts related to these two known signaling pathways do not increase in abundance following infection. This finding suggests new insight into a specific putative molecular strategy for defense against this pathogen. PMID:27471515

  2. Expression profiles of hot pepper (Capsicum annuum) genes under cold stress conditions

    Indian Academy of Sciences (India)

    Eul-Won Hwang; Kyung-A Kim; Soo-Chul Park; Mi-Jeong Jeong; Myung-Ok Byun; Hawk-Bin Kwon

    2005-12-01

    In an attempt to determine a cold defense mechanism in plants, we have attempted to characterize changes occurring in the expression of cold-regulated transcript levels in the hot pepper (Capsicum annuum), using cDNA microarray analysis, combined with Northern blot analysis. After analysing a 3.1 K hot pepper cDNA microarray, we isolated a total of 317 cold inducible genes. We selected 42 genes which were up-regulated and three genes which were down-regulated due to cold treatment, for further analysis. Among the 45 genes which appeared to be up-regulated by cold, 19 genes appeared to be simultaneously regulated by salt stress. Among the up-regulated cold-stress genes, we identified a variety of transcription factors, including: a family of 4 ethylene-responsive element binding protein (EREBP, designated CaEREBP-C1 to C4) genes, a bZIP protein (CaBZ1), RVA1, Ring domain protein, HSF1, and the WRKY (CaWRKY1) protein. As mentioned earlier, several genes appeared to be induced not only by cold stress, but also simultaneously by salt stress. These genes included: CaEREBP-C3, CaBZ1, putative trans-activator factor, NtPRp27, malate dehydrogenase, putative auxin-repressed protein, protein phosphatase (CaTPP1), SAR8.2 protein precursor, late-embryogenesis abundant protein 5 (LEA5), DNAJ protein homologue, xyloglucanendo-1,4--D-gucanase precursor, PR10, and the putative non-specific lipid transfer protein StnsLTP.

  3. Clinical observation of raltitrexed/bevacizumab combined with irinotecan or oxaliplation for advanced colorectal cancer

    Institute of Scientific and Technical Information of China (English)

    Jianwei Yang; Wei Gao; Jinyuan Lin; Yan Meng; Shuzhen Zhang; Tong Wang

    2014-01-01

    Objective: The aim of the study was to investigate the ef icacy and safety of raltitrexed/bevacizumab in combina-tion with irinotecan or oxaliplation for advanced colorectal cancer as the second-line and second-line above treatments. Meth-ods: Fifteen cases of advanced colorectal cancer were enrol ed to receive regimens including raltitrexed/bevacizumab com-bined with irinotecan or oxaliplation. Two cases were treated with raltitrexed + bavacizumab regimen, 9 cases with raltitrexed+ bavacizumab + irinotecan regimen, and 4 cases with raltitrexed + bevacizumab + oxaliplation regimen. The doses of the drugs were as fol ows: bevacizumab 5 mg/kg ivgtt, d1; raltitrexed 2.0 mg/m2 ivgtt 15 min, d2; irinotecan 180 mg/m2 ivgtt 1 h, d2; and oxaliplatin 85 mg/m2 ivgtt 2 h, d2. Two weeks was a cycle for each regimen. Results: The ef icacy of the 15 patients could be evaluated. Two cases were in PR ,10 cases in SD, 3 cases in PD, the response rate was 13.3%, and the disease control rate was 80.0%. The median progress-free survival was 5.1 months (95% CI: 3.404-6.813 months), and the median overal survival was 11.5 months (95% CI: 8.985-13.930 months). The adverse ef ects included anorexia, nausea/vomit-ing, fatigue, leucopenia, thrombocytopenia, etc, and the main 3-4 grades adverse ef ects were anorexia, nausea/vomiting, fatigue, and thrombocytopenia. Conclusion: Raltitrexed/bevacizumab combined with irinotecan or oxaliplatin as the second-line and second-line above treatments for advanced colorectal cancer has high disease control rates, and the adverse ef ect is wel tolerated. The combined regimen can be recommended as a phase III clinical research and second-line and second-lines above treatments for advanced colorectal cancer.

  4. Reference gene selection and validation for the early responses to downy mildew infection in susceptible and resistant Vitis vinifera cultivars.

