Enhancement of electrochemical performance of LiNi_1_/_3Co_1_/_3Mn_1_/_3O_2 by surface modification with MnO_2

International Nuclear Information System (INIS)

Guo, Xin; Cong, Li-Na; Zhao, Qin; Tai, Ling-Hua; Wu, Xing-Long; Zhang, Jing-Ping; Wang, Rong-Shun; Xie, Hai-Ming; Sun, Li-Qun

2015-01-01

LiNi_1_/_3Co_1_/_3Mn_1_/_3O_2 is successfully coated with MnO_2 by a chemical deposition method. The X-ray diffraction (XRD), scanning electron microscope (SEM) and high resolution transmission electron microscope (HRTEM) results demonstrate that MnO_2 forms a thin layer on the surface of LiNi_1_/_3Co_1_/_3Mn_1_/_3O_2 without destroying the crystal structure of the core material. Compared with pristine LiNi_1_/_3Co_1_/_3Mn_1_/_3O_2, the MnO_2-coated sample shows enhanced electrochemical performance especially the rate capability. Even at a current density of 750 mA g"−"1, the discharge capacity of MnO_2-coated LiNi_1_/_3Co_1_/_3Mn_1_/_3O_2 is 155.15 mAh g"−"1, while that of the pristine electrode is only 132.84 mAh g"−"1 in the range of 2.5–4.5 V. The cyclic voltammetry (CV) and X-ray photoelectron spectroscopy (XPS) curves show that the MnO_2 coating layer reacts with Li"+ during cycling, which is responsible for the higher discharge capacity of MnO_2-coated LiNi_1_/_3Co_1_/_3Mn_1_/_3O_2. Electrochemical impedance spectroscopy (EIS) results confirmed that the MnO_2 coating layer plays an important role in reducing the charge transfer resistance on the electrolyte–electrode interfaces. - Highlights: • MnO_2 coated LiNi_1_/_3Co_1_/_3Mn_1_/_3O_2 cathode material is synthesized for the first time. • MnO_2 offers available sites for insertion of extracted lithium. • The preserved surface and crystal structures results in the improved kinetics.

In Situ Carbon Coated LiNi0.5Mn1.5O4 Cathode Material Prepared by Prepolymer of Melamine Formaldehyde Resin Assisted Method

Directory of Open Access Journals (Sweden)

Wei Yang

2016-01-01

Full Text Available Carbon coated spinel LiNi0.5Mn1.5O4 were prepared by spray-drying using prepolymer of melamine formaldehyde resin (PMF as carbon source of carbon coating layer. The PMF carbon coated LiNi0.5Mn1.5O4 was characterized by XRD, SEM, and other electrochemical measurements. The as-prepared lithium nickel manganese oxide has the cubic face-centered spinel structure with a space group of Fd3m. It showed good electrochemical performance as a cathode material for lithium ion battery. After 100 discharge and charge cycles at 0.5 C rate, the specific discharge capacity of carbon coated LiNi0.5Mn1.5O4 was 130 mAh·g−1, and the corresponding capacity retention was 98.8%. The 100th cycle specific discharge capacity at 10 C rate of carbon coated LiNi0.5Mn1.5O4 was 105.4 mAh·g−1, and even the corresponding capacity retention was 95.2%.

High performance LiNi0.5Mn1.5O4 cathode by Al-coating and Al3+-doping through a physical vapor deposition method

International Nuclear Information System (INIS)

Sun, Peng; Ma, Ying; Zhai, Tianyou; Li, Huiqiao

2016-01-01

Highlights: • Metal Al was used as an electrical conductive coating material for LiNi 0.5 Mn 1.5 O 4 . • The uniform surface coating layer of metal Al was successfully achieved with adjusted thickness through a physical vapor deposition technology. • Al 3+ -doped LiNi 0.5 Mn 1.5 O 4 can be easily obtained by further directly annealing of Al-coated LiNi 0.5 Mn 1.5 O 4 in air. • The conductive Al-coating layer can greatly improve the rate performance and cycle stability of LiNi 0.5 Mn 1.5 O 4 . - Abstract: In this work, spinel LiNi 0.5 Mn 1.5 O 4 (LNMO) hollow microspheres are synthesized by an impregnation method using microsphere MnO 2 as both the precursor and template. To enhance the electrical conductivity of LNMO, metal Al was employed for the first time as a coating material for LNMO. Though an Electron-beam Vapor Deposition approach, the surface of LNMO can be easily coated by a tight layer of Al nanoparticles with adjusted thickness. Further annealing the Al-coated sample at 800 °C in air, the Al 3+ -doped LNMO can be obtained. The effects of Al-coating and Al 3+ -doping on the sample morphology and structure are investigated by SEM, TEM, XRD and FT-IR. The electrochemical properties of Al-coated LNMO and Al 3+ -doped LNMO are measured with comparison of bare LNMO by charge/discharge tests and electrochemical impedance spectroscopy (EIS). The results show that both Al-coating and Al 3+ -doping can greatly enhance the cycle performance and rate capability of LNMO. Especially for Al-coated LNMO, it shows the lowest battery impedance due to the existence of conductive Al coating layer, thus delivers the best rate performance among the three. The physical coating procedure used in this work may provide a new facile modification approach for other cathode materials.

Zn-Doped LiNi1/3Co1/3Mn1/3O2 Composite as Cathode Material for Lithium Ion Battery: Preparation, Characterization, and Electrochemical Properties

Directory of Open Access Journals (Sweden)

Han Du

2015-01-01

Full Text Available Zn-doped LiNi1/3Co1/3Mn1/3O2 composite, Li(Ni1/3Co1/3Mn1/31–xZnxO2 (x = 0.02; 0.05; 0.08, is synthesized by the sol-gel method. The crystal structure, morphology, and electrochemical performance are investigated via X-ray diffraction (XRD, scanning electron microscope (SEM, cyclic voltammetry (CV, and constant current charge/discharge experiment. The result reveals that Zn-doping cathode material can reach the initial charge/discharge capacity of 188.8/162.9 mAh·g−1 for Li(Ni1/3Co1/3Mn1/30.98Zn0.02O2 and 179.0/154.1 mAh·g−1 for Li(Ni1/3Co1/3Mn1/30.95Zn0.05O2 with the high voltage of 4.4 V at 0.1 C. Furthermore, the capacity retention of Li(Ni1/3Co1/3Mn1/30.98Zn0.02O2 is 95.1% at 0.5 C after 50 cycles at room temperature. The improved electrochemical properties of Zn-doped LiNi1/3Co1/3Mn1/3O2 are attributed to reduced electrode polarization, enhanced capacity reversibility, and excellent cyclic performance.

Aspects of resistance of flax and linseed (Linum usitatissimum) to Fusarium oxysporum f.sp. lini = Aspecten van de resistentie in vezel- en olievlas (Linum usitatissimum) tegen Fusarium oxysporum f.sp. lini

NARCIS (Netherlands)

Kroes, I.

1997-01-01

In the thesis aspects have been described of the flax and linseed interaction to Fusarium oxysporum f.sp. lini, the causal agent of flax wilt. Two in vitro tests were established to screen for resistance, to investigate race specificity

A novel process for recycling and resynthesizing LiNi1/3Co1/3Mn1/3O2 from the cathode scraps intended for lithium-ion batteries

International Nuclear Information System (INIS)

Zhang, Xihua; Xie, Yongbing; Cao, Hongbin; Nawaz, Faheem; Zhang, Yi

2014-01-01

Highlights: • A simple process to recycle cathode scraps intended for lithium-ion batteries. • Complete separation of the cathode material from the aluminum foil is achieved. • The recovered aluminum foil is highly pure. • LiNi 1/3 Co 1/3 Mn 1/3 O 2 is directly resynthesized from the separated cathode material. - Abstract: To solve the recycling challenge for aqueous binder based lithium-ion batteries (LIBs), a novel process for recycling and resynthesizing LiNi 1/3 Co 1/3 Mn 1/3 O 2 from the cathode scraps generated during manufacturing process is proposed in this study. Trifluoroacetic acid (TFA) is employed to separate the cathode material from the aluminum foil. The effects of TFA concentration, liquid/solid (L/S) ratio, reaction temperature and time on the separation efficiencies of the cathode material and aluminum foil are investigated systematically. The cathode material can be separated completely under the optimal experimental condition of 15 vol.% TFA solution, L/S ratio of 8.0 mL g −1 , reacting at 40 °C for 180 min along with appropriate agitation. LiNi 1/3 Co 1/3 Mn 1/3 O 2 is successfully resynthesized from the separated cathode material by solid state reaction method. Several kinds of characterizations are performed to verify the typical properties of the resynthesized LiNi 1/3 Co 1/3 Mn 1/3 O 2 powder. Electrochemical tests show that the initial charge and discharge capacities of the resynthesized LiNi 1/3 Co 1/3 Mn 1/3 O 2 are 201 mAh g −1 and 155.4 mAh g −1 (2.8–4.5 V, 0.1 C), respectively. The discharge capacity remains at 129 mAh g −1 even after 30 cycles with a capacity retention ratio of 83.01%

Structural and thermal stabilities of layered Li(Ni 1/3Co 1/3Mn 1/3)O 2 materials in 18650 high power batteries

Science.gov (United States)

He, Yan-Bing; Ning, Feng; Yang, Quan-Hong; Song, Quan-Sheng; Li, Baohua; Su, Fangyuan; Du, Hongda; Tang, Zhi-Yuan; Kang, Feiyu

The structural and thermal stabilities of the layered Li(Ni 1/3Co 1/3Mn 1/3)O 2 cathode materials under high rate cycling and abusive conditions are investigated using the commercial 18650 Li(Ni 1/3Co 1/3Mn 1/3)O 2/graphite high power batteries. The Li(Ni 1/3Co 1/3Mn 1/3)O 2 materials maintain their layered structure even when the power batteries are subjected to 200 cycles with 10 C discharge rate at temperatures of 25 and 50 °C, whereas their microstructure undergoes obvious distortion, which leads to the relatively poor cycling performance of power batteries at high charge/discharge rates and working temperature. Under abusive conditions, the increase in the battery temperature during overcharge is attributed to both the reactions of electrolyte solvents with overcharged graphite anode and Li(Ni 1/3Co 1/3Mn 1/3)O 2 cathode and the Joule heat that results from the great increase in the total resistance (R cell) of batteries. The reactions of fully charged Li(Ni 1/3Co 1/3Mn 1/3)O 2 cathodes and graphite anodes with electrolyte cannot be activated during short current test in the fully charged batteries. However, these reactions occur at around 140 °C in the fully charged batteries during oven test, which is much lower than the temperature of about 240 °C required for the reactions outside batteries.

Uncovering a facile large-scale synthesis of LiNi1/3Co1/3Mn1/3O2 nanoflowers for high power lithium-ion batteries

Science.gov (United States)

Hua, Wei-Bo; Guo, Xiao-Dong; Zheng, Zhuo; Wang, Yan-Jie; Zhong, Ben-He; Fang, Baizeng; Wang, Jia-Zhao; Chou, Shu-Lei; Liu, Heng

2015-02-01

Developing advanced electrode materials that deliver high energy at ultra-fast charge and discharge rates are very crucial to meet an increasing large-scale market demand for high power lithium ion batteries (LIBs). A three-dimensional (3D) nanoflower structure is successfully developed in the large-scale synthesis of LiNi1/3Co1/3Mn1/3O2 material for the first time. The fast co-precipitation is the key technique to prepare the nanoflower structure in our method. After heat treatment, the obtained LiNi1/3Co1/3Mn1/3O2 nanoflowers (NL333) pronouncedly present a pristine flower-like nano-architecture and provide fast pathways for the transport of Li-ions and electrons. As a cathode material in a LIB, the prepared NL333 electrode demonstrates an outstanding high-rate capability. Particularly, in a narrow voltage range of 2.7-4.3 V, the discharge capacity at an ultra-fast charge-discharge rate (20C) is up to 126 mAh g-1, which reaches 78% of that at 0.2C, and is much higher than that (i.e., 44.17%) of the traditional bulk LiNi1/3Co1/3Mn1/3O2.

Synthesis and electrochemical properties of LiNi0.4Mn1.5Cr0.1O4 and Li4Ti5O12

CSIR Research Space (South Africa)

Liu, GQ

2011-08-01

Full Text Available Spinel compound LiNi0.4Mn1.5Cr0.1O4 (LNMCO) and Li4Ti5O12 (LTO) were synthesized by the sol-gel method and the solid-state method, respectively. The particle sizes of the products LiNi0.4Mn1.5Cr0.1O4 and Li4Ti5O12 were 0.5 to 2 um and 0.5 to 0.8 um...

Synthesis of LiNi0.8Co0.1Mn0.1O2 cathode material by chloride co-precipitation method

Institute of Scientific and Technical Information of China (English)

李灵均; 李新海; 王志兴; 伍凌; 郑俊超; 李金辉

2010-01-01

LiNi0.8Co0.1Mn0.1O2 was prepared by a chloride co-precipitation method and characterized by thermogravimetric analysis, X-ray diffractometry with Rietveld refinement,electron scanning microscopy and electrochemical measurements.Effects of lithium ion content and sintering temperature on physical and electrochemical performance of LiNi0.8Co0.1Mn0.1O2 were also investigated. The results show that the sample synthesized at 750℃with 105%lithium content has fine particle sizes around 200 nm and homogenous sizes distribution.The initial discharge capacity for the powder is 184 mA·h/g between 2.7 and 4.3 V at 0.1C and room temperature.

Preparation and application of PVDF-HFP composite polymer electrolytes in LiNi0.5Co0.2Mn0.3O2 lithium-polymer batteries

International Nuclear Information System (INIS)

Yang, Chun-Chen; Lian, Zuo-Yu; Lin, S.J.; Shih, Jeng-Ywan; Chen, Wei-Houng

2014-01-01

Graphical abstract: - Highlights: • PVDF-HFP/SBA15 membrane and NCM cathode material were prepared for Li ion battery. • SBA15 fillers can trap more liquid electrolytes to enhance the ionic conductivity. • Modified fillers with functional groups play a key role in reducing impedance. • LiNi 0.5 Co 0.2 Mn 0.3 O 2 polymer battery showed excellent electrochemical performance. - Abstract: This study reports the preparation of a composite polymer electrolyte for application in LiNi 0.5 Co 0.2 Mn 0.3 O 2 lithium-polymer batteries. Poly(vinylidiene fluoride-hexafluoropropylene) (denoted as PVDF-HFP) was used as the polymer host and mesoporous modified-silica fillers (denoted as m-SBA15) used as the solid plasticizer were added into the polymer matrix. The characteristic properties of the composite polymer membranes were examined using Fourier transform infrared (FTIR) spectroscopy, scanning electron microscopy (SEM), X-ray diffraction (XRD), and an AC impedance method. The discharge capacities of LiNi 0.5 Co 0.2 Mn 0.3 O 2 polymer batteries with a PE separator, pure PVDF-HFP polymer membrane, or a PVDF-HFP/10 wt.%m-SBA15 composite at 0.1 C were determined to be 155.5, 159.5, and 198.6 mAh g −1 , respectively. The LiNi 0.5 Co 0.2 Mn 0.3 O 2 polymer battery containing the PVDF-HFP/10 wt.%m-SBA15 composite achieved discharge capacities of 194, 170, 161, 150, 129, 115, and 87 mAh g −1 at 0.1, 0.2, 0.5, 1, 3, 5, and 10 C, respectively. The lithium-polymer battery demonstrated a high coulomb efficiency of ca. 99%. The PVDF-HFP/m-SBA15 composite membrane is a strong candidate for application in LiNi 0.5 Co 0.2 Mn 0.3 O 2 lithium-polymer batteries

GITT studies on oxide cathode LiNi1/3Co1/3Mn1/3O2 synthesized ...

Indian Academy of Sciences (India)

Li diffusion; LiNi1/3Co1/3Mn1/3O2; lithium ion batteries; layered structure. 1. Introduction ... The coin-type cell CR2012 consisting of a metallic- lithium foil anode ... and the polyvinylidenefluoride (PVDF) binder with a mass ratio of 4:1:1 in NMP ...

Synthesis cathode material LiNi0.80Co0.15Al0.05O2 with two step solid-state method under air stream

Science.gov (United States)

Xia, Shubiao; Zhang, Yingjie; Dong, Peng; Zhang, Yannan

2014-01-01

A facile generic strategy of solid-state reaction under air atmosphere is employed to prepare LiNi0.8Co0.15Al0.05O2 layer structure micro-sphere as cathodes for Li-ion batteries. The impurity phase has been eliminated wholly without changing the R-3m space group of LiNi0.8Co0.15Al0.05O2. The electrochemical performance of LiNi0.8Co0.15Al0.05O2 cathodes depend on the sintering step, temperature, particle size and uniformity. The sample pre-sintered at 540 °C for 12 h and then sintered at 720 °C for 28 h exhibits the best electrochemical performance, which delivers a reversible capacity of 180.4, 165.8, 154.7 and 135.6 mAhg-1 at 0.2 C, 1 C, 2 C and 5 C, respectively. The capacity retention keeps over 87% after 76 cycles at 1 C. This method is simple, cheap and mass-productive, and thus suitable to large scale production of NCA cathodes directly used for lithium ion batteries.

Influence of Temperature on the Performance of LiNi1/3Co1/3Mn1/3O2 Prepared by High-Temperature Ball-Milling Method

Directory of Open Access Journals (Sweden)

Ming Tian

2018-01-01

Full Text Available Aiming at the preparation of high electrochemical performance LiNi1/3Co1/3Mn1/3O2 cathode material for lithium-ion battery, LiNi1/3Co1/3Mn1/3O2 was prepared with lithium carbonate, nickel (II oxide, cobalt (II, III oxide, and manganese dioxide as raw materials by high-temperature ball-milling method. Influence of ball-milling temperature was investigated in this work. It was shown that the fine LiNi1/3Co1/3Mn1/3O2 powder with high electrochemical performance can be produced by the high-temperature ball-milling process, and the optimal ball-milling temperature obtained in the current study was 750°C. Its initial discharge capacity was 146.0 mAhg−1 at the rate of 0.1 C, and over 50 cycles its capacity retention rate was 90.2%.

Electrochemical Properties of the LiNi0.6Co0.2Mn0.2O2 Cathode Material Modified by Lithium Tungstate under High Voltage.

Science.gov (United States)

Fu, Jiale; Mu, Daobin; Wu, Borong; Bi, Jiaying; Cui, Hui; Yang, Hao; Wu, Hanfeng; Wu, Feng

2018-05-31

An amount (5 wt %) of lithium tungstate (Li 2 WO 4 ) as an additive significantly improves the cycle and rate performances of the LiNi 0.6 Co 0.2 Mn 0.2 O 2 electrode at the cutoff voltage of 4.6 V. The 5 wt % Li 2 WO 4 -mixed LiNi 0.6 Co 0.2 Mn 0.2 O 2 electrode delivers a reversible capacity of 199.2 mA h g -1 and keeps 73.1% capacity for 200 cycles at 1 C. It retains 67.4% capacity after 200 cycles at 2 C and delivers a discharge capacity of 167.3 mA h g -1 at 10 C, while those of the pristine electrode are only 44.7% and 87.5 mA h g -1 , respectively. It is shown that the structure of the LiNi 0.6 Co 0.2 Mn 0.2 O 2 cathode material is not affected by mixing Li 2 WO 4 . The introduced Li 2 WO 4 effectively restrains the LiPF 6 and carbonate solvent decomposition by consuming PF 5 at high cutoff voltage, forming a stable cathode/electrolyte interface film with low resistance.

Ion-exchange mechanism of layered transition-metal oxides: case study of LiNi(0.5)Mn(0.5)O₂.

Science.gov (United States)

Gwon, Hyeokjo; Kim, Sung-Wook; Park, Young-Uk; Hong, Jihyun; Ceder, Gerbrand; Jeon, Seokwoo; Kang, Kisuk

2014-08-04

An ion-exchange process can be an effective route to synthesize new quasi-equilibrium phases with a desired crystal structure. Important layered-type battery materials, such as LiMnO2 and LiNi(0.5)Mn(0.5)O2, can be obtained through this method from a sodium-containing parent structure, and they often show electrochemical properties remarkably distinct from those of their solid-state synthesized equivalents. However, while ion exchange is generally believed to occur via a simple topotactic reaction, the detailed phase transformation mechanism during the process is not yet fully understood. For the case of layered LiNi(0.5)Mn(0.5)O2, we show through ex situ X-ray diffraction (XRD) that the ion-exchange process consists of several sequential phase transformations. By a study of the intermediate phase, it is shown that the residual sodium ions in the final structure may greatly affect the electrochemical (de)lithiation mechanism.

Processing of water-based LiNi1/3Mn1/3Co1/3O2 pastes for ...

Indian Academy of Sciences (India)

Results show that a substitution of the conventional organic solvent-based manufacturing route for LiNi1/3Mn1/3Co1/3O2 cathodes by water-based processing exhibits a promising way to realise Li-ion batteries with comparable electrochemical behaviour, while avoiding toxic processing aids and reducing overall ...

Spinel LiNi0.5Mn1.5O4 as superior electrode materials for lithium-ion batteries: Ionic liquid assisted synthesis and the effect of CuO coating

International Nuclear Information System (INIS)

Li, Xueliang; Guo, Wei; Liu, Yunfu; He, Wenxiang; Xiao, Zhenghui

2014-01-01

The LiNi 0.5 Mn 1.5 O 4 with different morphologies have been successfully prepared through co-precipitation route in mixed solution containing 1-dodecyl-3-methylimidazolium bromide ([C 12 mim]Br) and H 2 O with different mass ratios and followed by a solid reaction at high temperature. The morphology of LiNi 0.5 Mn 1.5 O 4 varies with the increasing ratio of [C 12 mim]Br. These samples synthesized at three kinds of concentrations present flake-like morphology, agglomerated flake-like structure and polygon particles with size about 700 nm, respectively. The as-prepared LiNi 0.5 Mn 1.5 O 4 with polygon structure presents the highest discharge capacity. The optimal LiNi 0.5 Mn 1.5 O 4 sample was modified with 1, 3 and 5 wt.% CuO, respectively. The electrochemical testing results demonstrate 3 wt.% CuO-modified material had the capacity retention of higher than 95% after 100 cycles, and high capacity of 98.7 mAh g −1 at 10 C rate, in comparison with the capacity retention of 83% and capacity of 63.6 mAh g −1 for the pristine one. The remarkably improved rate performance and cycling stability can be attributed to CuO coating, which acts as an effective lithium-ion conductor and a protective material against corrosion from electrolyte

Improved high-voltage performance of LiNi1/3Co1/3Mn1/3O2 cathode with Tris(2,2,2-trifluoroethyl) phosphite as electrolyte additive

International Nuclear Information System (INIS)

Wang, Long; Ma, Yulin; Li, Qin; Cui, Yingzhi; Wang, Panpan; Cheng, Xinqun; Zuo, Pengjian; Du, Chunyu; Gao, Yunzhi

2017-01-01

Tris(2,2,2-trifluoroethyl) phosphite (TTFEP) is investigated as an electrolyte additive to improve the electrochemical performance of LiNi 1/3 Co 1/3 Mn 1/3 O 2 cathode at high operating voltage (4.6 V). Charge/discharge measurements demonstrate that TTFEP is effective to improve the cycling stability and rate capability of LiNi 1/3 Co 1/3 Mn 1/3 O 2 cathode. The capacity retention of LiNi 1/3 Co 1/3 Mn 1/3 O 2 /Li cell with 1% TTFEP-containing electrolyte reaches up to 85.4% after 100 cycles at 0.5C (1C = 160 mA g −1 ), while that of the cell with the baseline electrolyte (1 M LiPF 6 in EC/DMC electrolyte) only remains 74.2%. Moreover, the discharge capacity of the cathode with 1% TTFEP-containing electrolyte could maintain around 112.0 mAh g −1 at 4C. Based on the characterization of electrochemical impedance spectroscopy (EIS), scanning electron microscopy (SEM), X-ray diffraction (XRD) and X-ray photoelectron spectroscopy (XPS), a protective interphase film formed on the cathode surface can be found due to the preferential oxidation of TTFEP, which inhibits the electrolyte decomposition and mitigates the cathode structural destruction, leading to the improved electrochemical performance of LiNi 1/3 Co 1/3 Mn 1/3 O 2 cathode at high voltage.

Synthesis and electrochemical behavior of nanosized LiNi1-xCa xO2 cathode materials for high voltage secondary lithium-ion cells

International Nuclear Information System (INIS)

Sathiyamoorthi, R.; Vasudevan, T.

2007-01-01

A new class of LiNi 1-x Ca x O 2 (x = 0.0, 0.1, 0.2, 0.3 and 0.5) layered oxide materials has been synthesized by a simple low temperature solid-state route with mixed nitrates/urea with glycerol as the starting materials. First we have taken TG/DTA for observing the phase transformations of LiNi 0.9 Ca 0.1 O 2 . The structure of the synthesized oxides was analyzed using X-ray diffraction (XRD) and Fourier transform infrared spectroscopy (FTIR) to identify the crystal structure and cation environment, respectively. The synthesized ceramic oxide battery materials were examined by using transmission electron microscope (TEM), scanning electron microscope (SEM) analysis to determine the particle size, nature and morphological structure. SEM with energy dispersive X-ray spectroscopic analysis (EDAX) analysis was carried out to explore the composition of the prepared materials. The electrochemical performance of LiNi 1-x Ca x O 2 electrodes was analyzed using cyclic voltammetry (CV) and galvanostatic charge-discharge cycling studies in the voltage range 3.0-4.5 V. Electrode made with cathode active material, acetylene black and poly(vinylidene difluoride) yield a discharge capacity of 178.1 mAh g -1 (x = 0.2) with good specific capacity over several charge-discharge cycles. These results have been also supported by cyclic voltammograms

Perancangan Line Balancing Dalam Upaya Perbaikkan Lini Produksi Dengan Simulasi Promodel Di PT Caterpillar Indonesia

OpenAIRE

Puteri, renty Anugerah Mahaji; Sudarwati, Wiwik

2016-01-01

P.T. Caterpillar Indonesia adalah suatu Perusahaan yang bergerak di bidang industri otomotif khusus alat berat. Pada bagian produksi PT. Caterpillar Indonesia terdapat proses produksi perakitan part dengan cara pengelasan dengan produk akhir swing frame, pada lini produksi khususnya Department Fabrication ada empat Section Department yaitu Boom, Stick, Swing Frame dan Base Frame dimana terdapat masalah diantaranya mengurangi waktu menganggur pada bagian welding swing frame dan biaya pro...

Improving low-temperature performance of spinel LiNi0.5Mn1.5O4 electrode and LiNi0.5Mn1.5O4/Li4Ti5O12 full-cell by coating solid-state electrolyte Li-Al-Ti-P-O

Science.gov (United States)

Bi, Kun; Zhao, Shi-Xi; Huang, Chao; Nan, Ce-Wen

2018-06-01

Octahedral cathode materials LiNi0.5Mn1.5O4 (LNMO), with primary particles size of 300-600 nm are prepared through one-step co-precipitation. Then solid-state electrolyte Li2O-Al2O3-TiO2-P2O5 (LATP) was coated on LNMO to form continuous surface-modification layer. There is no obviously difference of structure, morphology between coated LATP LiNi0.5Mn1.5O4 (LATP-LNMO) and pristine LiNi0.5Mn1.5O4 (P-LNMO). Low-temperature electrochemical performance of P-LNMO and LATP-LNMO electrodes, including charge-discharge capacity, cycle performance, middle discharge voltage and electrochemical impedance spectra (EIS), were measured systematically with three electrode. The results reveal that LATP-LNMO electrode presents superior electrochemical performance at low temperature, compared to P-LNMO electrode. At -20 °C, the capacity retention of LATP-LNMO (61%) is much higher than that of P-LNMO (39%). According to EIS, the enhancement of performance of LATP-LNMO cathode at low temperature can be attribute to LATP coating, which not only promotes lithium-ion diffusion at electrode/electrolyte interface but also decreases the charge transfer resistance. Finally, the electrochemical performances of full cell of LATP-LNMO or P-LNMO cathode vs Li4Ti5O12 anode are investigated. The energy density can be achieved to 270 Wh·Kg-1 at -20 °C if using LATP-LNMO, which is much better than that of P-LNMO.

Fabrication and Electrochemical Performance of LiNi0.5Co0.2Mn0.3O2 Coated with Nano FePO4 as Cathode Material for Lithium-ion Batteries

Directory of Open Access Journals (Sweden)

DONG Peng

2017-11-01

Full Text Available Layered LiNi0.5Co0.2Mn0.3O2 coated with homogeneous nano FePO4 suspension was prepared by using co-precipitation method. XRD, TG-DTA and TEM were adopted to characterize the structure, morphology and liquid state of FePO4 prepared. The structure, morphology and electrochemical performance of the coated materials prepared were characterized by the means such as XRD, SEM, EDS, TEM, ICP, galvanostatic charge-discharge cycling, cyclic voltammetry (CV and electrochemical impedance spectroscopy(EIS tests. The effect of heat treatment temperature and coating quantity on the structure and electrochemical performance of coated LiNi0.5Co0.2Mn0.3O2 by co-precipitation method was explored. The results show that 400℃ and 2%(mass fraction,the same below FePO4 coating can significantly improve cycle performance and rate capability of LiNi0.5Co0.2Mn0.3O2, CV and EIS testing results reveal that FePO4 coating can improve the reversibility and dynamic performance for LiNi0.5Co0.2Mn0.3O2. ICP results show that FePO4 coating layer can effectively reduce the electrolyte to dissolute and erode cathode materials, stabilize its layered structure, then improve the electrochemical performance of cathode materials.

Effects of lithium-active manganese trioxide coating on the structural and electrochemical characteristics of LiNi_0_._5Co_0_._2Mn_0_._3O_2 as cathode materials for lithium ion battery

International Nuclear Information System (INIS)

Li, Lingjun; Yao, Qi; Chen, Zhaoyong; Song, Liubin; Xie, Tian; Zhu, Huali; Duan, Junfei; Zhang, Kaili

2015-01-01

Li_2MnO_3-coated LiNi_0_._5Co_0_._2Mn_0_._3O_2 materials are successfully synthesized by sol–gel method. The effects of various pH values and Li_2MnO_3 contents on the structural and electrochemical properties of LiNi_0_._5Co_0_._2Mn_0_._3O_2 cathode materials are systematically investigated, respectively. Scanning electron microscope, transmission electron microscope and energy dispersive spectrometer confirm that the particles of LiNi_0_._5Co_0_._2Mn_0_._3O_2 are completely coated by crystalline Li_2MnO_3 phase. Electrochemical tests show that suitable Li_2MnO_3-coated samples exhibit higher rate capacity and better cycling performance than those of the pristine one. This improvement can be attributed to the synergetic contribution from the neutral pH value and appropriate Li_2MnO_3 amount. The neutral pH environment can protect the core material from damaging during the coating process and is conducive to relieving the rapid moisture uptaking problem of LiNi_0_._5Co_0_._2Mn_0_._3O_2. While, suitable Li_2MnO_3 coating can protect the bulk from directly contacting the electrolyte and offer a fast Li"+ diffusion path at the interface of bulk and electrolyte. - Graphical abstract: The 5% Li_2MnO_3-coated LiNi_0_._5Co_0_._2Mn_0_._3O_2 sample, modified at pH 6, exhibits a conformal and amorphous coating layer before calcination. After been sintered at 880 °C for 5 h, the sample shows Li_2MnO_3 crystalline surface, as well as superior electrochemical performance. - Highlights: • Li_2MnO_3-coated LiNi_0_._5Co_0_._2Mn_0_._3O_2 is prepared by sol–gel method. • Neutral pH environment can protect NMC from damaging during the coating process. • Li_2MnO_3 coating enhances the pristine at high cyclability and rate properties. • Suitable Li_2MnO_3 modification results in better Li"+ diffusion coefficient. • The 5% Li_2MnO_3-coated sample exhibits the best electrochemical performance.

Synthesis of LiNi0.65Co0.25Mn0.1O2 as cathode material for lithium-ion batteries by rheological phase method

International Nuclear Information System (INIS)

Cheng Cuixia; Tan Long; Hu Anzheng; Liu Haowen; Huang Xintang

2010-01-01

Research highlights: → In this paper, for the first time, rheological phase method, a simple and effective route, was applied to synthesis high capacity cathode material LiNi 0.65 Co 0.25 Mn 0.1 O 2 . → All of the results obtained by X-ray diffraction spectrometer, X-ray photoelectron spectrometer, charge-discharge tests and electrochemical impedance spectroscopy show that the rheological phase production have better properties than that of the report. - Abstract: Rheological phase (RP) method has been successfully applied to synthesize a promising cathode material LiNi 0.65 Co 0.25 Mn 0.1 O 2 . X-ray diffraction, X-ray photoelectron spectroscopy, inductively coupled plasma and transmission electron microscope are used to investigate the structure, composition and morphology, respectively. XRD result shows that the as-prepared powder has a layered α-NaFeO 2 structure. XPS pattern reveals that the Ni ions have valences of 2+ and 3+, and the Co and Mn are 3+, 4+, respectively. The electrode consisting of the obtained powder presents the better electrochemical properties, which is attributed to the fewer amounts of Ni 2+ ions and the smaller particles. All the results suggest that the rheological phase method is a promising technique for the preparation of LiNi 0.65 Co 0.25 Mn 0.1 O 2 cathode material of lithium-ion batteries.

GITT studies on oxide cathode LiNi1/3Co1/3Mn1/3O2 synthesized ...

Indian Academy of Sciences (India)

2016-08-26

Aug 26, 2016 ... GITT studies on oxide cathode LiNi1/3Co1/3Mn1/3O2 synthesized by citric acid assisted high-energy ball milling ... The State Key Laboratory Base of Novel Functional Materials and Preparation Science; The Faculty of Materials Science and Chemical Engineering, Ningbo University, Ningbo 315211, P. R. ...

Improve electrochemical performance of CeO2 surface modification LiNi0.80Co0.15Al0.05O2 cathode material

Science.gov (United States)

Xia, Shubiao; Zhang, Yingjie; Dong, Peng; Zhang, Yannan

2014-06-01

Lithium ion battery cathode material LiNi0.8Co0.15Al0.05O2 cathode has successfully prepared by co-precipitation. CeO2 surface modification has improved LiNi0.80Co0.15Al0.05O2 electrochemical performance use sol-gel method and subsequent heat treatment at 600 °C for 5 h. Different to other conventional coating material, CeO2 coating layer can not only inhibit the reaction of the electrode and the electrolyte, but also can reduce the impedance of electron transfer due to its high conductivity, and inhibit the production of Ni2+ because of its high oxidation. The surface-modified and pristine LiNi0.80Co0.15Al0.05O2 powders are characterized by XRD, SEM, TEM, XPS, CV and DSC. When CeO2 coating is 0.02% (mole ratio), contrast to pristine NCA, the CeO2-coated NCA cathode exhibits no decrease in its initial specific capacity of 184 mAh g -1 (at 0.2 C) and excellent capacity retention (86% of its initial capacity at 1 C) between 2.75 and 4.3 V after 100 cycles. The results indicate that the CeO2 surface treatment should be an effective way to improve cycle properties due to CeO2 inhibit the electrodes and the electrolyte side effects.

Dual functions of zirconium modification on improving the electrochemical performance of Ni-rich LiNi0.8Co0.1Mn0.1O2

Energy Technology Data Exchange (ETDEWEB)

Li, Xing; Zhang, Kangjia; Wang, Mingshan; Liu, Yang; Qu, Meizhen; Zhao, Wengao; Zheng, Jianming

2018-02-28

Trace amount of Zirconium (Zr) has been adopted to modify the crystal structure and surface of the Ni-rich LiNi0.8Co0.1Mn0.1O2 (NCM811) cathode material. During cycling at 1.0C, the Zr-modified NCM811 shows an improved capacity retention of 92% after 100 cycles, higher than 75% for pristine NMC811. In addition, the Zr-modified NCM811 is capable of delivering a discharge capacity of 107 mAh g-1 at 10.0C rate, much higher than 28 mAh g-1 delivered by pristine material. These improved electrochemical performances are ascribed to the dual functions of Zr modification. On one hand, part of the Zr enters the crystal lattice, which is beneficial for reducing the Li/Ni cation mixing and enhancing the crystal stability of the cathode. On the other hand, the rest of the Zr forms a 1~2 nm thick coating layer on the surface of the NCM811 cathode, which effectively prevents the direct contact between NCM and the electrolyte, thus suppressing the detrimental interfacial reactions. Therefore, the Zr-modified LiNi0.8Co0.1Mn0.1O2 exhibited significantly enhanced cycling stability and charging/discharging rate capability in comparison with the untreated counterpart.

Extracellular Matrix Proteins Expression Profiling in Chemoresistant Variants of the A2780 Ovarian Cancer Cell Line

Directory of Open Access Journals (Sweden)

Radosław Januchowski

2014-01-01

Full Text Available Ovarian cancer is the leading cause of death among gynaecological malignancies. Extracellular matrix (ECM can affect drug resistance by preventing the penetration of the drug into cancer cells and increased resistance to apoptosis. This study demonstrates alterations in the expression levels of ECM components and related genes in cisplatin-, doxorubicin-, topotecan-, and paclitaxel-resistant variants of the A2780 ovarian cancer cell line. Affymetrix Gene Chip Human Genome Array Strips were used for hybridisations. The genes that had altered expression levels in drug-resistant sublines were selected and filtered by scatter plots. The genes that were up- or downregulated more than fivefold were selected and listed. Among the investigated genes, 28 genes were upregulated, 10 genes were downregulated, and two genes were down- or upregulated depending on the cell line. Between upregulated genes 12 were upregulated very significantly—over 20-fold. These genes included COL1A2, COL12A1, COL21A1, LOX, TGFBI, LAMB1, EFEMP1, GPC3, SDC2, MGP, MMP3, and TIMP3. Four genes were very significantly downregulated: COL11A1, LAMA2, GPC6, and LUM. The expression profiles of investigated genes provide a preliminary insight into the relationship between drug resistance and the expression of ECM components. Identifying correlations between investigated genes and drug resistance will require further analysis.

High Tap Density Spherical Li[Ni0.5Mn0.3Co0.2]O2 Cathode Material Synthesized via Continuous Hydroxide Coprecipitation Method for Advanced Lithium-Ion Batteries

Directory of Open Access Journals (Sweden)

Shunyi Yang

2012-01-01

Full Text Available Spherical [Ni0.5Mn0.3Co0.2](OH2 precursor with narrow size distribution and high tap density has been successfully synthesized by a continuous hydroxide coprecipitation, and Li[Ni0.5Mn0.3Co0.2]O2 is then prepared by mixing the precursor with 6% excess Li2CO3 followed by calcinations. The tap density of the obtained Li[Ni0.5Mn0.3Co0.2]O2 powder is as high as 2.61 g cm−3. The powders are characterized by X-ray diffraction (XRD, X-ray photoelectron spectroscopy (XPS, scanning electron microscope (SEM, particle size distribution (PSD, and charge/discharge cycling. The XRD studies show that the prepared Li[Ni0.5Mn0.3Co0.2]O2 has a well-ordered layered structure without any impurity phases. Good packing properties of spherical secondary particles (about 12 μm consisted of a large number of tiny-thin plate-shape primary particles (less than 1 μm, which can be identified from the SEM observations. In the voltage range of 3.0–4.3 V and 2.5–4.6 V, Li[Ni0.5Mn0.3Co0.2]O2 delivers the initial discharge capacity of approximately 175 and 214 mAh g−1 at a current density of 32 mA g−1, and the capacity retention after 50 cycles reaches 98.8% and 90.2%, respectively. Besides, it displays good high-temperature characteristics and excellent rate capability.

Orbital-Specific observation of O2p and Ni3d electrons in LiNi0.5Mn0.5O2, a cathode material for lithium-ion batteries

Science.gov (United States)

Satou, Yoshinori; Komine, Shigeki; Shimizu, Sumera

2017-09-01

Cathode materials for lithium-ion batteries containing Ni2+ have attracted much interest because of their high theoretical capacity. However, the precise electronic structures of these cathode materials have not yet been clearly observed, especially the energy positions of the O2p and Ni3d orbitals and the shape of the density of states. The aim of this study was to investigate the relative energy positions and shape of the density of states of O2p and Ni3d for LiNi0.5Mn0.5O2 experimentally. We cleaved a LiNi0.5Mn0.5O2 pellet in an Ar-filled glove box and performed synchrotron ultraviolet photoelectron spectroscopy for different photon energies, which enabled us to investigate the relative cross-section intensity of O2p and Ni3d. As a result, the valence-band structure was determined. We found that O2p electrons are itinerant and exist in the vicinity of the Fermi energy more than Ni3d electrons. Ni3d electrons are more localized and spread mainly from 1.2-1.5 eV below the Fermi energy. To validate the electronic structure, we measured the synchrotron O K-edge X-ray absorption fine structure of electrochemically lithium-extracted LiNi0.5Mn0.5O2. The electronic structure demonstrated that ligand holes in the oxygen atoms form below the Fermi level during the initial stage of Li extraction and that the formation rate of the holes decreases with Li extraction.

One-step synthesis and effect of heat-treatment on the structure and electrochemical properties of LiNi0.5Mn1.5O4 cathode material for lithium-ion batteries

International Nuclear Information System (INIS)

Wen, Jian-Wu; Zhang, Da-Wei; Zang, Yong; Sun, Xin; Cheng, Bin; Ding, Chu-Xiong; Yu, Yan; Chen, Chun-Hua

2014-01-01

Highlights: • A one-step sol-gel route with resorcinol-formaldehyde resin is designed to synthesis LiNi 0.5 Mn 1.5 O 4 . • Fd-3 m phase delivers an excellent high rate performance and stable cycling retention. • A double “w”-shape R-V curve is a potential tool to indicate structure transition. - Abstract: Spinel LiNi 0.5 Mn 1.5 O 4 (Fd-3 m) powders are synthesized by a facile one-step sol-gel approach with a resorcinol formaldehyde (RF) resin as a chelating agent. The cross-linked metal-containing RF xerogel particles are sintered at different high temperatures from 750 to 950 °C to produce several micron-sized LiNi 0.5 Mn 1.5 O 4 powders. Electrochemical measurements suggest that the 850 °C-sintered (in air) sample (Fd-3 m phase) performs the best with a discharge capacity of 141 mAh g −1 at 0.1 C and 110 mAh g −1 at 10 C, and capacity-retention of 96.3% after 60 cycles at 0.25 C and 89% after 200 cycles at 1 C. For comparison, the LiNi 0.5 Mn 1.5 O 4 sample sintered at 850 °C in O 2 (P4 3 32 phase) presents limited rate performance (45 mAh g −1 at 10 C) and higher values in both AC impedance and DC-method derived resistance. A characteristic double “w”-shape curve of DC resistance against cell potential can be possibly considered as an indicator to probe the material structure transition during the charge/discharge process of the cell

Leaching process for recovering valuable metals from the LiNi1/3Co1/3Mn1/3O2 cathode of lithium-ion batteries.

Science.gov (United States)

He, Li-Po; Sun, Shu-Ying; Song, Xing-Fu; Yu, Jian-Guo

2017-06-01

In view of the importance of environmental protection and resource recovery, recycling of spent lithium-ion batteries (LIBs) and electrode scraps generated during manufacturing processes is quite necessary. An environmentally sound leaching process for the recovery of Li, Ni, Co, and Mn from spent LiNi 1/3 Co 1/3 Mn 1/3 O 2 -based LIBs and cathode scraps was investigated in this study. Eh-pH diagrams were used to determine suitable leaching conditions. Operating variables affecting the leaching efficiencies for Li, Ni, Co, and Mn from LiNi 1/3 Co 1/3 Mn 1/3 O 2 , such as the H 2 SO 4 concentration, temperature, H 2 O 2 concentration, stirring speed, and pulp density, were investigated to determine the most efficient conditions for leaching. The leaching efficiencies for Li, Ni, Co, and Mn reached 99.7% under the optimized conditions of 1M H 2 SO 4 , 1vol% H 2 O 2 , 400rpm stirring speed, 40g/L pulp density, and 60min leaching time at 40°C. The leaching kinetics of LiNi 1/3 Co 1/3 Mn 1/3 O 2 were found to be significantly faster than those of LiCoO 2 . Based on the variation in the weight fraction of the metal in the residue, the "cubic rate law" was revised as follows: θ(1-f) 1/3 =(1-kt/r 0 ρ), which could characterize the leaching kinetics optimally. The activation energies were determined to be 64.98, 65.16, 66.12, and 66.04kJ/mol for Li, Ni, Co, and Mn, respectively, indicating that the leaching process was controlled by the rate of surface chemical reactions. Finally, a simple process was proposed for the recovery of valuable metals from spent LiNi 1/3 Co 1/3 Mn 1/3 O 2 -based LIBs and cathode scraps. Copyright © 2017 Elsevier Ltd. All rights reserved.

Orbital-Specific observation of O2p and Ni3d electrons in LiNi0.5Mn0.5O2, a cathode material for lithium-ion batteries

Directory of Open Access Journals (Sweden)

Yoshinori Satou

2017-09-01

Full Text Available Cathode materials for lithium-ion batteries containing Ni2+ have attracted much interest because of their high theoretical capacity. However, the precise electronic structures of these cathode materials have not yet been clearly observed, especially the energy positions of the O2p and Ni3d orbitals and the shape of the density of states. The aim of this study was to investigate the relative energy positions and shape of the density of states of O2p and Ni3d for LiNi0.5Mn0.5O2 experimentally. We cleaved a LiNi0.5Mn0.5O2 pellet in an Ar-filled glove box and performed synchrotron ultraviolet photoelectron spectroscopy for different photon energies, which enabled us to investigate the relative cross-section intensity of O2p and Ni3d. As a result, the valence-band structure was determined. We found that O2p electrons are itinerant and exist in the vicinity of the Fermi energy more than Ni3d electrons. Ni3d electrons are more localized and spread mainly from 1.2–1.5 eV below the Fermi energy. To validate the electronic structure, we measured the synchrotron O K-edge X-ray absorption fine structure of electrochemically lithium-extracted LiNi0.5Mn0.5O2. The electronic structure demonstrated that ligand holes in the oxygen atoms form below the Fermi level during the initial stage of Li extraction and that the formation rate of the holes decreases with Li extraction.

