WorldWideScience

Sample records for adsorbera dlya izmereniya

  1. Data of evolutionary structure change: 1DLYA-1RTEA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1DLYA-1RTEA 1DLY 1RTE A A ------------SLFAKLGGREAVEAAVDKFYNKIVADP...TVSTYFSNTDMKVQRSKQFAFLAYALGGASEWKGKDMRTAHKDLVPHLSDVHFQAVARHLSDTLTELGVPPEDITDAMAVVASTRTEVLNMPQQ ...index>0 1RTE A 1RTE

  2. Data of evolutionary structure change: 1DLYA-1RTEB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1DLYA-1RTEB 1DLY 1RTE A B ------------SLFAKLGGREAVEAAVDKFYNKIVADP...TVSTYFSNTDMKVQRSKQFAFLAYALGGASEWKGKDMRTAHKDLVPHLSDVHFQAVARHLSDTLTELGVPPEDITDAMAVVASTRTEVLNMPQQ ...ndex>0 1RTE B 1RTE

  3. Data of evolutionary structure change: 1DLWA-1DLYA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1DLWA-1DLYA 1DLW 1DLY A A SLFEQLGGQAAVQAVTAQFYANIQADATVATFFNGIDMP...EAAVDKFYNKIVADPTVSTYFSNTDMKVQRSKQFAFLAYALGGASEWKGKDMRTAHKDLVPHLSDVHFQAVARHLSDTLTELGVPPEDITDAMAVVASTRTEVLNMPQ...HHGGGHHHH 0 1DLW A 1DLWA HANMG--VSN...Chain> 1DLY A 1DLY

  4. Avtomatizirovannyy elektrokhemilyuminestsentnyy metod opredeleniya kortizola v slyune dlya diagnostiki endogennogo giperkortitsizma sredi patsientov s ozhireniem

    Directory of Open Access Journals (Sweden)

    Zhanna Evgenyevna Belaya

    2011-06-01

    Full Text Available Nighttime salivary cortisol (NSC has been suggested to be a useful diagnostic test for Cushings syndrome (CS. However, the reference range and cut-off value are assay-specific and discordant. The goal of this study was to assess the analytical performance of automated elecrochemiluminiscence immunoassay method (ECLIA in CS. Ninety eight healthy volunteers and 123 obese patients including 45 proved to be CS provided salivary samples collected by them at 23:00 using Sallivette. Two hundred and five subjects collected salivary samples for two consecutive days and samples from 197 subjects were frozen to perform Enzyme-linked immunosorbent assay (ELISA. Obese patients underwent the 1-mg overnight dexamethasone suppression test (1-DST. CS was confirmed by the histologic diagnosis after surgical treatment or autopsy. The reference range for healthy volunteer has been set 0,5-9,4 nmol/l. Reproducibility was assessed in all subjects by a day-to-day variability and reflected by an intraclass correlation coefficient of 0,785. The cut-off value of 9,4 nmol/l has been suggested to differentiate CS among obese patients to achieve sensitivity of 84,4% (95%confidence interval 71,2-92,2%; specificity of 92,3% (95%CI 84,2-96,4% and diagnostic odds ratio 65,1 (95% CI 20,4-207,6. Likelihood ratio positive was 11,0 (95% CI 5,0-23,9, with a likelihood ratio negative of 0,17 (95%CI 0,08-0,33. The comparison of the total areas under the ROC-curve for the measurement of NSC once, twice with mean level by ECLIA, the same samples by ELISA and 1-DST have not shown any statistically significant difference among the tests performance. Conclusion: Based on its remarkable reproducibility, easy noninvasive nature, automated assay and at least similar diagnostic performance, NSC measured by ECLIA on Cobas e601 is a preferable first-line screening test for CS.

  5. Aktemra - pervyy i edinstvennyy biologicheskiy preparat, demonstriruyushchiy prevoskhodstvo nad sushchestvuyushchimi standartami terapii revmatoidnogo artrita

    Directory of Open Access Journals (Sweden)

    - -

    2008-01-01

    ostro neobkhodimy novye varianty terapii RA. Uil'yam M. Berns - glava podrazdeleniya Farma kompanii «Rosh»: «Dannye poslednikh issledovaniy yavlyayutsya obnadezhivayushchey novost'yu dlya patsientov, stradayushchikh ot razrushitel'nykh effektov RA. My verim, chto Aktemra - pervyy i edinstvennyy biologicheskiy preparat, demonstriruyushchiy preimushchestvo pered sushchestvuyushchimi standartami lecheniya RA, - oblegchit sostoyanie mnogikh bol'nykh. Krome togo, Aktemra predostavlyaet bol'she shansov dlya dostizheniya ranney i prodolzhitel'noy remissii».

  6. Aktemra - pervyy i edinstvennyy biologicheskiy preparat, demonstriruyushchiy prevoskhodstvo nad sushchestvuyushchimi standartami terapii revmatoidnogo artrita

    Directory of Open Access Journals (Sweden)

    - -

    2008-09-01

    ostro neobkhodimy novye varianty terapii RA. Uil'yam M. Berns - glava podrazdeleniya Farma kompanii «Rosh»: «Dannye poslednikh issledovaniy yavlyayutsya obnadezhivayushchey novost'yu dlya patsientov, stradayushchikh ot razrushitel'nykh effektov RA. My verim, chto Aktemra - pervyy i edinstvennyy biologicheskiy preparat, demonstriruyushchiy preimushchestvo pered sushchestvuyushchimi standartami lecheniya RA, - oblegchit sostoyanie mnogikh bol'nykh. Krome togo, Aktemra predostavlyaet bol'she shansov dlya dostizheniya ranney i prodolzhitel'noy remissii».