    Science.gov (United States)

    Monteiro, Filipa; Sebastiana, Mónica; Pais, Maria Salomé; Figueiredo, Andreia

    2013-01-01

    The pivotal role of cultivated grapevine (Vitis vinifera L.) in many countries economy is compromised by its high susceptibility to Plasmopara viticola, the causal agent of downy mildew disease. Recent research has identified a set of genes related to resistance which may be used to track downy mildew infection. Quantification of the expression of these resistance genes requires normalizing qPCR data using reference genes with stable expression in the system studied. In this study, a set of eleven genes (VATP16, 60 S, UQCC, SMD3, EF1α, UBQ, SAND, GAPDH, ACT, PsaB, PTB2) was evaluated to identify reference genes during the first hours of interaction (6, 12, 18 and 24 hpi) between two V. vinifera genotypes and P. viticola. Two analyses were used for the selection of reference genes: direct comparison of susceptible, Trincadeira, and resistant, Regent, V. vinifera cultivars at 0 h, 6, 12, 18 and 24 hours post inoculation with P. viticola (genotype effect); and comparison of each genotype with mock inoculated samples during inoculation time-course (biotic stress effect). Three statistical methods were used, GeNorm, NormFinder, and BestKeeper, allowing to identify UBQ, EF1α and GAPDH as the most stable genes for the genotype effect. For the biotic stress effect, EF1α, SAND and SMD3 were the most constant for the susceptible cultivar Trincadeira and EF1α, GAPDH, UBQ for the resistant cultivar Regent. In addition, the expression of three defense-related transcripts, encoding for subtilisin-like protein, CYP and PR10, was analysed, for both datasets, during inoculation time-course. Taken together, our results provide guidelines for reference gene(s) selection towards a more accurate and widespread use of qPCR to study the first hours of interaction between different grapevine cultivars and P. viticola. PMID:24023800

  5. Prospecting For Magnetite Ore Deposits With A Innovative Sensor's of Unique Fundamentally New Magnetometer.

    Science.gov (United States)

    Emelianenko, T. I.; Tachaytdinov, R. S.; Sarichev, V. F.; Kotov, B. V.; Susoeva, G. N.

    erosional truncation level determination(Patent for invention N 2148844 dated 10.05.2000,M.,2000). Emelianenko T.I.,Tachaytdinov R.S.,Sarichev V.F.,Kotov B.V.,Susoeva G.N.2000.Fundamentally new magnetometer -locator for search magnetite ores (Abstracts of 31 International Geological Congress -Rio-de-Janeiro Brasil)at http www:// 31.igc.org. Emel ianenko T.I.,Matveev A.A. 2000.New geochemical method of quantity estimation of magnetite deposits(Abstracts of 31 International Geological Congress in Rio de Janeiro Brasil)at htt :www.31.igc.org. Emelianenko T.I.,Matveev A.A.2001.Fundamentally new geochemical method of quantitative of magnetite ore deposits(Abstracts of 20 International Geochemical Exploration Simposium,Santiago de Chile)at http ://aeg.org. Emelianenko T.I.,Matveev A.A.2001.Fundamentally new geochemical method of hypsometrical level of magnetite deposits ore zone.(Abstracts of 20 International Geochemical Exploration Symposium Santiago de Chile).at http:www.aeg.org. Nikitskiye V.E.,Glebovskiye J.S..Magnitoprospecting.M.N.1980. Nikitskiye V.E.,Glebovskiye J.S. Magnitoprospecting.M.,N.,1990. .Grinevitch G.I.Magnitoprospecting.M.,N.,1974.

  6. 吉西他滨联合卡培他滨治疗转移性三阴性乳腺癌的临床观察%Clinical Outcomes of Gemcitabine Combined Capecitabine with Metastatic Triple-negative Breast Cancer

    Institute of Scientific and Technical Information of China (English)

    李景; 高俊峰

    2013-01-01

    Objective:To observe the ef ect and side reaction of Gemcitabine combined capecitabine inmetastatic triple-negative breast cancer. Method:28 patients with metastatic triple-negative breast cancer were enrol ed. Capecitabine was oral dose with 2000mg/m2 per day though day 1 to day 14 and Gemcitabine injected with 1000mg/m2 at day 1 and day 8. Every 2 weeks repeated. Results:The outcomes in 28 patients included completed response (n=2,7.14%),partial response (n=10,35.7%) , stable disease (n=10,35.7%),progressive disease (n=6,21.4%) Total ef ective rate was 42.9%. Conclusion: Gemcitabine combined capecitabine was ef ective plan with with metastatic triple-negative breast cancer after the patients were failed with anthracycline and/or taxanes.%目的观察吉西他滨联合卡培他滨治疗蒽环及紫杉类药物耐药的转移性三阴性乳腺癌的疗效及不良反应。方法28例转移性三阴性乳腺癌患者,卡培他滨2000mg/m2·d,第1~14d,早晚饭后30min,2次/d口服;吉西他滨1000mg/m2,第1、8d,3周天为1周期。结果28例患者中,CR2例(7.14%),PR 10例(35.7%),SD 10例(35.7%),PD6例(21.4%),总有效率(CR+PR)为42.9%。结论卡培他滨联合吉西他滨治疗蒽环类和(或)紫杉类耐药转移性三阴性乳腺癌患者疗效较好,不良反应可以耐受.可以作为蒽环类和(或)紫杉类耐药的晚期三阴性乳腺癌患者的一个有效解救方案。