Characterization and electrochemical performance of lithium-active titanium dioxide inlaid LiNi0.5Co0.2Mn0.3O2 material prepared by lithium residue-assisted method

International Nuclear Information System (INIS)

Li, Lingjun; Chen, Zhaoyong; Song, Liubin; Xu, Ming; Zhu, Huali; Gong, Li; Zhang, Kaili

2015-01-01

Highlights: • LiTiO 2 -inlaid LiNi 0.5 Co 0.2 Mn 0.3 O 2 is prepared by lithium residue-assisted method. • The unique inlaid architecture inherits the advantages of coating and doping. • LiTiO 2 inlaying enhances the pristine at high cyclability and rate properties. • Excess LiTiO 2 modification results in low Li + diffusion coefficient. • The 3 mol% LiTiO 2 inlaid sample exhibits the best electrochemical performance. - Abstract: The lithium residues are consumed as raw materials to in-situ synthesize the LiTiO 2 -inlaid LiNi 0.5 Co 0.2 Mn 0.3 O 2 composites. The effects of various LiTiO 2 contents on the morphology, structure, and electrochemical properties of LiNi 0.5 Co 0.2 Mn 0.3 O 2 materials are investigated in detail. Energy dispersive spectrometer mapping, high-resolution transmission electron microscopy and fast Fourier transform analysis confirm that the spherical particles of LiNi 0.5 Co 0.2 Mn 0.3 O 2 are completely coated by crystalline LiTiO 2 phase; X-ray diffraction, cross-section SEM and corresponding EDS results indicate that Ti ions are also doped into the bulk LiNi 0.5 Co 0.2 Mn 0.3 O 2 with gradient distribution. Electrochemical tests show that the LiTiO 2 -inlaid samples exhibit excellent reversible capacity, enhanced cyclability, superior lithium diffusion coefficient and rate properties. Specially, the 3 mol% LiTiO 2 inlaid sample maintains 153.7 mA h g −1 with 94.4% capacity retention after 100 cycles between 2.7–4.4 V at 1 C, take 30% advantage than that of the pristine one (118.2 mA h g −1 ). This improvement can be attributed to the removal of lithium residues and suitable LiTiO 2 inlaying. The absence of lithium residue is helpful to retard the decomposition of LiPF 6 . While, suitable LiTiO 2 inlaying can protect the bulk from directly contacting the electrolyte, buffer the volume change of core and shell during cycles, increase the surface electronic conductivity and offer a 3D path for Li + diffusion from the bulk to

Post mortem analysis of fatigue mechanisms in LiNi0.8Co0.15Al0.05O2 - LiNi0.5Co0.2Mn0.3O2 - LiMn2O4/graphite lithium ion batteries

Science.gov (United States)

Lang, Michael; Darma, Mariyam Susana Dewi; Kleiner, Karin; Riekehr, Lars; Mereacre, Liuda; Ávila Pérez, Marta; Liebau, Verena; Ehrenberg, Helmut

2016-09-01

The fatigue of commercial lithium ion batteries after long-term cycling at two different temperatures and cycling rates is investigated. The cells are opened after cycling and post-mortem analysis are conducted. Two main contributions to the capacity loss of the batteries are revealed. The loss of active lithium leads to a relative shift between anodes and cathodes potentials. A growth of the solid electrolyte interface (SEI) on the anode is determined as well as the formation of lithium fluoride species as an electrolyte decomposition product. Those effects are reinforced by increasing cycling rates from 1C/2C (charge/discharge) to 2C/3C as well as by increasing cycling temperatures from 25 °C to 40 °C. The other contribution to the capacity loss originates from a fatigue of the blended cathodes consisting of LiNi0.5Co0.2Mn0.3O2 (NCM), LiNi0.8Co0.15Al0.05O2 (NCA) and LiMn2O4 (LMO). Phase-specific capacity losses and fatigue mechanisms are identified. The layered oxides tend to form microcracks and reveal changes of the surface structure leading to a worsening of the lithium kinetics. The cathode exhibits a loss of manganese at 40 °C cycling temperature. Cycling at 40 °C instead of 25 °C has the major impact on cathodes capacity loss, while cycling at 2C/3C rates barely influences it.

Structural and compositional optimization of the LiNi0.8Co0.2O2 electrode by new synthesis conditions

International Nuclear Information System (INIS)

Mosqueda L, Y.; Milian P, C. R.; Pomares A, M.; Rodriguez H, J.; Perez C, E.

2012-01-01

The optimization of citrate precursor method to obtain the LiNi 0.8 Co 0.2 O 2 oxide from the thermal decomposition of the citrate precursor (NH 4 ) 3 LiNi 0.8 Co 0.2 (C 6 H 5 O 7 ) is presented. The optimization procedure consists of both the lithium atmosphere and the reaction time control during the decomposition of the citrate precursor. Were obtained and characterized two kind of the (Li l-x Ni x )(Ni 0.8 Co 0.2 )O 2 oxides, with and without optimized synthesis conditions, identified as A and B oxides, respectively. The A and B oxides are characterized by compositional, structural and electrochemical studies. The results showed that is possible to reach the ordered oxide phase at smaller reaction time if the lithium atmosphere is controlled. From the combination of the chemical analysis by Icp and the DRX Rietveld structural refinement it is possible to establish the Li, Ni(II), Ni(III) and Co(III) composition with great accuracy. The resulted structural and compositional transformations have a close relation with technological parameters of the rechargeable lithium battery using Li Ni 0.8 Co 0.2 O 2 oxide as cathode. (Author)

Hydrothermal synthesis of layered Li[Ni1/3Co1/3Mn1/3]O2 as positive electrode material for lithium secondary battery

International Nuclear Information System (INIS)

Myung, Seung-Taek; Lee, Myung-Hun; Komaba, Shinichi; Kumagai, Naoaki; Sun, Yang-Kook

2005-01-01

In attempts to prepare layered Li[Ni 1/3 Co 1/3 Mn 1/3 ]O 2 , hydrothermal method was employed. The hydrothermal precursor, [Ni 1/3 Co 1/3 Mn 1/3 ](OH) 2 , was synthesized via a coprecipitation route. The sphere-shaped powder precursor was hydrothermally reacted with LiOH aqueous solution at 170 deg. C for 4 days in autoclave. From X-ray diffraction and scanning electron microscopic studies, it was found that the as-hydrothermally prepared powders were crystallized to layered α-NaFeO 2 structure and the particles had spherical shape. The as-prepared Li[Ni 1/3 Co 1/3 Mn 1/3 ]O 2 delivered an initial discharge of about 110 mA h g -1 due to lower crystallinity. Heat treatment of the hydrothermal product at 800 deg. C was significantly effective to improve the structural integrity, which consequently affected the increase in the discharge capacity to 157 (4.3 V cut-off) and 182 mA h g -1 (4.6 V cut-off) at 25 deg. C with good reversibility

Structural evolution of bias sputtered LiNi0.5Mn1.5O4 thin film cathodes for lithium ion batteries

International Nuclear Information System (INIS)

Su, Shih-Hsuan; Chiu, Kuo-Feng; Leu, Hoang-Jyh

2014-01-01

LiNi 0.5 Mn 1.5 O 4 (LNMO) thin films have been deposited on stainless steel substrates using radio frequency (f = 13.56 MHz) magnetron sputtering, followed by thermal annealing in ambient atmosphere. Various negative biases were applied on the substrates during deposition. The structural evolution of LNMO thin films under different negative biases has been investigated and characterized by X-ray diffraction. All of the deposited films exhibit a crystalline spinel structure with a space group of Fd-3m, which is a so-called disordered phase. The results also indicate that particle size decreases with increasing negative bias. The electrochemical properties of the LNMO thin films as cathode materials for lithium ion batteries were investigated. Two distinctive voltage plateaus at ∼ 4.7 V and at ∼ 4.0 V (vs. Li + /Li) can be observed in the discharge curves, corresponding to the reactions of the disordered phase. The capacity of LNMO thin film electrodes under suitable negative bias can be optimized. - Highlights: • LiNi 0.5 Mn 1.5 O 4 thin films have been deposited on stainless steel substrates. • Various negative biases were applied on the substrates during deposition. • The particle sizes of LNMO thin films decrease with increasing negative bias

Electrochemical performance of LiNi0.5Mn1.5O4 prepared by improved solid state method as cathode in hybrid supercapacitor

International Nuclear Information System (INIS)

Wu Huiming; Rao, Ch. Venkateswara; Rambabu, B.

2009-01-01

The electrochemical performance of a hybrid asymmetric supercapacitor with activated carbon (AC) as anode and a lithium-ion intercalated compound LiNi 0.5 Mn 1.5 O 4 as cathode was studied. By using metal acetate precursors as starting materials in solid state reaction method, pure LiNi 0.5 Mn 1.5 O 4 was formed at low temperature. The role of precursors on the formation of material at low temperature and short period of time is presented. XRD confirms the cubic spinel structure (space group, Fd3m) and SEM shows the particles of size around 1 μm. The effect of the modified solid state reaction route on the structural and electrochemical properties was investigated. The fabricated hybrid supercapacitor, AC/LiNi 0.5 Mn 1.5 O 4 in a non-aqueous electrolyte 1.0 M LiPF 6 /EC-DMC exhibits a sloping voltage profile from 1.0 to 3.0 V and delivers a specific energy of ca. 56 Wh kg -1 . Moreover, it exhibits excellent cycling performance with less than 5% capacity loss over 1000 cycles.

The acceleration intermediate phase (NiS and Ni3S2) evolution by nanocrystallization in Li/NiS2 thermal batteries with high specific capacity

Science.gov (United States)

Jin, Chuanyu; Zhou, Lingping; Fu, Licai; Zhu, Jiajun; Li, Deyi; Yang, Wulin

2017-06-01

The intermediate phase of NiS2 is thought to be a bottleneck currently to improve the overall performance of Li/NiS2 thermal batteries because of its low conductivity and close formation enthalpy between NiS2 and the intermediate phase (NiS, Ni3S2, etc). For improving the discharge performances of Li/NiS2 thermal batteries, the nano NiS2 with an average size of 85 ± 5 nm is designated as a cathode material. The electrochemical measurements show that the specific capacity of nano NiS2 cathode is higher than micro NiS2. The nano NiS2 cathode exhibits excellent electrochemical performances with high specific capacities of 794 and 654 mAh g-1 at current density of 0.1 and 0.5 A cm-2 under a cut-off voltage of 0.5 V, respectively. These results show that the rapid intermediate phase evolution from the nanocrystallization can obviously enhance use efficiency of NiS2 and improve discharge performances of thermal batteries.

(PO_4)"3"− polyanions doped LiNi_1_/_3Co_1_/_3Mn_1_/_3O_2: An ultrafast-rate, long-life and high-voltage cathode material for Li-ion rechargeable batteries

International Nuclear Information System (INIS)

Cong, Lina; Zhao, Qin; Wang, Zhao; Zhang, Yuhang; Wu, Xinglong; Zhang, Jingping; Wang, Rongshun; Xie, Haiming; Sun, Liqun

2016-01-01

Highlights: • LiNi_1_/_3Co_1_/_3Mn_1_/_3O_2 layered structure is doped with (PO_4)"3"− polyanions. • Results confirm that (PO_4)"3"− influences MO_6 octahedral environment in LiNi_1_/_3Co_1_/_3Mn_1_/_3O_2 lattice. • Charge–discharge properties are investigated under high voltage battery operation. • Cycling and rate performance of the doped materials is markedly enhanced. • Pre-cycling treatment inhibits microcracks at the grain boundaries at 4.7–2.8 V. - Abstract: Layered compounds LiNi_1_/_3Co_1_/_3Mn_1_/_3O_2 have recently received much attention as they have been regarded as a promising cathode materials for industrial application. However, its fast energy density decay and poor rate performance which originate from structure disruption especially at high rate and high cut-off voltage limit its large-scale application. Here, a novel designed concept and facile method were firstly used to fabricate (PO_4)"3"− polyanions doped layered LiNi_1_/_3Co_1_/_3Mn_1_/_3O_2 (LNMC-(PO_4) _0_._0_1_5-O_1_._9_4) structure, which could offer more stable high-voltage cycling performance and high rate capability. We attribute this improved performance to the robust P_t_e_t-O covalence, which will stabilize the oxygen close-packed structure during repeated cycling. Moreover, our stepwise pre-cycling treatments could effectively restrain the formation of micro-cracks and non-crystallization defects, and significantly improve cyclic durability with high charge voltage of 4.7V. The LNMC-(PO_4) _0_._0_1_5-O_1_._9_4 electrode can still delivers capacity retention of 81% after 200 cycles at a current density of 300mA g"−"1. The preliminary results reported here manifest that this novel-designed LNMC-(PO_4) _0_._0_1_5-O_1_._9_4 material represents an attractive alternative to ultrafast-rate, long-life and high-voltage electrode material for lithium ion batteries.

Characterization of particulate sol-gel synthesis of LiNi0.8Co0.2O2 via maleic acid assistance with different solvents

International Nuclear Information System (INIS)

Zhong, Y.D.; Zhao, X.B.; Cao, G.S.; Tu, J.P.; Zhu, T.J.

2006-01-01

Particulate sol-gel LiNi 0.8 Co 0.2 O 2 has been synthesized by a maleic-acid-assisted process using de-ionized water or ethanol as the solvent. A comparison of the effect on these two different solvents was made on the basis of thermal studies, Fourier transform infrared spectroscopy, X-ray diffraction analysis, chemical diffusion coefficients measurement, and electrochemical cyclability tests. An esterification reaction occurred on the xerogel prepared with ethanol as solvent, reducing Ni and Co from their nitrate salts. LiNi 0.8 Co 0.2 O 2 grew at the expense of Li 2 CO 3 , NiO, and CoO during calcination. Better results of capacity and cyclability were obtained in a DI-water-solvent sample associated with a larger interslab thickness between O-Li-O and lower Ni occupancy on the Li site. The activation energy for the calcinations of DI-water-solvent sample is one-half of that of the ethanol-solvent one, which could be the reason for its better properties. Chemical diffusion coefficients of Li + ion are of the same order 10 -10 cm 2 /s, is not affected by the solvents used and/or the temperature raise to 55 deg. C

High rate performances of the cathode material LiNi1/3Co1/3Mn1/3O2 synthesized using low temperature hydroxide precipitation

International Nuclear Information System (INIS)

Cheng, Cuixia; Tan, Long; Liu, Haowen; Huang, Xintang

2011-01-01

Graphical abstract: A low-temperature reaction route is introduced based on hydroxide precipitation method to synthesize a cathode material LiNi 1/3 Co 1/3 Mn 1/3 O 2 . The charge-discharge tests were performed at 1000 mA g -1 between 2.5 and 4.5 V and the discharge capacity is about 160 mAh g -1 . The discharge capacity of the material is strongly impacted by the reaction temperature. The powders sintered at 850 o C show the best electrochemical performance. Highlights: → A low-temperature reaction route is introduced based on hydroxide precipitation method to synthesize a novel cathode material LiNi 1/3 Co 1/3 Mn 1/3 O 2 . → The charge-discharge tests were performed at higher current as 5 C between 2.5 and 4.5 V. → The discharge capacity of the material is strongly impacted by the reaction temperature. The powders sintered at 850 o C show the best electrochemical performance. -- Abstract: A low-temperature reaction route is introduced based on hydroxide precipitation method to synthesize the cathode material LiNi 1/3 Co 1/3 Mn 1/3 O 2 . The crystal structure and morphology of the prepared powder have been characterized by X-ray diffraction and Scan electron microscope, respectively. The charge-discharge tests were performed between 2.5 and 4.5 V. The discharge capacity of the material is strongly impacted by the reaction temperature. The powders sintered at 850 o C show the best electrochemical performance and the initial discharge capacity is about 160 mAh g -1 at 5 C. Powder X-ray diffraction and Scan electron microscope results reveal that the excellent electrochemical performances should be ascribed to the lower precursor reaction temperature, the lower degree of cation mixing and analogous spherical small particles, which can improve the transfer of Li ions and electrons. All these results indicate that this material has potential application in lithium-ion batteries.

Structural and dielectric studies of LiNiPO4 and LiNi0.5Co0.5PO4 cathode materials for lithium-ion batteries

Directory of Open Access Journals (Sweden)

K. Vijaya Babu

2016-09-01

Full Text Available Olivine-type LiNiPO4 has been considered as a most competitive positive electrode active material for lithium-ion batteries. In the present paper, the LiNiPO4 and Co-doped LiNi0.5Co0.5PO4 are synthesized by solid-state reaction method under air atmosphere. All the X-ray diffraction peaks of both the compounds are indexed and it is found that the samples are well crystallized in orthorhombic olivine structure belonging to the space group Pnma. The crystallite size is calculated from the Scherrer formula and it is found to be 6.918 and 4.818 nm for pure and doped samples, respectively. The surface morphology and grain sizes of the materials are investigated through scanning electron microscope. Presence of preferred local cation environment is understood from Fourier transform infrared spectroscopy (FTIR studies. The conductivity and dielectric analysis of the samples are carried out at different temperatures and frequencies using the complex impedance spectroscopy technique. The electrical conductivity of LiNi0.5Co0.5PO4 is higher than that of pure LiNiPO4.

Electrochemical performances of LiNi1−xMnxPO4 (x = 0.05–0.2) olivine cathode materials for high voltage rechargeable lithium ion batteries

DEFF Research Database (Denmark)

Karthikprabhu, S.; Karuppasamy, K.; Vikraman, Dhanasekaran

2018-01-01

This study demonstrated to synthesis of carbon-free lithium nickel phosphate (LiNiPO4) and its analogue of manganese doped LiNi1−xMnxPO4 (x = 0.05–0.2) cathode materials by a facile polyol method and their suitability for use in high voltage lithium ion batteries (LIBs). The physicochemical...

The preparation and role of Li_2ZrO_3 surface coating LiNi_0_._5Co_0_._2Mn_0_._3O_2 as cathode for lithium-ion batteries

International Nuclear Information System (INIS)

Xu, Yue; Liu, Yang; Lu, Zhongpei; Wang, Haiying; Sun, Deqin; Yang, Gang

2016-01-01

Graphical abstract: LiNi_0_._5Co_0_._2Mn_0_._3O_2 is coated by Li_2ZrO_3 layer with the thickness about 20 nm. Li_2ZrO_3 coating effectively improves cycling performance and rate capability. LZO-LMO delivers 194 mAh g"−"1 at 0.2 C and presents improved cyclic performance at 55 °C. - Highlights: • LiNi_0_._5Co_0_._2Mn_0_._3O_2 is coated by Li_2ZrO_3 layer with the thickness about 20 nm. • Li_2ZrO_3 coating effectively improves cycling performance and rate capability. • LZO-LMO delivers 194 mAh g"−"1 at 0.2 C and presents improved cyclic performance at 55 °C. • Li_2ZrO_3 coating suppresses cation dissolution and enhances the structural stability. - Abstract: Li_2ZrO_3-coated LiNi_0_._5Co_0_._2Mn_0_._3O_2 (LZO-LMO) is successful synthesized by using a wet chemical method. Li_2ZrO_3 coating formed a uniform layer on LiNi_0_._5Co_0_._2Mn_0_._3O_2 particles (LMO) without changing the crystal structure. Cyclic voltammetry (CV) and charge–discharge tests show that the Li_2ZrO_3-modified layer can improve the cyclic and rate performance. In the cut-off voltage of 2.7–4.6 V, LZO-LMO maintains 86% of the initial capacity at the 50th cycle, which is much higher than LMO with the retention of 66% of the initial capacity. The coating layer of LZO plays the positive role in conductivity of lithium diffusion and improves rate performance of LMO. At 10 C rates, LZO-LMO delivers the initial capacity of 95 mAh g"−"1 which is much higher than 40 mAh g"−"1 delivered by LMO. At the environmental temperature of 55 °C, LZO-LMO delivers the initial capacity of 194 mAh g"−"1 at 0.2 C rate and presents an improved cyclic performance in comparison with LMO. The elemental analysis of electrodes carried out after 50 charge/discharge cycles shows minor Ni content deviation in LMO, but LZO-LMO still remains the stoichiometric ratio, because the Li_2ZrO_3 coating efficiently hinders the metal dissolution during charge/discharge.

Significant improvement in performances of LiNi0.5Mn1.5O4 through surface modification with high ordered Al-doped ZnO electro-conductive layer

International Nuclear Information System (INIS)

Sun, Hongdan; Xia, Bingbo; Liu, Weiwei; Fang, Guoqing; Wu, Jingjing; Wang, Haibo; Zhang, Ruixue; Kaneko, Shingo; Zheng, Junwei; Wang, Hongyu; Li, Decheng

2015-01-01

Graphical abstract: Al-doped ZnO (AZO)-coated LiNi 0.5 Mn 1.5 O 4 (LNMO) was prepared by sol–gel method. AZO-coated LNMO electrode shows excellent rate capability and a remarkable improvement in the cyclic performance at a high rate at elevated temperature. - Highlights: • Al-doped ZnO (AZO)-coated LiNi 0.5 Mn 1.5 O 4 (LNMO) was prepared by a traditional sol–gel method. • Al-doped ZnO (AZO) layer grown on the surface of LNMO is high ordered. • At a high rate of 10 C, the discharge capacity of the AZO-coated LNMO electrode can reach 114 mAh g −1 . • Al-doped ZnO (AZO) modification improved cyclic performance of LNMO at high temperatures. - Abstract: Al-doped ZnO (AZO)-coated LiNi 0.5 Mn 1.5 O 4 (LNMO) was prepared by sol–gel method. Transmission electron microscopy (TEM) analysis indicates that AZO layer grown on the surface of LNMO is high ordered. The results of electrochemical performance measurements reveal that the AZO-coated LNMO electrode displays the best rate capability compared with the bare LNMO and ZnO-coated LNMO, even at a high rate of 10 C. The discharge capacity of the AZO-coated LNMO electrode can still reach 114.3 mAh g −1 , about 89% of its discharge capacity at 0.1 C. Moreover, AZO-coated LNMO electrode shows a remarkable improvement in the cyclic performance at a high rate at elevated temperature due to the protective effect of AZO coating layer. The electrode delivers a capacity of 120.3 mAh g −1 with the capacity retention of 95% at 5 C in 50 cycles at 50 °C. The analysis of electrochemical impedance spectra (EIS) indicates that AZO-coated LNMO possesses the lowest charge transfer resistance compared to the bare LNMO and ZnO-coated LNMO, which may be responsible for improved rate capability

NiCo2O4 surface coating Li[Ni0.03Mn1.97]O4 micro-/nano- spheres as cathode material for high-performance lithium ion battery

Science.gov (United States)

Ye, Pan; Dong, Hui; Xu, Yunlong; Zhao, Chongjun; Liu, Dong

2018-01-01

Here we report a novel transitional metal oxide (NiCo2O4) coated Li[Ni0.03Mn1.97]O4 micro-/nano- spheres as high-performance Li-ion battery cathode material. A thin layer of ∼10 nm NiCo2O4 was formed by simple wet-chemistry approach adjacent to the surface of Li[Ni0.03Mn1.97]O4 micro-/nano- spheres, leading to significantly enhanced battery electrochemical performance. The optimized sample(1 wt%) not only delivers excellent discharge capacity and cycling stability improvement at both room temperature and elevated temperatures, but also effectively prevents Mn dissolution while retaining its coating structure intact according to XRF and TEM results. The CV and EIS break-down analysis indicated a much faster electrochemical reaction kinetics, more reversible electrode process and greatly reduced charge transfer and Warburg resistance, clearly illustrating the dual role of NiCo2O4 coating to boost electron transport and Li+ diffusion, and alleviation of manganese dissolving. This approach may render as an efficient technique to realize high-performance lithium ion battery cathode material.

Comparative Investigation of 0.5Li2MnO3·0.5LiNi0.5Co0.2Mn0.3O2 Cathode Materials Synthesized by Using Different Lithium Sources

Directory of Open Access Journals (Sweden)

Peng-Bo Wang

2018-05-01

Full Text Available Lithium-rich manganese-based cathode materials has been attracted enormous interests as one of the most promising candidates of cathode materials for next-generation lithium ion batteries because of its high theoretic capacity and low cost. In this study, 0.5Li2MnO3·0.5LiNi0.5Co0.2Mn0.3O2 materials are synthesized through a solid-state reaction by using different lithium sources, and the synthesis process and the reaction mechanism are investigated in detail. The morphology, structure, and electrochemical performances of the material synthesized by using LiOH·H2O, Li2CO3, and CH3COOLi·2H2O have been analyzed by using Thermo gravimetric analysis (TGA, X-ray diffraction (XRD, Scanning electron microscope (SEM, Transmission electron microscope (TEM, X-ray photoelectron spectroscopy (XPS, and electrochemical measurements. The 0.5Li2MnO3·0.5LiNi0.5Co0.2Mn0.3O2 material prepared by using LiOH·H2O displays uniform morphology with nano particle and stable layer structure so that it suppresses the first cycle irreversible reaction and structure transfer, and it delivers the best electrochemical performance. The results indicate that LiOH·H2O is the best choice for the synthesis of the 0.5Li2MnO3·0.5LiNi0.5Co0.2Mn0.3O2 material.

Solvothermal coating LiNi_0_._8Co_0_._1_5Al_0_._0_5O_2 microspheres with nanoscale Li_2TiO_3 shell for long lifespan Li-ion battery cathode materials

International Nuclear Information System (INIS)

Wu, Naiteng; Wu, Hao; Liu, Heng; Zhang, Yun

2016-01-01

LiNi_0_._8Co_0_._1_5Al_0_._0_5O_2 (NCA) microspheres covered by a nanoscale Li_2TiO_3-based shell were synthesized by a facile strategy based on a solvothermal pre-coating treatment combined with a post-sintering lithiation process. The morphology, structure and composition of the Li_2TiO_3-coated NCA samples were investigated by X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS), scanning scanning electron microscope (SEM) with an energy-dispersive X-ray spectroscope (EDS), and transmission electron microscopy (TEM). Owing to the complete, uniform and nanoscale Li_2TiO_3 coating shell, the resultant surface-modified NCA microspheres used as Li-ion battery cathode materials manifest remarkably enhanced cycling performances, attaining 94% and 84% capacity retention after 200 and 400 cycles at 0.5 C, respectively, which is much better than the pristine NCA counterpart (60% retention, 200 cycles). More impressively, the surface-modified NCA also shows an intriguing storage stability. After being stored at 30 °C for 50 days, the coated NCA-based cells are subjected to be cycled both at room and elevated temperatures, in which the aged cells can still remain 84% capacity retention after 200 cycles at 25 °C and 77% capacity retention after 200 cycles at 55 °C, respectively. All these results demonstrate that the Li_2TiO_3-coated LiNi_0_._8Co_0_._1_5Al_0_._0_5O_2 microsphere is a promising cathode material for Li-ion batteries with long lifespan. - Graphical abstract: Nanoscale Li_2TiO_3-based shell encapsulated LiNi_0_._8Co_0_._1_5Al_0_._0_5O_2 (NCA) microspheres are fabricated through a solvothermal pre-coating treatment combined with post-lithiation process. The surface-coated NCA as cathode materials shows a remarkably enhanced cycling performance and storage stability for long lifespan Li-ion batteries. - Highlights: • Li_2TiO_3 is used as coating materials for layer structured LiNi_0_._8Co_0_._1_5Al_0_._0_5O_2 cathode. • Solvothermal coating

Overexpression of protein kinase A - RIalpha reduces lipofection efficiency of cisplatin-resistant human tumor cells.

Science.gov (United States)

Son, K K; Rosenblatt, J

2001-04-10

Cisplatin-resistant variant A2780CP/vector cells were 4.0-5.3-fold more transfectable and 7.6-fold more resistant to cisplatin than their parent cisplatin-sensitive human ovarian carcinoma A2780/vector cells. Overexpression of cAMP-dependent protein kinase Type I regulatory alpha subunit (PKA-RIalpha) gene in A2780CP cells significantly reduced (maximum 47.0%) the transfection activity, with a slight reduction (maximum 27.3%) of cisplatin resistance, of A2780CP cells. However, RIalpha-overexpressing A2780CP (A2780CP/RIalpha) cells were still 2.5-to 3.0-fold more transfectable and 5.5-fold more resistant to cisplatin than A2780 cells. This results suggest that gene transfer efficiency is associated with cisplatin resistance, in part, through the PKA-mediated cAMP signal transduction pathway.

Al2O3 Coated Concentration-Gradient Li[Ni0.73Co0.12Mn0.15]O2 Cathode Material by Freeze Drying for Long-Life Lithium Ion Batteries

International Nuclear Information System (INIS)

Wang, Jingpeng; Du, Chunyu; Yan, Chunqiu; He, Xiaoshu; Song, Bai; Yin, Geping; Zuo, Pengjian; Cheng, Xinqun

2015-01-01

Highlights: • Al 2 O 3 -coated concentration-gradient oxide is synthesized by a freeze drying method. • The effect of Al 2 O 3 -coating on concentration-gradient cathode is firstly studied. • Al 2 O 3 -coated sample exhibits high capacity and significantly enhanced cyclability. • Improved cyclability is ascribed to the effective protection of uniform Al 2 O 3 layer. - Abstract: In order to enhance the electrochemical performance of the high capacity layered oxide cathode with a Ni-rich core and a concentration-gradient shell (NRC-CGS), we use a freeze drying method to coat Al 2 O 3 layer onto the surface of NRC-CGS Li[Ni 0.73 Co 0.12 Mn 0.15 ]O 2 material. The samples are characterized by X-ray diffraction, scanning electron microscopy, transmission electron microscopy, charge-discharge measurements and electrochemical impedance spectroscopy. It is revealed that an amorphous Al 2 O 3 layer of about 5 nm in thickness is uniformly formed on the surface of NRC-CGS Li[Ni 0.73 Co 0.12 Mn 0.15 ]O 2 material by the freeze drying procedure. The freeze drying Al 2 O 3 -coated (FD-Al 2 O 3 -coated) sample demonstrates similar discharge capacity and significantly enhanced cycling performances, in comparison to the pristine and conventional heating drying Al 2 O 3 -coated (HD-Al 2 O 3 -coated) samples. The capacity decay rate of FD-Al 2 O 3 -coated Li[Ni 0.73 Co 0.12 Mn 0.15 ]O 2 material is 1.7% after 150 cycles at 55 °C, which is 9 and 12 times lower than that of the pristine and HD-Al 2 O 3 -coated samples. The superior electrochemical stability of the FD-Al 2 O 3 -coated sample is attributed to the synergistic protection of CGS and high-quality Al 2 O 3 coating that effectively protect the active material from electrolyte attack. The freeze drying process provides an effective method to prepare the high performance surface-coated electrode materials

Mechanical Composite of LiNi0.8Co0.15Al0.05O2/Carbon Nanotubes with Enhanced Electrochemical Performance for Lithium-Ion Batteries

OpenAIRE

Zhang, Liping; Fu, Ju; Zhang, Chuhong

2017-01-01

LiNi0.8Co0.15Al0.05O2/carbon nanotube (NCA/CNT) composite cathode materials are prepared by a facile mechanical grinding method, without damage to the crystal structure and morphology of the bulk. The NCA/CNT composite exhibits enhanced cycling and rate performance compared with pristine NCA. After 60?cycles at a current?rate?of 0.25 C, the reversible capacity of NCA/CNT composite cathode is 181?mAh/g with a discharge retention rate of 96%, considerably higher than the value of pristine NCA (...

Electronically Conductive Sb-doped SnO_2 Nanoparticles Coated LiNi_0_._8Co_0_._1_5Al_0_._0_5O_2 Cathode Material with Enhanced Electrochemical Properties for Li-ion Batteries

International Nuclear Information System (INIS)

He, Xiaoshu; Du, Chunyu; Shen, Bin; Chen, Cheng; Xu, Xing; Wang, Yajing; Zuo, Pengjian; Ma, Yulin; Cheng, Xinqun; Yin, Geping

2017-01-01

Highlights: • Conductive Sb-doped SnO_2 (ATO) is coated on LiNi_0_._8Co_0_._1_5Al_0_._0_5O_2 material. • The wet chemical process leads to homogeneous ATO coating layer. • The coated sample exhibits excellent rate capability and cyclic stability. • The capacity retention after 200 cycles at 60 °C increases by 20.81%. • The ATO coating restrains the cation disordering and SEI growth during cycling. - Abstract: The LiNi_0_._8Co_0_._1_5Al_0_._0_5O_2 (NCA) cathode material is modified by electronically conductive antimony-doped tin oxide (ATO) nanoparticles via a facile wet chemical process. As observed by scanning and transmission electron microscopy, the ATO nanoparticles are homogeneously coated on the surface of NCA material. Thus-obtained ATO-coated NCA (ATO-NCA) material delivers a high discharge capacity of 145 mAh g"−"1 at the current rate of 5C, which is significantly higher than that of pristine NCA material (135 mAh g"−"1). Moreover, the capacity retention of ATO-NCA material is 91.70% after 200 cycles at the current rate of 1C and 60 °C. In contrast, the pristine NCA only maintains 70.89% of its initial capacity after the same cycles. The substantially improved cyclability and rate capability are mainly attributed to the ATO coating layer, which can not only enhance the electron transport but also effectively restrain the side reactions between the NCA material and the electrolyte. More specifically, X-ray diffraction and photoelectron spectroscopy reveal that the ATO coating layer can restrain the Li"+/Ni"2"+ disordering and the growth of SEI layer of NCA material, which are responsible for the improved cycling stability, especially at elevated temperatures.

Effect of Cu Doping on the Structural and Electrochemical Performance of LiNi1/3Co1/3Mn1/3O2 Cathode Materials

Science.gov (United States)

Yang, Li; Ren, Fengzhagn; Feng, Qigao; Xu, Guangri; Li, Xiaobo; Li, Yuanchao; Zhao, Erqing; Ma, Jignjign; Fan, Shumin

2018-04-01

The structural and electrochemical performance of Cu-doped, Li[Ni1/3-xCo1/3 Mn1/3Cux]O2 (x = 0-0.1) cathode materials obtained by means of the sol-gel method are discussed; we used critic acid as gels and spent mixed batteries as the raw materials. The effects of the sintering time, sintering temperature, and Cu doping ratio on the phase structure, morphology, and element composition and the behavior in a galvanostatical charge/discharge test have been systemically studied. The results show that the Cu-doped material exhibits better galvanostatic charge/discharge cycling performance. At 0.2 C, its original discharge specific capacity is 180.4 mAh g-1 and its Coulomb efficiency is 90.3%. The Cu-doped material demonstrate an outstanding specific capacity at 0.2 C, 0.5 C, and 2.0 C. In comparison with the original capacities of 178 mAh g-1, 159.5 mAh g-1, and 119.4 mAh g-1, the discharge capacity after 50 cycles is 160.8 mAh g-1, 143.4 mAh g-1, and 90.1 mAh g-1, respectively. This obvious improvement relative to bare Li[Ni1/3Co1/3Mn1/3]O2 cathode materials arises from an enlarged Li layer spacing and a reduced degree of cation mixing. Therefore, Cu-doped cathode materials have obvious advantages in the field of lithium-ion batteries and their applications.

Synthesis and structural studies of Mg doped LiNi0.5Mn0.5O2 cathode materials for lithium-ion batteries

Science.gov (United States)

Murali, N.; Margarette, S. J.; Madhuri Sailaja, J.; Kondala Rao, V.; Himakar, P.; Kishore Babu, B.; Veeraiah, V.

2018-02-01

Layered Mg doped LiNi0.5Mn0.5O2 materials have been synthesized by sol-gel method. The physical properties of these materials were examined by XRD, FESEM and FT-IR studies. From XRD patterns, the phase formation of α-NaFeO2 layered structure with R\\bar 3m space group is confirmed. The surface morphology of the synthesized materials has been examined by FESEM analysis in which the average particle size is found to be about 2 - 2.5 µm. These materials show some changes in the local ion environment, as examined by FT-IR studies.

Preparation of nano-porous LiNi0.5Mn1.5O4 with high electrochemical performances by a co-precipitation method for 5 V lithium-ion batteries

Science.gov (United States)

Cui, Xiaoling; Li, Hongliang; Li, Shiyou

2017-10-01

Porous LiNi0.5Mn1.5O4 is prepared by co-precipitation method. The results of scanning electron microscopy show that the sample has a nano-porous structure. Charge-discharge tests show that the synthesized product exhibits excellent electrochemical performance with a high initial discharge capacity of 129.1 mAh g-1 at 0.5 C and a preferably capacity retention of 96.5% after 200 cycles. The superior performance of the synthesized product is attributed to its nano-porous structure. The nanoparticle reduces the path of Li+ diffusion and increases the reaction sites for lithium insertion/extraction, the pores provide room to buffer the volume changes during charge-discharge.

Enhanced electrochemical performance of LiNi0.6Co0.2Mn0.2O2 cathode at high cutoff voltage by modifying electrode/electrolyte interface with lithium metasilicate

International Nuclear Information System (INIS)

Fu, Jiale; Mu, Daobin; Wu, Borong; Bi, Jiaying; Liu, Xiaojiang; Peng, Yiyuan; Li, Yiqing; Wu, Feng

2017-01-01

Highlights: •The electrochemical properties of the LiNi 0.6 Co 0.2 Mn 0.2 O 2 cathode are investigated at high voltage of 4.6 V. •The Li 2 SiO 3 suppresses the decomposition of LiPF 6 and carbonate solvents. •Li 2 SiO 3 helpfully retards the transition metal dissolution by consuming HF. •The enhanced electrochemical properties of the LiNi 0.6 Co 0.2 Mn 0.2 O 2 cathode mixed with Li 2 SiO 3 . -- Abstract: Developing high-voltage Li ion batteries (LIBs) is an important trend to meet the requirement of high energy density battery. However, high voltage will cause a series of problems harming the cycle performance of LIBs at the same time. This work is to investigate the effect of inorganic substance Li 2 SiO 3 on the electrochemical performance of LiNi 0.6 Co 0.2 Mn 0.2 O 2 (NCM622) cathode at high cutoff voltage of 4.6 V. XRD result shows that the structure of NCM622 cathode material is not affected by mixing Li 2 SiO 3 . However, XPS and EIS tests indicate that Li 2 SiO 3 has an evident influence on suppressing the decomposition of LiPF 6 and carbonate solvents at high voltage, reducing interfacial solid film impedance and modifying electrode/electrolyte interface. In addition, Li 2 SiO 3 retards the transition metal dissolution by consuming HF. Therefore, it enhances the electrochemical properties of the NCM622 cathode significantly. The highest discharge capacity increases to 191.7 mA h g -1 by mixing Li 2 SiO 3 , compared with the value of 180 mA h g -1 in the case of NCM622 cathode. The NCM622 electrode mixed with Li 2 SiO 3 also exhibits a better capacity retention of 73.4% after 200 cycles and a high rate capability at 20C with the value of 89 mA h g -1 , in contrast with 62.2% and 31 mA h g -1 attained in the NCM622 cathode.

General Approach to Prepare 0.33Li₂MnO₃ · 0.67LiNi1/3Co1/3Mn1/3O₂ Hollow Microspheres for High Performance Lithium Ion Batteries.

Science.gov (United States)

Li, Jingfa; Xu, Wenjin; Zhang, Lei; Li, Min

2018-06-01

Li-excess manganese-based oxide layered structures, have drawn increasing interests as the promising cathodes to succeed the conventional LiCoO2 in lithium ion batteries (LIBs). It could deliver a higher energy density and output potential, as well as the nature of environment benign and low cost. Pristine Li-excess manganese-based oxides however suffer from poor rate capacity and voltage fading after cycling, and their inherent capacity limits of bulk size in performance. Micro-/Nanostructured electrode materials are considered to hold the key to overcome these thresholds. This paper reports a general approach to prepare 0.33Li2MnO3 · 0.67LiNi1/3Co1/3Mn1/3O2 microspheres with pores and void space, which benefits improving both the capacity and cyclability. The electrode made of hollow 0.33Li2MnO3 · 0.67LiNi1/3Co1/3Mn1/3O2 microspheres exhibits a 224 mAh g-1 discharge capacity over 200 cycles at 0.25 C rate, and 195 mAh g-1 at 5.0 C rate. These results indicated good perspective of hollow microspheres for practical battery applications.

Synthesis, electrochemical investigation and structural analysis of doped Li[Ni0.6Mn0.2Co0.2-xMx]O2 (x = 0, 0.05; M = Al, Fe, Sn) cathode materials

Science.gov (United States)

Eilers-Rethwisch, Matthias; Winter, Martin; Schappacher, Falko Mark

2018-05-01

Layered Ni-rich Li[Ni0.6Mn0.2Co0.2-xMx]O2 cathode materials (x = 0, 0.05; M = Al, Fe, Sn) are synthesized via a co-precipitation synthesis route and the effect of dopants on the structure and electrochemical performance is investigated. All synthesized materials show a well-defined layered structure of the hexagonal α-NaFeO2 phase investigated by X-ray diffraction (XRD). Undoped LiNi0.6Mn0.2Co0.2O2 exhibits a discharge capacity of 170 mAh g-1 in Li-metal 2032 coin-type cells. Doped materials reach lower capacities between 145 mAh g-1 for Al and 160 mAh g-1 for Sn. However, all doped materials prolong the cycle life by up to 20%. Changes of the lattice parameter before and after delithiation yield information about structural stability. A smaller repulsion of the transition metal layer during delithiation in the Sn-doped material leads to a smaller expansion of the unit cell, which results in enhanced structural stability of the material. The improved structural stability of Sn-doped NMC cathode active material is proven by thermal investigations with the help of Differential Scanning Calorimetry (DSC) and Thermogravimetric Analysis (TGA).

Improving the Electrochemical Performance of LiNi0.80Co0.15Al0.05O2 in Lithium Ion Batteries by LiAlO2 Surface Modification

OpenAIRE

Chunhua Song; Wenge Wang; Huili Peng; Ying Wang; Chenglong Zhao; Huibin Zhang; Qiwei Tang; Jinzhao Lv; Xianjun Du; Yanmeng Dou

2018-01-01

LiNi0.80Co0.15Al0.05O2 (NCA) as a lithium ion battery cathode material has received attention for its highly specific capacity and excellent low temperature performance. However, the disadvantages of its high surface lithium compound residues and high pH value have influenced its processing performance and limited its application. This paper uses a facile method to modify NCA through LiAlO2 coating. The results showed that when the molar ratio of Al(NO3)3·9H2O and lithium compound residues at...

Li3PO4 surface coating on Ni-rich LiNi0.6Co0.2Mn0.2O2 by a citric acid assisted sol-gel method: Improved thermal stability and high-voltage performance

Science.gov (United States)

Lee, Suk-Woo; Kim, Myeong-Seong; Jeong, Jun Hui; Kim, Dong-Hyun; Chung, Kyung Yoon; Roh, Kwang Chul; Kim, Kwang-Bum

2017-08-01

A surface coating of Li3PO4 was applied to a Ni-rich LiNi0.6Co0.2Mn0.2O2 (NCM) material to improve its thermal stability and electrochemical properties via a citric acid assisted sol-gel method. The addition of citric acid effectively suppressed the instant formation of Li3PO4 in solution, resulting in successful coating of the NCM surface. The improved thermal stability of NCM after Li3PO4 surface coating was demonstrated by differential scanning calorimetry (DSC) analysis and in situ time-resolved X-ray diffraction (TR-XRD). In particular, the TR-XRD results showed that the improved thermal stability after Li3PO4 surface coating originates from suppression of the phase transition of charged NCM at high temperatures. Furthermore, the charge-discharge tests demonstrated that Li3PO4-coated LiNi0.6Co0.2Mn0.2O2 (LP-NCM) has excellent electrochemical properties. LP-NCM exhibited a specific capacity of 192.7 mAh g-1, a capacity retention of 44.1% at 10 C, and a capacity retention of 79.7% after 100 cycles at a high cut-off voltage of 4.7 V; these values represent remarkably improved electrochemical properties compared with those of bare NCM. These improved thermal and electrochemical properties were mainly attributed to the improvement of the structural stability of the material and the suppression of the interface reaction between the cathode and the electrolyte owing to the Li3PO4 coating.

Cisplatin-induced caspase activation mediates PTEN cleavage in ovarian cancer cells: a potential mechanism of chemoresistance

International Nuclear Information System (INIS)

Singh, Mohan; Chaudhry, Parvesh; Fabi, Francois; Asselin, Eric

2013-01-01

The phosphatase and tensin homolog deleted on chromosome 10 (PTEN) tumor suppressor protein is a central negative regulator of the PI3K/AKT signaling cascade and suppresses cell survival as well as cell proliferation. PTEN is found to be either inactivated or mutated in various human malignancies. In the present study, we have investigated the regulation of PTEN during cisplatin induced apoptosis in A2780, A270-CP (cisplatin resistant), OVCAR-3 and SKOV3 ovarian cancer cell lines. Cells were treated with 10μM of cisplatin for 24h. Transcript and protein levels were analysed by quantitative reverse transcriptase-polymerase chain reaction (qRT-PCR) and western blotting, respectively. Immunofluorescence microscopy was used to assess the intracellular localization of PTEN. Proteasome inhibitor and various caspases inhibitors were used to find the mechanism of PTEN degradation. PTEN protein levels were found to be decreased significantly in A2780 cells; however, there was no change in PTEN protein levels in A2780-CP, OVCAR-3 and SKOV3 cells with cisplatin treatment. The decrease in PTEN protein was accompanied with an increase in the levels of AKT phosphorylation (pAKT) in A2780 cells and a decrease of BCL-2. Cisplatin treatment induced the activation/cleavage of caspase-3, -6, -7, -8, -9 in all cell lines tested in this study except the resistant variant A2780-CP cells. In A2780 cells, restoration of PTEN levels was achieved upon pre-treatment with Z-DEVD-FMK (broad range caspases inhibitor) and not with MG132 (proteasome inhibitor) and by overexpression of BCL-2, suggesting that caspases and BCL-2 are involved in the decrease of PTEN protein levels in A2780 cells. The decrease in pro-apoptotic PTEN protein levels and increase in survival factor pAKT in A2780 ovarian cancer cells suggest that cisplatin treatment could further exacerbate drug resistance in A2780 ovarian cancer cells

Cisplatin-induced caspase activation mediates PTEN cleavage in ovarian cancer cells: a potential mechanism of chemoresistance.