  7. Bibliography of Soviet Laser Developments. Number 70, March - April 1984.

    Science.gov (United States)

    1985-06-12

    Andriyakhin, V.M.; Mayorov, V.S.; Yakunin, V.P. ~ Measuring the spatial distribution of the intensity of industrial C02 laser radiation. FKOMA, no. 2...Storozhev, V.V. (SKBIRE) . Industrial equipment for producing fiber lightguides and fiberoptic communications systems. Pribory i oborudovaniye dlya...8217. Yestyesvennyye i tochnyye nauki, tekhnika) EAAED Electrotehnica, electronica Si automatica. Automatica si electronica series (Bucharest) EEAED Electrotehnica

  8. Alcohol and the clinical picture of gout

    OpenAIRE

    M S Eliseev; Nasonov, E L; V G Barskova; M S Yeliseyev; V A Nasonova; Ye L Nasonov

    2007-01-01

    Tsel' issledovaniya. Izuchenie vliyaniya alkogolya na klinicheskie proyavleniya u bol'nykh podagricheskim artritom. Material i metody. V issledovanie vklyucheny 280 muzhchin, bol'nykh podagroy (kriterii S.L. Wallace). Dlya vyyavleniya skrytoy tyagi k alkogolyu ispol'zovalsya voprosnik CAGE, putem oprosa vyyavlyalos' kolichestvo prinimaemogo alkogolya v nedelyu. U vsekh bol'nykh otsenivali antropometricheskie pokazateli, syvorotochnye urovni pechenochnykh fermentov, bilirubina, kreatinina, moc...

  9. Renormalization of Seasonals in the Additive Seasonal Model: Is it Necessary?

    Science.gov (United States)

    1984-02-01

    but with subsequently placing the c hange over switch ID- PRO of the PI 1-1 instrument in the ś"-൒" positions. Since by pi sc ing the change over...information for self instruction. A schlieren pro -jector installed in the simulator above the work station of the trainee simulates the situation. It...and Fresnukhin, L. N., Mikroprotsessory. Osnovy postroyeniya mikro -computer: ucheb. posobiye dlya VTUZov (Microprocessors. The Base of the Sturucture

  10. ChTO DELAT'', ESLI V PERIOD LEChENIYa INGIBITORAMI FAKTORA NEKROZA OPUKhOLI α VOZNIK PSORIAZ?

    Directory of Open Access Journals (Sweden)

    Yu. V. Muravyev

    2011-01-01

    Full Text Available Ingibitory faktora nekroza opukholi α (FNO α – infliksimab, adalimumab i etanertsept – k aprelyu 2009 g. poluchili bolee 2 mln bol'nykh vo vsem mire. Vse eti preparaty okazalis' odinakovo effektivny (okolo 60% bol'nykh otvetili na lechenie pri revmatoidnom artrite (RA, ankiloziruyushchem spondilite (AS, psoriaze, psoriaticheskom artrite i odobreny dlya lecheniya etikh boleznei [1, 2]. Odnako ikh ispol'zovanie mozhet byt' svyazano s tselym ryadom neblagopriyatnykh reaktsii, odnoi iz kotorykh yavlyaetsya obostrenie ili razvitie novykh sluchaev psoriaza [3].

  11. Il personaggio scontornato in Škola dlja Durakov. Dal romanzo di Saša Sokolov agli adattamenti teatrali

    Directory of Open Access Journals (Sweden)

    Irina Marchesini

    2012-12-01

    Full Text Available Sokolov’s Shkola dlya Durakov (A School for Fools, 1976 is an extremely complex novel, which “depicts [the] world”, as D. Barton Johnson (1986:640[1] poignantly observes, “through the eyes, and pure, if eccentric, language, of a schizophrenic youth”. How is it possible to translate such linguistic features and the effects they create into another medium? This question lies at the core of my proposal, which aims to approach the problem of intermedial translation from prose to theatre through the presentation of an individual case-study. In fact, A School for Fools has been staged by the director Andrey Moguchy (Formalny Theatre, Saint Petersburg, Russia. With the intention of reproducing Sokolov’s aesthetic construction of illusion, Moguchy introduces a new genre in the theatrical context, the so-called “vizualnaya associaciya” (“visual association”. As the director explained in a recent interview, this original genre recalls the Impressionists’ position in observing and representing nature, in order to obtain the same effect generated by the reading of the novel. To comprehend this process better, special attention is devoted to the construction of unusual, hybrid characters, highlighting their constitutive features both in the novel and in the theatrical adaptation. Moreover, this research seeks to enrich discussion of the work of Sokolov and Moguchy. [1] Johnson, D. Barton (1986 “Sasha Sokolov's Twilight Cosmos: Themes and Motifs”, in: Slavic Review, 45, 4 (Winter 1986, pp. 639-649.