  7. Clinical Observation of HIFU in Combination with Chemotherapy on Recurrent or Metastatic Peritoneo-Pelvic Malignant Tumors%HIFU合并化疗治疗腹盆腔复发或转移癌的临床观察

    Institute of Scientific and Technical Information of China (English)

    许新华; 付向阳; 李松; 陈燕; 张小红; 薛峰; 李道俊; 王翠华

    2006-01-01

    目的:探讨高能聚焦超声刀(High intensity focused ultrasound,HIFU)合并化疗治疗腹盆腔复发或转移癌的疗效及不良反应.方法:选取既往病史有过手术和/或放、化疗史,病理诊断明确的腹盆腔复发或转移癌68例,随机分为治疗组(36例)和对照组(32例),前者采用HIFU+化疗,后者单纯用化疗,均在完成2周期化疗后评价其有效率、临床受益反应,并至少随访1年.结果:治疗组完全缓解(CR)1例,部分缓解(PR)24例,总有效率69.4%(25/36),临床受益率(CBR)为83.3%(30/36),平均生存期为9.1±3.1个月;对照组CR 0例,PR 10例,总有效率31.3%(10/32),CBR为56.3%(18/32),平均生存期为6.8±2.4个月;两组比较有显著性意义(P<0.01、P<0.05、P<0.01),主要不良反应为骨髓抑制和消化道反应,两组间比较无统计学差异,治疗组无脏器穿孔、大出血、胰漏、腹膜炎等并发症发生.结论:HIFU合并化疗治疗腹盆腔复发或转移癌可取得较高的局控率和临床受益率,并能延长其生存期,对于无手术和(或)放疗适应症的晚期腹盆腔恶性肿瘤不失为一种安全、有效的高姑息治疗手段.

  8. Prevalence and Correlates of HIV Infection among Street Boys in Kisumu, Kenya.

    Directory of Open Access Journals (Sweden)

    Ariella Goldblatt

    Full Text Available Despite their perceived vulnerability to HIV, East African street youth have been neglected in HIV prevention research. We examined HIV seroprevalence and correlates of HIV infection in a sample of male street youth in Kisumu, Kenya.We enrolled a street-recruited sample of 13-21 year old street youth. Participants completed a survey followed by voluntary HIV counseling and testing. Survey items included demographics, homelessness history, survival activities, sexual behavior and substance use. We examined the relationship between predictor variables, markers of coercion and marginalization and HIV.The sample included 296 males. Survival activities included garbage picking (55%, helping market vendors (55%, begging (17%, and working as porters (46% or domestic workers (4%. Forty-nine percent of participants reported at least weekly use of alcohol and 32% marijuana. Forty-six percent of participants reported lifetime inhalation of glue and 8% fuel. Seventy-nine percent of participants reported lifetime vaginal sex, 6% reported lifetime insertive anal sex and 8% reported lifetime receptive anal sex. Twelve (4.1%; 95% CI: 2.3-7.0 participants tested positive for HIV. Of those, all had been on the street for at least one year and all had engaged in vaginal sex. Occupations placing youth at particular risk of coercion by adults, including helping market vendors (prevalence ratio (PR = 8.8; 95% CI: 1.2-67.5 and working as domestic workers (PR = 4.6; 95% CI: 1.1-19.0, were associated with HIV infection. Both insertive anal sex (PR = 10.2; 95% CI: 3.6-29.4 and receptive anal sex (PR = 3.9; 95% CI: 1.1-13.4 were associated with HIV infection. Drug use, begging, and garbage picking were not associated with HIV infection.Although HIV prevalence in our sample of street youth is comparable to that of similarly-aged male youth in Nyanza Province, our findings highlight behavioral factors associated with HIV infection that offer opportunities for targeted

  9. Effects of different nerve autografts on greater auricular nerve deficit in rabbits

    Institute of Scientific and Technical Information of China (English)