Science.gov (United States)

Singh, Mohan; Chaudhry, Parvesh; Fabi, Francois; Asselin, Eric

2013-05-10

The phosphatase and tensin homolog deleted on chromosome 10 (PTEN) tumor suppressor protein is a central negative regulator of the PI3K/AKT signaling cascade and suppresses cell survival as well as cell proliferation. PTEN is found to be either inactivated or mutated in various human malignancies. In the present study, we have investigated the regulation of PTEN during cisplatin induced apoptosis in A2780, A270-CP (cisplatin resistant), OVCAR-3 and SKOV3 ovarian cancer cell lines. Cells were treated with 10μM of cisplatin for 24h. Transcript and protein levels were analysed by quantitative reverse transcriptase-polymerase chain reaction (qRT-PCR) and western blotting, respectively. Immunofluorescence microscopy was used to assess the intracellular localization of PTEN. Proteasome inhibitor and various caspases inhibitors were used to find the mechanism of PTEN degradation. PTEN protein levels were found to be decreased significantly in A2780 cells; however, there was no change in PTEN protein levels in A2780-CP, OVCAR-3 and SKOV3 cells with cisplatin treatment. The decrease in PTEN protein was accompanied with an increase in the levels of AKT phosphorylation (pAKT) in A2780 cells and a decrease of BCL-2. Cisplatin treatment induced the activation/cleavage of caspase-3, -6, -7, -8, -9 in all cell lines tested in this study except the resistant variant A2780-CP cells. In A2780 cells, restoration of PTEN levels was achieved upon pre-treatment with Z-DEVD-FMK (broad range caspases inhibitor) and not with MG132 (proteasome inhibitor) and by overexpression of BCL-2, suggesting that caspases and BCL-2 are involved in the decrease of PTEN protein levels in A2780 cells. The decrease in pro-apoptotic PTEN protein levels and increase in survival factor pAKT in A2780 ovarian cancer cells suggest that cisplatin treatment could further exacerbate drug resistance in A2780 ovarian cancer cells.

Purification and characterization of an extracellular trypsin-like protease of Fusarium oxysporum var. lini.

Science.gov (United States)

Barata, Ricardo Andrade; Andrade, Milton Hercules Guerra; Rodrigues, Roberta Dias; Castro, Ieso Miranda

2002-01-01

An alkaline serineprotease, capable of hydrolyzing Nalpha-benzoyl- dl arginine p-nitroanilide, was secreted by Fusarium oxysporum var. lini grown in the presence of gelatin as the sole nitrogen and carbon source. The protease was purified 65-fold to electrophoretic homogenity from the culture supernatant in a three-step procedure comprising QSepharose chromatography, affinity chromatography, and FPLC on a MonoQ column. SDS-PAGE analysis of the purified protein indicated an estimated molecular mass of 41 kDa. The protease had optimum activity at a reaction temperature of 45 degrees C and showed a rapid decrease of activity at 48 degrees C. The optimum pH was around 8.0. Characterization of the protease showed that Ca2+ and Mg2+ cations increased the activity, which was not inhibited by EDTA or 1,10-phenanthroline. The enzyme activity on Nalpha-benzoyl-DL arginine p-nitroanilide was inhibited by 4-(2-aminoethyl)-benzenesulfonyl fluoride hydrochloride, p-aminobenzamidine dihydrochloride, aprotinin, 3-4 dichloroisocoumarin, and N-tosyl-L-lysine chloromethyl ketone. The enzyme is also inhibited by substrate concentrations higher than 2.5 x 10(-4)M. The protease had a Michaelis-Menten constant of 0.16 mM and a V(max) of 0.60 mumol released product.min(-1).mg(-1) enzyme when assayed in a non-inhibiting substrate concentration. The activity on Nalpha-benzoyl- dl arginine p-nitroanilide was competitively inhibited by p-aminobenzamidine dihydrochoride. A K(i) value of 0.04 mM was obtained.

A facile template method to synthesize significantly improved LiNi0.5Mn1.5O4 using corn stalk as a bio-template

International Nuclear Information System (INIS)

Liu, Guiyang; Kong, Xin; Sun, Hongyan; Wang, Baosen; Yi, Zhongzhou; Wang, Quanbiao

2014-01-01

In order to simplify the template method for the synthesis of cathode materials for lithium ion batteries, a facile template method using plant stalks as bio-templates has been introduced. Based on this method, LiNi 0.5 Mn 1.5 O 4 spinel with a significantly improved electrochemical performance has been synthesized using corn stalk as a template. X-ray diffraction (XRD), Fourier transform infrared pectroscopy (FTIR) and scanning electron microscope (SEM) have been used to investigate the phase composition and micro-morphologies of the products. Charge-discharge measurements in lithium cells, cyclic voltammetry (CV) and Electrochemical impedance spectroscopy (EIS) have been used to study the electrochemical performance of the products. The results indicate that the templated product exhibits higher crystallinity than that of non-templated product. Both of the templated product and the non-templated product are combination of the ordered space group P4 3 32 and the disordered Fd-3 m. The specific BET surface area of the templated product is about twice larger than that of the non-templated product. Moreover, the electrochemical performances of the templated product including specific capacity, cycling stability and rate capability are significantly improved as compared with the non-templated product, due to its higher crystallinity, larger Li + diffusion coefficient and lower charge transfer resistance

Exposing the {010} Planes by Oriented Self-Assembly with Nanosheets To Improve the Electrochemical Performances of Ni-Rich Li[Ni0.8Co0.1Mn0.1]O2 Microspheres.

Science.gov (United States)

Su, Yuefeng; Chen, Gang; Chen, Lai; Li, Weikang; Zhang, Qiyu; Yang, Zhiru; Lu, Yun; Bao, Liying; Tan, Jing; Chen, Renjie; Chen, Shi; Wu, Feng

2018-02-21

A modified Ni-rich Li[Ni 0.8 Co 0.1 Mn 0.1 ]O 2 cathode material with exposed {010} planes is successfully synthesized for lithium-ion batteries. The scanning electron microscopy images have demonstrated that by tuning the ammonia concentration during the synthesis of precursors, the primary nanosheets could be successfully stacked along the [001] crystal axis predominantly, self-assembling like multilayers. According to the high-resolution transmission electron microscopy results, such a morphology benefits the growth of the {010} active planes of final layered cathodes during calcination treatment, resulting in the increased area of the exposed {010} active planes, a well-ordered layer structure, and a lower cation mixing disorder. The Li-ion diffusion coefficient has also been improved after the modification based on the results of potentiostatic intermittent titration technique. As a consequence, the modified Li[Ni 0.8 Co 0.1 Mn 0.1 ]O 2 material exhibits superior initial discharges of 201.6 mA h g -1 at 0.2 C and 185.7 mA h g -1 at 1 C within 2.8-4.3 V (vs Li + /Li), and their capacity retentions after 100 cycles reach 90 and 90.6%, respectively. The capacity at 10 C also increases from 98.3 to 146.5 mA h g -1 after the modification. Our work proposes a novel approach for exposing high-energy {010} active planes of the layered cathode material and again confirms its validity in improving electrochemical properties.

Design of Nickel-Based Cation-Disordered Rock-Salt Oxides: The Effect of Transition Metal (M = V, Ti, Zr) Substitution in LiNi0.5M0.5O2 Binary Systems.

Science.gov (United States)

Cambaz, Musa Ali; Vinayan, Bhaghavathi P; Euchner, Holger; Johnsen, Rune E; Guda, Alexander A; Mazilkin, Andrey; Rusalev, Yury V; Trigub, Alexander L; Gross, Axel; Fichtner, Maximilian

2018-06-20

Cation-disordered oxides have been ignored as positive electrode material for a long time due to structurally limited lithium insertion/extraction capabilities. In this work, a case study is carried out on nickel-based cation-disordered Fm3 ̅m LiNi 0.5 M 0.5 O 2 positive electrode materials. The present investigation targets tailoring the electrochemical properties for nickel-based cation-disordered rock-salt by electronic considerations. The compositional space for binary LiM +3 O 2 with metals active for +3/+4 redox couples is extended to ternary oxides with LiA 0.5 B 0.5 O 2 with A = Ni 2+ and B = Ti 4+ , Zr 4+ , and V +4 to assess the impact of the different transition metals in the isostructural oxides. The direct synthesis of various new unknown ternary nickel-based Fm3̅ m cation-disordered rock-salt positive electrode materials is presented with a particular focus on the LiNi 0.5 V 0.5 O 2 system. This positive electrode material for Li-ion batteries displays an average voltage of ∼2.55 V and a high discharge capacity of 264 mAhg -1 corresponding to 0.94 Li. For appropriate cutoff voltages, a long cycle life is achieved. The charge compensation mechanism is probed by XANES, confirming the reversible oxidation and reduction of V 4+ /V 5+ . The enhancement in the electrochemical performances within the presented compounds stresses the importance of mixed cation-disordered transition metal oxides with different electronic configuration.

Spin glass transition in the rhombohedral LiNi1/3Mn1/3Co1/3O2

International Nuclear Information System (INIS)

Bie, Xiaofei; Yang, Xu; Han, Bing; Chen, Nan; Liu, Lina; Wei, Yingjin; Wang, Chunzhong; Chen, Hong; Du, Fei; Chen, Gang

2013-01-01

Highlights: •The Rietveld analysis of XRD data reveals a single phase with rhombohedral structure. •Dc susceptibility data suggest a spin glass behavior at low T in the 333 compound. •The ac susceptibility measurements have been observed in the typical SG system. •Three models have been employed to study the behavior of the spin glass state. •Both geometrical frustration and disorder play important role in the formation of SG. -- Abstract: Layered LiNi 1/3 Mn 1/3 Co 1/3 O 2 has been synthesized by co-precipitation method, and the magnetic properties were comprehensively studied by dc and ac susceptibilities. The dc magnetization curves show the irreversibility and spin freezing behavior at 109 K and 9 K. The evolution of real and imaginary part of ac susceptibility under different frequencies indicates a spin glass transition at low temperature. Three models (the Néel–Arrhenius law, the Vogel–Fulcher law, and the power law) have been employed to study the relaxation behavior of the spin glass state. Both frustration and disorder play important role in the formation of spin glass

Synthesis and electrochemical properties of layered structure Li[Ni0.5Co0.25Mn0.25]O2 cathode material

International Nuclear Information System (INIS)

Prathibha, G.; Rosaiah, P.; Reddy, B. Purusottam; Ganesh, K. Sivajee; Hussain, O. M.

2015-01-01

Lithium ion (Li-ion) batteries are currently the energy source of choice for cell phones, laptops, and other mobile electronic devices due to their balance of high energy density with high power density compared to other electrochemical energy carriers. In the present study, mixed hydroxide method is used to prepare Li[Ni 0.5 Co 0.25 Mn 0.25 ]O 2 from the precursors and analyze qualitatively and studied the electrochemical properties. The XRD spectrum exhibited predominant (003) orientation at 2θ =18.39 o corresponding to hexagonal layered structure of R3m symmetry with evaluated lattice parameters are a= 2.84 Å, c= 14.43 Å. Raman measurements were performed to understand the microstructure and vibrational modes of the prepared sample. From the electrochemical (EC) studies an initial discharge capacity of about 140 mAhg −1 with good cyclic stability was observed for the prepared sample in the potential range 0.0 −1.0V in aqueous medium

Three-dimensional evaluation of compositional and structural changes in cycled LiNi1/3Co1/3Mn1/3O2 by atom probe tomography

Science.gov (United States)

Lee, Ji Yeong; Kim, Ji Yoon; Cho, Hae In; Lee, Chi Ho; Kim, Han Sung; Lee, Sang Uck; Prosa, Ty J.; Larson, David J.; Yu, Tae Hwan; Ahn, Jae-Pyoung

2018-03-01

Accelerated capacity fading of LiNi1/3Co1/3Mn1/3O2 (NCM111) electrode by the chemical migration of lithium (Li) or transition metals (TMs), and surface reconstruction in the surface during electrochemical cycling were evaluated by correlative analysis of atom probe tomography (APT) and transmission electron microscopy (TEM). The cycled NCM111 showed a lack of Li at surface which provides the driving force for long-range Ni migration toward surface. A schematic model for phase transformation and the kinetics of TM migration within the layered structure by density functional theory (DFT) calculations was proposed. This study provides insights into capacity loss and voltage fade upon electrochemical charge-discharge process of NCM111 by measuring the variation of Li composition away from the surface.

Effects of CO/sub 2/ and membranes on sporulation in axenic cultures of flax rust. [Melampsora lini

Energy Technology Data Exchange (ETDEWEB)

Boasson, R.; Shaw, M.

1985-01-01

Uredospore production by axenically grown flax rust (Melampsora lini (Ehrenb.) Lev.) was measured as carotenoids (extinction units at 458 nm) per milligram protein. Sporulation was not affected by raising (flushing with 1-5% (v/v) CO/sub 2/ in air) or lowering (KOH well in culture flasks) the level of CO/sub 2/ in the air space above the cultures. Significant (two- to four-fold) increases in sporulation occurred beneath impermeable membranes of parafilm or Saran wrap placed on the surface of young (3 weeks from seeding) mycelial mats for 2 weeks. The stimulatory effect was confined strictly to those areas of the mycelial mats in contact with the membranes. Both Parafilm and Saran wrap were easily and cleanly peeled away from the mycelial mats. Permeable Unipore and HVHP membranes, to which the fungus adhered strongly, did not stimulate sporulation. The fungus did not adhere to Unipore or HVHP membranes treated with silicone or paraffin oil; membranes thus treated stimulated sporulation. The stimulatory effect of membranes on sporulation appears to depend on the nature of the contact between the membrane surface and the mycelium and to be unrelated to the effect of the membranes on the diffusion of gases or other volatile substances. 11 references, 2 figures, 4 tables.

Effect of preparation methods of LiNi1-xCoxO2 cathode materials on their chemical structure and electrode performance

International Nuclear Information System (INIS)

Cho, J.; Kim, G.; Lim, H.S.

1999-01-01

The authors have studied effects of different starting materials on preparation of LiNi 1-x Co x O 2 cathode material for a Li-ion cell where x = 0.1, 0.2, and 0.3, and the electrochemical properties of resulting compounds from two different preparation methods. A preparation method (method B) which uses spherical powder of Ni 1-x Co x (OH) 2 as one of the starting material produced a much superior cathode material than the other method (method A) which uses Ni(OH) 2 and Co(OH) 2 . Method A produced compounds with relatively high degrees of cation mixing which reduces electrochemical utilization (discharge capacity), increases irreversible capacity, and reduces stability on cycling of the cathode material. Method B, in contrast, produced cathode material with a much reduced degree of cation-mixing, thus improving the electrochemical properties. The spherical particle of material prepared by method B has the additional advantage of improved packing density of the electrode with improved volumetric energy density. The ratio of c/a was increased and the electrochemical stability on cycling of the material was improved as the content of Co (value of x) is increased

Structural, dielectric and conductivity studies of LiNi0.75Mg0.25-xCuxPO4 synthesized by solid state reaction method

Directory of Open Access Journals (Sweden)

Kotamalige Anand

2016-03-01

Full Text Available The olivine structured LiNi0.75Mg0.25-xCuxPO4 (x = 0, 0.05 and 0.1 cathode materials were synthesized by solid state reaction method. The XRD, FTIR and FESEM studies were conducted to investigate the phase purity, crystal structure, lattice parameters and morphology, respectively. The powder X-ray diffraction studies confirmed the single phase formation of the pure and doped compounds which are found to be orthorhombic with the parent LiNiPO4. Morphology and grain sizes of the materials were investigated through FESEM. The FTIR technique was used to characterize the stretching and bending vibrational modes of different functional groups existing in the materials. The cathode properties were analysed through impedance spectroscopy and indicated on improved electrical properties of the doped samples as compared to the pure LiNiPO4. The conductivity and modulus analyses of the samples were carried out at different temperatures and frequencies using the complex impedance spectroscopy technique.

Influence of electrode preparation on the electrochemical performance of LiNi0.8Co0.15Al0.05O2 composite electrodes for lithium-ion batteries

Science.gov (United States)

Tran, Hai Yen; Greco, Giorgia; Täubert, Corina; Wohlfahrt-Mehrens, Margret; Haselrieder, Wolfgang; Kwade, Arno

2012-07-01

The electrode manufacturing for lithium-ion batteries is based on a complex process chain with several influencing factors. A proper tailoring of the electrodes can greatly improve both the electrochemical performances and the energy density of the battery. In the present work, some significant parameters during the preparation of LiNi0.8Co0.15Al0.05O2-based cathodes were investigated. The active material was mixed with a PVDF-binder and two conductive additives in different ratios. The electrode thickness, the degree of compacting and the conductive agent type and mixing ratio have proven to have a strong impact on the electrochemical performances of the composite electrodes, especially on their behaviour at high C-rates. Further it has been shown that the compacting has an essential influence on the mechanical properties of NCA coatings, according to their total, ductile and elastic deformation behaviour.

Monitoring local redox processes in LiNi0.5Mn1.5O4 battery cathode material by in operando EPR spectroscopy

Science.gov (United States)

Niemöller, Arvid; Jakes, Peter; Eurich, Svitlana; Paulus, Anja; Kungl, Hans; Eichel, Rüdiger-A.; Granwehr, Josef

2018-01-01

Despite the multitude of analytical methods available to characterize battery cathode materials, identifying the factors responsible for material aging is still challenging. We present the first investigation of transient redox processes in a spinel cathode during electrochemical cycling of a lithium ion battery by in operando electron paramagnetic resonance (EPR). The battery contains a LiNi0.5Mn1.5O4 (LNMO) spinel cathode, which is a material whose magnetic interactions are well understood. The evolution of the EPR signal in combination with electrochemical measurements shows the impact of Mn3+ on the Li+ motion inside the spinel. Moreover, state of charge dependent linewidth variations confirm the formation of a solid solution for slow cycling, which is taken over by mixed models of solid solution and two-phase formation for fast cycling due to kinetic restrictions and overpotentials. Long-term measurements for 480 h showed the stability of the investigated LNMO, but also small amounts of cathode degradation products became visible. The results point out how local, exchange mediated magnetic interactions in cathode materials are linked with battery performance and can be used for material characterization.

Synchrotron radiation-based 61Ni Mössbauer spectroscopic study of Li(Ni1/3Mn1/3Co1/3)O2 cathode materials of lithium ion rechargeable battery

Science.gov (United States)

Segi, Takashi; Masuda, Ryo; Kobayashi, Yasuhiro; Tsubota, Takayuki; Yoda, Yoshitaka; Seto, Makoto

2016-12-01

Layered rocksalt type oxides, such as Li(Ni1/3Mn1/3Co1/3)O2, are widely used as the cathode active materials of lithium-ion rechargeable batteries. Because the nickel ions are associated with the role of the charge compensation at discharge and charge, the 61Ni Mössbauer measurements at 6 K using synchrotron radiation were performed to reveal the role of Ni. The Ni ions of the active materials play two roles for the redox process between the charge and discharge states of lithium-ion batteries. Half of the total Ni ions change to the low-spin Ni3+ with Jahn-Teller distortion from the Ni2+ ions of the discharge state. The remainder exhibit low-spin state divalent Ni ions.

NCX-4040, a nitric oxide-releasing aspirin, sensitizes drug-resistant human ovarian xenograft tumors to cisplatin by depletion of cellular thiols

Directory of Open Access Journals (Sweden)

Ignarro Louis J

2008-02-01

Full Text Available Abstract Background Ovarian carcinoma is the leading cause of mortality among gynecological cancers in the world. The high mortality rate is associated with lack of early diagnosis and development of drug resistance. The antitumor efficacy and mechanism of NCX-4040, a nitric oxide-releasing aspirin derivative, against ovarian cancer is studied. Methods NCX-4040, alone or in combination with cisplatin (cis-diamminedichloroplatinum, cDDP, was studied in cisplatin-sensitive (A2780 WT and cisplatin-resistant (A2780 cDDP cell lines as well as xenograft tumors grown in nude mice. Electron paramagnetic resonance (EPR was used for measurements of nitric oxide and redox state. Immunoblotting analysis of A2780 cDDP tumor xenografts from mice was used for mechanistic studies. Results Cells treated with NCX-4040 (25 μM showed a significant reduction of cell viability (A2780 WT, 34.9 ± 8.7%; A2780 cDDP, 41.7 ± 7.6%; p versus NCX-4040+cisplatin, 26.4 ± 7.6%; p versus NCX-4040+cisplatin, 56.4 ± 7.8%; p Conclusion The results suggested that NCX-4040 could resensitize drug-resistant ovarian cancer cells to cisplatin possibly by depletion of cellular thiols. Thus NCX-4040 appears to be a potential therapeutic agent for the treatment of human ovarian carcinoma and cisplatin-resistant malignancies.

Improving cyclic stability of lithium nickel manganese oxide cathode for high voltage lithium ion battery by modifying electrode/electrolyte interface with electrolyte additive

International Nuclear Information System (INIS)

Li, Bin; Wang, Yaqiong; Tu, Wenqiang; Wang, Zaisheng; Xu, Mengqing; Xing, Lidan; Li, Weishan

2014-01-01

Highlights: • Cyclic stability of LiNi 0.5 Mn 1.5 O 4 is improved significantly by using PES as additive. • A protective SEI is formed on LiNi 0.5 Mn 1.5 O 4 due to the preferential oxidation of PES. • The SEI suppresses electrolyte decomposition and structure destruction of LiNi 0.5 Mn 1.5 O 4 . - Abstract: We report a new approach to improve the cyclic stability of lithium nickel manganese oxide (LiNi 0.5 Mn 1.5 O 4 ) cathode, in which the cathode/electrolyte interface is modified by using prop-1-ene-1, 3-sultone (PES) as an electrolyte additive. The interfacial properties of LiNi 0.5 Mn 1.5 O 4 cathode in PES-containing electrolyte have been investigated by scanning electron spectroscopy (SEM), transmission electron microscopy (TEM), thermal gravimetry (TG), X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS), cyclic voltammometry (CV), chronoamperometry (CA), and constant current charge/discharge test. It is found that the application of PES improves significantly the cyclic stability of LiNi 0.5 Mn 1.5 O 4 . After 400 cycles at 1C rate (1C=147 mA g −1 ), the capacity retention of LiNi 0.5 Mn 1.5 O 4 is 90% for the cell using 1.0 wt% PES, while only 49% for the cell without the additive. The characterizations from SEM, TEM, TG, XRD, and XPS confirm that the LiNi 0.5 Mn 1.5 O 4 /electrolyte interface is modified and a protective solid electrolyte interface film is formed on LiNi 0.5 Mn 1.5 O 4 particles, which prevents LiNi 0.5 Mn 1.5 O 4 from destruction and suppresses the electrolyte decomposition

Silver/carbon nanotube hybrids: A novel conductive network for high-rate lithium ion batteries

International Nuclear Information System (INIS)

Zhou, Fangdong; Qiu, Kehui; Peng, Gongchang; Xia, Li

2015-01-01

LiNi 1/3 Co 1/3 Mn 1/3 O 2 /Ag composite cathodes are synthesized by a thermal decomposition method and multi-walled carbon nanotubes are uniformly introduced into the composites through ball mixing. A composite electrically conductive network consisting of CNTs and Ag is obtained to improve the conductivity of LiNi 1/3 Co 1/3 Mn 1/3 O 2 material. By comparing with the pure LiNi 1/3 Co 1/3 Mn 1/3 O 2 and cathode modified by CNTs or Ag, the as-obtained LiNi 1/3 Co 1/3 Mn 1/3 O 2 –CNT/Ag electrode exhibits the best rate capability (120.6 mAh/g at 5C) and cycle performance (134.2 mAh/g at 1C with a capacity retention of 94.4% over 100 cycles). With the construction of 3D spatial conductive network, the novel hybrid CNT/Ag demonstrates itself a promising strategy to improve Li storage performance for lithium ion batteries

Synthesis of 0.3Li2MnO3·0.7LiNi1/3Co1/3Mn1/3O2 cathode materials using 3-D urchin-like MnO2 as precursor for high performance lithium ion battery

International Nuclear Information System (INIS)

Zhao, Chenhao; Hu, Zhibiao; Zhou, Yunlong; Fang, Shuzhen; Cai, Shaohan

2015-01-01

In the paper, we report synthesis of lithium rich layered oxide 0.3Li 2 MnO 3 ·0.7LiNi 1/3 Co 1/3 Mn 1/3 O 2 by using an urchin-like MnO 2 as precursor. The influences of calcination temperatures on the structures and electrochemical performances of as-prepared materials are systematically studied. The results show that the obtained sample can partially retain the morphology of urchin-like precursor especially at low temperature, and a higher calcination temperature helps to improve the layered structure and particle size. As lithium ion battery cathodes, the 750 °C sample with the size of 100–200 nm reveals an optimal electrochemical performance. The initial discharge capacity of 234.6 mAh g −1 with high Coulombic efficiency of 84.6 % can be reached at 0.1C within 2.0–4.7 V. After 50 cycles, the capacity retention can reach 90.2 % at 0.5C. Even at high current density of 5C, the sample also shows a stable discharge capacity of 120.5 mAh g −1 . Anyways, the urchin-like MnO 2 directed route is suitable to prepare 0.3Li 2 MnO 3 ·0.7LiNi 1/3 Co 1/3 Mn 1/3 O 2 as lithium ion battery cathode

Impact of morphological changes of LiNi1/3Mn1/3Co1/3O2 on lithium-ion cathode performances

Science.gov (United States)

Pierre-Etienne, Cabelguen; David, Peralta; Mikael, Cugnet; Pascal, Maillet

2017-04-01

Major advances in Li-ion battery technology rely on the nanostructuration of active materials to overcome the severe kinetics limitations of new - cheaper and safer - chemistries. However, opening porosities results in the decrease of volumetric performances, closing the door to significant applications such as portable electronics, electromobility, and grid storage. In this study, we analyze the link between morphologies and performances of model LiNi1/3Mn1/3Co1/3O2 materials. By quantifying exhaustively their microstructures using nitrogen adsorption, mercury intrusion porosimetry, and helium pycnometry, we can discuss how porosities and surface areas are linked to the electrochemical behavior. There is no geometrical parameters that can predict the performances of all our materials. The shape of agglomeration dictates the electrochemical behavior. A huge drop in volumetric performances is measured when microstructure is considered. We show that gravimetric and volumetric power performances are contrary to each other. Highly dense materials exhibit, by far, the best power performances in terms of volumetric figures, so that opening porosities might not be the best strategy, even in non-nanosized materials, for Li-ion battery technology.

Effect of overcharge on Li(Ni0.5Mn0.3Co0.2)O2/graphite lithium ion cells with poly(vinylidene fluoride) binder. III - Chemical changes in the cathode

Science.gov (United States)

Bareño, Javier; Dietz Rago, Nancy; Dogan, Fulya; Graczyk, Donald G.; Tsai, Yifen; Naik, Seema R.; Han, Sang-Don; Lee, Eungje; Du, Zhijia; Sheng, Yangping; Li, Jianlin; Wood, David L.; Steele, Leigh Anna; Lamb, Joshua; Spangler, Scott; Grosso, Christopher; Fenton, Kyle; Bloom, Ira

2018-05-01

1.5 Ah pouch cells based on Li(Ni0.5Mn0.3Co0.2)O2 cathodes and graphite anodes, both containing poly (vinylidene fluoride) (PVDF) binders, were systematically overcharged to 100, 120, 140, 160, 180, and 250% state of charge (SOC), at which point they vented. The cells were subsequently discharged to 0% SOC and disassembled under an inert atmosphere for characterization. A combination of X-ray photoelectron spectroscopy (XPS), scanning-electron microscopy (SEM), energy-dispersive spectroscopy (EDS), 6Li SSNMR, and X-ray diffraction (XRD) analysis of the NMC532 cathodes indicates the formation of a thin C- and O-rich cathode electrolyte interphase layer, progressive Li loss above 140% SOC, and retention of the bulk crystal structure at all states of charge.

Synergy of Nyquist and Bode electrochemical impedance spectroscopy studies to particle size effect on the electrochemical properties of LiNi0.5Co0.2Mn0.3O2

International Nuclear Information System (INIS)

Liang, Chenghao; Liu, Lianbao; Jia, Zheng; Dai, Changsong; Xiong, Yueping

2015-01-01

To study the mechanism of material particle size effects on the electrochemical properties of LiNi 0.5 Co 0.2 Mn 0.3 O 2 , two kinds of materials with particle size of 300 nm and 1 μm were prepared, based on the electrospinning method and sol-gel method, respectively. The capacity differences of the two materials at 20 mA/g discharge current were unapparent, in the potential range of 2.8V–4.3 V, but become gigantic at 1000 mA/g discharge current. Electrochemical impedance spectroscopy (EIS) was employed to analysis the differences caused by particle size, and frequency responses of every electrochemical process were analyzed in detail through Bode plots, which proved the electrospinning material had an excellent performance caused by a shorter lithium ion and electron diffusion distance.

Surface Surgery of the Nickel-Rich Cathode Material LiNi0.815Co0.15Al0.035O2: Toward a Complete and Ordered Surface Layered Structure and Better Electrochemical Properties.

Science.gov (United States)

Tang, Zhongfeng; Bao, Junjie; Du, Qingxia; Shao, Yu; Gao, Minghao; Zou, Bangkun; Chen, Chunhua

2016-12-21

A complete and ordered layered structure on the surface of LiNi 0.815 Co 0.15 Al 0.035 O 2 (NCA) has been achieved via a facile surface-oxidation method with Na 2 S 2 O 8 . The field-emission transmission electron microscopy images clearly show that preoxidation of the hydroxide precursor can eliminate the crystal defects and convert Ni(OH) 2 into layered β-NiOOH, which leads to a highly ordered crystalline NCA, with its (006) planes perpendicular to the surface in the sintering process. X-ray photoelectron spectroscopy and Raman shift results demonstrate that the contents of Ni 2+ and Co 2+ ions are reduced with preoxidization on the surface of the hydroxide precursor. The level of Li + /Ni 2+ disordering in the modified NCA determined by the peak intensity ratio I (003) /I (104) in X-ray diffraction patterns decreases. Thanks to the complete and ordered layered structure on the surface of secondary particles, lithium ions can easily intercalate/extract in the discharging-charging process, leading to greatly improved electrochemical properties.

Capacity fade of LiNi(1-x-y)CoxAlyO2 cathode for lithium-ion batteries during accelerated calendar and cycle life test. I. Comparison analysis between LiNi(1-x-y)CoxAlyO2 and LiCoO2 cathodes in cylindrical lithium-ion cells during long term storage test

Science.gov (United States)

Watanabe, Shoichiro; Kinoshita, Masahiro; Nakura, Kensuke

2014-02-01

Ni-based LiNi(1-x-y)CoxAlyO2 (NCA) and LiCoO2 (LCO) cathode materials taken out of lithium-ion cells after storage for 2 years at 45 °C were analyzed by various spectroscopic techniques. X-ray photoelectron spectroscopy exhibited that there was no difference between NCA and LCO. On the other hand, scanning transmission electron microscopy-electron energy-loss spectroscopy demonstrated there was a remarkably large difference between the two cathode materials. Ni-L2,3 energy-loss near-edge structure (ELNES) spectra of the NCA showed a peak at about 856.5 eV, which was assigned to trivalent nickel, was maintained even after storage, indicating that the NCA had no significant change in its surface structure during storage. On the other hand, in the Co-L2,3 ELNES spectra of the LCO a peak at about 782.5 eV, which was assigned to trivalent cobalt, significantly shifted to the lower energies after storage. These results suggest that crystal structure change of the active material surface is a predominant reason of deterioration during the storage test.

Chloroquine is a zinc ionophore.

Directory of Open Access Journals (Sweden)

Jing Xue

Full Text Available Chloroquine is an established antimalarial agent that has been recently tested in clinical trials for its anticancer activity. The favorable effect of chloroquine appears to be due to its ability to sensitize cancerous cells to chemotherapy, radiation therapy, and induce apoptosis. The present study investigated the interaction of zinc ions with chloroquine in a human ovarian cancer cell line (A2780. Chloroquine enhanced zinc uptake by A2780 cells in a concentration-dependent manner, as assayed using a fluorescent zinc probe. This enhancement was attenuated by TPEN, a high affinity metal-binding compound, indicating the specificity of the zinc uptake. Furthermore, addition of copper or iron ions had no effect on chloroquine-induced zinc uptake. Fluorescent microscopic examination of intracellular zinc distribution demonstrated that free zinc ions are more concentrated in the lysosomes after addition of chloroquine, which is consistent with previous reports showing that chloroquine inhibits lysosome function. The combination of chloroquine with zinc enhanced chloroquine's cytotoxicity and induced apoptosis in A2780 cells. Thus chloroquine is a zinc ionophore, a property that may contribute to chloroquine's anticancer activity.

Altered localisation of the copper efflux transporters ATP7A and ATP7B associated with cisplatin resistance in human ovarian carcinoma cells

International Nuclear Information System (INIS)

Kalayda, Ganna V; Wagner, Christina H; Buß, Irina; Reedijk, Jan; Jaehde, Ulrich

2008-01-01

Copper homeostasis proteins ATP7A and ATP7B are assumed to be involved in the intracellular transport of cisplatin. The aim of the present study was to assess the relevance of sub cellular localisation of these transporters for acquired cisplatin resistance in vitro. For this purpose, localisation of ATP7A and ATP7B in A2780 human ovarian carcinoma cells and their cisplatin-resistant variant, A2780cis, was investigated. Sub cellular localisation of ATP7A and ATP7B in sensitive and resistant cells was investigated using confocal fluorescence microscopy after immunohistochemical staining. Co-localisation experiments with a cisplatin analogue modified with a carboxyfluorescein-diacetate residue were performed. Cytotoxicity of the fluorescent cisplatin analogue in A2780 and A2780cis cells was determined using an MTT-based assay. The significance of differences was analysed using Student's t test or Mann-Whitney test as appropriate, p values of < 0.05 were considered significant. In the sensitive cells, both transporters are mainly localised in the trans-Golgi network, whereas they are sequestrated in more peripherally located vesicles in the resistant cells. Altered localisation of ATP7A and ATP7B in A2780cis cells is likely to be a consequence of major abnormalities in intracellular protein trafficking related to a reduced lysosomal compartment in this cell line. Changes in sub cellular localisation of ATP7A and ATP7B may facilitate sequestration of cisplatin in the vesicular structures of A2780cis cells, which may prevent drug binding to genomic DNA and thereby contribute to cisplatin resistance. Our results indicate that alterations in sub cellular localisation of transport proteins may contribute to cisplatin resistance in vitro. Investigation of intracellular protein localisation in primary tumour cell cultures and tumour tissues may help to develop markers of clinically relevant cisplatin resistance. Detection of resistant tumours in patients may in turn

Altered localisation of the copper efflux transporters ATP7A and ATP7B associated with cisplatin resistance in human ovarian carcinoma cells

Directory of Open Access Journals (Sweden)

Reedijk Jan

2008-06-01

Full Text Available Abstract Background Copper homeostasis proteins ATP7A and ATP7B are assumed to be involved in the intracellular transport of cisplatin. The aim of the present study was to assess the relevance of sub cellular localisation of these transporters for acquired cisplatin resistance in vitro. For this purpose, localisation of ATP7A and ATP7B in A2780 human ovarian carcinoma cells and their cisplatin-resistant variant, A2780cis, was investigated. Methods Sub cellular localisation of ATP7A and ATP7B in sensitive and resistant cells was investigated using confocal fluorescence microscopy after immunohistochemical staining. Co-localisation experiments with a cisplatin analogue modified with a carboxyfluorescein-diacetate residue were performed. Cytotoxicity of the fluorescent cisplatin analogue in A2780 and A2780cis cells was determined using an MTT-based assay. The significance of differences was analysed using Student's t test or Mann-Whitney test as appropriate, p values of Results In the sensitive cells, both transporters are mainly localised in the trans-Golgi network, whereas they are sequestrated in more peripherally located vesicles in the resistant cells. Altered localisation of ATP7A and ATP7B in A2780cis cells is likely to be a consequence of major abnormalities in intracellular protein trafficking related to a reduced lysosomal compartment in this cell line. Changes in sub cellular localisation of ATP7A and ATP7B may facilitate sequestration of cisplatin in the vesicular structures of A2780cis cells, which may prevent drug binding to genomic DNA and thereby contribute to cisplatin resistance. Conclusion Our results indicate that alterations in sub cellular localisation of transport proteins may contribute to cisplatin resistance in vitro. Investigation of intracellular protein localisation in primary tumour cell cultures and tumour tissues may help to develop markers of clinically relevant cisplatin resistance. Detection of resistant tumours

Mechanical Composite of LiNi0.8Co0.15Al0.05O2/Carbon Nanotubes with Enhanced Electrochemical Performance for Lithium-Ion Batteries.

Science.gov (United States)

Zhang, Liping; Fu, Ju; Zhang, Chuhong

2017-12-01

LiNi 0.8 Co 0.15 Al 0.05 O 2 /carbon nanotube (NCA/CNT) composite cathode materials are prepared by a facile mechanical grinding method, without damage to the crystal structure and morphology of the bulk. The NCA/CNT composite exhibits enhanced cycling and rate performance compared with pristine NCA. After 60 cycles at a current rate of 0.25 C, the reversible capacity of NCA/CNT composite cathode is 181 mAh/g with a discharge retention rate of 96%, considerably higher than the value of pristine NCA (153 mAh/g with a retention rate of 90%). At a high current rate of 5 C, it also can deliver a reversible capacity of 160 mAh/g, while only 140 mAh/g is maintained for the unmodified NCA. Highly electrical conductive CNTs rather than common inert insulating materials are for the first time employed as surface modifiers for NCA, which are dispersed homogenously on the surface of NCA particles, not only improving the electrical conductivity but also providing effective protection to the side reactions with liquid electrolyte of the battery.

Crystallographic origin of cycle decay of the high-voltage LiNi0.5Mn1.5O4 spinel lithium-ion battery electrode.

Science.gov (United States)

Pang, Wei Kong; Lu, Cheng-Zhang; Liu, Chia-Erh; Peterson, Vanessa K; Lin, Hsiu-Fen; Liao, Shih-Chieh; Chen, Jin-Ming

2016-06-29

High-voltage spinel LiNi0.5Mn1.5O4 (LNMO) is considered a potential high-power-density positive electrode for lithium-ion batteries, however, it suffers from capacity decay after extended charge-discharge cycling, severely hindering commercial application. Capacity fade is thought to occur through the significant volume change of the LNMO electrode occurring on cycling, and in this work we use operando neutron powder diffraction to compare the structural evolution of the LNMO electrode in an as-assembled 18650-type battery containing a Li4Ti5O12 negative electrode with that in an identical battery following 1000 cycles at high-current. We reveal that the capacity reduction in the battery post cycling is directly proportional to the reduction in the maximum change of the LNMO lattice parameter during its evolution. This is correlated to a corresponding reduction in the MnO6 octahedral distortion in the spinel structure in the cycled battery. Further, we find that the rate of lattice evolution, which reflects the rate of lithium insertion and removal, is ∼9 and ∼10% slower in the cycled than in the as-assembled battery during the Ni(2+)/Ni(3+) and Ni(3+)/Ni(4+) transitions, respectively.

A rocking chair type all-solid-state lithium ion battery adopting Li2O-ZrO2 coated LiNi0.8Co0.15Al0.05O2 and a sulfide based electrolyte

Science.gov (United States)

Ito, Seitaro; Fujiki, Satoshi; Yamada, Takanobu; Aihara, Yuichi; Park, Youngsin; Kim, Tae Young; Baek, Seung-Wook; Lee, Jae-Myung; Doo, Seokgwang; Machida, Nobuya

2014-02-01

An all-solid-state lithium-ion battery (ASSB) using non-flammable solid electrolytes is a candidate for a next-generation battery. Although the excellent cycle performance and its high energy density are suggested in the literature, a practical size battery has not been appeared yet. In this paper, we have adopted a sulfide based electrolyte, Li2S-P2S5 (80:20 mol%) to a rocking chair type lithium ion battery. The electrochemical cell consists of a Li2O-ZrO2 coated LiNi0.8Co0.15Al0.05O2 (NCA) cathode, an artificial graphite anode and the sulfide based electrolyte without any organic and inorganic liquids. The cathode charge transfer resistance is significantly reduced by the Li2O-ZrO2 coating. The total cell resistance of the Li2O-ZrO2 (LZO) coated NCA adopted cell is approximately one quarter of non-treated one. A standard type single cell with the nominal capacity of 100 mAh at 25 °C is fabricated by wet printing process, and its capacity retention is approximately 80% at 100 cycles. Also, a 1 Ah class battery was constructed by stacking the single cells, and demonstrated.

The influence of the carbonate species on LiNi0.8Co0.15Al0.05O2 surfaces for all-solid-state lithium ion battery performance

Science.gov (United States)

Visbal, Heidy; Fujiki, Satoshi; Aihara, Yuichi; Watanabe, Taku; Park, Youngsin; Doo, Seokgwang

2014-12-01

The influence of selected carbonate species on LiNi0.8Co0.15Al0.05O2 (NCA) surface for all-solid-state lithium-ion battery (ASSB) with a sulfide based solid electrolyte was studied for its electrochemical properties, structural stabilities, and surface characteristics. The rated discharge performance improved with the reduction of the carbonate concentration on the NCA surface due to the decrease of the interface resistance. The species and coordination of the adsorbed carbonates on the NCA surface were analyzed by diffuse reflectance Fourier transformed infrared (DRIFT) spectroscopy. The coordination of the adsorbed carbonate anion was determined based on the degree of splitting of the ν3(CO) stretching vibrations. It is found that the surface carbonate species exists in an unidentate coordination on the surface. They react with the sulfide electrolyte to form an irreversible passivation layer. This layer obstructs the charge transfer process at the cathode/electrolyte interface, and results in the rise of the interface resistance and drop of the rated discharge capability.

Hydrogen peroxide assisted synthesis of LiNi1/3Co1/3Mn1/3O2 as high-performance cathode for lithium-ion batteries

Science.gov (United States)

Lin, Chaohong; Zhang, Yongzhi; Chen, Li; Lei, Ying; Ou, Junke; Guo, Yong; Yuan, Hongyan; Xiao, Dan

2015-04-01

LiNi1/3Co1/3Mn1/3O2 (NCM) is a promising cathode material for lithium-ion battery. In this research, a facile co-precipitation process is employed, during which the mixed solution of NH3·H2O, H2O2 (30% aqueous solution) and LiOH·H2O is added into the nitrate solution. Notably, H2O2 is introduced as the oxidant and dispersant during the co-precipitation process to oxidize the metal ions and decrease the agglomeration of the precursor by giving out O2, and then improves the specific capacity, stability and energy density of NCM. Additionally, O3 is employed to further oxidize NCM to enhance the stability during the calcination process. The obtained NCM material with single crystal structure exhibits a high initial discharge specific capacity of 208.9 mAh g-1 at 0.1 C (1 C = 280 mA g-1), an excellent cycle stability with high retained capacity of 176.3 mAh g-1 after 50 cycles, and a high initial discharge specific capacities of 150.6 mAh g-1 at 5 C even at a high cutoff potential (4.6 V).

In-situ time-of-flight neutron diffraction study of the structure evolution of electrode materials in a commercial battery with LiNi0.8Co0.15Al0.05O2 cathode

Science.gov (United States)

Bobrikov, I. A.; Samoylova, N. Yu.; Sumnikov, S. V.; Ivanshina, O. Yu.; Vasin, R. N.; Beskrovnyi, A. I.; Balagurov, A. M.

2017-12-01

A commercial lithium-ion battery with LiNi0.8Co0.15Al0.05O2 (NCA) cathode has been studied in situ using high-intensity and high-resolution neutron diffraction. Structure and phase composition of the battery electrodes have been probed during charge-discharge in different cycling modes. The dependence of the anode composition on the charge rate has been determined quantitatively. Different kinetics of Li (de)intercalation in the graphite anode during charge/discharge process have been observed. Phase separation of the cathode material has not been detected in whole voltage range. Non-linear dependencies of the unit cell parameters, atomic and layer spacing on the lithium content in the cathode have been observed. Measured dependencies of interatomic spacing and interlayer spacing, and unit cell parameters of the cathode structure on the lithium content could be qualitatively explained by several factors, such as variations of oxidation state of cation in oxygen octahedra, Coulomb repulsion of oxygen layers, changes of average effective charge of oxygen layers and van der Waals interactions between MeO2-layers at high level of the NCA delithiation.