    Shaozong Chen

    2007-01-01

    BACKGROUND: Autograft is commonly used to repair nerve deficit. Usually, the choice of donor nerves is based on their similarities in form and structures to the injured nerves. For the reason, the cutaneous antebrachii lateralis nerve is currently considered the most suited for digital nerve repair. OBJECTIVE: To compare early nerve regeneration after transplantation of three different autografts: the greater auricular nerve (CAN), the saphenous nerve (SN) and the lateral femoral cutaneous nerve (LFCN). DESIGN: Observational contrast study. SETTING: Department of Plastic Surgery and Burns, Tangdu Hospital, Fourth Military Medical University of Chinese PLA.MATERIALS: A total of 42 New Zealand rabbits, of both genders, 12 - 14 months old and weighing 2.0 -2.5 kg, were used in this study. In addition, Moller-spetra 900 operating microscope (Germany), Olympus BX 51 microscope, DP 70 image collecting System (Japan), BL-420E+ Biologic function testing System (China), JEM-100 electron microscope (Japan), Reichet-JunG820 Cryostat (Swiss), and Libror-AEG-120 precision analytical Balance (Japan) were also used in this study.METHODS: The experiment was carried out in the Department of Plastic Surgery and Burns, Tangdu Hospital, Fourth Military Medical University of Chinese PLA from April to November 2005. After anaesthesia, the GAN were dissected bilaterally and a 1.2 cm deficit was made in each nerve. The animals were randomly divided into three groups, including GAN group, SN group and LFCN group with 14 in each group. ①Nerve pinch test: At 1,2, and 4 weeks after operation, three animals in each group were tested. The nerve grafts, along with the proximal and distal GAN segments were exposed and pinched with microsurgical forceps in distal-proximal orientations. The distance between the proximal anastomosis site and the most distal point, where the pinch evoked an ear contraction response, was measured as distance of nerve regeneration. ②Computer image analysis: At 4

  10. 卡培他滨单药治疗老年晚期乳腺癌的临床观察%Clinical Observation of Capecitabine Monotherapy in Treatment of Elder Patients with Advanced Breast Cancer

    Institute of Scientific and Technical Information of China (English)

    方立萍; 蒋葵; 吴紫权; 张阳

    2012-01-01

    目的 观察卡培他滨单药治疗老年晚期乳腺癌的临床疗效和毒性反应.方法 36例Ⅳ期老年乳腺癌患者均经病理组织学或细胞学检查确诊.治疗剂量卡培他滨:2500 mg/m2,分早晚2次餐后半小时口服,第1 ~ 14天,每3~4周重复,2周期后评价疗效.结果 36例患者均可评价,其中获完全缓解(CR)0例,部分缓解(PR) 10例,稳定(SD) 14例,进展(PD)12例,总有效率27.8% (10/36).临床获益率(CR+ PR+ SD) 66.7% (24/36),中位疾病进展时间(TTP)7.1个月.主要的毒副反应为手足综合症、腹泻、口腔炎,均可耐受,无化疗相关死亡.结论 卡培他滨单药治疗老年晚期乳腺癌疗效确切,可明显改善患者生存质量,延长生存时间,副反应轻,耐受性良好并适合门诊治疗,是一种安全有效的姑息治疗方案.%Objective To evaluate the clinical efficacy and toxicity of capecitabine monotherapy in treatment of elder patients with advanced breast cancer. Methods Thirty six patients with advanced breast cancer confirmed by pathology or cytology were enrolled into the study. The patients received capecitabine 1250 mg/m2 twice daily,within 30 min after meal dl -14,every 3 -4 weeks and were evaluated efficacy after 2 cycles. Results None complete remission( CR) case was observed,PR was in 10 cases, 14 cases had stable disease( SD) and 12 cases got progressive disease( PD). The clinical benefit response rate( CR + PR + SD) was 66.7% (24/36). The median time to progression(TTP) was 7. 1 months. The main side effects were hand-foot syndrome , diarrhea and stomatitis which were all tolerable. Conclusion The regimen of capecitabine is effect, safe and well-tolerable in the treatment of elder patients with advanced breast cancer. It can significantly improve the quality of life in patients with advanced breast cancer, and prolong the survival time. The side effects are light and were well tolerated. It is suitable for outpatient treatment. The method is a safe

  11. Docetaxel plus Capecitabine Combination Therapy for Patients with Anthracycline-resistant Metastatic Breast Cancer%多西紫杉醇联合卡培他滨治疗蒽环类耐药的晚期乳腺癌

    Institute of Scientific and Technical Information of China (English)