The Contradiction Between the Half-Cell and Full-Battery Evaluations on the Tungsten-Coating LiNi_0_._5Co_0_._2Mn_0_._3O_2 Cathode

International Nuclear Information System (INIS)

Yang, Xinhe; Zuo, Zicheng; Wang, Haiyan; Chen, Quanbin; Zhang, Hui; Huang, Zhenlei; Wu, Borong; Zhou, Henghui

2015-01-01

A one-step synthesis method is developed to prepare the Li[Ni_0_._5Co_0_._2Mn_0_._3]O_2 (NCM 523) cathode with uniform tungsten-coating layer for lithium-ion battery. Such modified material shows similar properties with the bare NCM 523 in terms of the primary particles, secondary structure, and specific capacity. With W coating layer, the NCM 523 gives remarkable improvement in the long-term capacity retention in the half-cell testing, which is sharply inconsistent with the result from the full-battery tests, indicating a contradiction between the half-cell and full-battery tests in some case. After further investigations, such conflict between the half-cell and full-cell tests in evaluating the W-coating strategy is attributed to the dissolution of Li_2WO_4 layer in the electrolyte, which probably destroys the solid electrolyte interface (SEI) on the graphite anode and irreversibly consumes the active lithium ions for renovating SEI in full-cell testing. These results will benefit researchers in the area of lithium-ion batteries to fully understand the differences between the half-cell and full-cell testing, and develop the effective strategies for cathode modifications.

Chemical-wet Synthesis and Electrochemistry of LiNi1/3Co1/3Mn1/3O2 Cathode Materials for Li-ion Batteries

International Nuclear Information System (INIS)

Hsieh, Chien-Te; Mo, Chung-Yu; Chen, Yu-Fu; Chung, Yi-Jou

2013-01-01

LiNi 1/3 Co 1/3 Mn 1/3 O 2 (LNCM) with a well-ordered layered structure, confirmed by X-ray diffraction, was synthesized by the chemical-wet synthesis incorporated with (i) a pulse microwave-assisted heating of LNCM precursors and (ii) a carbon coating technique. The microwave irradiation periods (i.e., 5–20 min) and amount of carbon additive (i.e., glucose content: 0.1–0.75%) served as key factors in modifying as-prepared LNCM powders. The electrochemical performance of as-prepared LNCM cathodes was well characterized by cyclic voltammetry and charge–discharge cycling at 0.1–5C. Both appropriate microwave heating and carbon coating significantly improve discharge capacity, rate capability, and cycling stability of LNCM cathodes. This improved performance can be attributed to the facts that an appropriate microwave heating of LNCM precursors induces low cation mixing of the layered lattices and the carbon coating enables the creation of outer circuit of charge-transfer pathway, preventing cathode corrosion from direct contact to the electrolyte. The C-coated LNCM cathode shows the increased capacity retention from 70.2 to 93.3% after 50 cycles at 1C. On the basis of the experimental results, both the microwave heating and the carbon coating provide a feasible potential way to improve the electrochemical performance of LNCM cathode, benefiting the development of Li-ion batteries

Pengaruh dan Pertimbangan Faktor Lingkungan untuk Peningkatan Kualitas pada Lini Produksi

Directory of Open Access Journals (Sweden)

H Harisupriyanto

2015-07-01

Full Text Available Pemborosan (waste yang berasal dari proses produksi muncul sebagai indikasi adanya problem dandampak terhadap lingkungan, kesehatan dan keselamatan kerja.Indikasi wastetersebutadalahakibatdaridefect waste di mesin finishing dan waiting waste di mesin mounting. Defect waste yang tinggimengakibatkan Environment, Health and Safety (EHS waste yang tinggi pula. Untuk itu perusahaanharus melakukancontinous process improvement yang terus menerus.Tujuan yang ingin dicapaiadalah identifikasi waste di proses produksi, mencari akar penyebab permasalahan dan memberikanalternatif solusi yang dapat dilakukan perusahaan untuk mengurangi dampak timbulnyawasteIdentifikasi waste dilakukan berdasarkan pada, E-DOWNTIME yakni sembilan jenis waste.Jenis waste ini meliputi Environmental, Safety, and Health (EHS, Defect, OverProduction, Waiting,Not utilizing employee, Transportation, Inventory, Motion, dan Excessive processing waste. Untukmemetakan proses yang mengindikasikan adanya waste (pemborosan, diperlukan value streammapping.Pemetaan tersebut bertujuan untuk mencari critical waste.Berdasarkan pada critical wastemaka dicari akar permasalahan yang dapat dirunut dengan penggunaan RCA (root cause analisys.Untuk mencari prioritas resiko yang paling tinggi terhadap wastediperlukan FMEA (failure mode andeffect analisys. Dengan adanya prioritas tersebut maka alternatif solusi dapat dihasilkan.Alternatifperbaikan yang diusulkan adalah pembentukan timTotal Productive Maintenance, perbaikan kualitasproduk, serta eksperimen terhadap pengurangan pemakaian komponen. Dengan pendekatan valuemanagementmakapembentukan dan pelatihan untuk timTotal Productive Maintenance adalahalternatif terbaiknya. Hasil akhir dari alternatif ini adalah meningkatnya nilai sigmaproduk dari 2,91menjadi 3,08 Kenaikan sigmatersebut memberikan indikator perbaikan pada lini produksi dandampak lingkungan.Kata Kunci: EHS, waste, RCA, FMEA, sigma. Waste that comes from the process of production appears as

`Court-proof` operation of power plants; Der ``gerichtsfeste`` Kraftwerksbetrieb

Energy Technology Data Exchange (ETDEWEB)

Adams, H.W. [Dr. Adams und Partner Unternehmensberatung GmbH, Duisburg (Germany)

1995-09-01

The `court-proof` organisation of a power plant is understood to mean the well-defined, i.e., documented, organisation of its operational structure and work flows. This includes transparent delegation of tasks, competences, and responsibilities to individual officers and down hierarchical lines and mutual agreements on the rules for cooperation between lines and between lines and officers. Such an organisation ensures that responsibilities to give instructions, select personnel, and/or carry out control tasks can be ascertained. (orig./DG) [Deutsch] Die `gerichtsfeste` Organisation ist die festgelegte, das heisst dokumentierte, Aufbau- und Ablauforganisation mit transparenter Delegation von Aufgaben, Kompetenz und Verantwortung in Linie und Beauftragte und Verabreden der Spielregeln des Zusammenwirkens Linie-Linie beziehungsweise Linie-Beauftragte. Sie stellt sicher, dass Anweisungs-, Auswahl- und Ueberwachungspflichten nachgewiesen werden koennen. (orig./DG)

Insights on the fundamental lithium storage behavior of all-solid-state lithium batteries containing the LiNi0.8Co0.15Al0.05O2 cathode and sulfide electrolyte

Science.gov (United States)

Peng, Gang; Yao, Xiayin; Wan, Hongli; Huang, Bingxin; Yin, Jingyun; Ding, Fei; Xu, Xiaoxiong

2016-03-01

An insightful study on the fundamental lithium storage behavior of all-solid-state lithium battery with a structure of LiNi0.8Co0.15Al0.05O2 (NCA)/Li10GeP2S12/Li-In is carried out in this work. The relationship between electrochemical performances and particle size, surface impurities and defects of the NCA positive material is systematically investigated. It is found that a ball-milling technique can decrease the particle size and remove surface impurities of the NCA cathode while also give rise to surface defects which could be recovered by a post-annealing process. The results indicate that the interfacial resistance between the NCA and Li10GeP2S12 is obviously decreased during the ball-milling followed by a post-annealing. Consequently, the discharge capacity of NCA in the NCA/Li10GeP2S12/Li-In solid-state battery is significantly enhanced, which exhibits a discharge capacity of 146 mAh g-1 at 25 °C.

SiO2-coated LiNi0.915Co0.075Al0.01O2 cathode material for rechargeable Li-ion batteries.

Science.gov (United States)

Zhou, Pengfei; Zhang, Zhen; Meng, Huanju; Lu, Yanying; Cao, Jun; Cheng, Fangyi; Tao, Zhanliang; Chen, Jun

2016-11-24

We reported a one-step dry coating of amorphous SiO 2 on spherical Ni-rich layered LiNi 0.915 Co 0.075 Al 0.01 O 2 (NCA) cathode materials. Combined characterization of XRD, EDS mapping, and TEM indicates that a SiO 2 layer with an average thickness of ∼50 nm was uniformly coated on the surface of NCA microspheres, without inducing any change of the phase structure and morphology. Electrochemical tests show that the 0.2 wt% SiO 2 -coated NCA material exhibits enhanced cyclability and rate properties, combining with better thermal stability compared with those of pristine NCA. For example, 0.2 wt% SiO 2 -coated NCA delivers a high specific capacity of 181.3 mA h g -1 with a capacity retention of 90.7% after 50 cycles at 1 C rate and 25 °C. Moreover, the capacity retention of this composite at 60 °C is 12.5% higher than that of pristine NCA at 1 C rate after 50 cycles. The effects of SiO 2 coating on the electrochemical performance of NCA are investigated by EIS, CV, and DSC tests, the improved performance is attributed to the surface coating layer of amorphous SiO 2 , which effectively suppresses side reactions between NCA and electrolytes, decreases the SEI layer resistance, and retards the growth of charge-transfer resistance, thus enhancing structural and cycling stability of NCA.

Effects of Residual Lithium in the precursors of Li[Ni1/3Co1/3Mn1/3]O2 on their lithium-ion battery performance

Science.gov (United States)

Jo, Minsang; Ku, Heesuk; Park, Sanghyuk; Song, Junho; Kwon, Kyungjung

2018-07-01

Li[Ni1/3Co1/3Mn1/3]O2 cathode active materials are synthesized from co-precipitated hydroxide precursors Lix[Ni1/3Co1/3Mn1/3]1-x(OH)2, and the effect of residual Li in the precursors on the lithium-ion battery (LIB) performance of their corresponding cathode active materials is investigated. Three kinds of precursors that contain different amounts of Li are selected depending on different conditions of the solution composition for the co-precipitation and washing process. It is confirmed that the introduction of Li to the precursors reduces the degree of structural perfection by X-ray diffraction analysis. Undesirable cation mixing occurs with the increasing Li content of the precursors, which is inferred from a decline in lattice parameters and the calculated intensity ratio of (003) and (104) peaks. In the voltage range of 3.0-4.3 V, the initial charge/discharge capacities and the rate capability of the cathode active materials are aggravated when Li exists in the precursors. Therefore, it could be concluded that the strict control of Li in a solution for co-precipitation of precursors is necessary in the resynthesis of cathode active materials from spent LIBs.

Protein (Viridiplantae): 356536840 [PGDBj - Ortholog DB

Lifescience Database Archive (English)

Full Text Available 24:2780 3398:2780 71240:414 91827:414 71275:1623 91835:562 72025:981 3803:981 3814:981 163735:1026 3846:1026 3847:1026 PREDICTED: pat...ellin-4-like Glycine max MNNTNECCCNDENGKIVVGVPLVFNFFDKNTNNIEKSLKVQLEKKNQLEDHDCDQEDD

Protein (Viridiplantae): 356543245 [PGDBj - Ortholog DB

Lifescience Database Archive (English)

Full Text Available 24:2780 3398:2780 71240:414 91827:414 71275:1623 91835:562 72025:981 3803:981 3814:981 163735:1026 3846:1026 3847:1026 PREDICTED: pat...ellin-3-like Glycine max MAQNDSNPTPPPEPHVAAEPITEDLVQDKEEEDDSSKIVIPVPESESLSLKEDSNRVS

Protein (Viridiplantae): 356506815 [PGDBj - Ortholog DB

Lifescience Database Archive (English)

Full Text Available 24:2780 3398:2780 71240:414 91827:414 71275:1623 91835:562 72025:981 3803:981 3814:981 163735:1026 3846:1026 3847:1026 PREDICTED: pat...ellin-6-like Glycine max MMDTTSSPLSLQTQKTTFQELPEASPKPYKKGIVATLMGGGLFKEDNYFVSLLRSSEK

Analisis Sistem Antrian di Departemen Washing pada PT Mark Dynamics Indonesia dengan Menggunakan Teknik Simulasi ProModel

OpenAIRE

Limbong, Maraden

2010-01-01

Salah satu proses pada pembuatan cetakan sarung tangan di PT. Mark Dynamics Indonesia yaitu proses pencucian yang dilakukan di departemen Washing. Proses pencucian ini lini produksinya di bagi atas 3 lini dimana jenis ukuran yang harus dikerjakan terdiri dari 3 jenis yaitu small, medium dan large dimana waktu pengerjaannya berbeda-beda. Pada proses ini, tiap lini terdiri dari 20 orang dengan waktu kerja normal selama 400 menit (6,67 jam) per hari dengan persentase input ukuran yang masuk dal...

Reaction Heterogeneity in LiNi _0.8 Co _0.15 Al _0.05 O ₂ Induced by Surface Layer

Energy Technology Data Exchange (ETDEWEB)

Grenier, Antonin [X-ray; Liu, Hao [X-ray; Wiaderek, Kamila M. [X-ray; Lebens-Higgins, Zachary W. [Department; Borkiewicz, Olaf J. [X-ray; Piper, Louis F. J. [Department; Chupas, Peter J. [Energy; Chapman, Karena W. [X-ray

2017-08-15

Through operando synchrotron powder X-ray diffraction (XRD) analysis of layered transition metal oxide electrodes of composition LiNi0.8Co0.15Al0.05O2 (NCA), we decouple the intrinsic bulk reaction mechanism from surface-induced effects. For identically prepared and cycled electrodes stored in different environments, we demonstrate that the intrinsic bulk reaction for pristine NCA follows solid-solution mechanism, not a two-phase as suggested previously. By combining high resolution powder X-ray diffraction, diffuse reflectance infrared Fourier transform spectroscopy (DRIFTS) and surface sensitive X-ray photoelectron spectroscopy (XPS), we demonstrate that adventitious Li2CO3 forms on the electrode particle surface during exposure to air, through reaction with atmospheric CO2. This surface impedes ionic and electronic transport to the underlying electrode, with progressive erosion of this layer during cycling giving rise to different reaction states in particles with an intact vs an eroded Li2CO3 surface-coating. This reaction heterogeneity, with a bimodal distribution of reaction states, has previously been interpreted as a “two-phase” reaction mechanism for NCA, as an activation step that only occurs during the first cycle. Similar surface layers may impact the reaction mechanism observed in other electrode materials using bulk probes such as operando powder XRD.

Optimized structure stability and electrochemical performance of LiNi0.8Co0.15Al0.05O2 by sputtering nanoscale ZnO film

Science.gov (United States)

Lai, Yan-Qing; Xu, Ming; Zhang, Zhi-An; Gao, Chun-Hui; Wang, Peng; Yu, Zi-Yang

2016-03-01

LiNi0.8Co0.15Al0.05O2 (NCA) is one of the most promising cathode material for lithium-ion batteries (LIBs) in electric vehicles, which is successfully adopted in Tesla. However, the dissolution of the cation into the electrolyte is still a one of the major challenges (fading capacity and poor cyclability, etc.) presented in pristine NCA. Herein, a homogeneous nanoscale ZnO film is directly sputtered on the surface of NCA electrode via the magnetron sputtering (MS). This ZnO film is evidenced by scanning electron microscopy (SEM), transmission electron microscopy (TEM) and X-ray photoelectron spectroscopy (XPS). The results clearly demonstrate that ZnO film is fully and uniformly covered on the NCA electrodes. After 90 cycles at 1.0C, the optimized MS-2min coated NCA electrode delivers much higher discharge capacity with 169 mAh g-1 than that of the pristine NCA electrode with 127 mAh g-1. In addition, the discharge capacity also reaches 166 mAh g-1 at 3.0C, as compared to that of 125 mAh g-1 for the pristine electrode. The improved electrochemical performance can be ascribed to the superiority of the MS ZnO film that reduce charge transfer resistance and protect the NCA electrode from cation dissolution.

Aberrant DNA damage response pathways may predict the outcome of platinum chemotherapy in ovarian cancer.

Directory of Open Access Journals (Sweden)

Dimitra T Stefanou

Full Text Available Ovarian carcinoma (OC is the most lethal gynecological malignancy. Despite the advances in the treatment of OC with combinatorial regimens, including surgery and platinum-based chemotherapy, patients generally exhibit poor prognosis due to high chemotherapy resistance. Herein, we tested the hypothesis that DNA damage response (DDR pathways are involved in resistance of OC patients to platinum chemotherapy. Selected DDR signals were evaluated in two human ovarian carcinoma cell lines, one sensitive (A2780 and one resistant (A2780/C30 to platinum treatment as well as in peripheral blood mononuclear cells (PBMCs from OC patients, sensitive (n = 7 or resistant (n = 4 to subsequent chemotherapy. PBMCs from healthy volunteers (n = 9 were studied in parallel. DNA damage was evaluated by immunofluorescence γH2AX staining and comet assay. Higher levels of intrinsic DNA damage were found in A2780 than in A2780/C30 cells. Moreover, the intrinsic DNA damage levels were significantly higher in OC patients relative to healthy volunteers, as well as in platinum-sensitive patients relative to platinum-resistant ones (all P<0.05. Following carboplatin treatment, A2780 cells showed lower DNA repair efficiency than A2780/C30 cells. Also, following carboplatin treatment of PBMCs ex vivo, the DNA repair efficiency was significantly higher in healthy volunteers than in platinum-resistant patients and lowest in platinum-sensitive ones (t1/2 for loss of γH2AX foci: 2.7±0.5h, 8.8±1.9h and 15.4±3.2h, respectively; using comet assay, t1/2 of platinum-induced damage repair: 4.8±1.4h, 12.9±1.9h and 21.4±2.6h, respectively; all P<0.03. Additionally, the carboplatin-induced apoptosis rate was higher in A2780 than in A2780/C30 cells. In PBMCs, apoptosis rates were inversely correlated with DNA repair efficiencies of these cells, being significantly higher in platinum-sensitive than in platinum-resistant patients and lowest in healthy volunteers (all P<0.05. We conclude

Expression of the RNA-binding protein RBM3 is associated with a favourable prognosis and cisplatin sensitivity in epithelial ovarian cancer

LENUS (Irish Health Repository)

Ehlen, Asa

2010-08-20

Abstract Background We recently demonstrated that increased expression of the RNA-binding protein RBM3 is associated with a favourable prognosis in breast cancer. The aim of this study was to examine the prognostic value of RBM3 mRNA and protein expression in epithelial ovarian cancer (EOC) and the cisplatin response upon RBM3 depletion in a cisplatin-sensitive ovarian cancer cell line. Methods RBM3 mRNA expression was analysed in tumors from a cohort of 267 EOC cases (Cohort I) and RBM3 protein expression was analysed using immunohistochemistry (IHC) in an independent cohort of 154 prospectively collected EOC cases (Cohort II). Kaplan Meier analysis and Cox proportional hazards modelling were applied to assess the relationship between RBM3 and recurrence free survival (RFS) and overall survival (OS). Immunoblotting and IHC were used to examine the expression of RBM3 in a cisplatin-resistant ovarian cancer cell line A2780-Cp70 and its cisplatin-responsive parental cell line A2780. The impact of RBM3 on cisplatin response in EOC was assessed using siRNA-mediated silencing of RBM3 in A2780 cells followed by cell viability assay and cell cycle analysis. Results Increased RBM3 mRNA expression was associated with a prolonged RFS (HR = 0.64, 95% CI = 0.47-0.86, p = 0.003) and OS (HR = 0.64, 95% CI = 0.44-0.95, p = 0.024) in Cohort I. Multivariate analysis confirmed that RBM3 mRNA expression was an independent predictor of a prolonged RFS, (HR = 0.61, 95% CI = 0.44-0.84, p = 0.003) and OS (HR = 0.62, 95% CI = 0.41-0.95; p = 0.028) in Cohort I. In Cohort II, RBM3 protein expression was associated with a prolonged OS (HR = 0.53, 95% CI = 0.35-0.79, p = 0.002) confirmed by multivariate analysis (HR = 0.61, 95% CI = 0.40-0.92, p = 0.017). RBM3 mRNA and protein expression levels were significantly higher in the cisplatin sensitive A2780 cell line compared to the cisplatin resistant A2780-Cp70 derivative. siRNA-mediated silencing of RBM3 expression in the A2780 cells resulted

Enhanced Cytotoxicity of Folic Acid-Targeted Liposomes Co-Loaded with C6 Ceramide and Doxorubicin: In Vitro Evaluation on HeLa, A2780-ADR, and H69-AR Cells.

Science.gov (United States)

Sriraman, Shravan Kumar; Pan, Jiayi; Sarisozen, Can; Luther, Ed; Torchilin, Vladimir

2016-02-01

Current research in cancer therapy is beginning to shift toward the use of combinational drug treatment regimens. However, the efficient delivery of drug combinations is governed by a number of complex factors in the clinical setting. Therefore, the ability to synchronize the pharmacokinetics of the individual therapeutic agents present in combination not only to allow for simultaneous tumor accumulation but also to allow for a synergistic relationship at the intracellular level could prove to be advantageous. In this work, we report the development of a novel folic acid-targeted liposomal formulation simultaneously co-loaded with C6 ceramide and doxorubicin [FA-(C6+Dox)-LP]. In vitro cytotoxicity assays showed that the FA-(C6+Dox)-LP was able to significantly reduce the IC50 of Dox when compared to that after the treatment with the doxorubicin-loaded liposomes (Dox-LP) as well as the untargeted drug co-loaded (C6+Dox)-LP on HeLa, A2780-ADR, and H69-AR cells. The analysis of the cell cycle distribution showed that while the C6 liposomes (C6-LP) did not cause cell cycle arrest, all the Dox-containing liposomes mediated cell cycle arrest in HeLa cells in the G2 phase at Dox concentrations of 0.3 and 1 μM and in the S phase at the higher concentrations. It was also found that this arrest in the S phase precedes the progression of the cells to apoptosis. The targeted FA-(C6+Dox)-LP were able to significantly enhance the induction of apoptotic events in HeLa cell monolayers as compared to the other treatment groups. Next, using time-lapse phase holographic imaging microscopy, it was found that upon treatment with the FA-(C6+Dox)-LP, the HeLa cells underwent rapid progression to apoptosis after 21 h as evidenced by a drastic drop in the average area of the cells after loss of cell membrane integrity. Finally, upon evaluation in a HeLa spheroid cell model, treatment with the FA-(C6+Dox)-LP showed significantly higher levels of cell death compared to those with C6-LP and

Discovery of imidazo[1,2- a ]-pyridine inhibitors of pan-PI3 kinases that are efficacious in a mouse xenograft model

Energy Technology Data Exchange (ETDEWEB)

Han, Wooseok; Menezes, Daniel L.; Xu, Yongjin; Knapp, Mark S.; Elling, Robert; Burger, Matthew T.; Ni, Zhi-Jie; Smith, Aaron; Lan, Jiong; Williams, Teresa E.; Verhagen, Joelle; Huh, Kay; Merritt, Hanne; Chan, John; Kaufman, Susan; Voliva, Charles F.; Pecchi, Sabina

2016-02-01

Alterations in PI3K/AKT signaling are known to be implicated with tumorigenesis. The PI3 kinases family of lipid kinases has been an attractive therapeutic target for cancer treatment. Imidazopyridine compound 1, a potent, selective, and orally available pan-PI3K inhibitor, identified by scaffold morphing of a benzothiazole hit, was further optimized in order to achieve efficacy in a PTEN-deleted A2780 ovarian cancer mouse xenograft model. With a hypothesis that a planar conformation between the core and the 6-heteroaryl ring will allow for the accommodation of larger 5'-substituents in a hydrophobic area under P-loop, SAR efforts focused on 5'-alkoxy heteroaryl rings at the 6-position of imidazopyridine and imidazopyridazine cores that have the same dihedral angle of zero degrees. 6'-Alkoxy 5'-aminopyrazines in the imidazopyridine series were identified as the most potent compounds in the A2780 cell line. Compound 14 with 1,1,1-trifluoroisopropoxy group at 6'-position demonstrated excellent potency and selectivity, good oral exposure in rats and in vivo efficacy in A2780 tumor-bearing mouse. Also, we disclose the X-ray co-crystal structure of one enantiomer of compound 14 in PI3Kα, confirming that the trifluoromethyl group fits nicely in the hydrophobic hot spot under P-loop.

Discovery of imidazo[1,2-a]-pyridine inhibitors of pan-PI3 kinases that are efficacious in a mouse xenograft model.

Science.gov (United States)

Han, Wooseok; Menezes, Daniel L; Xu, Yongjin; Knapp, Mark S; Elling, Robert; Burger, Matthew T; Ni, Zhi-Jie; Smith, Aaron; Lan, Jiong; Williams, Teresa E; Verhagen, Joelle; Huh, Kay; Merritt, Hanne; Chan, John; Kaufman, Susan; Voliva, Charles F; Pecchi, Sabina

2016-02-01

Alterations in PI3K/AKT signaling are known to be implicated with tumorigenesis. The PI3 kinases family of lipid kinases has been an attractive therapeutic target for cancer treatment. Imidazopyridine compound 1, a potent, selective, and orally available pan-PI3K inhibitor, identified by scaffold morphing of a benzothiazole hit, was further optimized in order to achieve efficacy in a PTEN-deleted A2780 ovarian cancer mouse xenograft model. With a hypothesis that a planar conformation between the core and the 6-heteroaryl ring will allow for the accommodation of larger 5'-substituents in a hydrophobic area under P-loop, SAR efforts focused on 5'-alkoxy heteroaryl rings at the 6-position of imidazopyridine and imidazopyridazine cores that have the same dihedral angle of zero degrees. 6'-Alkoxy 5'-aminopyrazines in the imidazopyridine series were identified as the most potent compounds in the A2780 cell line. Compound 14 with 1,1,1-trifluoroisopropoxy group at 6'-position demonstrated excellent potency and selectivity, good oral exposure in rats and in vivo efficacy in A2780 tumor-bearing mouse. Also, we disclose the X-ray co-crystal structure of one enantiomer of compound 14 in PI3Kα, confirming that the trifluoromethyl group fits nicely in the hydrophobic hot spot under P-loop. Copyright © 2016 Elsevier Ltd. All rights reserved.

Structural, morphological, impedance and magnetic studies of nanostructured LiNi0.45M0.1Mn0.45O2 (MCu and Al cathode materials for lithium-ion batteries

Directory of Open Access Journals (Sweden)

N. Murali

2017-12-01

Full Text Available Layered structure LiNi0.45M0.1Mn0.45O2 (MCu and Al cathode materials for lithium-ion batteries are synthesized by sol–gel auto combustion method. The structural, morphological, electrical and magnetic properties are examined by X-ray diffraction (XRD, field effect scanning electron microscope FESEM, FT-IR, EIS and ESR. XRD data revealed the rhombohedral and α-NaFeO2 structure with a space group R-3m. The electrical conductivity, dielectric constant, and dielectric loss are measured in the room temperature at a frequency ranging from 20 Hz to 1 MHz. The electrical conductivity of the compound is measured by AC impedance. An effective improvement in the electrical conductivity of order 5.42 × 10−6 S/cm is observed for the copper doped LNMO compounds. ESR spectra is recorded at room temperature on a Bruker EMX model X-band spectrometer operating at a frequency of 9.50 GHz. The critical dopants of Cu, with minimum g-factor and maximum line-width (W are observed. Keywords: Sol–gel, FESEM, AC impedance, ESR

RNA-seq Transcriptome Response of Flax (Linum usitatissimum L.) to the Pathogenic Fungus Fusarium oxysporum f. sp. lini.

Science.gov (United States)

Galindo-González, Leonardo; Deyholos, Michael K

2016-01-01

Fusarium oxysporum f. sp. lini is a hemibiotrophic fungus that causes wilt in flax. Along with rust, fusarium wilt has become an important factor in flax production worldwide. Resistant flax cultivars have been used to manage the disease, but the resistance varies, depending on the interactions between specific cultivars and isolates of the pathogen. This interaction has a strong molecular basis, but no genomic information is available on how the plant responds to attempted infection, to inform breeding programs on potential candidate genes to evaluate or improve resistance across cultivars. In the current study, disease progression in two flax cultivars [Crop Development Center (CDC) Bethune and Lutea], showed earlier disease symptoms and higher susceptibility in the later cultivar. Chitinase gene expression was also divergent and demonstrated and earlier molecular response in Lutea. The most resistant cultivar (CDC Bethune) was used for a full RNA-seq transcriptome study through a time course at 2, 4, 8, and 18 days post-inoculation (DPI). While over 100 genes were significantly differentially expressed at both 4 and 8 DPI, the broadest deployment of plant defense responses was evident at 18 DPI with transcripts of more than 1,000 genes responding to the treatment. These genes evidenced a reception and transduction of pathogen signals, a large transcriptional reprogramming, induction of hormone signaling, activation of pathogenesis-related genes, and changes in secondary metabolism. Among these, several key genes that consistently appear in studies of plant-pathogen interactions, had increased transcript abundance in our study, and constitute suitable candidates for resistance breeding programs. These included: an induced R PMI-induced protein kinase; transcription factors WRKY3, WRKY70, WRKY75, MYB113 , and MYB108 ; the ethylene response factors ERF1 and ERF14 ; two genes involved in auxin/glucosinolate precursor synthesis ( CYP79B2 and CYP79B3 ); the flavonoid

RNA-seq Transcriptome Response of Flax (Linum usitatissimum L. to the Pathogenic Fungus Fusarium oxysporum f. sp. lini.

Directory of Open Access Journals (Sweden)

Leonardo Miguel Galindo-González

2016-11-01

Full Text Available Fusarium oxysporum f. sp. lini is a hemibiotrophic fungus that causes wilt in flax. Along with rust, fusarium wilt has become an important factor in flax production worldwide. Resistant flax cultivars have been used to manage the disease, but the resistance varies, depending on the interactions between specific cultivars and isolates of the pathogen. This interaction has a strong molecular basis, but no genomic information is available on how the plant responds to attempted infection, to inform breeding programs on potential candidate genes to evaluate or improve resistance across cultivars. In the current study, disease progression in two flax cultivars (CDC Bethune and Lutea, showed earlier disease symptoms and higher susceptibility in the later cultivar. Chitinase gene expression was also divergent and demonstrated and earlier molecular response in Lutea. The most resistant cultivar (CDC Bethune was used for a full RNA-seq transcriptome study through a time-course at 2, 4, 8 and 18 days post-inoculation (DPI. While over 100 genes were significantly differentially expressed at both 4 and 8 DPI, the broadest deployment of plant defense responses was evident at 18 DPI with transcripts of more than 1,000 genes responding to the treatment. These genes evidenced a reception and transduction of pathogen signals, a large transcriptional reprogramming, induction of hormone signalling, activation of pathogenesis-related (PR genes, and changes in secondary metabolism. Among these several key genes, that consistently appear in studies of plant-pathogen interactions, had increased transcript abundance in our study, and constitute suitable candidates for resistance breeding programs. These included: an induced RPMI-induced protein kinase (RIPK; transcription factors WRKY3, WRKY70, WRKY75, MYB113 and MYB108; the ethylene response factors ERF1 and ERF14; two genes involved in auxin/glucosinolate precursor synthesis (CYP79B2 and CYP79B3; the flavonoid

Electrochemical performance of all-solid-state lithium secondary batteries with Li-Ni-Co-Mn oxide positive electrodes

International Nuclear Information System (INIS)

Kitaura, Hirokazu; Hayashi, Akitoshi; Tadanaga, Kiyoharu; Tatsumisago, Masahiro

2010-01-01

LiNi 1/3 Co 1/3 Mn 1/3 O 2 was applied as a promising material to the all-solid-state lithium cells using the 80Li 2 S.19P 2 S 5 .1P 2 O 5 (mol%) solid electrolyte. The cell showed the first discharge capacity of 115 mAh g -1 at the current density of 0.064 mA cm -2 and retained the reversible capacity of 110 mAh g -1 after 10 cycles. The interfacial resistance was observed in the impedance spectrum of the all-solid-state cell charged to 4.4 V (vs. Li) and the transition metal elements were detected on the solid electrolyte in the vicinity of LiNi 1/3 Co 1/3 Mn 1/3 O 2 by the TEM observations with EDX analyses. The electrochemical performance was improved by the coating of LiNi 1/3 Co 1/3 Mn 1/3 O 2 particles with Li 4 Ti 5 O 12 film. The interfacial resistance was decreased and the discharge capacity was increased from 63 to 83 mAh g -1 at 1.3 mA cm -2 by the coating. The electrochemical performance of LiNi 1/3 Co 1/3 Mn 1/3 O 2 was compared with that of LiCoO 2 , LiMn 2 O 4 and LiNiO 2 in the all-solid-state cells. The rate capability of LiNi 1/3 Co 1/3 Mn 1/3 O 2 was lower than that of LiCoO 2 . However, the reversible capacity of LiNi 1/3 Co 1/3 Mn 1/3 O 2 at 0.064 mA cm -2 was larger than that of LiCoO 2 , LiMn 2 O 4 and LiNiO 2 .

Interphase evolution at two promising electrode materials for Li-ion batteries: LiFePO4 and LiNi1/2 Mn1/2O2.

Science.gov (United States)

Dupré, Nicolas; Cuisinier, Marine; Martin, Jean-Frederic; Guyomard, Dominique

2014-07-21

The present review reports the characterization and control of interfacial processes occurring on olivine LiFePO(4) and layered LiNi(1/2) Mn(1/2)O(2), standing here as model compounds, during storage and electrochemical cycling. The formation and evolution of the interphase created by decomposition of the electrolyte is investigated by using spectroscopic tools such as magic-angle-spinning nuclear magnetic resonance ((7)Li,(19)F and (31)P) and electron energy loss spectroscopy, in parallel to X-ray photoelectron spectroscopy, to quantitatively describe the interphase and unravel its architecture. The influence of the pristine surface chemistry of the active material is carefully examined. The importance of the chemical history of the surface of the electrode material before any electrochemical cycling and the strong correlation between interface phenomena, the formation/evolution of an interphase, and the electrochemical behavior appear clearly from the use of these combined characterization probes. This approach allows identifying interface aging and failure mechanisms. Different types of surface modifications are then investigated, such as intrinsic modifications upon aging in air or methods based on the use of additives in the electrolyte or carbon coatings on the surface of the active materials. In each case, the species detected on the surface of the materials during storage and cycling are correlated with the electrochemical performance of the modified positive electrodes. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

LiNi1/3Co1/3Mn1/3O2 nanoplates with {010} active planes exposing prepared in polyol medium as a high-performance cathode for Li-ion battery.

Science.gov (United States)

Li, Jili; Yao, Ruimin; Cao, Chuanbao

2014-04-09

As we know, Li(+)-ion transport in layered LiNi1/3Co1/3Mn1/3O2 (NCM) is through two-dimensional channels parallel to the Li(+)-ion layers that are indexed as {010} active planes. In this paper, NCM nanoplates with exposed {010} active facets are synthesized in a polyol medium (ethylene glycol) and characterized by XRD, XPS, SEM, and HR-TEM. In addition, the effects of reaction conditions on the morphologies, structures and electrochemical performances are also evaluated. The results show that more {010} facets can be exposed with the thickness of NCM nanoplates increasing which can lead to more channels for Li(+)-ion migration. However, when the annealing temperatures exceed 900 °C, many new crystal planes grow along the thickness direction covering the {010} facets. In all of the NCM nanoplates obtained at different conditions, the NCM nanoplates calcined at 850 °C for 12 h (NCM-850-12H) display a high initial discharge capacity of 207.6 mAh g(-1) at 0.1 C (1 C = 200 mA g(-1)) between 2.5 and 4.5 V higher than most of NCM materials as cathodes for lithium ion batteries. The discharge capacities of NCM-850-12H are 169.8, 160.5, and 149.3 mAh g(-1) at 2, 5, and 7 C, respectively, illustrating the excellent rate capability. The superior electrochemical performance of NCM-850-12H cathode can be attributed to more {010} active planes exposure.

Was there a volcanic eruption off Vietnam in AD 608?

Science.gov (United States)

Khoo, T. T.

In the Sui-shu (Annals of the Sui Dynasty, 581-618), there is a record that returning envoys of the Chinese court to a state in northeastern Malay peninsula had in April-June AD 608 reached the state of Lin-i where for a whole day's sail the air around the vessel was yellowish and fetid. Lin-i was located at the southern end of the Annam Highlands chain and it is interpreted here that the phenominon reported could be due to a volcanic eruption in the Poulo Cecir-Ile des Cendres-Veteran volcanic islands group near the area. During the months of May to June the winds of the southwest monsoon, too, blow from the volcanic area toward the southern end of the Annam Highlands.

Discovery of dachshund 2 protein as a novel biomarker of poor prognosis in epithelial ovarian cancer

Directory of Open Access Journals (Sweden)

Nodin Björn

2012-01-01

Full Text Available Abstract Background The Dachshund homolog 2 (DACH2 gene has been implicated in development of the female genital tract in mouse models and premature ovarian failure syndrome, but to date, its expression in human normal and cancerous tissue remains unexplored. Using the Human Protein Atlas as a tool for cancer biomarker discovery, DACH2 protein was found to be differentially expressed in epithelial ovarian cancer (EOC. Here, the expression and prognostic significance of DACH2 was further evaluated in ovarian cancer cell lines and human EOC samples. Methods Immunohistochemical expression of DACH2 was examined in tissue microarrays with 143 incident EOC cases from two prospective, population-based cohorts, including a subset of benign-appearing fallopian tubes (n = 32. A nuclear score (NS, i.e. multiplier of staining fraction and intensity, was calculated. For survival analyses, cases were dichotomized into low (NS 3 using classification and regression tree analysis. Kaplan Meier analysis and Cox proportional hazards modelling were used to assess the impact of DACH2 expression on survival. DACH2 expression was analysed in the cisplatin sensitive ovarian cancer cell line A2780 and its cisplatin resistant derivative A2780-Cp70. The specificity of the DACH2 antibody was tested using siRNA-mediated silencing of DACH2 in A2780-Cp70 cells. Results DACH2 expression was considerably higher in the cisplatin resistant A2780-Cp70 cells compared to the cisplatin-sensitive A2780 cells. While present in all sampled fallopian tubes, DACH2 expression ranged from negative to strong in EOC. In EOC, DACH2 expression correlated with several proteins involved in DNA integrity and repair, and proliferation. DACH2 expression was significantly higher in carcinoma of the serous subtype compared to non-serous carcinoma. In the full cohort, high DACH2 expression was significantly associated with poor prognosis in univariable analysis, and in carcinoma of the serous subtype

Electrochemical performance of NCM/LFP/Al composite cathode materials for lithium-ion batteries

Science.gov (United States)

Allahyari, Ehsan; Ghorbanzadeh, Milad; Riahifar, Reza; Hadavi, S. M. M.

2018-05-01

The LiNi0.5Mn0.3Co0.2O2 (NCM) was synthesized via conventional solution combustion synthesis method. Different amounts of LiFePO4 (10, 20 and 30 wt%) were added to NCM via the ball milling technique to improve electrochemical performance including discharge capacity, cycle stability, and rate capability. The LiNi0.5Mn0.3Co0.2O2/LiFePO4 containing 20 wt% LiFePO4 was considered as the optimum composition according to the electrochemical results and SEM images. The Al powder was added to optimum LiNi0.5Mn0.3Co0.2/LiFePO4-0.2 composite through planetary ball mill to enhance the conductivity of LiNi0.5Mn0.3Co0.2O2/LiFePO4-0.2. The LiNi0.5Mn0.3Co0.2O2/LiFePO4-0.2/Al composite cathodes provide better electrochemical performance compared to pure LiNi0.5Mn0.3Co0.2O2 cathodes. The results indicate that by addition of 20 wt% of LiFePO4, the internal resistance of the electrode as well as the charge transfer resistance are reduced. Due to the strong P–O bond of the PO4 in LiFePO4, side reactions between the active electrode and electrolyte is prevented. In addition, according to weakness of the Ionic conductivity in solid electrolyte, in this paper aluminum powders added to the electrode for resolving this problem.

Layered oxides-LiNi1/3Co1/3Mn1/3O2 as anode electrode for symmetric rechargeable lithium-ion batteries

Science.gov (United States)

Wang, Yuesheng; Feng, Zimin; Yang, Shi-Ze; Gagnon, Catherine; Gariépy, Vincent; Laul, Dharminder; Zhu, Wen; Veillette, René; Trudeau, Michel L.; Guerfi, Abdelbast; Zaghib, Karim

2018-02-01

High-performance and long-cycling rechargeable lithium-ion batteries have been in steadily increasing demand for the past decades. Nevertheless, the two dominant anodes at the moment, graphite and L4T5O12, suffer from a safety issue of lithium plating (operating voltage at ∼ 0.1 V vs. Li+/Li) and low capacity (175 mAh/g), respectively. Here, we report LiNi1/3Co1/3Mn1/3O2 as an alternative anode material which has a working voltage of ∼1.1 V and a capacity as high as 330 mAh/g at the current rate of C/15. Symmetric cells with both electrodes containing LiNi1/3Co1/3Mn1/3O2 can deliver average discharge voltage of 2.2 V. In-situ XRD, HRTEM and first principles calculations indicate that the reaction mechanism of a LiNi1/3Co1/3Mn1/3O2 anode is comprised mainly of conversion. Both the fundamental understanding and practical demonstrations suggest that LiNi1/3Co1/3Mn1/3O2 is a promising negative electrode material for lithium-ion batteries.

Enhanced electrochemical performance and thermal stability of LiNi0.80Co0.15Al0.05O2 via nano-sized LiMnPO4 coating

International Nuclear Information System (INIS)

Duan, Jianguo; Wu, Ceng; Cao, Yanbing; Du, Ke; Peng, Zhongdong; Hu, Guorong

2016-01-01

Highlights: • LiMnPO 4 was introduced to modify Ni-rich cathode materials. • LiMnPO 4 uniformly coated NCA composite has been constructed successfully. • Olivine structured skin restrains the formation of residues on NCA during cycling. • LiMnPO 4 improves the structural and thermal stability of NCA@LMP. - Abtract: LiNi 0.80 Co 0.15 Al 0.05 O 2 has been widely pursued as an alternative to LiCoO 2 cathode materials for lithium ion batteries because of its high capacity and acceptable cycling property. However, that NCA can react with commercialized electrolyte during cycling restrains its wide use. Here, olivine structured LiMnPO 4 has been introduced to modify the surface of NCA by a sol-gel method. Characterizations from structure, morphology and composition analysis technologies demonstrate that a LiMnPO 4 layer has been uniformly coated on NCA particles. The electrochemical performance and thermo stability of modified samples are characterized by electrochemical tests, XRD and metallic nail penetration tests. The olivine structured skin, which provides structural and thermal stability, is used to encapsulate the high powered core via using the effective coating technique. The modified material displays a high discharge capacity of 211.0 mAh g −1 at 0.2 C and better rate performance and promoted cycling stability than the uncoated control sample. Furthermore, the thermal stability of coated sample in the delithiated state is upgraded to the pristine powders remarkably.

Bulletin of Materials Science | Indian Academy of Sciences

Indian Academy of Sciences (India)

... synthesized LiNi0.8Co0.2O2 and its performance as cathode in Li-ion cells ... Lithium batteries; intercalation compounds; electrochemical characterization; diffusion ... electron microscopic studies on the as-synthesized LiNi0.8Co0.2O2 sample ... phase transition is further supported by impedance spectroscopy that shows ...

Bio-Catalytic Structural Transformation of Anti-cancer Steroid, Drostanolone Enanthate with Cephalosporium aphidicola and Fusarium lini, and Cytotoxic Potential Evaluation of Its Metabolites against Certain Cancer Cell Lines

Directory of Open Access Journals (Sweden)

M. Iqbal Choudhary

2017-12-01

Full Text Available In search of selective and effective anti-cancer agents, eight metabolites of anti-cancer steroid, drostanolone enanthate (1, were synthesized via microbial biotransformation. Enzymes such as reductase, oxidase, dehydrogenase, and hydrolase from Cephalosporium aphidicola, and Fusarium lini were likely involved in the biotransformation of 1 into new metabolites at pH 7.0 and 26°C, yielding five new metabolites, 2α-methyl-3α,14α,17β-trihydroxy-5α-androstane (2, 2α-methyl-7α-hydroxy-5α-androstan-3,17-dione (3, 2-methylandrosta-11α-hydroxy-1, 4-diene-3,17-dione (6, 2-methylandrosta-14α-hydroxy-1,4-diene-3,17-dione (7, and 2-methyl-5α-androsta-7α-hydroxy-1-ene-3,17-dione (8, along with three known metabolites, 2α-methyl-3α,17β-dihydroxy-5α-androstane (4, 2-methylandrosta-1, 4-diene-3,17-dione (5, and 2α-methyl-5α-androsta-17β-hydroxy-3-one (9, on the basis of NMR, and HREI-MS data, and single-crystal X-ray diffraction techniques. Interestingly, C. aphidicola and F. lini were able to catalyze hydroxylation only at alpha positions of 1. Compounds 1–9 showed a varying degree of cytotoxicity against HeLa (human cervical carcinoma, PC3 (human prostate carcinoma, H460 (human lung cancer, and HCT116 (human colon cancer cancer cell lines. Interestingly, metabolites 4 (IC50 = 49.5 ± 2.2 μM, 5 (IC50 = 39.8 ± 1.5 μM, 6 (IC50 = 40.7 ± 0.9 μM, 7 (IC50 = 43.9 ± 2.4 μM, 8 (IC50 = 19.6 ± 1.4 μM, and 9 (IC50 = 25.1 ± 1.6 μM were found to be more active against HeLa cancer cell line than the substrate 1 (IC50 = 54.7 ± 1.6 μM. Similarly, metabolites 2 (IC50 = 84.6 ± 6.4 μM, 3 (IC50 = 68.1 ± 1.2 μM, 4 (IC50 = 60.4 ± 0.9 μM, 5 (IC50 = 84.0 ± 3.1 μM, 6 (IC50 = 58.4 ± 1.6 μM, 7 (IC50 = 59.1 ± 2.6 μM, 8 (IC50 = 51.8 ± 3.4 μM, and 9 (IC50 = 57.8 ± 3.2 μM were identified as more active against PC-3 cancer cell line than the substrate 1 (IC50 = 96.2 ± 3.0 μM. Metabolite 9 (IC50 = 2.8 ± 0.2 μM also showed potent anticancer

Improving the Electrochemical Performance of LiNi0.80Co0.15Al0.05O2 in Lithium Ion Batteries by LiAlO2 Surface Modification

Directory of Open Access Journals (Sweden)

Chunhua Song

2018-03-01

Full Text Available LiNi0.80Co0.15Al0.05O2 (NCA as a lithium ion battery cathode material has received attention for its highly specific capacity and excellent low temperature performance. However, the disadvantages of its high surface lithium compound residues and high pH value have influenced its processing performance and limited its application. This paper uses a facile method to modify NCA through LiAlO2 coating. The results showed that when the molar ratio of Al(NO33·9H2O and lithium compound residues at the surface of NCA cathode material was 0.25:1, the pH of the cathode material decreased from 12.70 to 11.80 and the surface lithium compound residues decreased from 3.99% to 1.48%. The NCA cell was charged and discharged for 100 cycles at 1 C in the voltage range of 3.0–4.3 V, to test the capacity retention of NCA. It was found to be as high as 94.67%, which was 5.36% higher than the control NCA cell. The discharge capacity of NCA-0.25-500 °C was 139.8 mAh/g even at 8 C rate, which was 15% higher than the raw NCA. Further research indicated that Al(NO33·9H2O reacted with the surface lithium compound residues of NCA and generated LiAlO2, which improved the NCA electrochemical performance.

Mechanistic Insight in the Function of Phosphite Additives for Protection of LiNi0.5Co0.2Mn0.3O2 Cathode in High Voltage Li-Ion Cells.

Science.gov (United States)

He, Meinan; Su, Chi-Cheung; Peebles, Cameron; Feng, Zhenxing; Connell, Justin G; Liao, Chen; Wang, Yan; Shkrob, Ilya A; Zhang, Zhengcheng

2016-05-11

Triethlylphosphite (TEP) and tris(2,2,2-trifluoroethyl) phosphite (TTFP) have been evaluated as electrolyte additives for high-voltage Li-ion battery cells using a Ni-rich layered cathode material LiNi0.5Co0.2Mn0.3O2 (NCM523) and the conventional carbonate electrolyte. The repeated charge/discharge cycling for cells containing 1 wt % of these additives was performed using an NCM523/graphite full cell operated at the voltage window from 3.0-4.6 V. During the initial charge process, these additives decompose on the cathode surface at a lower oxidation potential than the baseline electrolyte. Impedance spectroscopy and post-test analyses indicate the formation of protective coatings by both additives on the cathode surface that prevent oxidative breakdown of the electrolyte. However, only TTFP containing cells demonstrate the improved capacity retention and Coulombic efficiency. For TEP, the protective coating is also formed, but low Li(+) ion mobility through the interphase layer results in inferior performance. These observations are rationalized through the inhibition of electrocatalytic centers present on the cathode surface and the formation of organophosphate deposits isolating the cathode surface from the electrolyte. The difference between the two phosphites clearly originates in the different properties of the resulting phosphate coatings, which may be in Li(+) ion conductivity through such materials.

The effect of gradient boracic polyanion-doping on structure, morphology, and cycling performance of Ni-rich LiNi0.8Co0.15Al0.05O2 cathode material

Science.gov (United States)

Chen, Tao; Li, Xiang; Wang, Hao; Yan, Xinxiu; Wang, Lei; Deng, Bangwei; Ge, Wujie; Qu, Meizhen

2018-01-01

A gradient boracic polyanion-doping method is applied to Ni-rich LiNi0.8Co0.15Al0.05O2 (NCA) cathode material in this study to suppress the capacity/potential fade during charge-discharge cycling. Scanning electron microscope (SEM) results show that all samples present spherical morphology and the secondary particle size increases with increasing boron content. X-ray diffraction (XRD), transmission electron microscopy (TEM), and X-ray photoelectron spectroscopy (XPS) results demonstrate that boracic polyanions are successfully introduced into the bulk material and more enriched in the outer layer. XPS analysis further reveals that the valence state of Ni3+ is partly reduced to Ni2+ at the surface due to the incorporation of boracic polyanions. From the electrochemical measurements, B0.015-NCA electrode exhibits excellent cycling performance, even at high potential and elevated temperature. Moreover, the SEM images illustrate the presence of cracks and a thick SEI layer on pristine particles after 100 cycles at high temperature, while the B0.015-NCA particles show an intact structure and thin SEI layer. Electrochemical impedance spectroscopy confirms that the boracic polyanion doping could hinder the impedance increase during cycling at elevated temperature. These results clearly indicate that the gradient boracic polyanion-doping contributes to the remarkable enhancement of structure stability and cycling performance of NCA.

BRCA1 Expression is an Important Biomarker for Chemosensitivity: Suppression of BRCA1 Increases the Apoptosis via Up-regulation of p53 and p21 During Cisplatin Treatment in Ovarian Cancer Cells

Directory of Open Access Journals (Sweden)

Ikuo Konishi

2006-01-01

Full Text Available BRCA1 is a tumor suppressor which plays a crucial role in the repair of DNA double-strand breaks, and its abnormality is responsible for hereditary ovarian cancer syndrome. It has recently been reported that reduced expression of BRCA1 is also common in sporadic ovarian carcinoma via its promoter hypermethylation, and that ovarian carcinoma patients negative for BRCA1 expression showed favorable prognosis. To address if BRCA1 expression plays a role in the chemotherapeutic response, we analyzed the effect of BRCA1 suppression on the sensitivity to cisplatin and paclitaxel in ovarian cancer cells. Specific siRNA for BRCA1 gene was transfected into 3 ovarian cancer cell lines with various p53 status. Reduced expression of BRCA1 by transfection of BRCA1-siRNA resulted in a 5.3-fold increase in sensitivity to cisplatin in p53-wild A2780 cells, but not in p53-mutated A2780/CDDP and p53-deleted SKOV3 cells. Regarding the sensitivity to paclitaxel, BRCA1 suppression caused no significant changes in all the 3 cell lines. For ionizing radiation sensitivity, BRCA1 suppression also showed a significant higher sensitivity in A2780 cells. Growth curve and cell cycle analyses showed no signifi cant differences between BRCA1-siRNA-transfected A2780 cells and control cells. However, cisplatin treatment under suppression of BRCA1 showed a significantly increased apoptosis along with up-regulation of p53 and p21 in A2780 cells. Accordingly, reduced expression of BRCA1 enhances the cisplatin sensitivity and apoptosis via up-regulation of p53 and p21, but does not affect the paclitaxel sensitivity. Expression of BRCA1 might be an important biomarker for cisplatin resistance in ovarian carcinoma.

Exosomes as mediators of platinum resistance in ovarian cancer.

Science.gov (United States)

Crow, Jennifer; Atay, Safinur; Banskota, Samagya; Artale, Brittany; Schmitt, Sarah; Godwin, Andrew K

2017-02-14

Exosomes have been implicated in the cell-cell transfer of oncogenic proteins and genetic material. We speculated this may be one mechanism by which an intrinsically platinum-resistant population of epithelial ovarian cancer (EOC) cells imparts its influence on surrounding tumor cells. To explore this possibility we utilized a platinum-sensitive cell line, A2780 and exosomes derived from its resistant subclones, and an unselected, platinum-resistant EOC line, OVCAR10. A2780 cells demonstrate a ~2-fold increase in viability upon treatment with carboplatin when pre-exposed to exosomes from platinum-resistant cells as compared to controls. This coincided with increased epithelial to mesenchymal transition (EMT). DNA sequencing of EOC cell lines revealed previously unreported somatic mutations in the Mothers Against Decapentaplegic Homolog 4 (SMAD4) within platinum-resistant cells. A2780 cells engineered to exogenously express these SMAD4 mutations demonstrate up-regulation of EMT markers following carboplatin treatment, are more resistant to carboplatin, and release exosomes which impart a ~1.7-fold increase in resistance in naive A2780 recipient cells as compared to controls. These studies provide the first evidence that acquired SMAD4 mutations enhance the chemo-resistance profile of EOC and present a novel mechanism in which exchange of tumor-derived exosomes perpetuates an EMT phenotype, leading to the development of subpopulations of platinum-refractory cells.

Near East/South Asia Report, No. 2780.

Science.gov (United States)

1983-07-08

special occasions, festivals and holidays. The Majority and Cheap Meat Several meters from the Governorate of Giza , at a government-run consumer store...are distributed in a single shipment. Muhammad ’Abd-al-Hakim, the owner of a farm near the pyramids said, "Fodder allotments are sufficient for all

Enthalpies of formation of layered LiNixMnxCo1-2xO2 (0 ≤ x ≤ 0.5) compounds as lithium ion battery cathode materials

International Nuclear Information System (INIS)

Masoumi, Maryam; Cupid, Damian M.; Reichmann, Thomas L.; Seifert, Hans J.; Chang, Keke; Music, Denis; Schneider, Jochen M.

2017-01-01

Layer-structured mixed transition metal oxides with the formula LiNi x Mn x Co 1-2x O 2 (0 ≤ x ≤ 0.5) are considered as important cathode materials for lithium-ion batteries. In an effort to evaluate the relative thermodynamic stabilities of individual compositions in this series, the enthalpies of formation of selected stoichiometries are determined by high temperature oxide melt drop solution calorimetry and verified by ab-initio calculations. The measured and calculated data are in good agreement with each other, and the results show that LiCoO 2 -LiNi 0.5 Mn 0.5 O 2 solid solution approaches ideal behavior. By increasing x, i.e. by equimolar substitution of Mn 4+ and Ni 2+ for Co 3+ , the enthalpy of formation of LiNi x Mn x Co 1-2x O 2 from the elements becomes more exothermic, implying increased energetic stability. This conclusion is in agreement with the literature results showing improved structural stability and cycling performance of Ni/Mn-rich LiNi x Mn x Co 1-2x O 2 compounds cycled to higher cut-off voltages.

PENGUKURAN NILAI OVERALL EQUIPMENT EFFECTIVENESS SEBAGAI DASAR USAHA PERBAIKAN PROSES MANUFAKTUR PADA LINI PRODUKSI (Studi Kasus pada Stamping Production Division Sebuah Industri Otomotif

Directory of Open Access Journals (Sweden)

Robby Suhendra

2005-01-01

satu lini produksi dalam satu periode dan melalui analisis pareto terhadap hasil pengukuran tersebut diperoleh akar permasalahan dan faktor penyebabnya yang secara jelas ditampilkan pada sebuah diagram sebab-akibat. Kata kunci: pengukuran kinerja peralatan, regresi berganda dan analisa korelasi, industri otomotif, peralatan pabrik.

Enhanced electrochemical performance of LiNi_0_._8Co_0_._1_5Al_0_._0_5O_2 by nanoscale surface modification with Co_3O_4

International Nuclear Information System (INIS)

Huang, Yaqun; Huang, Yunhui; Hu, Xianluo

2017-01-01

Highlights: • Facile coating method to prepare Co_3O_4-modified NCA. • Co_3O_4 is uniformly coated on the surface of NCA. • The nanolayer coating protects the surface of NCA during Li cycling. • Co_3O_4-modified NCA exhibits enhanced cyclability and rate capability. - Abstract: LiNi_0_._8Co_0_._1_5Al_0_._0_5O_2 (NCA) has attracted much attention because of its high capacity and low cost. Herein, we report a facile wet-chemical route to prepare a Co_3O_4-modified NCA cathode material with enhanced electrochemical performance for lithium-ion batteries. The as-prepared Co_3O_4-coated NCA cathode material delivers a specific capacity of 207.6 mAh g"−"1 with an initial Coulombic efficiency of 90.8% at 0.1 C. The capacity retention of the Co_3O_4-coated NCA cathode material is as high as 91.6% at 1 C between the potential from 2.8 to 4.3 V after 100 cycles. More importantly, the capacity retention of the resulting Co_3O_4-coated NCA is higher than 94.7% after 100 cycles at 0.2 C. In addition, the Co_3O_4-coated NCA cathode material exhibits good rate capability, especially a high discharge capacity at a high current density. The outstanding electrochemical performance of Co_3O_4-coated NCA is assigned to the surface coating of Co_3O_4 that may react with lithium-containing impurities on the surface and decrease the charge-transfer resistance.

The LiyNi0.2Mn0.2Co0.6O2 electrode materials: A structural and magnetic study

International Nuclear Information System (INIS)

Labrini, Mohamed; Saadoune, Ismael; Almaggoussi, Abdelmajid; Elhaskouri, Jamal; Amoros, Pedro

2012-01-01

Graphical abstract: EPR signal of the Li 0.6 Co 0.6 Ni 0.2 Mn 0.2 O 2 composition showing that Mn 4+ ions are the solely paramagnetic ions in the structure. Highlights: ► LiCo 0.6 Ni 0.2 Mn 0.2 O 2 was prepared by the combustion method with sucrose as a fuel. ► Chemical delithiaition was performed by using NO 2 BF 4 oxidizing agent. ► The rhombohedral symmetry was preserved upon lithium removal. ► Lithium extraction leads to Ni 2+ oxidation to Ni 4+ followed by Co 3+ oxidation. ► The EPR narrow signal of Li 0.6 Co 0.6 Ni 0.2 Mn 0.2 O 2 is due to the only active Mn 4+ ions. -- Abstract: Layered LiNi 0.2 Mn 0.2 Co 0.6 O 2 phase, belonging to a solid solution between LiNi 1/2 Mn 1/2 O 2 and LiCoO 2 most commercialized cathodes, was prepared via the combustion method at 900 °C for a short time (1 h). Structural and magnetic properties of this material during chemical extraction were investigated. The powders adopted the α-NaFeO 2 structure with almost none of the well-known Li/Ni cation disorder. The analysis of the magnetic properties in the paramagnetic domain agrees with the combination of Ni 2+ (S = 1), Co 3+ (S = 0) and Mn 4+ (S = 3/2) spin-only values. X-ray analysis of the chemically delithiated Li y Ni 0.2 Mn 0.2 Co 0.6 O 2 reveals no structural transition. The process of lithium extraction from and insertion into LiNi 0.2 Mn 0.2 Co 0.6 O 2 was discussed on the basis of ex situ EPR experiments and magnetic susceptibility. Oxidation of Ni 2+ (S = 1) to Ni 3+ (S = 1/2) and to Ni 4+ (S = 0) was observed upon lithium removal.

Directory of Polish Officials: A Reference Aid

Science.gov (United States)

1989-04-01

Jan 86 Deputy Director Mondalski, Janusz Aug 83 Polish Steamship Company (Polski Zegluga Morska ) (PZM) Director Andruczyk, Mieczyslaw Jan...2<> Polski Kosciol Chrzescijan Baptystow 12° Polski Linie Oceaniczne ’"- Polski Towarzystwo Ekonomiczne ’’° Polski Zegluga Morska 102 Polski

Atomic Layer Deposition of Al2O3-Ga2O3 Alloy Coatings for Li[Ni0.5Mn0.3Co0.2]O2 Cathode to Improve Rate Performance in Li-Ion Battery.

Science.gov (United States)

Laskar, Masihhur R; Jackson, David H K; Guan, Yingxin; Xu, Shenzhen; Fang, Shuyu; Dreibelbis, Mark; Mahanthappa, Mahesh K; Morgan, Dane; Hamers, Robert J; Kuech, Thomas F

2016-04-27

Metal oxide coatings can improve the electrochemical stability of cathodes and hence, their cycle-life in rechargeable batteries. However, such coatings often impose an additional electrical and ionic transport resistance to cathode surfaces leading to poor charge-discharge capacity at high C-rates. Here, a mixed oxide (Al2O3)1-x(Ga2O3)x alloy coating, prepared via atomic layer deposition (ALD), on Li[Ni0.5Mn0.3Co0.2]O2 (NMC) cathodes is developed that has increased electron conductivity and demonstrated an improved rate performance in comparison to uncoated NMC. A "co-pulsing" ALD technique was used which allows intimate and controlled ternary mixing of deposited film to obtain nanometer-thick mixed oxide coatings. Co-pulsing allows for independent control over film composition and thickness in contrast to separate sequential pulsing of the metal sources. (Al2O3)1-x(Ga2O3)x alloy coatings were demonstrated to improve the cycle life of the battery. Cycle tests show that increasing Al-content in alloy coatings increases capacity retention; whereas a mixture of compositions near (Al2O3)0.5(Ga2O3)0.5 was found to produce the optimal rate performance.

Two new ortho benzoquinones from Uncaria rhynchophylla.

Science.gov (United States)

Zhang, Qian; Chen, Lei; Hu, Le-Jian; Liu, Wen-Yuan; Feng, Feng; Qu, Wei

2016-03-01

The present study was designed to determine the chemical constituents of the stems and hooks of Uncaria rhynchophylla. The chemical constituents were isolated and purified from CH2Cl2 fraction by chromatography. Their structures were elucidated by spectroscopic analyses. Their cytotoxicity was tested using MTT method. Two new ortho benzoquinones, 3-diethylamino-5-methoxy-1, 2-benzoquinone (1) and 3-ethylamino-5-methoxy-1, 2-benzoquinone (2), together with a known compound isorhynchophyllic acid (3) were isolated from U. rhynchophylla. These compounds were evaluated for their cytotoxicity against cancer cells A549, HepG2 and A2780. Compounds 1 and 2 were new ortho benzoquinones and showed weak antiproliferative activities on A549, HepG2 and A2780 cells. Compound 3 significantly inhibited the proliferation of A549, HepG2 and A2780 cells with IC50 values being 5.8, 12.8 and 11.8 µmol·L(-1), respectively. Copyright © 2016 China Pharmaceutical University. Published by Elsevier B.V. All rights reserved.

Synthesis, crystal structure and anticancer activity of tetrakis(N-isopropylimidazolidine-2-selenone)platinum(II) chloride

Science.gov (United States)

Ahmad, Saeed; Altoum, Ali Osman S.; Vančo, Ján; Křikavová, Radka; Trávníček, Zdeněk; Dvořák, Zdeněk; Altaf, Muhammad; Sohail, Manzar; Isab, Anvarhusein A.

2018-01-01

A Platinum(II) complex of N-isopropylimidazolidine-2-selenone (i-PrImSe), [Pt(i-PrImSe)4]Cl2 (1) was prepared and characterized by elemental analysis, IR and NMR (1H, 13C, 77Se &195Pt) spectroscopy, and X-ray crystallography. The structure of 1 consists of [Pt(i-PrImSe)4]2+ complex ion and chloride counter ions. The platinum(II) atom adopts a distorted square planar geometry. The in vitro antitumor activity of 1 as well as cisplatin, was evaluated by MTT assay against human; ovarian carcinoma A2780 and its cisplatin-resistant subline A2780R, prostate cancer 22Rv1 and breast cancer MCF-7 cell lines. The title complex displayed the activity against the A2780 cells (IC50 = 30.8 μM) at the level comparable to cisplatin (IC50 = 26.8 μM). The interaction studies with sulfur-containing biomolecules revealed its ability to form a variety of intermediates and oxidized species with L-cysteine and reduced glutathione.

Synthesis of LiNixFe1−xPO4 solid solution as cathode materials for lithium ion batteries

International Nuclear Information System (INIS)

Qing, Rui; Yang, Ming-Che; Meng, Ying Shirley; Sigmund, Wolfgang

2013-01-01

Highlights: • Phase pure LiNi x Fe 1−x PO 4 and LiNi x Fe 1−x PO 4 /C nanocomposites were obtained via a solid state reaction method. • Crystallite sizes were around 50 nm. Linear relationship was observed between lattice parameters and chemical composition. • Synthesized materials displayed electronic conductivity similar to reported value of LiFePO 4 . Carbon coating increased the conductivity to ∼10 −3 S/cm. • Chemical delithiation via NO 2 BF 4 extracted more than 90% of lithium from the nanocomposites, proving that Ni 2+ /Ni 3+ redox couple was activated. -- Abstract: Nanosize LiNi x Fe 1−x PO 4 solid solution and LiNi x Fe 1−x PO 4 /C nanocomposites were prepared via a solid state reaction method under argon atmosphere. A single phase olivine-type structure with Pnma space group was determined by X-ray diffraction. Crystallite sizes were found to be around 50 nm. A linear relationship was observed between lattice parameters and chemical composition which follows Vegard's law. Synthesized materials displayed electronic conductivity similar to previous reported values of LiFePO 4 . Carbon coating further increased the overall conductivity of nanocomposites to the order of 10 −3 S/cm. Chemical delithiation via NO 2 BF 4 oxidant extracted more than 95% of lithium from the solid solution material accompanied by a decrease in lattice parameters

Nasicon-Type Surface Functional Modification in Core-Shell LiNi0.5Mn0.3Co0.2O2@NaTi2(PO4)3 Cathode Enhances Its High-Voltage Cycling Stability and Rate Capacity toward Li-Ion Batteries.

Science.gov (United States)

Liang, Longwei; Sun, Xuan; Wu, Chen; Hou, Linrui; Sun, Jinfeng; Zhang, Xiaogang; Yuan, Changzhou

2018-02-14

Surface modifications are established well as efficient methodologies to enhance comprehensive Li-storage behaviors of the cathodes and play a significant role in cutting edge innovations toward lithium-ion batteries (LIBs). Herein, we first logically devised a pilot-scale coating strategy to integrate solid-state electrolyte NaTi 2 (PO 4 ) 3 (NTP) and layered LiNi 0.5 Mn 0.3 Co 0.2 O 2 (NMC) for smart construction of core-shell NMC@NTP cathodes. The Nasicon-type NTP nanoshell with exceptional ion conductivity effectively suppressed gradual encroachment and/or loss of electroactive NMC, guaranteed stable phase interfaces, and meanwhile rendered small sur-/interfacial electron/ion-diffusion resistance. By benefiting from immanently promoting contributions of the nano-NTP coating, the as-fabricated core-shell NMC@NTP architectures were competitively endowed with superior high-voltage cyclic stabilities and rate capacities within larger electrochemical window from 3.0 to 4.6 V when utilized as advanced cathodes for advanced LIBs. More meaningfully, the appealing electrode design concept proposed here will exert significant impact upon further constructing other high-voltage Ni-based cathodes for high-energy/power LIBs.

Mechanisms responsible for two possible electrochemical reactions in Li1.2Ni0.13Mn0.54Co0.13O2 used for lithium ion batteries

Science.gov (United States)

Konishi, Hiroaki; Hirano, Tatsumi; Takamatsu, Daiko; Gunji, Akira; Feng, Xiaoliang; Furutsuki, Sho; Okumura, Takefumi; Terada, Shohei; Tamura, Kazuhisa

2018-02-01

Two electrochemical reactions are possible in regard to Li1.2Ni0.13Mn0.54Co0.13O2 (0.5Li2MnO3-0.5LiNi0.33Mn0.33Co0.33O2), viz, Li2MnO3-like and LiNi0.33Mn0.33Co0.33O2-like reactions. The open circuit potential (OCP) and changes in crystal structure during the charge-discharge process of Li1.2Ni0.13Mn0.54Co0.13O2 were investigated to clarify the mechanism responsible for the two reactions. Li2MnO3 and LiNi0.33Mn0.33Co0.33O2 were separately prepared for the investigation, and the OCPs and crystal structures in these cathodes were measured and then compared with those for Li1.2Ni0.13Mn0.54Co0.13O2. The results obtained using X-ray diffraction (XRD) indicated that two phases existed in Li1.2Ni0.13Mn0.54Co0.13O2. The changes in crystal structure of the two phases during the charge-discharge process were similar to those in Li2MnO3 and LiNi0.33Mn0.33Co0.33O2. This indicated that two phases, viz, Li2MnO3-like and LiNi0.33Mn0.33Co0.33O2-like, existed in Li1.2Ni0.13Mn0.54Co0.13O2. Li2MnO3-like, LiNi0.33Mn0.33Co0.33O2-like, and Li2MnO3-like phases were found to contribute mainly to electrochemical reactions in the low, middle, and high state of charge (SOC) ranges during the charge process from the results obtained using XRD and electrochemical measurements carried out on Li1.2Ni0.13Mn0.54Co0.13O2. In contrast, the Li2MnO3-like and LiNi0.33Mn0.33Co0.33O2-like phases mainly contributed to electrochemical reactions in the low and high SOC ranges during the discharge process. Furthermore, the high polarization and potential decay during the charge-discharge cycling of Li1.2Ni0.13Mn0.54Co0.13O2 were mainly attributed to the Li2MnO3-like phase.

Control of electrochemical properties of nickel-rich layered cathode materials for lithium ion batteries by variation of the manganese to cobalt ratio

Science.gov (United States)

Sun, Ho-Hyun; Choi, Wonchang; Lee, Joong Kee; Oh, In-Hwan; Jung, Hun-Gi

2015-02-01

Various Ni-rich layered oxide cathodes (above 0.80 Ni content), such as LiNi1-y-zCoyAlzO2 (NCA), are used in electric vehicles (EVs) due to their high capacity (∼200 mAh g-1 for NCA). However, to improve cycle performance and thermal stability and to ensure longer and safer usage, numerous studies have investigated surface modification, coating, and doping of cathode materials. In this study, we have investigated the characteristics of Li[Ni0.85CoxMn0.15-x]O2 with various Mn to Co ratios (x = 0-0.15) synthesized by a coprecipitation method. The discharge capacities of the Li[Ni0.85CoxMn0.15-x]O2 cathodes are similar at around 206 mAh g-1 at room temperature and 213.8 mAh g-1 at 55 °C between 2.7 and 4.3 V at a 0.2C rate, while the cyclability, thermal stability, and rate capability of all samples differ according to the Mn and Co ratio. The Li[Ni0.85Co0.05Mn0.10]O2 cathode shows the most promising electrochemical properties under different conditions among the various cathodes evaluated; it displays a high rate capacity (approximately 163 mAh g-1 at 5C rate) at 25 °C and good thermal stability (main exothermic temperature of 233.7 °C and relatively low heat evolution of 857.3 J g-1).

Tris(trimethylsilyl)phosphate as electrolyte additive for self-discharge suppression of layered nickel cobalt manganese oxide

International Nuclear Information System (INIS)

Liao, Xiaolin; Zheng, Xiongwen; Chen, Jiawei; Huang, Ziyu; Xu, Mengqing; Xing, Lidan; Liao, Youhao; Lu, Qilun; Li, Xiangfeng; Li, Weishan

2016-01-01

Highlights: • TMSP is effective for self-discharge suppression of the charged NCM under 4.5 V. • TMSP oxidizes preferentially forming protective cathode interface film on NCM. • The film suppresses electrolyte decomposition and prevents NCM destruction. - Abstract: Application of layered nickel cobalt manganese oxide as cathode under higher potential than conventional 4.2 V yields a significant improvement in energy density of lithium ion battery. However, the cathode fully charged under high potential suffers serious self-discharge, in which the interaction between the cathode and electrolyte proceeds without potential limitation. In this work, we use tris(trimethylsilyl)phosphate (TMSP) as an electrolyte additive to solve this problem. A representative layered nickel cobalt manganese oxide, LiNi 1/3 Co 1/3 Mn 1/3 O 2 , is considered. The effect of TMSP on self-discharge behavior of LiNi 1/3 Co 1/3 Mn 1/3 O 2 is evaluated by physical and electrochemical methods. It is found that the self-discharge of charged LiNi 1/3 Co 1/3 Mn 1/3 O 2 can be suppressed significantly by using TMSP. TMSP is oxidized preferentially in comparison with the standard electrolyte during initial charging process forming a protective cathode interface film, which avoids the interaction between cathode and electrolyte at any potential and thus prevents electrolyte decomposition and protects LiNi 1/3 Co 1/3 Mn 1/3 O 2 from structure destruction.

Metabolomic Profiling of the Effects of Melittin on Cisplatin Resistant and Cisplatin Sensitive Ovarian Cancer Cells Using Mass Spectrometry and Biolog Microarray Technology

Directory of Open Access Journals (Sweden)

Sanad Alonezi

2016-10-01

Full Text Available In the present study, liquid chromatography-mass spectrometry (LC-MS was employed to characterise the metabolic profiles of two human ovarian cancer cell lines A2780 (cisplatin-sensitive and A2780CR (cisplatin-resistant in response to their exposure to melittin, a cytotoxic peptide from bee venom. In addition, the metabolomics data were supported by application of Biolog microarray technology to examine the utilisation of carbon sources by the two cell lines. Data extraction with MZmine 2.14 and database searching were applied to provide metabolite lists. Principal component analysis (PCA gave clear separation between the cisplatin-sensitive and resistant strains and their respective controls. The cisplatin-resistant cells were slightly more sensitive to melittin than the sensitive cells with IC50 values of 4.5 and 6.8 μg/mL respectively, although the latter cell line exhibited the greatest metabolic perturbation upon treatment. The changes induced by melittin in the cisplatin-sensitive cells led mostly to reduced levels of amino acids in the proline/glutamine/arginine pathway, as well as to decreased levels of carnitines, polyamines, adenosine triphosphate (ATP and nicotinamide adenine dinucleotide (NAD+. The effects on energy metabolism were supported by the data from the Biolog assays. The lipid compositions of the two cell lines were quite different with the A2780 cells having higher levels of several ether lipids than the A2780CR cells. Melittin also had some effect on the lipid composition of the cells. Overall, this study suggests that melittin might have some potential as an adjuvant therapy in cancer treatment.

Connectivity dynamics since the Last Glacial Maximum in the northern Andes: a pollen-driven framework to assess potential migration

NARCIS (Netherlands)

Flantua, S.G.A.; Hooghiemstra, H.; van Boxel, J.H.; Cabrera, M.; González-Carranza, Z.; González-Arango, C.; Stevens, W.D.; Montiel, O.M.; Raven, P.H.

2014-01-01

We provide an innovative pollen-driven connectivity framework of the dynamic altitudinal distribution of North Andean biomes since the Last Glacial Maximum (LGM). Altitudinally changing biome distributions reconstructed from a pollen record from Lake La Cocha (2780 m) are assessed in terms of their

Selenium in bread and durum wheats grown under a soil-supplementation regime in actual field conditions, determined by cyclic and radiochemical neutron activation analysis

Czech Academy of Sciences Publication Activity Database

Galinha, C.; Pacheco, A. M. G.; Freitas, M. C.; Fikrle, Marek; Kučera, Jan; Coutinho, J.; Macas, B.; Almeida, A. S.; Wolterbeek, H. T.

2014-01-01

Roč. 2014, AUG (2014), s. 3499 ISSN 1588-2780 R&D Projects: GA MŠk(XE) LM2011019 Institutional support: RVO:61389005 Keywords : agronomy * biofortification * Selenium * supplementation * wheat * NAA Subject RIV: GM - Food Processing

Lithium recycling and cathode material regeneration from acid leach liquor of spent lithium-ion battery via facile co-extraction and co-precipitation processes.

Science.gov (United States)

Yang, Yue; Xu, Shengming; He, Yinghe

2017-06-01

A novel process for extracting transition metals, recovering lithium and regenerating cathode materials based on facile co-extraction and co-precipitation processes has been developed. 100% manganese, 99% cobalt and 85% nickel are co-extracted and separated from lithium by D2EHPA in kerosene. Then, Li is recovered from the raffinate as Li 2 CO 3 with the purity of 99.2% by precipitation method. Finally, organic load phase is stripped with 0.5M H 2 SO 4 , and the cathode material LiNi 1/3 Co 1/3 Mn 1/3 O 2 is directly regenerated from stripping liquor without separating metal individually by co-precipitation method. The regenerative cathode material LiNi 1/3 Co 1/3 Mn 1/3 O 2 is miro spherical morphology without any impurities, which can meet with LiNi 1/3 Co 1/3 Mn 1/3 O 2 production standard of China and exhibits good electrochemical performance. Moreover, a waste battery management model is introduced to guarantee the material supply for spent battery recycling. Copyright © 2017 Elsevier Ltd. All rights reserved.

The effect of diamond-like carbon coating on LiNi0.8Co0.15Al0.05O2 particles for all solid-state lithium-ion batteries based on Li2S-P2S5 glass-ceramics

Science.gov (United States)

Visbal, Heidy; Aihara, Yuichi; Ito, Seitaro; Watanabe, Taku; Park, Youngsin; Doo, Seokgwang

2016-05-01

There have been several reports on improvements of the performance of all solid-state battery using lithium metal oxide coatings on the cathode active material. However, the mechanism of the performance improvement remains unclear. To better understand the effect of the surface coating, we studied the impact of diamond-like carbon (DLC) coating on LiNi0.8Co0.15Al0.05O2 (NCA) by chemical vapor deposition (CVD). The DLC coated NCA showed good cycle ability and rate performance. This result is further supported by reduction of the interfacial resistance of the cathode and electrolyte observed in impedance spectroscopy. The DLC layer was analyzed by transmission electron microscopy electron energy loss spectroscopy (TEM-EELS). After 100 cycles the sample was analyzed by X-ray photo spectroscopy (XPS), and Time-of-Flight Secondary Ion Mass Spectrometry (TOF-SIMS). These analyses showed that the thickness of the coating layer was around 4 nm on average, acting to hinder the side reactions between the cathode particle and the solid electrolyte. The results of this study will provide useful insights for understanding the nature of the buffer layer for the cathode materials.

Preclinical therapeutic potential of a nitrosylating agent in the treatment of ovarian cancer.

Directory of Open Access Journals (Sweden)

Shailendra Giri

Full Text Available This study examines the role of s-nitrosylation in the growth of ovarian cancer using cell culture based and in vivo approaches. Using the nitrosylating agent, S-nitrosoglutathione (GSNO, a physiological nitric oxide molecule, we show that GSNO treatment inhibited proliferation of chemoresponsive and chemoresistant ovarian cancer cell lines (A2780, C200, SKVO3, ID8, OVCAR3, OVCAR4, OVCAR5, OVCAR7, OVCAR8, OVCAR10, PE01 and PE04 in a dose dependent manner. GSNO treatment abrogated growth factor (HB-EGF induced signal transduction including phosphorylation of Akt, p42/44 and STAT3, which are known to play critical roles in ovarian cancer growth and progression. To examine the therapeutic potential of GSNO in vivo, nude mice bearing intra-peritoneal xenografts of human A2780 ovarian carcinoma cell line (2 × 10(6 were orally administered GSNO at the dose of 1 mg/kg body weight. Daily oral administration of GSNO significantly attenuated tumor mass (p<0.001 in the peritoneal cavity compared to vehicle (phosphate buffered saline treated group at 4 weeks. GSNO also potentiated cisplatin mediated tumor toxicity in an A2780 ovarian carcinoma nude mouse model. GSNO's nitrosylating ability was reflected in the induced nitrosylation of various known proteins including NFκB p65, Akt and EGFR. As a novel finding, we observed that GSNO also induced nitrosylation with inverse relationship at tyrosine 705 phosphorylation of STAT3, an established player in chemoresistance and cell proliferation in ovarian cancer and in cancer in general. Overall, our study underlines the significance of S-nitrosylation of key cancer promoting proteins in modulating ovarian cancer and proposes the therapeutic potential of nitrosylating agents (like GSNO for the treatment of ovarian cancer alone or in combination with chemotherapeutic drugs.

RNA disruption is associated with response to multiple classes of chemotherapy drugs in tumor cell lines.

Science.gov (United States)

Narendrula, Rashmi; Mispel-Beyer, Kyle; Guo, Baoqing; Parissenti, Amadeo M; Pritzker, Laura B; Pritzker, Ken; Masilamani, Twinkle; Wang, Xiaohui; Lannér, Carita

2016-02-24

Cellular stressors and apoptosis-inducing agents have been shown to induce ribosomal RNA (rRNA) degradation in eukaryotic cells. Recently, RNA degradation in vivo was observed in patients with locally advanced breast cancer, where mid-treatment tumor RNA degradation was associated with complete tumor destruction and enhanced patient survival. However, it is not clear how widespread chemotherapy induced "RNA disruption" is, the extent to which it is associated with drug response or what the underlying mechanisms are. Ovarian (A2780, CaOV3) and breast (MDA-MB-231, MCF-7, BT474, SKBR3) cancer cell lines were treated with several cytotoxic chemotherapy drugs and total RNA was isolated. RNA was also prepared from docetaxel resistant A2780DXL and carboplatin resistant A2780CBN cells following drug exposure. Disruption of RNA was analyzed by capillary electrophoresis. Northern blotting was performed using probes complementary to the 28S and 18S rRNA to determine the origins of degradation bands. Apoptosis activation was assessed by flow cytometric monitoring of annexin-V and propidium iodide (PI) binding to cells and by measuring caspase-3 activation. The link between apoptosis and RNA degradation (disruption) was investigated using a caspase-3 inhibitor. All chemotherapy drugs tested were capable of inducing similar RNA disruption patterns. Docetaxel treatment of the resistant A2780DXL cells and carboplatin treatment of the A2780CBN cells did not result in RNA disruption. Northern blotting indicated that two RNA disruption bands were derived from the 3'-end of the 28S rRNA. Annexin-V and PI staining of docetaxel treated cells, along with assessment of caspase-3 activation, showed concurrent initiation of apoptosis and RNA disruption, while inhibition of caspase-3 activity significantly reduced RNA disruption. Supporting the in vivo evidence, our results demonstrate that RNA disruption is induced by multiple chemotherapy agents in cell lines from different tissues and is

CSIR ScienceScope: Art and science of modelling and simulation

CSIR Research Space (South Africa)

CSIR

2008-03-01

Full Text Available -2780 I CSRR Ma)ewialx Science and Manufac)uwing Pretoria 012 841-4392 Johannesburg 011 482-1300 Port olizabeth 041 508-3200 Cape Town 021 685-4329 I CSRR Na)uwal Rexouwcex and )he En0iwonmen) Pretoria 012 841-4005 Johannesburg 011 358...) En0iwonmen) Pretoria 012 841-3871 Stellenbosch 021 888-2508 I CSRR Defencec Neacec Safe)y and Secuwi)y Pretoria 012 841-2780 I CSRR Ma)ewialx Science and Manufac)uwing Pretoria 012 841-4392 Johannesburg 011 482-1300 Port olizabeth 041 508...

Research@ARL: Energy & Energetics

Science.gov (United States)

2012-06-01

LiNi0.80Co0.15Al0.05O2 ( NCA ), cathode in a full cell, we found that the activation energy, Ea, for the charge transfer at the graphite/electrolyte interface...kinetics at the graphite anode and the lithium nickel cobalt aluminum oxide, LiNi0.80Co0.15Al0.05O2 ( NCA ), cathode in a full cell, we found that the...Both the NCA and the graphite electrodes are porous electrodes. The dimension of the NCA cathode was 6.35 cm × 3.81 cm, the dimension of the graphite

Stabilizing the Electrode/Electrolyte Interface of LiNi0.8Co0.15Al0.05O2 through Tailoring Aluminum Distribution in Microspheres as Long-Life, High-Rate, and Safe Cathode for Lithium-Ion Batteries.

Science.gov (United States)

Hou, Peiyu; Zhang, Hongzhou; Deng, Xiaolong; Xu, Xijin; Zhang, Lianqi

2017-09-06

The unstable electrode/electrolyte interface of high-capacity LiNi 0.8 Co 0.15 Al 0.05 O 2 (NCA) cathodes, especially at a highly delithiated state, usually leads to the transformation of layered to spinel and/or rock-salt phases, resulting in drastic capacity fade and poor thermal stability. Herein, the Al-increased and Ni-,Co-decreased electrode surface is fabricated through tailoring element distribution in micrometer-sized spherical NCA secondary particles via coprecipitation and solid-state reactions, aimed at stabilizing the electrode/electrolyte interface during continuous cycles. As expected, it shows much extended cycle life, 93.6% capacity retention within 100 cycles, compared with that of 78.5% for the normal NCA. It also delivers large reversible capacity of about 140 mAh g -1 even at 20 C, corresponding to energy density of around 480 Wh kg -1 , which is enhanced by 45% compared to that of the normal NCA (about 330 Wh kg -1 ). Besides, the delayed heat emission temperature and reduced heat generation mean remarkably improved thermal stability. These foregoing improvements are ascribed to the Al-increased spherical secondary particle surface that stabilizes the electrode/electrolyte interface by protecting inner components from directly contacting with electrolyte and suppressing the side reaction on electrode surface between high oxidizing Ni 4+ and electrolyte.

APPLICATION OF NISIN INTO SLOVAK FERMENTED SALAMI PÚCHOV

Directory of Open Access Journals (Sweden)

Andrea Laukova

2012-12-01

Full Text Available Púchov salami is favorite fermented salami among Slovak consumers. Nisin is the only bacteriocin accepted by European Commission for a commercial use as additive for food preservation (although not commonly used in meat products. Because of its possibility to prolonge shelf-life of the products and its antimicrobial activity, its effect in dry fermented Slovak salami Púchov experimentally inoculated with Listeria innocua Li1 strain was checked. The initial number of L. innocua Li1 in the inoculated salami mixtures was 104 CFU/g (log 10; 4.04  ± 0 07. After nisin addition, the count of Li1 strain in the meat samples (inoculated with Li1 and treated by nisin was 1.36±0.07 CFU/g; difference 2.68 logarithmic cycle was noted between Li and Li/Ni samples. At day 2, the difference 3.23 log cycle was detected between Li1 and Li/Ni samples (Li:5.46±0.08, Li/Ni: 2.14±0.07 CFU/g; at weeks 3, 4, it was 1.69 and 1.80 log cycle. Activity of nisin itself was not recovered from the experimental salamis by the analytical method; however, its inhibitory effect was shown by Li1 count decrease. The pH in  salamis during processing was almost at the same level (5.52, 5.53, 5.55. Water activity was not negatively influenced. Water content in Li/Ni salamis reached almost requested levels (maximum percentage of water requested is 34 %.doi:10.5219/218

4-Hydroxy estradiol but not 2-hydroxy estradiol induces expression of hypoxia-inducible factor 1α and vascular endothelial growth factor A through phosphatidylinositol 3-kinase/Akt/FRAP pathway in OVCAR-3 and A2780-CP70 human ovarian carcinoma cells

International Nuclear Information System (INIS)

Gao Ning; Nester, Rebecca A.; Sarkar, Mohamadi A.

2004-01-01

Hypoxia-inducible factor 1 (HIF-1) is a heterodimeric basic helix-loop-helix transcription factor composed of HIF-1α and HIF-1β subunits. HIF-1 expression is induced by hypoxia, growth factors, and activation of oncogenes. HIF-1 activates downstream target genes such as vascular endothelial growth factor A (VEGF-A), which plays an important role in tumor progression and angiogenesis. Estrogen exposure is considered to be the major risk factor for ovarian cancer. Estradiol (E2) is usually metabolized by CYP1A1/1A2 and CYP3A4 to the 2-hydroxy estradiol (2-OHE2) and 4-hydroxy estradiol (4-OHE2) in human liver. Many reports have suggested that the formation of 4-OHE2 is important for mammary carcinogenesis. However, the formation of 2-OHE2 may play an important role in exhibiting anticarcinogenic effects. In the present study, we have demonstrated that one of the catechol estrogen metabolites of E2, 4-OHE2, induces HIF-1α and VEGF-A expression at protein level in two human ovarian cancer cell lines, OVCAR-3 and A2780-CP70 cells, in dose- and time-dependent manners, whereas the other catechol estrogen metabolite of E2, 2-OHE2, does not alter HIF-1α and VEGF-A expression. To explore the mechanism of 4-OHE2-induced HIF-1α and VEGF-A expression, we studied whether phosphatidylinositol 3-kinase (PI3K) or mitogen-activated protein kinase (MAPK) signaling pathways are involved in 4-OHE2-induced HIF-1α and VEGF-A expression. Our findings indicate that PI3K inhibitors, LY294002 and wortmannin, inhibited HIF-1α and VEGF-A expression, whereas MAPK inhibitor, PD98059, did not alter HIF-1α and VEGF-A expression induced by 4-OHE2. 4-OHE2, but not 2-OHE2, also induced Akt phosphorylation at Ser473 in dose- and time-dependent manners, and LY294002 and wortmannin inhibited Akt phosphorylation at Ser473 induced by 4-OHE2. Our results also indicated that the mTOR/FRAP inhibitor, rapamycin, inhibited 4-OHE2-induced HIF-1α and VEGF-A expression. These results suggest that the PI3K

Elevated electrochemical performance of (NH4)3AlF6-coated 0.5Li2MnO3·0.5LiNi1/3Co1/3Mn1/3O2 cathode material via a novel wet coating method

International Nuclear Information System (INIS)

Xu, Guofeng; Li, Jianling; Xue, Qingrui; Dai, Yu; Zhou, Hongwei; Wang, Xindong; Kang, Feiyu

2014-01-01

A novel wet method of (NH 4 ) 3 AlF 6 coating was explored to enhance the electrochemical performance of Mn-based solid-solution cathode material 0.5Li 2 MnO 3 ·0.5LiNi 1/3 Co 1/3 Mn 1/3 O 2 . The X-ray powder diffraction patterns show that the coating material is pure-phase (NH 4 ) 3 AlF 6 and both pristine and coated samples can be indexed to hexagonal α-NaFeO 2 layered structure with space group of R-3 m. The field-emission scanning electron microscope images and the energy dispersive X-ray spectroscopy show that (NH 4 ) 3 AlF 6 is successfully coated on the surface of active particle. The (NH 4 ) 3 AlF 6 coated electrodes exhibit improved electrochemical performance, for instance, the initial charge-discharge efficiency was promoted by 5% (NH 4 ) 3 AlF 6 coating, the 1 wt.% and 3 wt.% coated electrodes deliver elevated cycling ability which is ascribed to the lower resistance between electrode and electrolyte as indicated by AC impedance measurement at different cycles. In addition, the coated-electrodes also give enhanced rate capability particularly for 1 wt.% NAF-coated electrode performing surprising capacity of 143.4 mAh g −1 at 5 C higher than that of 109.4 mAh g −1 for pristine electrode. Furthermore, the 1 wt.% NAF-coated electrode also shows improved cycle and rate performance at 55°C

Pre-Treatment of Platinum Resistant Ovarian Cancer Cells with an MMP-9/MMP-2 Inhibitor Prior to Cisplatin Enhances Cytotoxicity as Determined by High Content Screening

Directory of Open Access Journals (Sweden)

John J. O'Leary

2013-01-01

Full Text Available Platinum resistance is a major cause of treatment failure in ovarian cancer. We previously identified matrix metalloproteinase 9 (MMP-9 as a potential therapeutic target of chemoresistant disease. A2780cis (cisplatin-resistant and A2780 (cisplatin-sensitive ovarian carcinoma cell lines were used. The cytotoxic effect of MMP-9/MMP-2 inhibitor, (2R-2-[(4-Biphenylsulfonyl amino]-3 phenylpropionic acid (C21H19NO4S alone or in combination with cisplatin was determined using high content screening. Protein expression was examined using immunohistochemistry and ELISA. Co-incubation of cisplatin and an MMP-9/MMP-2 inhibitor, (2R-2-[(4-Biphenylsulfonyl amino]-3 phenylpropionic acid (C21H19NO4S resulted in significantly greater cytotoxicity as compared to either treatment alone in a cisplatin resistant MMP-9 overexpressing cell line; A2780cis. In addition, pre-incubating with MMP-9i prior to cisplatin further enhances the cytotoxic effect. No significant difference was observed in MMP-9 protein in tissue but a trend towards increased MMP-9 was observed in recurrent serum. We propose that MMP-9/MMP-2i may be utilized in the treatment of recurrent/chemoresistant ovarian cancers that overexpress MMP-9 mRNA but its role in vivo remains to be evaluated.