    柴文英; 马芸; 李萍; 钱锦贤; 蒋爱梅

    2011-01-01

    目的:观察多西紫杉醇联合卡培他滨(DC)治疗蒽环类耐药晚期乳腺癌的疗效和安全性.方法:31例经病理证实的蒽环类耐药的转移性乳腺癌患者,采用多西紫杉醇联合卡培他滨化疗.剂量为多西紫杉醇75mg/m2,静滴,d1;希罗达2 500mg/m2,口服,d1~d14,21天为1个周期,化疗至疾病进展或不良反应无法耐受.根据WHO制定的实体瘤客观疗效评价标准和抗癌药物毒性分级标准评价疗效和不良反应.结果:31例患者共完成118个周期化疗,每例患者化疗2个~8个周期,中位周期数4个.31例患者中,完全缓解1例(3.2%),部分缓解16例(51.6%),稳定10例(32.3%),进展4例(12.9%),总有效率为54.8%.中位肿瘤进展时间6.3个月,中位生存期13个月,1年生存率为58.8 %.主要不良反应为骨髓抑制、胃肠道反应和手足综合征,患者均可耐受.结论:多西紫杉醇联合卡培他滨治疗蒽环类耐药晚期乳腺癌的疗效较好,不良反应可以耐受,是治疗蒽环类耐药晚期乳腺癌的有效方案.%Objective: To evaluate the efficacy and toxicity of docetaxel plus capecitabine in the treatment of anthracycline-resistant metastatic breast cancer. Methods: Thirty-one patients with anthracycline-resistant metastatic breast cancer were treated with chemotherapy combined with docetaxel and capecitabine. Docetaxel ( 75mg/m2 ) was given intravenously on d1 and capecitabine ( 2 500mg/m2 )was taken orally on d1 to d14, every 21 days as one cycle. Results: A total of 118 cycles of the regimen were administered in the 31 cases with a median of 4 cycles( range 2 ~ 8 cycles for each patient ). The overall response rate was 54.8%. Among the 31 patients, one got complete response( CR ), 16 partial response( PR ), 10 stable disease( SD ) and4 progressive disease( PD ). The median time of progression ( TTP ) was 6.3 months. The median survival time was 13 months. The one-year survival rate was 58.8%.The major toxicity and adverse effects

  12. Magnetic characterization of distal IRD layers at the NW Iberia Continental margin

    Science.gov (United States)

    Rey, D.; Mohamed, K. J.; Andrade, A.; Rodríguez-Germade, I.; Coimbra, R. L.; Rubio, B.; Bernabeu, A. M.; Alvarez-Iglesias, P.; Frederichs, T.

    2012-12-01

    during the Heinrich events. H-events in the study area have been assigned to those horizons that exceed 0.5 times the standard deviation background value recalculated to Ln(k) of a given core after detail magnetic characterization of "IRD-suspicious" layers. The robustness of the method have been demonstrated against increasing grain size trends loops on the ARM vs. K plots, the identification of larger size magnetite grains by low temperature techniques, EDX assisted BS-SEM, consistency with elemental FRX derived composition down-core trends, and 14C ages in hemipelagic layers. The method allowed fast recognition of events H1 to H5 at the study area and subsequently the creation of a robust and inexpensive geochronological framework. Further to this, we have been able to identify the presence of H-layer derived diagenetic greigite in some of the horizons. Bond, G. et al., 1992. Nature, 360, 245- 249. Heinrich, 1988. Quaternary Research, 29, 142-152 . Kissel, 2005. C. R. Geoscience 337, 908-918 Lebreiro, et al.,1996. Marine Geology 131, 47-56. Moreno et al. 2002. EPSL, 202, 465-480. Rey et al., 2008. Mar. Geol, 249, 64-92 . Robinson et al. 1995. Paleoceanography, 10, 221-250 . Ruddiman, W.F. (1977). Geol. Soc. Am. Bull. 88, 1-12 . Thouveny, et al. 2000. EPSL, 180, 61-75. Cont. Proj. CTM2007-61227/MAR, GCL2010-16688, 09MMA012312PR & 10MMA312022PR

  13. SMALL-DOSE CYTOKINES IN COMBINATION WITH 5-FLUOROURACIL IN OLISSEMINATED RENAL CELL CARCINOMA: FINAL RESULTS OF A RANDOMIZED TRIAL

    Directory of Open Access Journals (Sweden)