A versatile single molecular precursor for the synthesis of layered oxide cathode materials for Li-ion batteries.

Science.gov (United States)

Li, Maofan; Liu, Jiajie; Liu, Tongchao; Zhang, Mingjian; Pan, Feng

2018-02-01

A carbonyl-bridged single molecular precursor LiTM(acac) 3 [transition metal (TM) = cobalt/manganese/nickel (Co/Mn/Ni), acac = acetylacetone], featuring a one-dimensional chain structure, was designed and applied to achieve the layered oxide cathode materials: LiTMO 2 (TM = Ni/Mn/Co, NMC). As examples, layered oxides, primary LiCoO 2 , binary LiNi 0.8 Co 0.2 O 2 and ternary LiNi 0.5 Mn 0.3 Co 0.2 O 2 were successfully prepared to be used as cathode materials. When they are applied to lithium-ion batteries (LIBs), all exhibit good electrochemical performance because of their unique morphology and great uniformity of element distribution. This versatile precursor is predicted to accommodate many other metal cations, such as aluminum (Al 3+ ), iron (Fe 2+ ), and sodium (Na + ), because of the flexibility of organic ligand, which not only facilitates the doping-modification of the NMC system, but also enables synthesis of Na-ion layered oxides. This opens a new direction of research for the synthesis of high-performance layered oxide cathode materials for LIBs.

RNA disruption is associated with response to multiple classes of chemotherapy drugs in tumor cell lines

International Nuclear Information System (INIS)

Narendrula, Rashmi; Mispel-Beyer, Kyle; Guo, Baoqing; Parissenti, Amadeo M.; Pritzker, Laura B.; Pritzker, Ken; Masilamani, Twinkle; Wang, Xiaohui; Lannér, Carita

2016-01-01

Cellular stressors and apoptosis-inducing agents have been shown to induce ribosomal RNA (rRNA) degradation in eukaryotic cells. Recently, RNA degradation in vivo was observed in patients with locally advanced breast cancer, where mid-treatment tumor RNA degradation was associated with complete tumor destruction and enhanced patient survival. However, it is not clear how widespread chemotherapy induced “RNA disruption” is, the extent to which it is associated with drug response or what the underlying mechanisms are. Ovarian (A2780, CaOV3) and breast (MDA-MB-231, MCF-7, BT474, SKBR3) cancer cell lines were treated with several cytotoxic chemotherapy drugs and total RNA was isolated. RNA was also prepared from docetaxel resistant A2780DXL and carboplatin resistant A2780CBN cells following drug exposure. Disruption of RNA was analyzed by capillary electrophoresis. Northern blotting was performed using probes complementary to the 28S and 18S rRNA to determine the origins of degradation bands. Apoptosis activation was assessed by flow cytometric monitoring of annexin-V and propidium iodide (PI) binding to cells and by measuring caspase-3 activation. The link between apoptosis and RNA degradation (disruption) was investigated using a caspase-3 inhibitor. All chemotherapy drugs tested were capable of inducing similar RNA disruption patterns. Docetaxel treatment of the resistant A2780DXL cells and carboplatin treatment of the A2780CBN cells did not result in RNA disruption. Northern blotting indicated that two RNA disruption bands were derived from the 3’-end of the 28S rRNA. Annexin-V and PI staining of docetaxel treated cells, along with assessment of caspase-3 activation, showed concurrent initiation of apoptosis and RNA disruption, while inhibition of caspase-3 activity significantly reduced RNA disruption. Supporting the in vivo evidence, our results demonstrate that RNA disruption is induced by multiple chemotherapy agents in cell lines from different tissues

Determination of elemental impurities in phosphoric acid by INAA employing a novel method of phosphate precipitation

Czech Academy of Sciences Publication Activity Database

Kameník, Jan; Amsil, H.; Kučera, Jan

2014-01-01

Roč. 2014, AUG (2014), s. 3455 ISSN 1588-2780 R&D Projects: GA ČR(CZ) GBP108/12/G108; GA MŠk(XE) LM2011019 Institutional support: RVO:61389005 Keywords : instrumental neutron activation analysis * phosphoric acid * elemental impurities * isothermal distillation Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

Advanced cathode materials for high-power applications

Science.gov (United States)

Amine, K.; Liu, J.; Belharouak, I.; Kang, S.-H.; Bloom, I.; Vissers, D.; Henriksen, G.

In our efforts to develop low cost high-power Li-ion batteries with excellent safety, as well as long cycle and calendar life, lithium manganese oxide spinel and layered lithium nickel cobalt manganese oxide cathode materials were investigated. Our studies with the graphite/LiPF 6/spinel cells indicated a very significant degradation of capacity with cycling at 55 °C. This degradation was caused by the reduction of manganese ions on the graphite surface which resulted in a significant increase of the charge-transfer impedance at the anode/electrolyte interface. To improve the stability of the spinel, we investigated an alternative salt that would not generate HF acid that may attack the spinel. The alternative salt we selected for this work was lithium bisoxalatoborate, LiB(C 2O 4) 2 ("LiBoB"). In this case, the graphite/LiBoB/spinel Li-ion cells exhibited much improved cycle/calendar life at 55 °C and better abuse tolerance, as well as excellent power. A second system based on LiNi 1/3Co 1/3Mn 1/3O 2 layered material was also investigated and its performance was compared to commercial LiNi 0.8Co 0.15Al 0.05O 2. Cells based on LiNi 1/3Co 1/3Mn 1/3O 2 showed lower power fade and better thermal safety than the LiNi 0.8Co 0.15Al 0.05O 2-based commercial cells under similar test conditions. Li-ion cells based on the material with excess lithium (Li 1.1Ni 1/3Co 1/3Mn 1/3O 2) exhibited excellent power performance that exceeded the FreedomCAR requirements.

Characteristics of LiMO2 (M = Co, Ni, Ni0.2Co0.8, Ni0.8Co0.2) powders prepared from solution of their acetates

International Nuclear Information System (INIS)

Arof, A.K.

2008-01-01

Stoichiometric quantities of the acetates of lithium, cobalt and nickel were dissolved in distilled water and stirred with a magnetic stirrer. After complete dissolution was obtained, the solutions were heated at 120 deg. C under continuous stirring until some dark colored powder materials were formed. These precursor materials were divided into three batches and heated at 250 deg. C (for 24 h), 370 deg. C (for 24 h) and 800 deg. C for 10 h. The precursor and calcined samples were X-rayed. The X-ray diffractograms for the prepared samples were compared to that of commercialized samples and those published in the literature. The Bragg peak with Miller indices (0 0 3) in the diffractogram of the LiNi 0.8 Co 0.2 O 2 prepared sample showed a lower intensity compared to the (1 0 4) peak. The ratio of the (0 0 3) to (1 0 4) peaks for the LiNi 0.2 Co 0.8 O 2 sample is 1.56. Lattice parameters showed that the LiCoO 2 and LiNi 0.2 Co 0.8 O 2 samples produced by the method in the present investigation have potential to exhibit good electrochemical performance when used as electrodes in lithium ion batteries

Synthesis, Characterization and in Vitro Antitumor Activity of Platinum(II Oxalato Complexes Involving 7-Azaindole Derivatives as Coligands

Directory of Open Access Journals (Sweden)

Pavel Štarha

2014-07-01

Full Text Available The platinum(II oxalato complexes [Pt(ox(naza2] (1–3 were synthesized and characterized by elemental analysis (C, H, N, multinuclear NMR spectroscopy (1H, 13C, 15N, 195Pt and electrospray ionization mass spectrometry (ESI-MS; naza = 4-chloro-7-azaindole (4Claza; 1, 3-bromo-7-azaindole (3Braza; 2 or 4-bromo-7-azaindole (4Braza; 3. The prepared substances were screened for their in vitro antitumor activity on the osteosarcoma (HOS and breast adenocarcinoma (MCF7 human cancer cell lines, where 2 showed moderate antitumor effect (IC50 = 27.5 μM, and 18.3 μM, respectively. The complex 2 was further tested on a panel of six others human cancer cell lines, including the malignant melanoma (G361, cervix carcinoma (HeLa, ovarian carcinoma (A2780, cisplatin-resistant ovarian carcinoma (A2780R, lung carcinoma (A549 and prostate adenocarcinoma (LNCaP. This substance was found to be moderate antitumor effective against G361 (IC50 = 17.3 μM, HeLa (IC50 = 31.8 μM and A2780 (IC50 = 19.2 μM cell lines. The complex 2 was also studied by NMR for its solution stability and by ESI-MS experiments for its ability to interact with biomolecules, such as cysteine, glutathione or guanosine 5'-monophosphate.

Driving p53 Response to Bax Activation Greatly Enhances Sensitivity to Taxol by Inducing Massive Apoptosis

Directory of Open Access Journals (Sweden)

Paola De Feudis

2000-05-01

Full Text Available The proapoptotic gene bax is one of the downstream effectors of p53. The p53 binding site in the bax promoter is less responsive to p53 than the one in the growth arrest mediating gene p21. We introduced the bax gene under the control of 13 copies of a strong p53 responsive element into two ovarian cancer cell lines. The clones expressing bax under the control of p53 obtained from the wild-type (wt p53-expressing cell line A2780 were much more sensitive (500- to 1000-fold to the anticancer agent taxol than the parent cell line, with a higher percentage of cells undergoing apoptosis after drug treatment that was clearly p53-dependent and bax-mediated. Xenografts established in nude mice from one selected clone (A2780/C3 were more responsive to taxol than the parental line and the apoptotic response of A2780/C3 tumors was also increased after treatment. Introduction of the same plasmid into the p53 null SKOV3 cell line did not alter the sensitivity to taxol or the induction of apoptosis. In conclusion, driving the p53 response (after taxol treatment by activating the bax gene rather than the p21 gene results in induction of massive apoptosis, in vitro and in vivo, and greatly enhances sensitivity to the drug.

The use of Co2+ for crystallization and structure determination, using a conventional monochromatic X-ray source, of flax rust avirulence protein

International Nuclear Information System (INIS)

Gunčar, Gregor; Wang, Ching-I A.; Forwood, Jade K.; Teh, Trazel; Catanzariti, Ann-Maree; Ellis, Jeffrey G.; Dodds, Peter N.; Kobe, Boštjan

2007-01-01

It is demonstrated that anomalous diffraction based on the signal from a cobalt ion measured on a conventional monochromatic X-ray source can be used to determine the structure of a protein with a novel fold (M. lini avirulence protein AvrL567-A). The approach could be applicable to many metal-binding proteins, particularly when synchrotron radiation is not readily available. Metal-binding sites are ubiquitous in proteins and can be readily utilized for phasing. It is shown that a protein crystal structure can be solved using single-wavelength anomalous diffraction based on the anomalous signal of a cobalt ion measured on a conventional monochromatic X-ray source. The unique absorption edge of cobalt (1.61 Å) is compatible with the Cu Kα wavelength (1.54 Å) commonly available in macromolecular crystallography laboratories. This approach was applied to the determination of the structure of Melampsora lini avirulence protein AvrL567-A, a protein with a novel fold from the fungal pathogen flax rust that induces plant disease resistance in flax plants. This approach using cobalt ions may be applicable to all cobalt-binding proteins and may be advantageous when synchrotron radiation is not readily available

Kinetics and structural changes of Li-rich layered oxide 0.5Li2MnO3·0.5LiNi(0.292)Co(0.375)Mn(0.333)O2 material investigated by a novel technique combining in situ XRD and a multipotential step.

Science.gov (United States)

Shen, Chong-Heng; Huang, Ling; Lin, Zhou; Shen, Shou-Yu; Wang, Qin; Su, Hang; Fu, Fang; Zheng, Xiao-Mei

2014-08-13

Li-rich layered oxide 0.5Li2MnO3·0.5LiNi0.292Co0.375Mn0.333O2 was prepared by an aqueous solution-evaporation route. X-ray powder diffraction (XRD) showed that the as-synthesized material was a solid solution consisting of layered α-NaFeO2-type LiMO2 (M = Ni, Co, Mn) and monoclinic Li2MnO3. The superlattice spots in the selected area electron diffraction pattern indicated the ordering of lithium ions with transition metal (TM) ions in TM layers in this Li-rich layered oxide. Electrochemical performance testing showed that the as-synthesized material could deliver an initial discharge capacity of 267.7 mAh/g, with a capacity retention of 88.5% after 33 cycles. A new combination technique, multipotential step in situ XRD (MPS in situ XRD) measurement, was applied for the first time to investigate the Li-rich layered oxide. Using this approach, the relationships between kinetics and structural variations can be obtained simutaneously. In situ XRD results showed that the c parameter decreased from 3.70 to 4.30 V and increased from 4.30 to 4.70 V, whereas the a parameter underwent a decrease above 4.30 V during the first charge process. Below 3.90 V during the first discharge process, a slight decrease in the c parameter was found along with an increase in the a parameter. During the first charge process, the value of the coefficient of diffusion for lithium ions (DLi+) decreased to its mininum at 4.55 V, which might be associated with Ni(2+) migration, as indicated by both Ni occupancy in 3b sites (Ni3b%) in the Li(+) layers and complicated chemical reactions. Remarkably, a lattice distortion might occur within the local domain in the host stucture during the first discharge process, indicated by a slight splitting of the (003) diffraction peak at 3.20 V.

Platelet adhesion and degranulation induce pro-survival and pro-angiogenic signalling in ovarian cancer cells.

Directory of Open Access Journals (Sweden)

Karl Egan

Full Text Available Thrombosis is common in ovarian cancer. However, the interaction of platelets with ovarian cancer cells has not been critically examined. To address this, we investigated platelet interactions in a range of ovarian cancer cell lines with different metastatic potentials [HIO-80, 59M, SK-OV-3, A2780, A2780cis]. Platelets adhered to ovarian cancer cells with the most significant adhesion to the 59M cell line. Ovarian cancer cells induced platelet activation [P-selectin expression] in a dose dependent manner, with the most significant activation seen in response to the 59M cell line. The platelet antagonists [cangrelor, MRS2179, and apyrase] inhibited 59M cell induced activation suggesting a P2Y12 and P2Y1 receptor mediated mechanism of platelet activation dependent on the release of ADP by 59M cells. A2780 and 59M cells potentiated PAR-1, PAR-4, and TxA2 receptor mediated platelet activation, but had no effect on ADP, epinephrine, or collagen induced activation. Analysis of gene expression changes in ovarian cancer cells following treatment with washed platelets or platelet releasate showed a subtle but valid upregulation of anti-apoptotic, anti-autophagy pro-angiogenic, pro-cell cycle and metabolic genes. Thus, ovarian cancer cells with different metastatic potential adhere and activate platelets differentially while both platelets and platelet releasate mediate pro-survival and pro-angiogenic signals in ovarian cancer cells.

TET1 promotes cisplatin-resistance via demethylating the vimentin promoter in ovarian cancer.

Science.gov (United States)

Han, Xi; Zhou, Yuanyuan; You, Yuanyi; Lu, Jiaojiao; Wang, Lijie; Hou, Huilian; Li, Jing; Chen, Wei; Zhao, Le; Li, Xu

2017-04-01

The development of chemo-resistance impairs the outcome of the first line platinum-based chemotherapies for ovarian cancer. Deregulation of DNA methylation/demethylation provides a critical mechanism for the occurrence of chemo-resistance. The ten-eleven translocation (TET) family of dioxygenases including TET1/2/3 plays an important part in DNA demethylation, but their roles in cisplatin resistance have not been elucidated. Using cisplatin-sensitive and cisplatin-resistant ovarian cancer cell models, we found that TET1 was significantly upregulated in cisplatin-resistant CP70 cells compared with that in cisplatin-sensitive A2780 cells. Ectopic expression of TET1 in A2780 cells promoted cisplatin resistance and decreased cytotoxicity induced by cisplatin, while inhibition of TET1 by siRNA transfection in CP70 cells attenuated cisplatin resistance and enhanced cytotoxicity of cisplatin. Increased TET1 induced re-expression of vimentin through active DNA demethylation, and cause partial epithelial-to-mesenchymal (EMT) in A2780 cells. Contrarily, knocking down of TET1 in CP70 cells reduced vimentin expression and reversed EMT process. Immunohistochemical analysis of TET1 in human ovarian cancer tissues revealed that TET1 existed in nucleus and cytoplasm in ovarian cancer tissues. And the expression of nuclear TET1 was positively correlated with residual tumor and chemotherapeutic response. Thus, TET1 expression causes resistance to cisplatin and one of the targets of TET1 action is vimentin in ovarian cancer. © 2017 International Federation for Cell Biology.

7 CFR 400.202 - Definitions.

Science.gov (United States)

2010-01-01

... the data communications protocol (standard) that is a binary synchronous communications (BSC), International Business Systems (IBM)-defined, byte controlled communications protocol, using control characters... second (bps) transmission of data utilizing 3780 (or 2780) protocol. (c) Contract, the see Agency Sales...

In Vitro Antitumor Active Gold(I Triphenylphosphane Complexes Containing 7-Azaindoles

Directory of Open Access Journals (Sweden)

Pavel Štarha

2016-12-01

Full Text Available A series of gold(I complexes of the general composition [Au(naza(PPh3] (1–8 was prepared and thoroughly characterized (e.g., electrospray ionization (ESI mass spectrometry and multinuclear nuclear magnetic resonance (NMR spectroscopy. The N1-deprotonated anions of 7-azaindole or its derivatives (naza are coordinated to the metal centre through the N1 atom of their pyrrole ring, as proved by a single crystal X-ray analysis of the complexes [Au(3I5Braza(PPh3] (7 and [Au(2Me4Claza(PPh3]·½H2O (8′. The in vitrocytotoxicity of the complexes 1–8 was studied against both the cisplatin-sensitive and -resistant variants of the A2780 human ovarian carcinoma cell line, as well as against the MRC-5 human normal fibroblast cell line. The complexes 4, 5, and 8, containing deprotonated 3-iodo-7-azaindole, 5-bromo-7-azaindole, and 2-methyl-4-chloro-7-azaindole (2Me4Claza, respectively, showed significantly higher potency (IC50 = 2.8–3.5 µM than cisplatin (IC50 = 20.3 µM against the A2780 cells and markedly lower effect towards the MRC-5 non-cancerous cells (IC50 = 26.0–29.2 µM, as compared with the mentioned A2780 cancer cells. The results of the flow cytometric studies of the A2780 cell cycle perturbations revealed a G2-cell cycle phase arrest of the cells treated by the representative complexes 1 and 5, which is indicative of a different mechanism of action from cisplatin (induced S-cell cycle phase arrest. The stability of the representative complex 8 in the water-containing solution as well as its ability to interact with the reduced glutathione, cysteine and bovine serum albumin was also studied using 1H and 31P-NMR spectroscopy (studied in the 50% DMF-d7/50% D2O mixture and ESI+ mass spectrometry (studied in the 50% DMF/50% H2O mixture; DMF = dimethylformamide. The obtained results are indicative for the release of the N-donor azaindole-based ligand in the presence of the used biomolecules.

Frank Robert Tangherlini — the Founder of an Alternative Relativistic Kinematics (On the Occasion of His 85th Birthday

Directory of Open Access Journals (Sweden)

Malykin G. B.

2009-01-01

Full Text Available Already fifty years ago, Frank Robert Tangherlini, an American theoretical physicist, suggested an original procedure which, targeting the synchronization of clocks located in two different inertial reference frames of the space, was di erent from that Einstein had introduced. As a result of these, Tangherlini had deduced the so-called the Tangher- lini transformations, which are a sort of the transformations of the spatial coordinates and time being moved from one inertial reference frame into another one. The Tangher- lini transformations differ from the Lorentz transformations (which can be meant clas- sic ones in the theory of relativity and, in particular, suggest the velocity of light to be anisotropic in a moving inertial reference frame. The Tangherlini transformations be- ing applied provide adequate explanations to all well-known interference experiments checking of the Special Theory of Relativity.

Tervenemine kirgastumise kaudu / Riin Kübarsepp

Index Scriptorium Estoniae

Kübarsepp, Riin, 1978-

2002-01-01

August Künnapu kohaspetsiifiline kuraatoriprojekt "Tervenemine" Mustamäe haiglas, näituse "X mistakes Y for Z" haruprojekt. Paralleele Toomas Altnurme suviste maalide ja taivani kunstniku Michael Lini installatsiooniga "Voodi"

MicroRNA signature of cis-platin resistant vs. cis-platin sensitive ovarian cancer cell lines

Directory of Open Access Journals (Sweden)

Kumar Smriti

2011-09-01

Full Text Available Abstract Background Ovarian cancer is the leading cause of death from gynecologic cancer in women worldwide. According to the National Cancer Institute, ovarian cancer has the highest mortality rate among all the reproductive cancers in women. Advanced stage diagnosis and chemo/radio-resistance is a major obstacle in treating advanced ovarian cancer. The most commonly employed chemotherapeutic drug for ovarian cancer treatment is cis-platin. As with most chemotherapeutic drugs, many patients eventually become resistant to cis-platin and therefore, diminishing its effect. The efficacy of current treatments may be improved by increasing the sensitivity of cancer cells to chemo/radiation therapies. Methods The present study is focused on identifying the differential expression of regulatory microRNAs (miRNAs between cis-platin sensitive (A2780, and cis-platin resistant (A2780/CP70 cell lines. Cell proliferation assays were conducted to test the sensitivity of the two cell lines to cis-platin. Differential expression patterns of miRNA between cis-platin sensitive and cis-platin resistant cell lines were analyzed using novel LNA technology. Results Our results revealed changes in expression of 11 miRNAs out of 1,500 miRNAs analyzed. Out of the 11 miRNAs identified, 5 were up-regulated in the A2780/CP70 cell line and 6 were down regulated as compared to cis-platin sensitive A2780 cells. Our microRNA data was further validated by quantitative real-time PCR for these selected miRNAs. Ingenuity Pathway Analysis (IPA and Kyoto Encyclopedia of Genes and Genomes (KEGG analysis was performed for the selected miRNAs and their putative targets to identify the potential pathways and networks involved in cis-platin resistance. Conclusions Our data clearly showed the differential expression of 11 miRNAs in cis-platin resistant cells, which could potentially target many important pathways including MAPK, TGF-β signaling, actin cytoskeleton, ubiquitin mediated

Investigation of physico-chemical processes in lithium-ion batteries by deconvolution of electrochemical impedance spectra

Science.gov (United States)

Manikandan, Balasundaram; Ramar, Vishwanathan; Yap, Christopher; Balaya, Palani

2017-09-01

The individual physico-chemical processes in lithium-ion batteries namely solid-state diffusion and charge transfer polarization are difficult to be tracked by impedance spectroscopy due to simultaneous contributions from cathode and anode. A deeper understanding of various polarization processes in lithium-ion batteries is important to enhance storage performance and cycle life. In this context, the polarization processes occurring in cylindrical 18650 cells comprising different cathodes against graphite anode (LiNi0.2Mn0.2Co0.6O2vs. graphite; LiNi0.6Mn0.2Co0.2O2vs. graphite; LiNi0.8Co0.15Al0.05O2vs. graphite and LiFePO4vs. graphite) are investigated by deconvolution of impedance spectra across various states of charge. Further, cathodes and anodes are extracted from the investigated 18650-type cells and tested in half-cells against Li-metal as well as in symmetric cell configurations to understand the contribution of cathode and anode to the full cells of various battery chemistries studied. Except for the LiFePO4vs. graphite cell, the polarization resistance in graphite of other cells are found to be higher than those of the investigated cathodes, proving that the polarization in lithium-ion battery is largely influenced by the graphitic anode. Furthermore, the charge transfer polarization resistance encountered by the cathodes investigated in this work is found to be a strong function of the states of charge.

On anodic stability and decomposition mechanism of sulfolane in high-voltage lithium ion battery

International Nuclear Information System (INIS)

Xing, Lidan; Tu, Wenqiang; Vatamanu, Jenel; Liu, Qifeng; Huang, Wenna; Wang, Yating; Zhou, Hebing; Zeng, Ronghua; Li, Weishan

2014-01-01

Graphical abstract: - Highlights: • Influence of lithium salts on the anodic stability of sulfolane has been investigated. • Oxidation decomposition mechanisms of LiPF 6 /Sulfolane electrolyte have been well understood by theoretical and experimental methods. • Decomposition products of the electrolyte can be found on the electrode surface and in the interfacial electrolyte. - Abstract: In this work, we investigated the anodic stability and decomposition mechanism of sulfolane (SL). The anodic stability of SL-based electrolyte with different lithium salts on Pt and LiNi 0.5 Mn 1.5 O 4 electrodes was found to decrease as follows: LiPF 6 /SL > LiBF 4 /SL > LiClO 4 /SL. The oxidation potential of 1M LiPF 6 /SL electrolyte on both Pt and electrodes is about 5.0V vs Li/Li + . The presence of PF 6 - and another SL solvent dramatically alters the decomposition mechanism of SL. Oxidation decomposition of SL-SL cluster is the most favorable reaction in LiPF 6 /SL electrolyte. The dimer products with S-O-R group were detected by IR spectra on the charged LiNi 0.5 Mn 1.5 O 4 electrode surface and in the electrolyte near the electrode surface, and were found to increase the interfacial reaction resistance of the LiNi 0.5 Mn 1.5 O 4 electrode

Effect of altered innervation and thyroid hormones on myosin heavy chain expression and fiber type transitions: a mini-review

Czech Academy of Sciences Publication Activity Database

Soukup, Tomáš; Smerdu, V.

2015-01-01

Roč. 143, č. 2 (2015), s. 123-130 ISSN 0948-6143 R&D Projects: GA MŠk(CZ) LH12058; GA MŠk(CZ) 7AMB14SK123 Grant - others:EC(XE) LSH-CT-2004-511978 Institutional support: RVO:67985823 Keywords : muscle fiber types * muscle regeneration * muscle transplantation * MyHC isoforms * thyroid hormone status * innervation Subject RIV: EA - Cell Biology Impact factor: 2.780, year: 2015

Cytotoxicity of Nanoliposomal Cisplatin Coated with Synthesized ...

African Journals Online (AJOL)

Purpose: To evaluate the cytotoxicity of pegylated nanoliposomal cisplatin on human ovarian cancer cell line A2780CP. Methods: Synthesized methoxypolyethylene glycol (mPEG) propionaldehyde was characterized by 1Hnuclear magnetic resonance (1H-NMR) and Fourier transform infrared spectroscopy (FTIR) and used ...

Antiproliferative Compounds of Cyphostemma greveana from a Madagascar Dry Forest[1

OpenAIRE

Cao, Shugeng; Hou, Yanpeng; Brodie, Peggy; Miller, James S.; Randrianaivo, Richard; Rakotobe, Etienne; Rasamison, Vincent E.; Kingston, David G. I.

2011-01-01

Bioassay-guided fractionation of the EtOH extracts obtained from a plant identified as Cyphostemma greveana Desc. (Vitaceae) led to the identification of one macrolide, lasiodiplodin (1), three sesquiterpenoids, 12-hydroxy-15-oxo-selina-4,1l-diene (2), 1β,6α-dihydroxyeudesm-4(15)-ene (3), and (7R*)-opposit-4(15)-ene-1β,7-diol (5), and the new diterpenoid, 16,18-dihydroxykolavenic acid lactone (4). All the isolates were tested against the A2780 human ovarian cancer cell line, and compound 4 an...

Synthesis, characterisation and biological properties of gold(III) compounds with modified bipyridine and bipyridylamine ligands.

Science.gov (United States)

Casini, Angela; Diawara, Mariam Celine; Scopelliti, Rosario; Zakeeruddin, Shaik Mohammed; Grätzel, Michael; Dyson, Paul J

2010-03-07

Square planar gold(III) complexes that contain functionalised bipyridine ligands of general formula [Au(N--N)Cl(2)][PF(6)] [where N--N = 2,2'-bipyridine, 4,4'-dimethyl-2,2'-bipyridine, 4,4'-dimethoxy-2,2'-bipyridine and 4,4'-diamino-2,2'-bipyridine] have been prepared and characterised by NMR spectroscopy and mass spectrometry. Two of the complexes have also been characterised in the solid state by X-ray crystallography. In addition, a gold(iii) compound bearing a dipyridin-2-ylamine ligand was also prepared and characterised. The complexes were found to undergo hydrolysis under pseudo-physiological conditions. Moreover, the complexes showed moderate to good cytotoxicity in vitro towards the A2780 human ovarian carcinoma cell line and the cisplatin resistant variant A2780cisR. Reactivity studies with biomolecules, such as reducing agents, plasmid DNA and a model protein (ubiquitin) were also performed to provide tentative insights into the mode of action of the complexes.

The influence of cycling temperature and cycling rate on the phase specific degradation of a positive electrode in lithium ion batteries: A post mortem analysis

Science.gov (United States)

Darma, Mariyam Susana Dewi; Lang, Michael; Kleiner, Karin; Mereacre, Liuda; Liebau, Verena; Fauth, Francois; Bergfeldt, Thomas; Ehrenberg, Helmut

2016-09-01

The influence of cycling temperatures and cycling rates on the cycling stability of the positive electrode (cathode) of commercial batteries are investigated. The cathode is a mixture of LiMn2O4 (LMO), LiNi0.5Co0.2Mn0.3O2 (NCM) and LiNi0.8Co0.15Al0.05O2 (NCA). It is found that increasing the cycling temperature from 25 °C to 40 °C is detrimental to the long term cycling stability of the cathode. Contrastingly, the improved cycling stability is observed for the cathodes cycled at higher charge/discharge rate (2C/3C instead of 1C/2C). The microstructure analysis by X-ray powder diffraction reveals that a significant capacity fading and an increased overvoltage is observed for NCM and NCA in all the fatigued cathodes. After high number of cycling (above 1500 cycles), NCM becomes partially inactive. In contrast to NCM and NCA, LMO shows a good cycling stability at 25 °C. A pronounced degradation of LMO is only observed for the fatigued cathodes cycled at 40 °C. The huge capacity losses of NCM and NCA are most likely because the blended cathodes were cycled up to 4.12 V vs. the graphite anode during the cycle-life test (corresponds to 4.16 V vs. Li+/Li); which is beyond the stability limit of the layered oxides below 4.05 V vs. Li+/Li.

Bulletin of Materials Science | News

Indian Academy of Sciences (India)

Layered LiNi1/3Co1/3Mn1/3O2 was synthesized by a citric acid assisted ... was investigated by the galvanostatic intermittent titration technique (GITT) ... The State Key Laboratory Base of Novel Functional Materials and Preparation Science; ...

Synthesis, dielectric, conductivity and magnetic studies of LiNi1/3Co1/3Mn(1/3−xAlxO2 (x = 0.0, 0.02, 0.04 and 0.06 for cathode materials of lithium-ion batteries

Directory of Open Access Journals (Sweden)

N. Murali

Full Text Available Layered structure cathode materials LiNi1/3Co1/3Mn(1/3−xAlxO2 (x = 0.0, 0.02, 0.04 and 0.06 are prepared by the sol-gel method by adding citric acid as chelating agent. The physical, electrical and magnetic properties of the synthesized materials are systematically discussed using the structural (XRD, FESEM with EDS and FT-IR, impedance (LCR and electron spin resonance (ESR measurements. The X-ray diffraction pattern of the synthesized samples possessed the α-NaFeO2 structure of the space group, R3¯m, with no evidence of any impurities. The peak intensity ratio I(104/I(003 increased with Al concentration, which indicated the cation mixing between transition metal layer and lithium layer. The field effect scanning electron microscopy showed the particle size distribution in the range of 230–250 nm and EDS has been analysed for elemental mapping. The local structure is investigated by vibrational spectroscopy in FT-IR study. The impedance studies are characterized by complex impedance spectroscopy (CIS in the frequency range from 42 Hz to 1 MHz at room temperature (30 °C. The dielectric properties are analyzed in the framework of complex dielectric permittivity and formalism of the complex electric modulus. For these samples, the ESR analysis of magnetic measurements, the degree of cation mixing, is estimated to be Ni2+(3b = 2.75%. Keywords: Layered structure, XRD, FESEM, FT-IR, Dielectric, ESR

Modeling Dry Deposition of Aerosol Particles on Rough Surfaces

Czech Academy of Sciences Publication Activity Database

Hussein, T.; Smolík, Jiří; Kerminen, V.-M.; Kulmala, M.

2012-01-01

Roč. 46, č. 1 (2012), s. 44-59 ISSN 0278-6826 Institutional research plan: CEZ:AV0Z40720504 Keywords : aerosol particles * dry deposition * transport Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.780, year: 2012

Defect physics vis-à-vis electrochemical performance in layered mixed-metal oxide cathode materials

Science.gov (United States)

Hoang, Khang; Johannes, Michelle

Layered mixed-metal oxides with different compositions of (Ni,Co,Mn) [NCM] or (Ni,Co,Al) [NCA] have been used in commercial lithium-ion batteries. Yet their defect physics and chemistry is still not well understood, despite having important implications for the electrochemical performance. In this presentation, we report a hybrid density functional study of intrinsic point defects in the compositions LiNi1/3Co1/3Mn1/3O2 (NCM1/3) and LiNi1/3Co1/3Al1/3O2 (NCA1/3) which can also be regarded as model compounds for NCM and NCA. We will discuss defect landscapes in NCM1/3 and NCA1/3 under relevant synthesis conditions with a focus on the formation of metal antisite defects and its implications on the electrochemical properties and ultimately the design of NCM and NCA cathode materials.

High-Thermal- and Air-Stability Cathode Material with Concentration-Gradient Buffer for Li-Ion Batteries.

Science.gov (United States)

Shi, Ji-Lei; Qi, Ran; Zhang, Xu-Dong; Wang, Peng-Fei; Fu, Wei-Gui; Yin, Ya-Xia; Xu, Jian; Wan, Li-Jun; Guo, Yu-Guo

2017-12-13

Delivery of high capacity with high thermal and air stability is a great challenge in the development of Ni-rich layered cathodes for commercialized Li-ion batteries (LIBs). Herein we present a surface concentration-gradient spherical particle with varying elemental composition from the outer end LiNi 1/3 Co 1/3 Mn 1/3 O 2 (NCM) to the inner end LiNi 0.8 Co 0.15 Al 0.05 O 2 (NCA). This cathode material with the merit of NCM concentration-gradient protective buffer and the inner NCA core shows high capacity retention of 99.8% after 200 cycles at 0.5 C. Furthermore, this cathode material exhibits much improved thermal and air stability compared with bare NCA. These results provide new insights into the structural design of high-performance cathodes with high energy density, long life span, and storage stability materials for LIBs in the future.

Triphenyltin derivatives of sulfanylcarboxylic esters.

Science.gov (United States)

Casas, José S; Couce, María D; Sánchez, Agustín; Seoane, Rafael; Sordo, José; Perez-Estévez, Antonio; Vázquez-López, Ezequiel

2018-03-01

The reaction of 3-(aryl)-2-sulfanylpropenoic acids [H 2 xspa; x: p=3-phenyl-, f=3-(2-furyl)-, t=3-(2-thienyl)-] with methanol or ethanol gave the corresponding methyl (Hxspme) or ethyl (Hxspee) esters. The reaction of these esters (HL) with triphenyltin(IV) hydroxide gave compounds of the type [SnPh 3 L], which were isolated and characterized as solids by elemental analysis, IR spectroscopy and mass spectrometry and in solution by multinuclear ( 1 H, 13 C and 119 Sn) NMR spectroscopy. The structures of [SnPh 3 (pspme)], [SnPh 3 (fspme)] and [SnPh 3 (fspee)] were determined by X-ray diffractometry and the antimicrobial activity against E. coli, S. aureus, B. subtilis, P. aeruginosa, Resistant P. aeruginosa (a strain resistant to 'carbapenem'), and C. albicans was tested and the in vitro cytotoxic activity against the HeLa-229, A2780 and A2780cis cell lines was determined for all compounds. Copyright © 2017 Elsevier Inc. All rights reserved.

Organometallic rhodium(III) and iridium(III) cyclopentadienyl complexes with curcumin and bisdemethoxycurcumin co-ligands.

Science.gov (United States)

Pettinari, Riccardo; Marchetti, Fabio; Pettinari, Claudio; Condello, Francesca; Petrini, Agnese; Scopelliti, Rosario; Riedel, Tina; Dyson, Paul J

2015-12-21

A series of half-sandwich cyclopentadienyl rhodium(III) and iridium(III) complexes of the type [Cp*M(curc/bdcurc)Cl] and [Cp*M(curc/bdcurc)(PTA)][SO3CF3], in which Cp* = pentamethylcyclopentadienyl, curcH = curcumin and bdcurcH = bisdemethoxycurcumin as O^O-chelating ligands, and PTA = 1,3,5-triaza-7-phosphaadamantane, is described. The X-ray crystal structures of three of the complexes, i.e. [Cp*Rh(curc)(PTA)][SO3CF3] (5), [Cp*Rh(bdcurc)(PTA)][SO3CF3] (6) and [Cp*Ir(bdcurc)(PTA)][SO3CF3] (8), confirm the expected "piano-stool" geometry. With the exception of 5, the complexes are stable under pseudo-physiological conditions and are moderately cytotoxic to human ovarian carcinoma (A2780 and A2780cisR) cells and also to non-tumorigenic human embryonic kidney (HEK293) cells, but lack the cancer cell selectivity observed for related arene ruthenium(II) complexes.

Virtuelle Fachbibliothek Sozialwissenschaften - Projektskizze

OpenAIRE

Kluck, Michael; Krause, Jürgen; Müller, Matthias N.O.; Schmiede, Rudi; Wenzel, H.; Winkler, Stefan; Meier, Wolfgang

2000-01-01

Das Projekt zielt auf die integrierte Bereitstellung sozialwissenschaftlicher Literaturinformationen aus verteilten und inhaltlich unterschiedlich erschlossenen Datenbeständen. In erster Linie sollen Probleme des inhaltlichen Zugriffs auf solch heterogene Dokumentenbestände gelöst werden.

Economical recycling process for spent lithium-ion batteries and macro- and micro-scale mechanistic study

Science.gov (United States)

Li, Li; Bian, Yifan; Zhang, Xiaoxiao; Xue, Qing; Fan, Ersha; Wu, Feng; Chen, Renjie

2018-02-01

An economical effective method is developed for recycling spent LiNi1/3Co1/3Mn1/3O2 cathodes, where more than 98% Li, Co, Ni and Mn can be leached out with different organic acids, and resynthesized to LiNi1/3Co1/3Mn1/3O2. The leaching mechanism is investigated at macro- and micro-scales. The particles undergo a loosening-breaking-shrinking change for two acids, while the FTIR and UV-vis spectra indicate different coordination reactions. The performance of LiNi1/3Co1/3Mn1/3O2 resynthesized from the leachate of the acetic acid leaching (NCM-Ac) and maleic acid leaching (NCM-Ma) are compared. The first discharge capacity of NCM-Ma and NCM-Ac at 0.2C are 151.6 and 115.0 mA h g-1, respectively. The much better performance of NCM-Ma than NCM-Ac results from the different coordination of the two acids in the sol-gel process, where the maleic acid can esterify to establish a stable network to chelate metal ions, while the weak chelation of acetic acid leads to the formation of impurities. The economics analysis including the cost of leaching acid and energy consumption shows that the price of organic acids and reducing agents, short leaching time, low temperature and high-valued products are the effective way to increase recycling and environmental benefits, which shows advantages in terms of resources cost and added value.

Ananthakrishna, Prof. Garani

Indian Academy of Sciences (India)

Date of birth: 11 December 1942. Specialization: Theoretical Materials Science, Condensed Matter and Dynamical Systems & Chaos Address: Materials Research Centre, Indian Institute of Science, Bengaluru 560 012, Karnataka Contact: Office: (080) 2293 2780. Residence: (080) 4953 5791. Mobile: 99002 68902

Solution combustion synthesis of the nanocrystalline NCM oxide for lithium-ion battery uses

Science.gov (United States)

Habibi, Amirhosein; Jalaly, Maisam; Rahmanifard, Roohollah; Ghorbanzadeh, Milad

2018-02-01

In this study, the NCM cathode with a chemical composition of {{{LiNi}}}1/3}{{{Co}}}1/3}{{{Mn}}}1/3}{{{O}}}2 were synthesized through a solution combustion method. In this method, metal nitrates and urea were used as precursors and fuel, respectively. The powder obtained from combustion were transferred into a alumina crucible and insert to the muffle furnace and calcined at 750 °C for 15 h. The crystallite size of the sample was calculated with sherer equation to be about 41 nm. The prepared cathode were characterized using x-ray diffraction (XRD), scanning electron microscopy (SEM), thermogravimetry analysis (TGA), differential scanning calorimetry (DSC) and battery charge-discharge test. The initial charge and discharge capacities of {{{LiNi}}}1/3}{{{Co}}}1/3}{{{Mn}}}1/3}{{{O}}}2 electrode containing 94% active material at a rate of 0.05 C in voltage window of 2.5-4.3 V at room temperature was obtained 168.03 and 150.01 mAh g-1, respectively.

Histone deacetylase inhibitors restore IL-10 expression in lipopolysaccharide-induced cell inflammation and reduce IL-1β and IL-6 production in breast silicone implant in C57BL/6J wild-type murine model.

Science.gov (United States)

Di Liddo, Rosa; Valente, Sergio; Taurone, Samanta; Zwergel, Clemens; Marrocco, Biagina; Turchetta, Rosaria; Conconi, Maria Teresa; Scarpa, Carlotta; Bertalot, Thomas; Schrenk, Sandra; Mai, Antonello; Artico, Marco

2016-01-20

Among epigenetic enzymes, histone deacetylases (HDACs) are responsible for regulating the expression of an extensive array of genes by reversible deacetylation of nuclear histones as well as a large number of non-histone proteins. Initially proposed for cancer therapy, recently the interest for HDAC inhibitors (HDACi) as orally active, safe, and anti-inflammatory agents is rising due to their ability in reducing the severity of inflammatory and autoimmune diseases. In particular, selective HDAC3, HDAC6, and HDAC8 inhibitors have been described to downregulate the expression of pro-inflammatory cytokines (TNF-α, TGF-β, IL-1β, and IL-6). Herein, using KB31, C2C12, and 3T3-J2 cell lines, we demonstrated that, under lipopolysaccharide-induced in vitro inflammation, HDAC3/6/8 inhibitor MC2625 and HDAC6-selective inhibitor MC2780 were effective at a concentration of 30 ng/mL to downregulate mRNA expression of pro-inflammatory cytokines (IL-1β and IL-6) and to promote the transcription of IL-10 gene, without affecting the cell viability. Afterwards, we investigated by immunohistochemistry the activity of MC2625 and MC2780 at a concentration of 60 ng/kg animal weight to regulate silicone-triggered immune response in C57BL/6J female mice. Our findings evidenced the ability of such inhibitors to reduce host inflammation in silicone implants promoting a thickness reduction of peri-implant fibrous capsule, upregulating IL-10 expression, and reducing the production of both IL-1β and IL-6. These results underline the potential application of MC2625 and MC2780 in inflammation-related diseases.

Cytotoxic and Pro-Apoptotic Effects of Honey Bee Venom and Chrysin on Human Ovarian Cancer Cells

Directory of Open Access Journals (Sweden)

Elaheh Amini

2015-06-01

Full Text Available Background: The anti-cancer effects of honey bee venom (BV and chrysin might open a new window for treatment of chemo-resistant cancers. This study was designed to evaluate cytotoxic and pro-apoptotic effects of BV and chrysin on A2780cp cistplatin- resistant human ovarian cancer cells. Methods: As per the study objectives, A2780cp cells were categorized to 4 groups: 3 experiment groups (treated either with BV or chrysin or BV + chrysin and 1 control group (untreated cells.  Experiment group cells were cultured and treated by different concentrations of BV and chrysin for 24 hours. Then, experiment and control cells were studied with MTT assay, Annexin V-FITC, DAPI and Acridine Orange / Propidium Iodide statining, flow cytometry, caspase-3 and -9 assay, measurement of intracellular level of reactive oxygen species (ROS and RT-PCR. Results: MTT assay showed that 8 μg/mL BV, 40 µg/ml chrysin and 6 + 15 μg/mL BV + chrysin co-treatment induced 50% cell death on A2780cp cells compared with controls (P < 0.001. Morphological observations by inverted and fluorescent microscopy revealed ROS generation and apoptotic cell death under exposure to BV or chrysin or BV + chrysin co-treatment. Caspase-3 and -9 assay demonstrated that BV and chrysin triggered apoptosis through intrinsic pathway and RT-PCR demonstrated down-regulation of Bcl-2. Conclusion: Honey bee venom and chrysin are effective for destroying chemoresistant ovarian cancer cells through activation of intrinsic apoptosis, which propose them as potential candidates to be used in development of improved chemotherapeutic agents in the future.