    L. V. Demidov

    2009-01-01

    Full Text Available Background: High and intermediate IL-2 regimens are difficult to recommend because of great toxicity and efficacy is not sufficient. We suggest that a combination of very low-dose cytokines is effective and safe in metastatic renal cell carcinoma (MRCC patients (pts. A prospective randomized study was started in 2003. The primary end-point was a response rate. Methods: The eligibility criteria included histopathologically confirmed MRCC, ECOG PS 0-2, no autoimmune diseases, no brain metastases, and normal organ function. All pts were randomized in three arms: IL-2 alone, 1.5 MIU, iv, t.i.w., weeks 1—3 or IL-2 1.0 MIU, iv, t.i.w., weeks 1—3 plus IFN 5 MIU, sc, t.i.w, weeks 1—3 or biochemotherapy group 5-FU, 500 mg/m2, iv, once a week, weeks 1—3 plus IL-2 1.0 MIU, iv, t.i.w., weeks 1—3 plus IFN 5 MIU, sc, t.i.w., weeks 1—3. Courses were repeated every three weeks. A response was assessed according to the RECIST every 2 courses.Results: 64 pts were enrolled, of whom 63 were analyzed. Their median age was 55.4 years (range 16—74. 42.9% of the patients had pre- viously received chemo- or immunotherapy. 55.6 percent of the pts had poor prognosis (according to Motzer et al., 2002. Bone metastases were present in 52.4% of the pts. Sixteen patients treated with IL-2 alone showed no CR, PR, 2 SD, or 14 PD. Of 23 patients in the IL-2+IFN group, there were 5 PR, 8 SD, and 10 PD, with a response rate of 21.7%. Amongst 24 patients in the 5-FU+IL-2+IFN group, there were 1 CR, 3 PR, 10 SD, and 10 PD, with a response rate of 16.7%. One-year survival was 20.0%, 81.3% and 81.0%, respectively. The influenza-like syndrome was the most common side effect in the pts who received IFN (89.1%, grade 1, CTC. Hypotension associated with IL-2 (all groups was seen in 56.3% (50%, grade 1 and 6.3%, grade 2. The other adverse reactions were 12.7% grade 1 neutropenia and vomiting in 4.7% pts (Group 3.Conclusion: All regimens are well tolerated. Small-dose IL-2

  14. 多西他赛联合卡培他滨治疗复发转移乳腺癌的疗效及相关因素研究%Clinical study of low-dose docetaxel combined with capecitabine for metastatic breast cancer

    Institute of Scientific and Technical Information of China (English)

    陆海林; 李燕; 宁志强; 曹婷华; 陈超

    2011-01-01

    were evaluable for efficacy. The overall response rate was 55. 3% (21/38), with 3 patients of CR, 18 patients of PR, 10 patients of SD and 7 patients of PD. The median PFS of 38 patients was 7. 1 months. The most frequent treatment-related adverse events were nausea/vomiting, fatigue, leukopenia and hand-foot syndrome. Among them, grade 3-4 leukopenia was 15. 8% and no treatment-related deaths occurred. PS(P=0.003), pausimenia status(P= 0.043) and number of transfer(P=0.021) were related to RR, while only PS was the independent prognostic factor (P < 0. 05). PS was the only independent prognostic factor for PFS by Cox proportion hazard model ( P < 0.05). Conclusion Low-dose docetaxel combined with capecitabine is effective and safe in the treatment of metastatic breast cancer and adverse events were tolerable. PS is the only independent prognostic factor for efficacy of XT regimen in metastatic breast cancer.

  15. ESO PR Highlights in 2006

    Science.gov (United States)

    2007-01-01

    Last year proved to be another exceptional year for the European organisation for ground-based astronomy. ESO should begin the New Year with two new member states: Spain (PR 05/06) and the Czech Republic (PR 52/06). ESO PR Highlights 2006 2006 was a year of renovation and revolution in the world of planets. A new Earth-like exoplanet has been discovered (PR 03/06) using a network of telescopes from all over the world (including the Danish 1.54-m one at ESO La Silla). It is not the only child of this fruitful year: thanks to the combined use of ESO's Very Large Telescope (VLT) and La Silla instruments, a surprising system of twin giant exoplanets was found (PR 29/06), and a trio of Neptune-like planets hosted by a nearby star were identified (PR 18/06). These results open new perspectives on the search for habitable zones and on the understanding of the mechanism of planet formation. The VISIR instrument on the VLT has been providing unique information to answer this last question, by supplying a high resolution view of a planet-forming disc (PR 36/06). There are not only new members in the planets' register: during the General Assembly of the International Astronomical Union held in Prague (Czech Republic), it was decided that Pluto is not a planet anymore but a 'dwarf planet'. Whatever its status, Pluto still has a satellite, Charon, whose radius and density have been measured more accurately by observing a rare occultation from different sites, including Cerro Paranal (PR 02/06). The scientific community dedicated 2006 to the great physicist James Clerk Maxwell (it was the 175th anniversary of the birth): without his electromagnetic theory of light, none of the astonishing discoveries of modern physics could have been achieved. Nowadays we can look at distant galaxies in great detail: the GIRAFFE spectrograph on the VLT revealed that galaxies 6 billion years ago had the same amount of dark matter relative to stars than nowadays (PR 10/06), while SINFONI gave an