Fideo ja Vilm Pärnus

Index Scriptorium Estoniae

1999-01-01

Pärnu Fideo- ja Vilmifestival 2.-3. apr. Muuseumi Aidas. Margus Tiitsmaa ja Sütevaka Andrese performance'test. Jasper Zoova ja Erno Võsa installatsioonist "Eesti mehe ja naise identifitseerimise masin". Taivani kunstniku Eliza Lin'i fotoinstallatsioonist ja videost

Hepatitis B X-interacting protein promotes cisplatin resistance and regulates CD147 via Sp1 in ovarian cancer.

Science.gov (United States)

Zou, Wei; Ma, Xiangdong; Yang, Hong; Hua, Wei; Chen, Biliang; Cai, Guoqing

2017-03-01

Ovarian cancer is the highest mortality rate of all female reproductive malignancies. Drug resistance is a major cause of treatment failure in malignant tumors. Hepatitis B X-interacting protein acts as an oncoprotein, regulates cell proliferation, and migration in breast cancer. We aimed to investigate the effects and mechanisms of hepatitis B X-interacting protein on resistance to cisplatin in human ovarian cancer cell lines. The mRNA and protein levels of hepatitis B X-interacting protein were detected using RT-PCR and Western blotting in cisplatin-resistant and cisplatin-sensitive tissues, cisplatin-resistant cell lines A2780/CP and SKOV3/CP, and cisplatin-sensitive cell lines A2780 and SKOV3. Cell viability and apoptosis were measured to evaluate cellular sensitivity to cisplatin in A2780/CP cells. Luciferase reporter gene assay was used to determine the relationship between hepatitis B X-interacting protein and CD147. The in vivo function of hepatitis B X-interacting protein on tumor burden was assessed in cisplatin-resistant xenograft models. The results showed that hepatitis B X-interacting protein was highly expressed in ovarian cancer of cisplatin-resistant tissues and cells. Notably, knockdown of hepatitis B X-interacting protein significantly reduced cell viability in A2780/CP compared with cisplatin treatment alone. Hepatitis B X-interacting protein and cisplatin cooperated to induce apoptosis and increase the expression of c-caspase 3 as well as the Bax/Bcl-2 ratio. We confirmed that hepatitis B X-interacting protein up-regulated CD147 at the protein expression and transcriptional levels. Moreover, we found that hepatitis B X-interacting protein was able to activate the CD147 promoter through Sp1. In vivo, depletion of hepatitis B X-interacting protein decreased the tumor volume and weight induced by cisplatin. Taken together, these results indicate that hepatitis B X-interacting protein promotes cisplatin resistance and regulated CD147 via Sp1 in

Spurious Additional Warming Reconstructed From Borehole\

Czech Academy of Sciences Publication Activity Database

Šafanda, Jan

2018-01-01

Roč. 45, č. 6 (2018), s. 2780-2785 ISSN 0094-8276 R&D Projects: GA MŠk(CZ) EF16_013/0001792 Institutional support: RVO:67985530 Subject RIV: DC - Siesmology, Volcanology, Earth Structure OBOR OECD: Volcanology Impact factor: 4.253, year: 2016

75 FR 61747 - Union Leader Corporation; Supplemental Notice That Initial Market-Based Rate Filing Includes...

Science.gov (United States)

2010-10-06

... of Union Leader Corporation's application for market-based rate authority, with an accompanying rate... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. ER10-2780-000] Union Leader Corporation; Supplemental Notice That Initial Market-Based Rate Filing Includes Request for Blanket Section...

Studies of local degradation phenomena in composite cathodes for lithium-ion batteries

International Nuclear Information System (INIS)

Kerlau, Marie; Marcinek, Marek; Srinivasan, Venkat; Kostecki, Robert M.

2007-01-01

LiNi 0.8 Co 0.15 Al 0.05 O 2 and LiNi 1/3 Co 1/3 Mn 1/3 O 2 composite cathodes were cycled in model cells to study interfacial phenomena that could lead to electrode degradation. Ex situ spectroscopic analysis of the tested cathodes, which suffered substantial power and capacity loss, showed that the state of charge (SOC) of oxide particles on the cathode surface was highly non-uniform despite the deep discharge of the Li-ion cell at the end of the test. The inconsistent kinetic behavior of individual oxide particles was attributed to the degradation of electronic pathways within the composite cathodes. A simple theoretical model based on a distributed network showed that an increase of the contact resistance between composite electrode particles may be responsible for non-uniform local kinetic behavior of individual oxide particles and the overall degradation of electrochemical performance of composite electrodes

Unbounded planar domains whose second nodal line does not touch the boundary

Czech Academy of Sciences Publication Activity Database

Freitas, P.; Krejčiřík, David

2007-01-01

Roč. 14, č. 1 (2007), s. 107-111 ISSN 1073-2780 R&D Projects: GA MŠk LC06002 Institutional research plan: CEZ:AV0Z10480505 Keywords : Dirichlet Laplacian * eigenfunctions * nodal line Subject RIV: BA - General Mathematics Impact factor: 0.702, year: 2007

Inhibitory specificity and insecticidal selectivity of alpha-amylase inhibitor from Phaseolus vulgaris

Czech Academy of Sciences Publication Activity Database

Kluh, Ivan; Horn, Martin; Hýblová, Jana; Hubert, J.; Dolečková, Lucie; Voburka, Zdeněk; Kudlíková, I.; Kocourek, F.; Mareš, Michael

2005-01-01

Roč. 66, - (2005), 31-39 ISSN 0031-9422 R&D Projects: GA MŠk(CZ) OC D16.001 Institutional research plan: CEZ:AV0Z4055905 Keywords : enzyme inhibition * digestive enzyme Subject RIV: FD - Oncology ; Hematology Impact factor: 2.780, year: 2005

Ovarian and Breast Cancer Spheres Are Similar in Transcriptomic Features and Sensitive to Fenretinide

Directory of Open Access Journals (Sweden)

Haiwei Wang

2013-01-01

Full Text Available Cancer stem cells (CSCs are resistant to chemotherapy and are ability to regenerate cancer cell populations, thus attracting much attention in cancer research. In this report, we first demonstrated that sphere cells from ovarian cancer cell line A2780 shared many features of CSCs, such as resistance to cisplatin and able to initiate tumors in an efficient manner. Then, we conducted cDNA microarray analysis on spheres from ovarian A2780 cells, and from breast MCF7 and SUM159 cells, and found that molecular pathways underlying spheres from these cancer cell lines were similar to a large extent, suggesting that similar mechanisms are involved in the genesis of CSCs in both ovarian and breast cancer types. In addition, we showed that spheres from these cancer types were highly sensitive to fenretinide, a stimulus of oxidative stress-mediated apoptosis in cancer cells. Thus, our results not only provide important insights into mechanisms underlying CSCs in ovarian and breast cancer, but also lead to the development of more sophisticated protocols of cancer therapy in near future.

Botrytis cinerea als parasiet van vlas

NARCIS (Netherlands)

Spek, van der J.

1965-01-01

After some introductory words on flax, different forms of the parasite Botrytis cinerea Pers. ex Fr. were compared. Use of differences in production of organic acids as done by van Beyma Thoe Kingma were not a satisfactory distinction between formae lini of Botrytis. The M, Sc and Sp growth forms,

22 CFR 127.10 - Civil penalty.

Science.gov (United States)

2010-04-01

... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Civil penalty. 127.10 Section 127.10 Foreign... Civil penalty. (a) The Assistant Secretary of State for Political-Military Affairs is authorized to impose a civil penalty in an amount not to exceed that authorized by 22 U.S.C. 2778, 2779a and 2780 for...

Determination of 129 I in biomonitors collected in the vicinity of a nuclear power plant by neutron activation analysis

Czech Academy of Sciences Publication Activity Database

Krausová, Ivana; Kučera, Jan; Světlík, Ivo

2012-01-01

Roč. 293, 13Sep2012 (2012), s. 1-6 ISSN 1588-2780 R&D Projects: GA ČR(CZ) GBP108/12/G108; GA MŠk(XE) LM2011019 Institutional support: RVO:61389005 Keywords : Iodine-129 * neutron activation analysis * biomonitor * nuclear power plant * Thyroid gland Subject RIV: CB - Analytical Chemistry, Separation http://download.springer.com/static/pdf/725/art%253A10.1007%252Fs10967-012-2200-5.pdf?auth66=1361263915_42267d28376ca81c4fc0de53c3cb59f4&ext=.pdf

Effect of mixed and single crops on disease suppressiveness of soils

NARCIS (Netherlands)

Hiddink, G.A.; Termorshuizen, A.J.; Raaijmakers, J.M.; Bruggen, van A.H.C.

2005-01-01

The effect of mixed cropping on disease suppressiveness of soils was tested for two cropping systems, Brussels sprouts¿barley and triticale¿white clover. Disease suppressiveness of field soils was evaluated in bioassays for the soilborne pathogens Rhizoctonia solani, Fusarium oxysporum f. sp. lini,

75 FR 80430 - Passenger Car and Light Truck Average Fuel Economy Standards Request for Product Plan Information...

Science.gov (United States)

2010-12-22

... energy of the battery. d. Battery Chemistry for Cathode--Chemistries such as LiNi 0.8 Co 0.15 Al 0.05 O 2 (NCA ), LiFePO 4 (LFP), LiMn 2 O 4 (MS), etc. e. Battery Chemistry for Anode--Chemistries such as...

Bulletin of Materials Science | Indian Academy of Sciences

Indian Academy of Sciences (India)

hexylthiophene)- graft -carbon nanotubes with LiNi 0.5 Mn 1.5 O _4$ and its application as potential cathode materials for lithium-ion batteries · THANG VAN LE THU ANH NGUYEN NGUYET MINH THI NGUYEN ANH TUAN LUU LE-THU T NGUYEN HA ...

Understanding the Role of Temperature and Cathode Composition on Interface and Bulk: Optimizing Aluminum Oxide Coatings for Li-Ion Cathodes

International Nuclear Information System (INIS)

Han, Binghong; Paulauskas, Tadas; Key, Baris; Peebles, Cameron; Park, Joong Sun

2017-01-01

Here, surface coating of cathode materials with Al_2O_3 has been shown to be a promising method for cathode stabilization and improved cycling performance at high operating voltages. However, a detailed understanding on how coating process and cathode composition changes the chemical composition, morphology and distribution of coating within cathode interface and bulk lattice, is still missing. In this study, we use a wet-chemical method to synthesize a series of Al_2O_3-coated LiNi_0_._5Co_0_._2Mn_0_._3O_2 and LiCoO_2 cathodes treated under various annealing temperatures and a combination of structural characterization techniques to understand the composition, homogeneity and morphology of coating layer and the bulk cathode. Nuclear magnetic resonance and electron microscopy results reveal that the nature of the interface is highly depended on the annealing temperature and cathode composition. For Al_2O_3-coated LiNi_0_._5Co_0_._2Mn_0_._3O_2, higher annealing temperature leads to more homogeneous and more closely attached coating on cathode materials, corresponding to better electrochemical performance. Lower Al_2O_3 coating content is found to be helpful to further improve the initial capacity and cyclability, which can greatly outperform the pristine cathode material. For Al_2O_3-coated LiCoO_2, the incorporation of Al into the cathode lattice is observed after annealing at high temperatures, implying the transformation from “surface coatings” to “dopants”, which is not observed for LiNi_0_._5Co_0_._2Mn_0_._3O_2. As a result, Al_2O_3-coated LiCoO_2 annealed at higher temperature shows similar initial capacity but lower retention compared to that annealed at a lower temperature, due to the intercalation of surface alumina into the bulk layered structure forming a solid solution.

Understanding the Role of Temperature and Cathode Composition on Interface and Bulk: Optimizing Aluminum Oxide Coatings for Li-Ion Cathodes.

Science.gov (United States)

Han, Binghong; Paulauskas, Tadas; Key, Baris; Peebles, Cameron; Park, Joong Sun; Klie, Robert F; Vaughey, John T; Dogan, Fulya

2017-05-03

Surface coating of cathode materials with Al 2 O 3 has been shown to be a promising method for cathode stabilization and improved cycling performance at high operating voltages. However, a detailed understanding on how coating process and cathode composition change the chemical composition, morphology, and distribution of coating within the cathode interface and bulk lattice is still missing. In this study, we use a wet-chemical method to synthesize a series of Al 2 O 3 -coated LiNi 0.5 Co 0.2 Mn 0.3 O 2 and LiCoO 2 cathodes treated under various annealing temperatures and a combination of structural characterization techniques to understand the composition, homogeneity, and morphology of the coating layer and the bulk cathode. Nuclear magnetic resonance and electron microscopy results reveal that the nature of the interface is highly dependent on the annealing temperature and cathode composition. For Al 2 O 3 -coated LiNi 0.5 Co 0.2 Mn 0.3 O 2 , higher annealing temperature leads to more homogeneous and more closely attached coating on cathode materials, corresponding to better electrochemical performance. Lower Al 2 O 3 coating content is found to be helpful to further improve the initial capacity and cyclability, which can greatly outperform the pristine cathode material. For Al 2 O 3 -coated LiCoO 2 , the incorporation of Al into the cathode lattice is observed after annealing at high temperatures, implying the transformation from "surface coatings" to "dopants", which is not observed for LiNi 0.5 Co 0.2 Mn 0.3 O 2 . As a result, Al 2 O 3 -coated LiCoO 2 annealed at higher temperature shows similar initial capacity but lower retention compared to that annealed at a lower temperature, due to the intercalation of surface alumina into the bulk layered structure forming a solid solution.

Experiences in the formalisation and verification of medical protocols

OpenAIRE

Balser, Michael

2003-01-01

Experiences in the formalisation and verification of medical protocols / M. Balser ... - In: Artificial intelligence in medicine : 9th Conference on Artificial Intelligence in Medicine in Europe, AIME 2003, Protaras, Cyprus, October 18 - 22, 2003 ; proceedings / Michel Dojat ... (eds.). - Berlin u.a. : Springer, 2003. - S. 132-141. - (Lecture notes in computer science ; 2780 : Lecture notes in artificial intelligence)

Bulletin of Materials Science | News

Indian Academy of Sciences (India)

... nickel oxides, LiNi0.8M0.2O2 and LiCo0.8M0.2O2 (M = Mg2+, Ca2+, Ba2+), ... Department of Industrial Chemistry, Alagappa University, Karaikudi 630 003, India; Department of Chemical Engineering, Yonsei University, Seodaemun-Ku, ...

Zyklischer Vitalismus

DEFF Research Database (Denmark)

Halse, Sven

2013-01-01

Der ”Vitalismus” hat sich in den letzten Jahren in Teilen der skandinavischen Forschung als kulturanalytischer Begriff durchgesetzt. Er wurde in erster Linie für die Identifikation und Charakteristik der stärke-, gesundheits- und schönheitspreisenden Kunstströmung zwischen 1890 und1930 verwendet...

Ufundishaji wa Kusoma na Kuandika Kiswahili: Uzoefu wa Idara ya ...

African Journals Online (AJOL)

Makala haya yanahusu shughuli za kufundisha Kiswahili kama lugha ya kigeni katika Chuo Kikuu cha Sebha nchini Libya. Kwanza inaeleza historia ya Kiswahili – yaani kilianza lini kufundishwa kwa madhumuni gani na nani walikuwa wanzilishi. Halikadhalika makala ya naeleza utaratibu uliowekwa na idara ili kuweza ...

USAFA/8086 - A State of the Art Microprocessor System. Volume II. Software Documentation.

Science.gov (United States)

1980-06-01

8217IDENT’ IS USED TO IDENTIFY WHICH OF THE TWO LINKIAGE MAP BlUFFERS (IDENT IS LINKI , IDENT-- IS LINK2) THAT IS TO BE USED. 4/ 32 1 LINKSIN$OUT...CALL DATSIN$OT(, FMDRIVE, LINKi (I). TRK, , - LINi(I). SECT, 9); /s WRITE NEW FILE s 429, 4 CALL DfITAINOUT(iTODRELINK2I). TRIG LINK2(I). SECT, 9); 439...CALL DATR$INSOU(B, DRIVE, RTRACK, RSECTOR, PTR); 559 4 END, /* GET NEXT LINKAGE WI SECTOR *i- 568 3 LINKECTO=INK W SECT; 561 3 LINKTRACK- LINKi (1

Coloring of radiation damages in ion-implanted poly(aryl ether ether ketone): LiCl uptake and thermal desorption

Czech Academy of Sciences Publication Activity Database

Červená, Jarmila; Vacík, Jiří; Hnatowicz, Vladimír; Švorčík, V.; Kobayashi, Y.

2002-01-01

Roč. 83, - (2002), s. 2780-2784 ISSN 0021-8995 R&D Projects: GA ČR GA203/99/1626; GA AV ČR IAA7011908; GA AV ČR KSK1010104 Keywords : irradiated peek Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.927, year: 2002

Author Details

African Journals Online (AJOL)

Bladergroen, B. Vol 60 (2007) - Articles Preparation and Characterization of Sulfonated Poly (ether ether ketone)/Phosphated Zirconia Nanoparticles Composite Proton-conducting Membranes Abstract PDF · Vol 61 (2008) - Articles Performance and Structure of LiNi0.5Mn1.5O4 Prepared from Various Ni Precursors for ...

Interactions of hydrated divalent metal cations with nucleic acid bases. How to relate the gas phase data to solution situation and binding selectivity in nucleic acids

Czech Academy of Sciences Publication Activity Database

Šponer, Judit E.; Sychrovský, Vladimír; Hobza, Pavel; Šponer, Jiří

2004-01-01

Roč. 6, č. 10 (2004), s. 2772-2780 ISSN 1463-9076 R&D Projects: GA MŠk LN00A016; GA MŠk LN00A032 Grant - others:Wellcome Trust(GB) GR067507MF Institutional research plan: CEZ:AV0Z5004920 Keywords : nucleic acids * gas phase * guanine Subject RIV: BO - Biophysics Impact factor: 2.076, year: 2004

Electrochemical reaction mechanisms under various charge-discharge operating conditions for Li1.2Ni0.13Mn0.54Co0.13O2 in a lithium-ion battery

Science.gov (United States)

Konishi, Hiroaki; Hirano, Tatsumi; Takamatsu, Daiko; Gunji, Akira; Feng, Xiaoliang; Furutsuki, Sho; Okumura, Takefumi; Terada, Shohei; Tamura, Kazuhisa

2018-06-01

The potential in each state of charge (SOC) during charging of Li1.2Ni0.13Mn0.54Co0.13O2 is higher than that during discharging. In other words, the potential hysteresis occurs between charging and discharging. Furthermore, the potential in each SOC changes according to the charge-discharge operating conditions, indicating that the charge-discharge reaction mechanism is also affected. To clarify the effect of charge-discharge operating conditions on the electrochemical reaction, Li1.2Ni0.13Mn0.54Co0.13O2 was charged and discharged under various charge-discharge operating ranges, and open-circuit potential (OCP), crystal structure, and oxidation states of the transition metals were evaluated by electrochemical measurement, X-ray diffraction (XRD), and X-ray absorption fine structure (XAFS). These results indicate that OCP, lattice parameters, and oxidation states of the transition metals of Li1.2Ni0.13Mn0.54Co0.13O2 in each SOC are not constant. The XRD results indicate that two phases, namely, LiNi0.33Mn0.33Co0.33O2-like and Li2MnO3-like, exist in Li1.2Ni0.13Mn0.54Co0.13O2. For the LiNi0.33Mn0.33Co0.33O2-like phase, the relationship between OCP, lattice parameters, and oxidation states of the transition metals in each SOC is not affected by the charge-discharge operating conditions, indicating that extraction and insertion of lithium ions for the LiNi0.33Mn0.33Co0.33O2-like phase progresses at almost the same potential. Although the extraction and insertion of lithium ions for the Li2MnO3-like phase progresses at almost the same potential in the low-SOC region, the OCP and lattice parameter in each SOC in the high-SOC region are not constant. Therefore, the extraction of lithium ions from the Li2MnO3-like phase in the high-SOC region causes the potential hysteresis of Li1.2Ni0.13Mn0.54Co0.13O2.

Characterization of Aerobic Chemical Processes in Reservoirs: Problem Description and Model Formulation.

Science.gov (United States)

1983-10-01

electrochemical potential at which water becomes unstable and is oxidized to molecular oxygen ( Baas Becking et al. 1960). Within the limits imposed by...Research, pp 169-175. Baas Becking , L. G. M., Kaplan, I . R. ,anid Moore, D. 1960. "Lini ts of the Na tu ral Environment in Terms of’ pH a rid Oxidat ion

Der Entwurf einer Musterwohnung für ältere Menschen mit Demenz

NARCIS (Netherlands)

Joost van Hoof

2014-01-01

Einführung Ältere Menschen mit Demenz brauchen Wohnungen, die sowohl altersgemäß ausgestattet sind als auch die erforderliche Pflege im Haus anbieten. Traditionelle Änderungen und entsprechende Technologien bieten in erster Linie Lösungen für Personen mit eingeschränkter Mobilität. Dies bedeutet,

Cancer-associated fibroblasts are not formed from cancer cells by epithelial-to-mesenchymal transition in nu/nu mice

Czech Academy of Sciences Publication Activity Database

Dvořánková, B.; Smetana Jr, K.; Říhová, Blanka; Kučera, J.; Mateu, R.; Szabo, P.

2015-01-01

Roč. 143, č. 5 (2015), s. 463-469 ISSN 0948-6143 R&D Projects: GA ČR(CZ) GAP301/12/1254; GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:61388971 Keywords : Cancer stroma * Cancer-associated fibroblast * Myofibroblast Subject RIV: EC - Immunology Impact factor: 2.780, year: 2015

Bonding Strength of Universal Adhesives To Er,Cr:YSGG Laser ...

African Journals Online (AJOL)

2018-02-07

Feb 7, 2018 ... E-mail: kerimayar@biruni.edu.tr smear layer ... increased, owing to their greater aesthetic properties and the potential ... produced by the selective ablation of the intertubular dentin ... 2.780 nm, power of 1.5 W, frequency of 20 Hz, pulse duration ..... Lopes RM, Trevelin LT, da Cunha SRB, de Oliveira RF, de.

Alterations in tumor necrosis factor signaling pathways are associated with cytotoxicity and resistance to taxanes: a study in isogenic resistant tumor cells

Science.gov (United States)

2012-01-01

Introduction The taxanes paclitaxel and docetaxel are widely used in the treatment of breast, ovarian, and other cancers. Although their cytotoxicity has been attributed to cell-cycle arrest through stabilization of microtubules, the mechanisms by which tumor cells die remains unclear. Paclitaxel has been shown to induce soluble tumor necrosis factor alpha (sTNF-α) production in macrophages, but the involvement of TNF production in taxane cytotoxicity or resistance in tumor cells has not been established. Our study aimed to correlate alterations in the TNF pathway with taxane cytotoxicity and the acquisition of taxane resistance. Methods MCF-7 cells or isogenic drug-resistant variants (developed by selection for surviving cells in increasing concentrations of paclitaxel or docetaxel) were assessed for sTNF-α production in the absence or presence of taxanes by enzyme-linked immunosorbent assay (ELISA) and for sensitivity to docetaxel or sTNF-α by using a clonogenic assay (in the absence or presence of TNFR1 or TNFR2 neutralizing antibodies). Nuclear factor (NF)-κB activity was also measured with ELISA, whereas gene-expression changes associated with docetaxel resistance in MCF-7 and A2780 cells were determined with microarray analysis and quantitative reverse transcription polymerase chain reaction (RTqPCR). Results MCF-7 and A2780 cells increased production of sTNF-α in the presence of taxanes, whereas docetaxel-resistant variants of MCF-7 produced high levels of sTNF-α, although only within a particular drug-concentration threshold (between 3 and 45 nM). Increased production of sTNF-α was NF-κB dependent and correlated with decreased sensitivity to sTNF-α, decreased levels of TNFR1, and increased survival through TNFR2 and NF-κB activation. The NF-κB inhibitor SN-50 reestablished sensitivity to docetaxel in docetaxel-resistant MCF-7 cells. Gene-expression analysis of wild-type and docetaxel-resistant MCF-7, MDA-MB-231, and A2780 cells identified changes

http://spilplus.journals.ac.za

African Journals Online (AJOL)

Linda always eats an ice-cream. Daar Is nie 'n lini^re verband gevind tussen die aantal jare blootstelling aan Engels en prestasie in take met VP-inisieie bywoorde nie. 5.2.3 Beoordeling en produksie van kongruensie. Produksie en beoordeling van kongruensie toon dieselfde grafiekvorm as wat by woordorde voorgekom ...

Synthetic Control of Kinetic Reaction Pathway and Cationic Ordering in High-Ni Layered Oxide Cathodes

Energy Technology Data Exchange (ETDEWEB)

Wang, Dawei [Sustainable Energy Technologies Department, Brookhaven National Laboratory, Upton NY 11973 USA; Collaborative Innovation Center of Chemistry for Energy Materials, State Key Laboratory Physical Chemistry Solid Surfaces, Department of Chemistry, Xiamen University, Xiamen Fujian 361005 China; Kou, Ronghui [X-Ray Science Division, Advanced Photon Source, Argonne National Laboratory, Argonne IL 60439 USA; Ren, Yang [X-Ray Science Division, Advanced Photon Source, Argonne National Laboratory, Argonne IL 60439 USA; Sun, Cheng-Jun [X-Ray Science Division, Advanced Photon Source, Argonne National Laboratory, Argonne IL 60439 USA; Zhao, Hu [Sustainable Energy Technologies Department, Brookhaven National Laboratory, Upton NY 11973 USA; Zhang, Ming-Jian [Sustainable Energy Technologies Department, Brookhaven National Laboratory, Upton NY 11973 USA; School of Advanced Materials, Peking University Shenzhen Graduate School, Shenzhen Guangdong 518055 P. R. China; Li, Yan [Chemical Sciences and Engineering Division, Argonne National Laboratory, Argonne IL 60439 USA; Huq, Ashifia [Chemical and Engineering Materials Division, Oak Ridge National Laboratory, Oak Ridge TN 37831 USA; Ko, J. Y. Peter [The Cornell High Energy Synchrotron Source, Cornell University, Ithaca NY 14853 USA; Pan, Feng [School of Advanced Materials, Peking University Shenzhen Graduate School, Shenzhen Guangdong 518055 P. R. China; Sun, Yang-Kook [Department of Energy Engineering, Hanyang University, Seoul 133-791 South Korea; Yang, Yong [Collaborative Innovation Center of Chemistry for Energy Materials, State Key Laboratory Physical Chemistry Solid Surfaces, Department of Chemistry, Xiamen University, Xiamen Fujian 361005 China; Amine, Khalil [Chemical Sciences and Engineering Division, Argonne National Laboratory, Argonne IL 60439 USA; Bai, Jianming [National Synchrotron Light Source II, Brookhaven National Laboratory, Upton NY 11973 USA; Chen, Zonghai [Chemical Sciences and Engineering Division, Argonne National Laboratory, Argonne IL 60439 USA; Wang, Feng [Sustainable Energy Technologies Department, Brookhaven National Laboratory, Upton NY 11973 USA

2017-08-25

Nickel-rich layered transition metal oxides, LiNi1-x(MnCo)(x)O-2 (1-x >= 0.5), are appealing candidates for cathodes in next-generation lithium-ion batteries (LIBs) for electric vehicles and other large-scale applications, due to their high capacity and low cost. However, synthetic control of the structural ordering in such a complex quaternary system has been a great challenge, especially in the presence of high Ni content. Herein, synthesis reactions for preparing layered LiNi0.7Mn0.15Co0.15O2 (NMC71515) by solid-state methods are investigated through a combination of time-resolved in situ high-energy X-ray diffraction and absorption spectroscopy measurements. The real-time observation reveals a strong temperature dependence of the kinetics of cationic ordering in NMC71515 as a result of thermal-driven oxidation of transition metals and lithium/oxygen loss that concomitantly occur during heat treatment. Through synthetic control of the kinetic reaction pathway, a layered NMC71515 with low cationic disordering and a high reversible capacity is prepared in air. The findings may help to pave the way for designing high-Ni layered oxide cathodes for LIBs.

Differential Cytotoxic Potential of Silver Nanoparticles in Human Ovarian Cancer Cells and Ovarian Cancer Stem Cells

Directory of Open Access Journals (Sweden)

Yun-Jung Choi

2016-12-01

Full Text Available The cancer stem cell (CSC hypothesis postulates that cancer cells are composed of hierarchically-organized subpopulations of cells with distinct phenotypes and tumorigenic capacities. As a result, CSCs have been suggested as a source of disease recurrence. Recently, silver nanoparticles (AgNPs have been used as antimicrobial, disinfectant, and antitumor agents. However, there is no study reporting the effects of AgNPs on ovarian cancer stem cells (OvCSCs. In this study, we investigated the cytotoxic effects of AgNPs and their mechanism of causing cell death in A2780 (human ovarian cancer cells and OvCSCs derived from A2780. In order to examine these effects, OvCSCs were isolated and characterized using positive CSC markers including aldehyde dehydrogenase (ALDH and CD133 by fluorescence-activated cell sorting (FACS. The anticancer properties of the AgNPs were evaluated by assessing cell viability, leakage of lactate dehydrogenase (LDH, reactive oxygen species (ROS, and mitochondrial membrane potential (mt-MP. The inhibitory effect of AgNPs on the growth of ovarian cancer cells and OvCSCs was evaluated using a clonogenic assay. Following 1–2 weeks of incubation with the AgNPs, the numbers of A2780 (bulk cells and ALDH+/CD133+ colonies were significantly reduced. The expression of apoptotic and anti-apoptotic genes was measured by real-time quantitative reverse transcriptase polymerase chain reaction (qRT-PCR. Our observations showed that treatment with AgNPs resulted in severe cytotoxicity in both ovarian cancer cells and OvCSCs. In particular, AgNPs showed significant cytotoxic potential in ALDH+/CD133+ subpopulations of cells compared with other subpopulation of cells and also human ovarian cancer cells (bulk cells. These findings suggest that AgNPs can be utilized in the development of novel nanotherapeutic molecules for the treatment of ovarian cancers by specific targeting of the ALDH+/CD133+ subpopulation of cells.

Identifying gaps in the surgical training curriculum in Rwanda through evaluation of operative activity at a teaching hospital.

Science.gov (United States)

Rickard, Jennifer L; Ntakiyiruta, Georges; Chu, Kathryn M

2015-01-01

To define the operations performed by surgical residents at a tertiary referral hospital in Rwanda to help guide development of the residency program. Cross-sectional study of all patients operated by surgical residents from October 2012 to September 2013. University Teaching Hospital of Kigali (Centre Hospitalier Universitaire de Kigali [CHUK]), a public, tertiary referral hospital in Kigali, Rwanda. All patient data were entered into the operative database by surgical residents at CHUK. A total of 2833 cases were entered into the surgical database. Of them, 53 cases were excluded from further analysis because no surgical resident was listed as the primary or assistant surgeon, leaving 2780 cases for analysis. There were 2780 operations involving surgical residents. Of them, 51% of procedures were classified under general surgery, 38% orthopedics, 7% neurosurgery, and 4% urology. Emergency operations accounted for 64% of the procedures, with 56% of those being general surgery and 35% orthopedic. Further, 50% of all operations were trauma, with 71% of those orthopedic and 21% general surgery. Surgical faculty were involved in 45% of operations as either the primary or the assistant surgeons, while the remainder of operations did not involve surgical faculty. Residents were primary surgeons in 68% of procedures and assistant surgeons in 84% of procedures. The operative experience of surgery residents at CHUK primarily involves emergency and trauma procedures. Although this likely reflects the demographics of surgical care within Rwanda, more focus should be placed on elective procedures to ensure that surgical residents are broadly trained. Copyright © 2015 Association of Program Directors in Surgery. Published by Elsevier Inc. All rights reserved.

Author Details

African Journals Online (AJOL)

Performance and Structure of LiNi0.5Mn1.5O4 Prepared from Various Ni Precursors for Lithium Ion Batteries Abstract PDF · Vol 65 (2012) - Articles Highly Active, Carbon-supported, PdSn Nano-core, Partially Covered with Pt, as Catalysts for Methanol Oxidation Abstract PDF. ISSN: 0379-4350. AJOL African Journals Online.

Kommentarer vedr. eventuelle ændringer af den tidligere risikovurdering. Zea mays (1507). Supplerende oplysninger til EFSA. Modtaget 17-12-2004, deadline 28-01-2005, svar 25-01-2005

DEFF Research Database (Denmark)

Kjellsson, Gøsta; Strandberg, Morten Tune

2004-01-01

"DMU har modtaget og vurderet de supplerende oplysninger (brev fra Skov- og Naturstyrelsen d. 16-12-2004) til ansøgningen om tilladelse til markedsføring af genetisk modificeret majs C/ES/01/01 (linie 1507). Vi har gennemgået oplysningerne i det tilsendte materiale for at se om de giver anledning...

Determination of the mechanism and extent of surface degradation in Ni-based cathode materials after repeated electrochemical cycling

Directory of Open Access Journals (Sweden)

Sooyeon Hwang

2016-09-01

Full Text Available We take advantage of scanning transmission electron microscopy and electron energy loss spectroscopy to investigate the changes in near-surface electronic structure and quantify the degree of local degradation of Ni-based cathode materials with the layered structure (LiNi0.8Mn0.1Co0.1O2 and LiNi0.4Mn0.3Co0.3O2 after 20 cycles of delithiation and lithiation. Reduction of transition metals occurs in the near-surface region of cathode materials: Mn is the major element to be reduced in the case of relatively Mn-rich composition, while reduction of Ni ions is dominant in Ni-rich materials. The valences of Ni and Mn ions are complementary, i.e., when one is reduced, the other is oxidized in order to maintain charge neutrality. The depth of degradation zone is found to be much deeper in Ni-rich materials. This comparative analysis provides important insights needed for the devising of new cathode materials with high capacity as well as long lifetime.

Die Darstellung Rudolf Virchows in der Vossischen Zeitung im Zeitraum vom 1. Januar 1844 bis zum 31. Dezember 1865

OpenAIRE

Feddersen, Lars Harald

2010-01-01

DIE DARSTELLUNG RUDOLF VIRCHOWS IN DER VOSSISCHEN ZEITUNG IM ZEITRAUM VOM 1. JANUAR 1844 BIS ZUM 31. DEZEMBER 1865 Rudolf Virchow erforschte u.a. als Pathologe, Hygieniker, Anthropologe, Ethnologe und Prähistoriker bedeutende Grundlagen der modernen Wissenschaft. Diese vielschichtigen Tätigkeitsbereiche zeichnen ihn als einen der bedeutendsten Wissenschaftler v.a. der Medizingeschichte aus. Als Politiker engagierte sich Virchow in erster Linie im sozial- und gesellschaftspolitischen Bereich. ...

40 CFR 60.2780 - What must I include in the deviation report?

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 6 2010-07-01 2010-07-01 false What must I include in the deviation... PROGRAMS (CONTINUED) STANDARDS OF PERFORMANCE FOR NEW STATIONARY SOURCES Emissions Guidelines and... the deviation report? In each report required under § 60.2775, for any pollutant or parameter that...

Autonomous Mobile Systems 2012 22 Fachgespräch Stuttgart, 26 bis 28 September 2012

CERN Document Server

Zweigle, Oliver; Häußermann, Kai; Eckstein, Bernd

2012-01-01

In erster Linie werden Tagungsberichte von Fachtagungen der Gesellschaft für Informatik veröffentlicht, die regelmäßig, oft in Zusammenarbeit mit anderen wissenschaftlichen Gesellschaften, von den Fachausschüssen der Gesellschaft für Informatik veranstaltet werden. Die Auswahl der Vorträge erfolgt im allgemeinen durch international zusammengesetzte Programmkomitees. Die Tagungssprache ist Deutsch.

Dansk sekretær i DAC

DEFF Research Database (Denmark)

Andersen, Jens Enevold Thaulov

2007-01-01

Danmark lå noget længere nede ad listen, hvad deltagere angår - på linie med Algeriet, Venezuela og Estland! Selvom Euroanalysis kongressen og DANSAK kongressen nu holdes i henholdsvis ulige og lige år, så var det alligevel kun de tre medlemmer af Analytikergruppen fra DTU, som repræsenterede Danmark. Det...

An access to a library of novel triterpene derivatives with a promising pharmacological potential by Ugi and Passerini multicomponent reactions.

Science.gov (United States)

Wiemann, Jana; Heller, Lucie; Csuk, René

2018-04-25

The promising combination of natural product leads and their derivatization by isocyanide-based multicomponent reactions (IMCRs) has gained interest in accessing diversity-oriented libraries with auspicious pharmacological potential. Therefore, a set of 34 Ugi and 3 Passerini products was successfully synthesized starting from naturally occurring triterpenoids, i.e. oleanolic acid (OA) and maslinic acid (MA), followed by a biological evaluation of the novel α-acylamino carboxamides and the α-acyloxy carboxamides in colorimetric SRB assays to determine their cytotoxic potential. Especially, the MA-Ugi products 6a, 6b and 7b showed a remarkable cytotoxicity for A2780 ovarian carcinoma cells in a low μM range. Compounds 6a and 7b induced programmed cell death in part through the apoptosis pathway. Copyright © 2018 Elsevier Masson SAS. All rights reserved.

DKK1 is a potential novel mediator of cisplatin-refractoriness in non-small cell lung cancer cell lines

International Nuclear Information System (INIS)

Salim, Hogir; Zong, Dali; Hååg, Petra; Novak, Metka; Mörk, Birgitta; Lewensohn, Rolf; Lundholm, Lovisa; Viktorsson, Kristina

2015-01-01

Platinum compounds are the mainstay of chemotherapy for lung cancer. Unfortunately treatment failure remains a critical issue since about 60 % of all non-small cell lung cancer (NSCLC) patients display intrinsic platinum resistance. We analyzed global gene expression profiles of NSCLC clones surviving a pulse treatment with cisplatin and mapped deregulated signaling networks in silico by Ingenuity Pathway Analysis (IPA). Further validation was done using siRNA. The pooled cisplatin-surviving NSCLC clones from each of the biological replicates demonstrated heterogeneous gene expression patterns both in terms of the number and the identity of the altered genes. Genes involved in Wnt signaling pathway (Dickkopf-1, DKK1), DNA repair machinery (XRCC2) and cell-cell/cell-matrix interaction (FMN1, LGALS9) were among the top deregulated genes by microarray in these replicates and were validated by q-RT-PCR. We focused on DKK1 which previously was reported to be overexpressed in NSCLC patients. IPA network analysis revealed coordinate up-regulation of several DKK1 transcriptional regulators (TCF4, EZH2, DNAJB6 and HDAC2) in cisplatin-surviving clones from that biological replicate. Knockdown of DKK1 by siRNA sensitized for cisplatin in two different NSCLC cell lines and in ovarian A2780 cells, but not in the A2780 cis subline made resistant to cisplatin by chronic exposure, suggesting a role of DKK1 in intrinsic but not acquired platinum refractoriness. We identified DKK1 as a possible marker of a cisplatin-refractory phenotype and as a potential novel therapeutic target to improve platinum response of NSCLC cells. The online version of this article (doi:10.1186/s12885-015-1635-9) contains supplementary material, which is available to authorized users

Towards deriving Ni-rich cathode and oxide-based anode materials from hydroxides by sharing a facile co-precipitation method.

Science.gov (United States)

Qiu, Haifa; Du, Tengfei; Wu, Junfeng; Wang, Yonglong; Liu, Jian; Ye, Shihai; Liu, Sheng

2018-05-22

Although intensive studies have been conducted on layered transition metal oxide(TMO)-based cathode materials and metal oxide-based anode materials for Li-ion batteries, their precursors generally follow different or even complex synthesis routes. To share one route for preparing precursors of the cathode and anode materials, herein, we demonstrate a facile co-precipitation method to fabricate Ni-rich hydroxide precursors of Ni0.8Co0.1Mn0.1(OH)2. Ni-rich layered oxide of LiNi0.8Co0.1Mn0.1O2 is obtained by lithiation of the precursor in air. An NiO-based anode material is prepared by calcining the precursor or multi-walled carbon nanotubes (MWCNTs) incorporated precursors. The pre-addition of ammonia solution can simplify the co-precipitation procedures and the use of an air atmosphere can also make the heat treatment facile. LiNi0.8Co0.1Mn0.1O2 as the cathode material delivers a reversible capacity of 194 mA h g-1 at 40 mA g-1 and a notable cycling retention of 88.8% after 100 cycles at 200 mA g-1. This noticeable performance of the cathode arises from a decent particle morphology and high crystallinity of the layered oxides. As the anode material, the MWCNTs-incorporated oxides deliver a much higher reversible capacity of 811.1 mA h g-1 after 200 cycles compared to the pristine oxides without MWCNTs. The improvement on electrochemical performance can be attributed to synergistic effects from MWCNTs incorporation, including reinforced electronic conductivity, rich meso-pores and an alleviated volume effect. This facile and sharing method may offer an integrated and economical approach for commercial production of Ni-rich electrode materials for Li-ion batteries.

Bulletin of Materials Science | Indian Academy of Sciences

Indian Academy of Sciences (India)

Home; Journals; Bulletin of Materials Science. G P Nayaka. Articles written in Bulletin of Materials Science. Volume 37 Issue 3 May 2014 pp 705-711. Structural, electrical and electrochemical behaviours of LiNi0.4M0.1Mn1.5O4 ( = Al, Bi) as cathode material for Li-ion batteries · G P Nayaka J Manjanna K C Anjaneya P ...

Skulptuur kui avaliku ruumi keskkond / Rael Artel

Index Scriptorium Estoniae

Artel, Rael, 1980-

2004-01-01

Skulptuuri mõistest, keskkonnana lahendatud skulptuuridest. Daniel Libeskindi projekteeritud Holokausti tornist ja Eksiili aiast Berliini juudimuuseumis, Maya Lini (sünd. 1959) Vietnami sõja veteranide memoriaalist (1982) Washington DC-s, Joseph Beuysi aiaskulptuurist "7000 tamme" (1982-1987) Kasselis, Raoul Kurvitza "Katedraalist kodututele" (1999) Vabaduse väljakul, Andres Kure heliinstallatsioonist "Metroopol" (1999) Tallinna Liivalaia t. jalakäijate tunnelis

k c anjaneya

Indian Academy of Sciences (India)

Home; Journals; Bulletin of Materials Science. K C ANJANEYA. Articles written in Bulletin of Materials Science. Volume 39 Issue 5 September 2016 pp 1279-1284. Structural, electrical and electrochemical studies of LiNi 0.4 M 0.1 Mn 1.5 O 4 ( M = Co, Mg) solid solutions for lithium ion battery · G P NAYAKA K V PAI J ...

Bulletin of Materials Science | Indian Academy of Sciences

Indian Academy of Sciences (India)

Home; Journals; Bulletin of Materials Science. K C Anjaneya. Articles written in Bulletin of Materials Science. Volume 37 Issue 3 May 2014 pp 705-711. Structural, electrical and electrochemical behaviours of LiNi0.4M0.1Mn1.5O4 ( = Al, Bi) as cathode material for Li-ion batteries · G P Nayaka J Manjanna K C Anjaneya P ...

ALDH1A1 maintains ovarian cancer stem cell-like properties by altered regulation of cell cycle checkpoint and DNA repair network signaling.

Directory of Open Access Journals (Sweden)

Erhong Meng

Full Text Available OBJECTIVE: Aldehyde dehydrogenase (ALDH expressing cells have been characterized as possessing stem cell-like properties. We evaluated ALDH+ ovarian cancer stem cell-like properties and their role in platinum resistance. METHODS: Isogenic ovarian cancer cell lines for platinum sensitivity (A2780 and platinum resistant (A2780/CP70 as well as ascites from ovarian cancer patients were analyzed for ALDH+ by flow cytometry to determine its association to platinum resistance, recurrence and survival. A stable shRNA knockdown model for ALDH1A1 was utilized to determine its effect on cancer stem cell-like properties, cell cycle checkpoints, and DNA repair mediators. RESULTS: ALDH status directly correlated to platinum resistance in primary ovarian cancer samples obtained from ascites. Patients with ALDHHIGH displayed significantly lower progression free survival than the patients with ALDHLOW cells (9 vs. 3 months, respectively p<0.01. ALDH1A1-knockdown significantly attenuated clonogenic potential, PARP-1 protein levels, and reversed inherent platinum resistance. ALDH1A1-knockdown resulted in dramatic decrease of KLF4 and p21 protein levels thereby leading to S and G2 phase accumulation of cells. Increases in S and G2 cells demonstrated increased expression of replication stress associated Fanconi Anemia DNA repair proteins (FANCD2, FANCJ and replication checkpoint (pS317 Chk1 were affected. ALDH1A1-knockdown induced DNA damage, evidenced by robust induction of γ-H2AX and BAX mediated apoptosis, with significant increases in BRCA1 expression, suggesting ALDH1A1-dependent regulation of cell cycle checkpoints and DNA repair networks in ovarian cancer stem-like cells. CONCLUSION: This data suggests that ovarian cancer cells expressing ALDH1A1 may maintain platinum resistance by altered regulation of cell cycle checkpoint and DNA repair network signaling.