  16. Consumo precoz de tabaco y alcohol como factores modificadores del riesgo de uso de marihuana Early tobacco and alcohol consumption as modifying risk factors on marijuana use

    Directory of Open Access Journals (Sweden)

    Verónica Iglesias

    2007-08-01

    idade de início de consumo de tabaco e/ou álcool e a intensidade de uso de tabaco. Uso de maconha e idade de início do consumo foram as variáveis de desfecho. Para a análise dos dados se utilizou regressão de Poisson e regressão de Weibull. RESULTADOS: Os escolares apresentaram alta prevalência de consumo de tabaco, álcool maconha (77%, 79% e 23%, respectivamente. O consumo de tabaco na presença de consumo de álcool foi um fator de risco de uso de maconha (RP=10,4; IC 95%: 8,9;12,2. O início tardio de consumo de tabaco (HR=0,85; IC 95%: 0,84;0,86 e álcool (HR=0,90; IC 95%: 0,89;0,91 resultou ser um fator protetor do uso de maconha. A probabilidade de consumo de maconha foi maior naqueles que fumavam diariamente ou quase, em relação àqueles que fumavam somente aos fins de semana (RP=3,11; IC 95%: 2,96;3,26 vs. RP=1,70; IC 95%: 1,58;1,83. CONCLUSÕES: O risco de consumo de maconha se associou significativamente à idade de início de consumo de tabaco, à freqüência de consumo de tabaco e ao consumo simultâneo de álcool. As estratégias de prevenção deveriam proteger os escolares do consumo precoce de tabaco.OBJECTIVE: To assess the relationship between early tobacco and alcohol use and the risk of marijuana consumption among schoolchildren. METHODS: A cross-sectional study comprising data from the Fourth National Study on Drug Use in the Chilean School Population (2001. There were studied 54,001 schoolchildren aged between eight and 20 years. Predictors were self-reported tobacco and alcohol use (ever users, age at initiation of tobacco and/or alcohol use, and intensity of tobacco use. The study outcome was self-reported marijuana use (ever users versus never users and age at initiation of marijuana use. Poisson regression and Weibull regression were used for data analysis. RESULTS: Lifetime prevalence of tobacco use was high: 77%, alcohol 79%, and marijuana 23%. Tobacco consumption increased the likelihood of marijuana use (PR=10.4; 95% CI: 8

  17. Three Good Reasons for Celebrating at the ESO/ST-ECF Science Archive Facility

    Science.gov (United States)

    2000-12-01

    Great Demand for Data from New "Virtual Observatory" Summary Due to a happy coincidence, the ESO/ST-ECF Science Archive Facility is celebrating three different milestones at the same time: * its 10th anniversary since the establishment in 1991 * the 10,000th request for data , and * the signing-up of active user number 2000 . This Archive contains over 8 Terabytes (1 Terabyte = 1 million million bytes) of valuable observational data from the NASA/ESA Hubble Space Telescope (HST), the ESO Very Large Telescope (VLT) and other ESO telescopes . Its success paves the way for the establishment of "Virtual Observatories" from which first-class data can be obtained by astronomers all over the world. This greatly enhances the opportunities for more (young) scientists to participate in front-line research. PR Photo 34/00 : Front-page of a new brochure, describing the ESO/ST-ECF Science Archive Facility. Just 10 years ago, on the 1st of January 1991, the ESO/ST-ECF (European Southern Observatory/Space Telescope-European Coordinating Facility) Science Archive Facility opened. It has since served the astronomical community with gigabyte after gigabyte of high-quality astronomical data from some of the world's leading telescopes. The Archive, which is located in Garching, just outside Munich (Germany), contains data from the 2.4-m NASA/ESA Hubble Space Telescope , as well as from several ESO telescopes: the four 8.2-m Unit Telescopes of the Very Large Telescope (VLT) at the Paranal Observatory , and the 3.5-m New Technology Telescope (NTT) , the 3.6-m telescope and the MPG/ESO 2.2-m telescope at La Silla. The Archive is a continuously developing project - in terms of amounts of data stored, the number of users and in particular because of the current dramatic development of innovative techniques for data handling and storage. In the year 2000 more than 2 Terabytes (2000 Gigabytes) of data were distributed to users worldwide. The archiving of VLT data has been described in ESO PR

  18. Distant World in Peril Discovered from La Silla

    Science.gov (United States)

    2003-01-01

    Giant Exoplanet Orbits Giant Star Summary When, in a distant future, the Sun begins to expand and evolves into a "giant" star, the surface temperature on the Earth will rise dramatically and our home planet will eventually be incinerated by that central body. Fortunately for us, this dramatic event is several billion years away. However, that sad fate will befall another planet, just discovered in orbit about the giant star HD 47536, already within a few tens of millions of years. At a distance of nearly 400 light-years from us, it is the second-remotest planetary system discovered to date [1]. This is an interesting side-result of a major research project, now carried out by a European-Brazilian team of astronomers [2]. In the course of a three-year spectroscopic survey, they have observed about 80 giant stars in the southern sky with the advanced FEROS spectrograph on the 1.52-m telescope installed at the ESO La Silla Observatory (Chile). It is one of these stars that has just been found to host a giant planet. This is only the fourth such case known and with a diameter of about 33 million km (or 23.5 times that of our Sun), HD 47536 is by far the largest of those giant stars [1]. The distance of the planet from the star is still of the order of 300 million km (or twice the distance of the Earth from the Sun), a safe margin now, but this will not always be so. The orbital period is 712 days, i.e., somewhat less than two Earth years, and the planet's mass is 5 - 10 times that of Jupiter. The presence of exoplanets in orbit around giant stars, some of which will eventually perish into their central star (be "cannibalized"), provides a possible explanation of the anomalous abundance of certain chemical elements that is observed in the atmospheres of some stars, cf. ESO PR 10/01. This interesting discovery bodes well for coming observations of exoplanetary systems with new, more powerful instruments, like HARPS to be installed next year at the ESO 3.6-m telescope on

  19. Missing Black Holes Driven Out

    Science.gov (United States)

    2004-05-01

    Active galaxies Active galaxies are breathtaking objects. Their compact nuclei (AGN = Active Galaxy Nuclei) are so luminous that they can outshine the entire galaxy; "quasars" constitute extreme cases of this phenomenon, their powerful engine making them visible over a very large fraction of the observable Universe. It is now widely accepted that the ultimate power station of these activities originates in supermassive black holes with masses up to thousands of millions times the mass of our Sun, cf. e.g., ESO PR 04/01. For comparison, the one in the Milky Way galaxy has only about 3 million solar masses, cf. ESO PR 17/02. The central black hole is believed to be fed from a tightly wound accretion disc of gas and dust encircling it, in a donuts-shaped torus (cf. ESO PR 10/04). Material that falls towards these gigantic "vacuum cleaners" will be compressed and heated up to enormous temperatures. This hot gas radiates an incredible amount of light, causing the active galaxy nucleus to shine so brightly. Because of this obscuring dust torus, the aspect of the AGN or the quasar may greatly vary. Sometimes, astronomers can look along the axis of the dust torus from above or from below and thus have a clear view of the black hole. Such objects are called "Type-1 sources". "Type-2 sources", however, are oriented such that the dust torus is seen edge-on from Earth, and our view of the black hole is therefore totally blocked by the dust over a large range of wavelengths from the near-infrared to soft X-rays. Type-2 quasars - where are they? While many examples of rather close-by Type-2 AGNs are known (so-called Seyfert 2 galaxies), it is still a matter of debate whether their larger luminosity quasar counterparts exist. Until very recently, very few examples of this class were known. One of them is the Type-2 Quasar CXOCDFS J033229.9-275106, discovered by combining observations taken in X-rays with spectra obtained by the Very Large Telescope (ESO PR 05/01). It is indeed a

  20. Young and Waltzing Binary Stars

    Science.gov (United States)

    2001-10-01

    current ESO-ESA CERN educational programme on "Life in the Universe". [3] In the case of exoplanets, the planet itself is not visible, but the spectral lines from the star are seen to wobble due to the gravitational influence of the planet, cf. ESO PR 07/01. [4] Several ESO Press Releases concern observations of the element Lithium in stars, e.g., PR 03/99 (in a giant star), PR 08/00 (in a metal-poor star) and PR 10/01 (from a "swallowed" exoplanet).