Thermal abuse performance of high-power 18650 Li-ion cells

Science.gov (United States)

Roth, E. P.; Doughty, D. H.

High-power 18650 Li-ion cells have been developed for hybrid electric vehicle applications as part of the DOE Advanced Technology Development (ATD) program. The thermal abuse response of two advanced chemistries (Gen1 and Gen2) were measured and compared with commercial Sony 18650 cells. Gen1 cells consisted of an MCMB graphite based anode and a LiNi 0.85Co 0.15O 2 cathode material while the Gen2 cells consisted of a MAG10 anode graphite and a LiNi 0.80Co 0.15 Al 0.05O 2 cathode. Accelerating rate calorimetry (ARC) and differential scanning calorimetry (DSC) were used to measure the thermal response and properties of the cells and cell materials up to 400 °C. The MCMB graphite was found to result in increased thermal stability of the cells due to more effective solid electrolyte interface (SEI) formation. The Al stabilized cathodes were seen to have higher peak reaction temperatures that also gave improved cell thermal response. The effects of accelerated aging on cell properties were also determined. Aging resulted in improved cell thermal stability with the anodes showing a rapid reduction in exothermic reactions while the cathodes only showed reduced reactions after more extended aging.

In vitro antioxidant activity and phenolic composition of Georgian, Central and West European wines

Czech Academy of Sciences Publication Activity Database

Tauchen, J.; Maršík, Petr; Kvasnicová, Marie; Maghradze, D.; Kokoška, L.; Vaněk, Tomáš; Landa, Přemysl

2015-01-01

Roč. 41, AUG 2015 (2015), s. 113-121 ISSN 0889-1575 R&D Projects: GA MŠk(CZ) LD11005 Grant - others:OP Praha Konkurenceschopnost(XE) CZ.2.16/3.1.00/24014; project CIGA(CZ) 20142012; COST Action(CZ) FA1003 Institutional support: RVO:61389030 Keywords : Red wine * White wine * Antioxidant activity Subject RIV: GM - Food Processing Impact factor: 2.780, year: 2015

A closed-loop process for recycling LiNixCoyMn(1−x−yO2 from mixed cathode materials of lithium-ion batteries

Directory of Open Access Journals (Sweden)

Rujuan Zheng

2017-01-01

Full Text Available With the rapid development of consumer electronics and electric vehicles (EV, a large number of spent lithium-ion batteries (LIBs have been generated worldwide. Thus, effective recycling technologies to recapture a significant amount of valuable metals contained in spent LIBs are highly desirable to prevent the environmental pollution and resource depletion. In this work, a novel recycling technology to regenerate a LiNi1/3Co1/3Mn1/3O2 cathode material from spent LIBs with different cathode chemistries has been developed. By dismantling, crushing, leaching and impurity removing, the LiNi1/3Co1/3Mn1/3O2 (selected as an example of LiNixCoyMn(1−x−yO2 powder can be directly prepared from the purified leaching solution via co-precipitation followed by solid-state synthesis. For comparison purposes, a fresh-synthesized sample with the same composition has also been prepared using the commercial raw materials via the same method. X-ray diffraction (XRD, scanning electron microscopy (SEM and electrochemical measurements have been carried out to characterize these samples. The electrochemical test result suggests that the re-synthesized sample delivers cycle performance and low rate capability which are comparable to those of the fresh-synthesized sample. This novel recycling technique can be of great value to the regeneration of a pure and marketable LiNixCoyMn(1−x−yO2 cathode material with low secondary pollution. Keywords: Spent lithium-ion battery, Cathode material recycling, Acid leaching, Purification, Co-precipitation

Suppressed oxygen extraction and degradation of LiNixMnyCozO2 cathodes at high charge cut-off voltages

Energy Technology Data Exchange (ETDEWEB)

Zheng, Jianming; Yan, Pengfei; Zhang, Jiandong; Engelhard, Mark H.; Zhu, Zihua; Polzin, Bryant J.; Trask, Steve; Xiao, Jie; Wang, Chongmin; Zhang, Jiguang

2017-09-01

The capacity degradation mechanism in lithium nickel-manganese-cobalt oxide (NMC) cathodes (LiNi1/3Mn1/3Co1/3O2 (NMC333) and LiNi0.4Mn0.4Co0.2O2 (NMC442)) during high-voltage (cut-off of 4.8 V) operation has been investigated. In contrast to NMC442, NMC333 exhibits rapid structural changes including severe micro-crack formation and phase transformation from a layered to a disordered rock-salt structure, as well as interfacial degradation during high-voltage cycling, leading to a rapid increase of the electrode resistance and fast capacity decline. The fundamental reason behind the poor structural and interfacial stability of NMC333 was found to be correlated to its high Co content and the significant overlap between the Co3+/4+ t(2g) and O2- 2p bands, resulting in oxygen removal and consequent structural changes at high voltages. In addition, oxidation of the electrolyte solvents by the extracted oxygen species generates acidic species, which then attack the electrode surface and form highly resistive LiF. These findings highlight that both the structural and interfacial stability should be taken into account when tailoring cathode materials for high voltage battery systems

miR-30a can inhibit DNA replication by targeting RPA1 thus slowing cancer cell proliferation.

Science.gov (United States)

Zou, Zhenyou; Ni, Mengjie; Zhang, Jing; Chen, Yongfeng; Ma, Hongyu; Qian, Shihan; Tang, Longhua; Tang, Jiamei; Yao, Hailun; Zhao, Chengbin; Lu, Xiongwen; Sun, Hongyang; Qian, Jue; Mao, Xiaoting; Lu, Xulin; Liu, Qun; Zen, Juping; Wu, Hanbing; Bao, Zhaosheng; Lin, Shudan; Sheng, Hongyu; Li, Yunlong; Liang, Yong; Chen, Zhiqiang; Zong, Dan

2016-07-15

Cell proliferation was inhibited following forced over-expression of miR-30a in the ovary cancer cell line A2780DX5 and the gastric cancer cell line SGC7901R. Interestingly, miR-30a targets the DNA replication protein RPA1, hinders the replication of DNA and induces DNA fragmentation. Furthermore, ataxia telangiectasia mutated (ATM) and checkpoint kinase 2 (CHK2) were phosphorylated after DNA damage, which induced p53 expression, thus triggering the S-phase checkpoint, arresting cell cycle progression and ultimately initiating cancer cell apoptosis. Therefore, forced miR-30a over-expression in cancer cells can be a potential way to inhibit tumour development. © 2016 The Author(s). published by Portland Press Limited on behalf of the Biochemical Society.

Kriegsgefangene der Mittelmächte in Russland im Ersten Weltkrieg

OpenAIRE

Wurzer, Georg

2000-01-01

Gegenstand dieser Dissertation ist das Schicksal der Kriegsgefangenen der Mittelmächte in Russland im Ersten Weltkrieg. Zur Erforschung dieses noch weitgehend unbearbeiteten Gebiets wurden in erster Linie Erlebnisberichte ehemaliger Gefangener und erst seit kurzem zugängliche russische Archivdokumente herangezogen. Die kriegsgefangenen Mannschaften machten nach den schrecklichen Flecktyphus-Epidemien der Winter 1914/15 und 1915/16 sehr unterschiedliche Erfahrungen. Die einen litten grosse Ent...

Entwicklung und Anwendung von Methoden zur Bestimmung von Selen-Spezies in human-biologischem Material

OpenAIRE

Jäger, Thomas

2014-01-01

Selen ist essentieller Bestandteil von mehr als 25 physiologisch wichtigen menschlichen Enzymen. Der tägliche Bedarf wird überwiegend in Form von organischen Selenverbindungen wie Selenmethionin oder Selenocystein aus der Nahrung aufgenommen. Weitere Expositionswege sind die Einnahme von Nahrungsergänzungsmitteln zur Selensupplementation sowie die inhalative oder dermale Aufnahme von in erster Linie anorganischen Selenverbindungen oder elementarem Selen an Arbeitsplätzen der Selen-verarbeiten...

Quantitative Evaluation of Cisplatin Uptake in Sensitive and Resistant Individual Cells by Single-Cell ICP-MS (SC-ICP-MS).

Science.gov (United States)

Corte Rodríguez, M; Álvarez-Fernández García, R; Blanco, E; Bettmer, J; Montes-Bayón, M

2017-11-07

One of the main limitations to the Pt-therapy in cancer is the development of associated drug resistance that can be associated with a significant reduction of the intracellular platinum concentration. Thus, intracellular Pt concentration could be considered as a biomarker of cisplatin resistance. In this work, an alternative method to address intracellular Pt concentration in individual cells is explored to permit the evaluation of different cell models and alternative therapies in a relatively fast way. For this aim, total Pt analysis in single cells has been implemented using a total consumption nebulizer coupled to inductively coupled plasma mass spectrometric detection (ICP-MS). The efficiency of the proposed device has been evaluated in combination with flow cytometry and turned out to be around 25% (cells entering the ICP-MS from the cells in suspension). Quantitative uptake studies of a nontoxic Tb-containing compound by individual cells were conducted and the results compared to those obtained by bulk analysis of the same cells. Both sets of data were statistically comparable. Thus, final application of the developed methodology to the comparative uptake of Pt-species in cisplatin resistant and sensitive cell lines (A2780cis and A2780) was conducted. The results obtained revealed the potential of this analytical strategy to differentiate between different cell lines of different sensitivity to the drug which might be of high medical interest.

Synthesis of hierarchical mesoporous lithium nickel cobalt manganese oxide spheres with high rate capability for lithium-ion batteries

Science.gov (United States)

Tong, Wei; Huang, Yudai; Cai, Yanjun; Guo, Yong; Wang, Xingchao; Jia, Dianzeng; Sun, Zhipeng; Pang, Weikong; Guo, Zaiping; Zong, Jun

2018-01-01

Hierarchical mesoporous LiNi1/3Co1/3Mn1/3O2 spheres have been synthesized by urea-assisted solvothermal method with adding Triton X-100. The structure and morphology of the as-prepared materials were analyzed by X-ray diffraction and electron microscope. The results show that the as-prepared samples can be indexed as hexagonal layered structure with hierarchical architecture, and the possible formation mechanism is speculated. When evaluated as cathode material, the hierarchical mesoporous LiNi1/3Co1/3Mn1/3O2 spheres show good electrochemical properties with high initial discharge capacity of 129.9 mAh g-1, and remain the discharge capacity of 95.5 mAh g-1 after 160 cycles at 10C. The excellent electrochemical performance of the as-prepared sample can be attributed to its stable hierarchical mesoporous framework in conjunction with large specific surface, low cation mixing and small particle size. They not only provide a large number of reaction sites for surface or interface reaction, but also shorten the diffusion length of Li+ ions. Meanwhile, the mesoporous spheres composed of nanoparticles can contribute to high rate ability and buffer volume changes during charge/discharge process.

Antiproliferative Properties Against Human Breast, Cervical and Ovarian Cancer Cell Lines, and Antioxidant Capacity of Leaf Aqueous Ethanolic Extract from Cotinus coggygria Scop.

Directory of Open Access Journals (Sweden)

Gospodinova Z.

2017-10-01

Full Text Available Cotinus coggygria Scop. leaf aqueous ethanolic extract was examined for its in vitro antiproliferative and antioxidant activity. Antiproliferative effect was assessed on four human gynecological cancer cell lines: breast (MCF7, T47D, cervical (HeLa and ovarian (A2780 and compared to the cell growth inhibitory effect on non-cancerous breast epithelial cell line MCF10A using MTT cell proliferation assay. Radical scavenging assay with DPPH was applied to evaluate antioxidant potential of the extract. The obtained results showed that the herb inhibited cell growth of all of the tested cancer cell lines and the highest was the cytostatic effect on A2780 cells with a half maximal inhibitory concentration (IC50 value of 30.8 μg/ml. For the other cell lines the IC50 values were in the range of 55-122.7 μg/ml. Additionally, the extract exerted considerably weaker reduction in cell proliferation of the non-cancerous cell line MCF10A compared to cancer cells, which indicates for antiproliferative selectivity. C. coggygria extract showed high free radical scavenging activity with an IC50 value of 11.2 μg/ml. The obtained data provide evidence for pharmacological potential of the tested extract and future more detailed studies concerning the molecular mechanisms of the anticancer effect of the herb are needed.

The anti-proliferative and anti-angiogenic effect of the methanol extract from brittle star.

Science.gov (United States)

Baharara, Javad; Amini, Elaheh; Mousavi, Marzieh

2015-04-01

Anti-angiogenic therapy is a crucial step in cancer treatment. The discovery of new anti-angiogenic compounds from marine organisms has become an attractive concept in anti-cancer therapy. Because little data correlated to the pro- and anti-angiogenic efficacies of Ophiuroidea, which include brittle star, the current study was designed to explore the anti-angiogenic potential of brittle star methanol extract in vitro and in vivo. The anti-proliferative effect of brittle star extract on A2780cp cells was examined by MTT assays, and transcriptional expression of VEGF and b-FGF was evaluated by RT-PCR. In an in vivo model, 40 fertilized Ross eggs were divided into control and three experimental groups. The experimental groups were incubated with brittle star extract at concentrations of 25, 50 and 100 µg/ml, and photographed by photo-stereomicroscopy. Ultimately, numbers and lengths of vessels were measured by Image J software. Data were analyzed with SPSS software (pstar extract exerted a dose- and time-dependent anti-proliferative effect on A2780cp cancer cells. In addition, VEGF and b-FGF expression decreased with brittle star methanol extract treatment. Macroscopic evaluations revealed significant changes in the second and third experimental group compared to controls (pstar methanol extract in vitro and in vivo confer novel insight into the application of natural marine products in angiogenesis-related pathologies.

The varieties of religious development in adulthood: a longitudinal investigation of religion and rational choice.

Science.gov (United States)

McCullough, Michael E; Enders, Craig K; Brion, Sharon L; Jain, Andrea R

2005-07-01

The authors used growth mixture models to study religious development during adulthood (ages 27-80) in a sample of individuals who were identified during childhood as intellectually gifted. The authors identified 3 discrete trajectories of religious development: (a) 40% of participants belonged to a trajectory class characterized by increases in religiousness until midlife and declines in later adulthood; (b) 41% of participants belonged to a trajectory class characterized by very low religiousness in early adulthood and age-related decline; and (c) 19% of participants belonged to a trajectory class characterized by high religiousness in early adulthood and age-related increases. Gender, strength of religious upbringing, number of children, marrying, and agreeableness predicted membership in the trajectory classes. Results were largely consistent with the rational choice theory of religious involvement.

Enhancement of Cisplatin-Mediated Apoptosis in Ovarian Cancer Cells through Potentiating G2/M Arrest and p21 Upregulation by Combinatorial Epigallocatechin Gallate and Sulforaphane

Directory of Open Access Journals (Sweden)

Huaping Chen

2013-01-01

Full Text Available Advanced-stage ovarian cancer is characterized by high mortality due to development of resistance to conventional chemotherapy. Novel compounds that can enhance the efficacy of conventional chemotherapy in ovarian cancer may overcome this drug resistance. Consumption of green tea (epigallocatechin gallate, EGCG and cruciferous vegetables (sulforaphane, SFN is inversely associated with occurrence of ovarian cancer and has anticancer effects through targeting multiple molecules in cancer cells. However, the effects of EGCG and SFN combinational treatment on ovarian cancer cells and on efficacy of cisplatin to these cells are unknown. In this study, EGCG or SFN was used to treat both cisplatin-sensitive (A2780 and cisplatin-resistant (A2780/CP20 ovarian cancer cells alone or in combination with cisplatin. We found that EGCG and SFN combinational treatment can reduce cell viability of both ovarian cancer cell lines time- and dose-dependently. Furthermore, EGCG and SFN combinational treatment can enhance cisplatin-induced apoptosis and G2/M phase arrest, thereby enhancing the efficacy of cisplatin on both cisplatin-sensitive and cisplatin-resistant ovarian cancer cells. EGCG and SFN combinational treatment upregulated p21 expression induced by cisplatin in cisplatin-sensitive ovarian cancer cells, while p27 expression was not regulated by these treatments. Collectively, these studies provide novel approaches to overcoming cisplatin chemotherapy resistance in ovarian cancer.

High-energy cathode material for long-life and safe lithium batteries

Science.gov (United States)

Sun, Yang-Kook; Myung, Seung-Taek; Park, Byung-Chun; Prakash, Jai; Belharouak, Ilias; Amine, Khalil

2009-04-01

Layered lithium nickel-rich oxides, Li[Ni1-xMx]O2 (M=metal), have attracted significant interest as the cathode material for rechargeable lithium batteries owing to their high capacity, excellent rate capability and low cost. However, their low thermal-abuse tolerance and poor cycle life, especially at elevated temperature, prohibit their use in practical batteries. Here, we report on a concentration-gradient cathode material for rechargeable lithium batteries based on a layered lithium nickel cobalt manganese oxide. In this material, each particle has a central bulk that is rich in Ni and a Mn-rich outer layer with decreasing Ni concentration and increasing Mn and Co concentrations as the surface is approached. The former provides high capacity, whereas the latter improves the thermal stability. A half cell using our concentration-gradient cathode material achieved a high capacity of 209mAhg-1 and retained 96% of this capacity after 50 charge-discharge cycles under an aggressive test profile (55∘C between 3.0 and 4.4V). Our concentration-gradient material also showed superior performance in thermal-abuse tests compared with the bulk composition Li[Ni0.8Co0.1Mn0.1]O2 used as reference. These results suggest that our cathode material could enable production of batteries that meet the demanding performance and safety requirements of plug-in hybrid electric vehicles.

Brune bønner på danske middagsborde

DEFF Research Database (Denmark)

Bjerno, Gudrun Lau

2005-01-01

Linser, nødder og olivenolie eller pasta, ris og kartofler? Hvad skal vi spise for at bevare den slanke linie? Ifølge nogle eksperter bør kost¬pyramiden vendes på hovedet, mens andre mener, at den er god nok, som den er. Hvad er op og ned på kostpyramiden og eksperternes råd? Det spørgsmål forsøger...

Viele Daten, hohe Hürden: eine Bilanz aus dem Projekt Open-Access-Statistik

OpenAIRE

Herb, Ulrich

2018-01-01

Dieser Artikel referiert die Ergebnisse des Projekts Open-Access-Statistik, dessen Ziel es war, standardisierte Nutzungszahlen für wissenschaftliche Dokumente zu erheben. Die gesammelten Nutzungsdaten sollten in erster Linie dazu dienen, Impact-Werte für Open-Access-Dokumente zu ermitteln. Das Projekt sah auch die Implementierung anspruchsvollerer Verfahren wie Netzwerk-Analysen vor, sah sich jedoch mit komplexen rechtlichen Anforderungen konfrontiert. Der Beitrag versucht überdies, Open-Acce...

Polen, Deutschland, die EU und Russland

OpenAIRE

Wilkiewicz, Zbigniew

2009-01-01

Besonders seit dem EU-Beitritt Polens ist es um die deutsch-polnischen Beziehungen nicht besonders gut bestellt. In den vergangenen Jahren hat man sich in erster Linie an bilateralen Konflikten abgearbeitet und keine gemeinsame Europapolitik betrieben. Im Beitrag wird diese Entwicklung rekonstruiert und danach gefragt, ob es angesichts einer solchen Entwicklung Aussichten auf die Wiederherstellung der deutsch-polnischen Interessengemeinschaft gibt oder die Interessen beider Staaten so stark d...

(Lehr-Film(-lehren. Potenziale von Lehrfilmen für die Medienbildung

Directory of Open Access Journals (Sweden)

Christian Stewen

2015-06-01

Full Text Available Christian Stewen schlägt in seinem Impulspapier vor, Lehrfilme im Unterricht nicht in erster Linie zur Vermittlung von Wissensinhalten einzusetzen, sondern anhand ihrer die medialen Prozesse der Entstehung und Vermittlung von Wissen in schulischen Unterrichtssituationen zu veranschaulichen und zu problematisieren. "[T]he educational film is one which contributes to the achievement of desirable educational goals by making effective use of the motion picture as a medium of communication." (McClusky 1947: 372

Cellular responses induced by Cu(II quinolinonato complexes in human tumor and hepatic cells

Directory of Open Access Journals (Sweden)

Trávníček Zdeněk

2012-12-01

Full Text Available Abstract Background Inspired by the unprecedented historical success of cisplatin, one of the most important research directions in bioinorganic and medicinal chemistry is dedicated to the development of new anticancer compounds with the potential to surpass it in antitumor activity, while having lower unwanted side-effects. Therefore, a series of copper(II mixed-ligand complexes of the type [Cu(qui(L]Y · xH2O (1–6, where Hqui = 2-phenyl-3-hydroxy-4(1H-quinolinone, Y = NO3 (1, 3, 5 or BF4 (2, 4, 6, and L = 1,10-phenanthroline (phen (1, 2, 5-methyl-1,10-phenanthroline (mphen (3, 4 and bathophenanthroline (bphen (5, 6, was studied for their in vitro cytotoxicity against several human cancer cell lines (A549 lung carcinoma, HeLa cervix epitheloid carcinoma, G361 melanoma cells, A2780 ovarian carcinoma, A2780cis cisplatin-resistant ovarian carcinoma, LNCaP androgen-sensitive prostate adenocarcinoma and THP-1 monocytic leukemia. Results The tested complexes displayed a stronger cytotoxic effect against all the cancer cells as compared to cisplatin. The highest cytotoxicity was found for the complexes 4 (IC50 = 0.36 ± 0.05 μM and 0.56 ± 0.15 μM, 5 (IC50 = 0.66 ± 0.07 μM and 0.73 ± 0.08 μM and 6 (IC50 = 0.57 ± 0.11 μM and 0.70 ± 0.20 μM against A2780, and A2780cis respectively, as compared with the values of 12.0 ± 0.8 μM and 27.0 ± 4.6 μM determined for cisplatin. Moreover, the tested complexes were much less cytotoxic to primary human hepatocytes than to the cancer cells. The complexes 5 and 6 exhibited significantly high ability to modulate secretion of the pro-inflammatory cytokines TNF-α (2873 ± 238 pg/mL and 3284 ± 139 pg/mL for 5, and 6 respectively and IL-1β (1177 ± 128 pg/mL and 1087 ± 101 pg/mL for 5, and 6 respectively tested on the lipopolysaccharide (LPS-stimulated THP-1 cells as compared with the values of 1173�

Comparative study on experiments and simulation of blended cathode active materials for lithium ion batteries

International Nuclear Information System (INIS)

Appiah, Williams Agyei; Park, Joonam; Van Khue, Luu; Lee, Yunju; Choi, Jaecheol; Ryou, Myung-Hyun; Lee, Yong Min

2016-01-01

We simulate the electrochemical properties of Li-ion cells consisting of a blended cathode composed of LiMn 2 O 4 and LiNi 0.6 Co 0.2 Mn 0.2 O 2 and an artificial graphite anode using the Li-ion battery model available in COMSOL MULTIPHYSICS 4.4 along with a capacity fade model. The discharge profiles of the pure and blended cathodes at various current rates obtained through simulations and experimental results are well matched. By combining two capacity fade models available in literature, namely the solid electrolyte interphase (SEI) growth model and the Mn 2+ dissolution model, the cycling performance of the pure LiMn 2 O 4 cells at 25 °C are successfully simulated and found to be in a good agreement with the experimental results. The blended cathode exhibits better capacity retention than the pure LiMn 2 O 4 during cycling. We also observed that at high powers, the gravimetric energy density of the LiMn 2 O 4 cathode exceeds that of the LiNi 0.6 Co 0.2 Mn 0.2 O 2 cathode; the reverse effect is seen at low powers. Further, we were able to easily modulate the energy and power densities of the blended cathode system by changing the blend ratio in our simulation model.

Příběh bludné linie

Czech Academy of Sciences Publication Activity Database

Bydžovská, Lenka

2006-01-01

Roč. 16, č. 33 (2006), s. 70-79 ISSN 0862-8440 Institutional research plan: CEZ:AV0Z80330511 Keywords : Jindřich Štyrský * artificialism * surrealism Subject RIV: AL - Art, Architecture, Cultural Heritage

Two Players Make a Formidable Combination: In Situ Generated Poly(acrylic anhydride-2-methyl-acrylic acid-2-oxirane-ethyl ester-methyl methacrylate) Cross-Linking Gel Polymer Electrolyte toward 5 V High-Voltage Batteries.

Science.gov (United States)

Ma, Yue; Ma, Jun; Chai, Jingchao; Liu, Zhihong; Ding, Guoliang; Xu, Gaojie; Liu, Haisheng; Chen, Bingbing; Zhou, Xinhong; Cui, Guanglei; Chen, Liquan

2017-11-29

Electrochemical performance of high-voltage lithium batteries with high energy density is limited because of the electrolyte instability and the electrode/electrolyte interfacial reactivity. Hence, a cross-linking polymer network of poly(acrylic anhydride-2-methyl-acrylic acid-2-oxirane-ethyl ester-methyl methacrylate) (PAMM)-based electrolyte was introduced via in situ polymerization inspired by "shuangjian hebi", which is a statement in a traditional Chinese Kungfu story similar to the synergetic effect of 1 + 1 > 2. A poly(acrylic anhydride) and poly(methyl methacrylate)-based system is very promising as electrolyte materials for lithium-ion batteries, in which the anhydride and acrylate groups can provide high voltage resistance and fast ionic conductivity, respectively. As a result, the cross-linking PAMM-based electrolyte possesses a significant comprehensive enhancement, including electrochemical stability window exceeding 5 V vs Li + /Li, an ionic conductivity of 6.79 × 10 -4 S cm -1 at room temperature, high mechanical strength (27.5 MPa), good flame resistance, and excellent interface compatibility with Li metal. It is also demonstrated that this gel polymer electrolyte suppresses the negative effect resulting from dissolution of Mn 2+ ions at 25 and 55 °C. Thus, the LiNi 0.5 Mn 1.5 O 4 /Li and LiNi 0.5 Mn 1.5 O 4 /Li 4 Ti 5 O 12 cells using the optimized in situ polymerized cross-linking PAMM-based gel polymer electrolyte deliver stable charging/discharging profiles and excellent rate performance at room temperature and even at 55 °C. These findings suggest that the cross-linking PAMM is an intriguing candidate for 5 V class high-voltage gel polymer electrolyte toward high-energy lithium-on batteries.

Nuclear Monitoring Research at the Center for Seismic Studies

Science.gov (United States)

1991-05-13

Garm (GAR) in the Southern Tien-Shan Mountains , and a fifth at Irkutsk (IRK) near the border of the Siberian platform and the Baikal rift zone. With...Shan 1-1 Mountains , and a fifth not far from lrkutsk (IRK), at the border of the Precambrian Siberian platform and the Baikal rift zone. Table 1. IRIS...clossinlg northl-eastern, aleas uf tile rist Europen vlatfot ni rjoil Kineshnia to Vorkuta. 1. 2-linies Of iSOVCIUoitieS in thec upper ,uantue (kits

Reduced graphene oxide–silver nanoparticle nanocomposite: a potential anticancer nanotherapy

Directory of Open Access Journals (Sweden)

Gurunathan S

2015-10-01

Full Text Available Sangiliyandi Gurunathan, Jae Woong Han, Jung Hyun Park, Eunsu Kim, Yun-Jung Choi, Deug-Nam Kwon, Jin-Hoi Kim Department of Animal Biotechnology, Konkuk University, Seoul, Republic of Korea Background: Graphene and graphene-based nanocomposites are used in various research areas including sensing, energy storage, and catalysis. The mechanical, thermal, electrical, and biological properties render graphene-based nanocomposites of metallic nanoparticles useful for several biomedical applications. Epithelial ovarian carcinoma is the fifth most deadly cancer in women; most tumors initially respond to chemotherapy, but eventually acquire chemoresistance. Consequently, the development of novel molecules for cancer therapy is essential. This study was designed to develop a simple, non-toxic, environmentally friendly method for the synthesis of reduced graphene oxide–silver (rGO–Ag nanoparticle nanocomposites using Tilia amurensis plant extracts as reducing and stabilizing agents. The anticancer properties of rGO–Ag were evaluated in ovarian cancer cells. Methods: The synthesized rGO–Ag nanocomposite was characterized using various analytical techniques. The anticancer properties of the rGO–Ag nanocomposite were evaluated using a series of assays such as cell viability, lactate dehydrogenase leakage, reactive oxygen species generation, cellular levels of malonaldehyde and glutathione, caspase-3 activity, and DNA fragmentation in ovarian cancer cells (A2780. Results: AgNPs with an average size of 20 nm were uniformly dispersed on graphene sheets. The data obtained from the biochemical assays indicate that the rGO–Ag nanocomposite significantly inhibited cell viability in A2780 ovarian cancer cells and increased lactate dehydrogenase leakage, reactive oxygen species generation, caspase-3 activity, and DNA fragmentation compared with other tested nanomaterials such as graphene oxide, rGO, and AgNPs. Conclusion: T. amurensis plant extract

Targeting RNA transcription and translation in ovarian cancer cells with pharmacological inhibitor CDKI-73.

Science.gov (United States)

Lam, Frankie; Abbas, Abdullahi Y; Shao, Hao; Teo, Theodosia; Adams, Julian; Li, Peng; Bradshaw, Tracey D; Fischer, Peter M; Walsby, Elisabeth; Pepper, Chris; Chen, Yi; Ding, Jian; Wang, Shudong

2014-09-15

Dysregulation of cellular transcription and translation is a fundamental hallmark of cancer. As CDK9 and Mnks play pivotal roles in the regulation of RNA transcription and protein synthesis, respectively, they are important targets for drug development. We herein report the cellular mechanism of a novel CDK9 inhibitor CDKI-73 in an ovarian cancer cell line (A2780). We also used shRNA-mediated CDK9 knockdown to investigate the importance of CDK9 in the maintenance of A2780 cells. This study revealed that CDKI-73 rapidly inhibited cellular CDK9 kinase activity and down-regulated the RNAPII phosphorylation. This subsequently caused a decrease in the eIF4E phosphorylation by blocking Mnk1 kinase activity. Consistently, CDK9 shRNA was also found to down-regulate the Mnk1 expression. Both CDKI-73 and CDK9 shRNA decreased anti-apoptotic proteins Mcl-1 and Bcl-2 and induced apoptosis. The study confirmed that CDK9 is required for cell survival and that ovarian cancer may be susceptible to CDK9 inhibition strategy. The data also implied a role of CDK9 in eIF4E-mediated translational control, suggesting that CDK9 may have important implication in the Mnk-eIF4E axis, the key determinants of PI3K/Akt/mTOR- and Ras/Raf/MAPK-mediated tumorigenic activity. As such, CDK9 inhibitor drug candidate CDKI-73 should have a major impact on these pathways in human cancers.

Tryptophanabhängige Synthese von indolhaltigen Pigmenten bei verschiedenen humanpathogenen Asco- und Basidiomyceten

OpenAIRE

Nies, Silke Marie

2006-01-01

Der Begriff "Pigment" beschreibt in erster Linie farbige Substanzen. Pigmente sind aber darüber hinaus für wichtige metabolische oder physiologische Prozesse verantwortlich. Im Reich der Pilze gibt es eine Vielzahl von Pigmenten. Zu ihnen zählen die Melanine, die Carotenoide, die Naphthoquinone, die Phenoxazine, die Flavonoide sowie indolhaltige Pigmente. Gewisse Indolderivate wurden von einer Arbeitsgruppe um Prof. Mayser 1998 erstmals bei der Hefe Malassezia furfur beschrieben, bei der ...

Tumor Vesicle—Associated CD147 Modulates the Angiogenic Capability of Endothelial Cells

Directory of Open Access Journals (Sweden)

Danilo Millimaggi

2007-04-01

Full Text Available Matrix metalloproteinase (MMP degradation of extracellular matrix is thought to play an important role in invasion, angiogenesis, tumor growth, and metastasis. Several studies have demonstrated that CD147/ extracellular MMP inducer, a membrane-spanning molecule highly expressed in tumor cells, may be involved in the progression of malignancies by regulating expression of MMP in peritumoral stromal cells. In the present study we show that CD147 is expressed in microvesicles derived from epithelial ovarian cancer cells and that CD147-positive vesicles may promote an angiogenic phenotype in endothelial cells in vitro. Vesicles shed by human ovarian carcinoma cell lines OVCAR3, SKOV3, and A2780 expressed different levels of CD147 and stimulated proangiogenic activities of human umbilical vein endothelial cells (HUVECs in a CD147-dependent fashion (OVCAR3 > SKOV3 > A2780. Moreover, vesicles shed by ovarian carcinoma cell line CABA I with low CD147 expression had no significant effect on the development of angiogenic phenotype in HUVECs. The treatment of OVCAR3 cells with small interfering RNA against CD147 suppressed the angiogenic potential of OVCAR3-derived microvesicles. However, transfection of CD147 cDNA into the CABA I cell line enabled CABA I-derived vesicles to induce angiogenesis and to promote MMP genes expression in HUVECs. We therefore conclude that vesicles shed by ovarian cancer cells may induce proangiogenic activities of HUVECs by a CD147-mediated mechanism.

Inovační linie moderní doby I.

Directory of Open Access Journals (Sweden)

Ondřej Chwaszcz

2013-11-01

Full Text Available Purpose of the article: This work analyzes the basic theories of innovation that influenced the behaviour of firms in today's modern age. That provides a comprehensive analysis of the issue and explains the situation in a way that is useful for both managers and scholars. The work at the same time forms the foundations, on which are the newest innovations approaches formed. Without sufficient understanding of the development of the innovative, the understanding of the current and future innovative theories is considerably limited and can lead to misleading conclusions. The author considers so called open innovation & disruptive innovation as the current innovative approaches which have received the attention recently. Methodology/methods: The basic methodology of this work is based on the analysis of the individual innovative theories using comparative analysis. Each theory is also supported in the text by case studies. Scientific aim The connection of theory and use case studies creates the unusual comprehensive overview. This comprehension and inclusion of all important innovation theories of modern time is in its entirety a unique view of the topic and opens the door for further analysis of innovation and enterprises interaction. Findings: This area nowadays deserves an attention, because the environment, which are companies moving is changing more rapidly. Oncoming of globalization businesses were made to pay much more attention to their business strategies. All strategies are intended to differentiate companies from competitors and establish them on the market – companies have to constantly innovate. Conclusions: (limits, implications etc The work found out that the development of innovative theories intensifies over the time. Existing theories become far more comprehensive and even new ones are evolving. The conclusion is that further development of theories of innovation can be built on the analysis and application of

Molybdenum cluster loaded PLGA nanoparticles: An innovative theranostic approach for the treatment of ovarian cancer.

Science.gov (United States)

Brandhonneur, N; Hatahet, T; Amela-Cortes, M; Molard, Y; Cordier, S; Dollo, G

2018-04-01

We evaluate poly (d,l-lactide-co-glycolide) (PLGA) nanoparticles embedding inorganic molybdenum octahedral cluster for photodynamic therapy of cancer (PDT). Tetrabutyl ammonium salt of Mo 6 Br 14 cluster unit, (TBA) 2 Mo 6 Br 14 , presents promising photosensitization activity in the destruction of targeted cancer cells. Stable cluster loaded nanoparticles (CNPs) were prepared by solvent displacement method showing spherical shapes, zeta potential values around -30 mV, polydispersity index lower than 0.2 and sizes around 100 nm. FT-IR and DSC analysis revealed the lack of strong chemical interaction between the cluster and the polymer within the nanoparticles. In vitro release study showed that (TBA) 2 Mo 6 Br 14 was totally dissolved in 20 min, while CNPs were able to control the release of encapsulated cluster. In vitro cellular viability studies conducted on A2780 ovarian cancer cell line treated up to 72 h with cluster or CNPs did not show any sign of toxicity in concentrations up to 20 µg/ml. This concentration was selected for photo-activation test on A2780 cells and CNPs were able to generate oxygen singlet resulting in a decrease of the cellular viability up to 50%, respectively compared to non-activated conditions. This work presents (TBA) 2 Mo 6 Br 14 as a novel photosensitizer for PDT and suggests PLGA nanoparticles as an efficient delivery system intended for tumor targeting. Copyright © 2018 Elsevier B.V. All rights reserved.

Quantitative Microstructure Characterization of a NMC Electrode

Energy Technology Data Exchange (ETDEWEB)

Usseglio-Viretta, François Laurent Emilien; Smith, Kandler

2017-07-07

Performance of lithium-ion batteries (LIBs) is strongly influenced by the porous microstructure of their electrodes. In this work, 3D microstructures of calendared and un-calendared positive electrode LiNi1/3Mn1/3Co1/3O2 (NMC) have been investigated in order to extract relevant properties useful for battery modeling. Transport (volume fraction, connectivity, particle size and tortuosity) and electrochemical (specific surface area) properties have been calculated for the pore and the active material. Special attention has been paid to determine the size of the so-called representative volume element (RVE) required to be statistically representative of the heterogeneous medium. Several parameters have been calculated using a panel of different numerical methods in order to compare their results. Besides, the image level of detail has been evaluated (using original criteria based upon edge detection) to assess the overall data quality available for the study.

Quantitative Microstructure Characterization of a NMC Electrode

Energy Technology Data Exchange (ETDEWEB)

Usseglio Viretta, Francois L [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Smith, Kandler A [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

2017-09-28

Performance of lithium-ion batteries (LIBs) is strongly influenced by the porous microstructure of their electrodes. In this work, 3D microstructures of calendared and un-calendared positive electrode LiNi1/3Mn1/3Co1/3O2 (NMC) have been investigated in order to extract relevant properties useful for battery modeling. Transport (volume fraction, connectivity, particle size and tortuosity) and electrochemical (specific surface area) properties have been calculated for the pore and the active material. Special attention has been paid to determine the size of the so-called representative volume element (RVE) required to be statistically representative of the heterogeneous medium. Several parameters have been calculated using a panel of different numerical methods in order to compare their results. Besides, the image level of detail has been evaluated (using original criteria based upon edge detection) to assess the overall data quality available for the study.

Synthesis and In Vitro Antiproliferative Activity of Novel Androst-5-ene Triazolyl and Tetrazolyl Derivatives

Directory of Open Access Journals (Sweden)

János Wölfling

2011-06-01

Full Text Available A straightforward and reliable method for the regioselective synthesis of steroidal 1,4-disubstituted triazoles and 1,5-disubstituted tetrazoles via copper(I-catalyzed cycloadditions is reported. Heterocycle moieties were efficiently introduced onto the starting azide compound 3β-acetoxy-16β-azidomethylandrost-5-en-17β-ol through use of the “click” chemistry approach. The antiproliferative activities of the newly-synthesized triazoles were determined in vitro on three human gynecological cell lines (HeLa, MCF7 and A2780 using the microculture tetrazolium assay.

Was sind Biodiversity Hotspots - global, regional, lokal?

OpenAIRE

Hobohm, Carsten

2005-01-01

Das Konzept der Biodiversity Hotspots, das Ende der 1980er Jahre von Norman Myers entworfen wurde, gehört derzeit zu den wichtigen forschungsleitenden Ansätzen globaler Naturschutzstrategien. In der vorliegenden Arbeit geht es in erster Linie um die Frage, ob und inwiefern dieses Konzept auf die regionale und lokale Dimension Europas übertragen werden kann. Es wird ein Vorschlag unterbreitet, wie europäische Biodiversity Hotspots definiert und identifiziert werden können. Bei der Erforschung ...

A preclinical study on the rescue of normal tissue by nicotinic acid in high-dose treatment with APO866, a specific nicotinamide phosphoribosyltransferase inhibitor

DEFF Research Database (Denmark)

Olesen, Uffe Høgh; Thougaard, Annemette V; Jensen, Peter Buhl

2010-01-01

Inhibitor of nicotinamide phosphoribosyltransferase APO866 is a promising cancer drug currently in phase II clinical trials in oncology. Here, we present a strategy for increasing the therapeutic potential of APO866 through the rescue of normal tissues by coadministration of nicotinic acid (Vitamin...... B(3)). We examined the toxicity profile of APO866 in B6D2F1 mice and the effect of oral administration of nicotinic acid on tissue toxicity. Nicotinic acid (50 mg/kg) protects mice from death and severe toxicity from an APO866 dose (60 mg/kg) four times the monotherapy maximum tolerated dose (15 mg....../kg). In a panel of six cancer cell lines, we find that three (including ML-2 cells) are protected by nicotinic acid in vitro, whereas the cytotoxicity of APO866 remains unaffected in the remaining three (including A2780 cells). A selective biomarker for the protection by nicotinic acid was subsequently identified...

Defect structure of yttria-stabilized zirconia and its influence on the ionic conductivity at elevated temperatures

DEFF Research Database (Denmark)

Goff, J.P.; Hayes, W.; Hull, S.

1999-01-01

The defect structure of cubic fluorite structured yttria-stabilized zirconia (ZrO2)(1-x)(Y2O3)(x) has been investigated over the composition range 0.100(3)less than or equal to x less than or equal to 0.241 (10) and temperatures T(K) up to 2780(10) K, using single-crystal specimens. Analysis of n......, we propose that the anomalous decrease in the ionic conductivity with increasing x is a consequence of the decreasing mobility of the isolated defects, possibly due to blockage by the increasing number of static aggregates....

Lithium nickel cobalt manganese oxide synthesized using alkali chloride flux: morphology and performance as a cathode material for lithium ion batteries.

Science.gov (United States)

Kim, Yongseon

2012-05-01

Li(Ni(0.8)Co(0.1)Mn(0.1))O(2) (NCM811) was synthesized using alkali chlorides as a flux and the performance as a cathode material for lithium ion batteries was examined. Primary particles of the powder were segregated and grown separately in the presence of liquid state fluxes, which induced each particle to be composed of one primary particle with well-developed facet planes, not the shape of agglomerates as appears with commercial NCMs. The new NCM showed far less gas emission during high temperature storage at charged states, and higher volumetric capacity thanks to its high bulk density. The material is expected to provide optimal performances for pouch type lithium ion batteries, which require high volumetric capacity and are vulnerable to deformation caused by gas generation from the electrode materials.

Isolation of the New Antiplasmodial Butanolide, Malleastrumolide A, from Malleastrum sp. (Meliaceae) from Madagascar.

Science.gov (United States)

Du, Yongle; Abedi, Alexander K; Valenciano, Ana Lisa; Fernández-Murga, Maria L; Cassera, Maria B; Rasamison, Vincent E; Applequist, Wendy L; Miller, James S; Kingston, David G I

2017-12-01

An extract of Malleastrum sp. (Meliaceae) collected in Madagascar by the Madagascar International Cooperative Biodiversity Group was found to have antimalarial activity, with an IC 50 value between 2.5 and 5 μg ml -1 . After purification by liquid-liquid partition, chromatography on a Diaion open column, C 18 SPE and C 18 reversed phase HPLC, the new butanolide, malleastrumolide A, was isolated. The structure of malleastrumolide A was determined by mass spectrometry, NMR, and ECD. The double bond position was determined by cross-metathesis and mass spectrometry. The compound has antiproliferative activity against the A2780 ovarian cancer cell line with an IC 50 value of 17.4 μm and antiplasmodial activity against the drug-resistant Dd2 strain of Plasmodium falciparum with an IC 50 value of 2.74 μm. © 2017 Wiley-VHCA AG, Zurich, Switzerland.

Effect of Mg-doping on the degradation of LiNiO2-based cathode materials by combined spectroscopic methods

OpenAIRE

Muto, Shunsuke; Tatsumi, Kazuyoshi; Kojima, Yuji; Oka, Hideaki; Kondo, Hiroki; Horibuchi, Kayo; Ukyo, Yoshio

2012-01-01

The performance of a LiNiO2-based cell has been shown to be significantly improved by Mg-doping of LiNi0.8Co0.15Al0.05O2 (Mg-doped NCA) cathode materials. In the present study, the effects of Mg-doping were examined by electrochemical impedance spectroscopy (EIS) and scanning transmission electron microscopy-electron energy loss spectroscopy. EIS analysis revealed that the activation energy of Mg-doped NCA for the charge-transfer reaction was larger than that of undoped NCA by a factor of ∼10...

Comprehension and acceptability of a patient information leaflet (pil for antiretroviral therapy

Directory of Open Access Journals (Sweden)

Betty Mwingira

2006-11-01

Full Text Available The patient information leaflet (PIL is recognised as playing a key role in informing patients about their medicines. The objectives of this research were to evaluate the readability and understanding of a PIL for the first-line ARV (antiretroviral regimen available in the South African public health sector, and investigate its acceptability in the target Xhosa population. Opsomming Daar word algemeen aanvaar dat die pasiëntinligtingsblaadjie (PIB ‘n sleutelrol speel in die oordra van inligting ten opsigte van medikasie aan pasiënte. Die doelwitte van hierdie navorsing was om die leesbaarheid en begrip van ‘n PIB vir die eerste-linie antiretrovirale (ARV regimen wat in die Suid-Afrikaanse openbare gesondheidsektor beskikbaar is, te evalueer, en om die aanvaarbaarheid daarvan in ‘n teiken-Xhosabevolking te ondersoek. *Please note: This is a reduced version of the abstract. Please refer to PDF for full text.

Antiproliferative Compounds of Cyphostemma greveana from a Madagascar Dry Forest[1

Science.gov (United States)

Cao, Shugeng; Hou, Yanpeng; Brodie, Peggy; Miller, James S.; Randrianaivo, Richard; Rakotobe, Etienne; Rasamison, Vincent E.

2011-01-01

Bioassay-guided fractionation of the EtOH extracts obtained from a plant identified as Cyphostemma greveana Desc. (Vitaceae) led to the identification of one macrolide, lasiodiplodin (1), three sesquiterpenoids, 12-hydroxy-15-oxo-selina-4,1l-diene (2), 1β,6α-dihydroxyeudesm-4(15)-ene (3), and (7R*)-opposit-4(15)-ene-1β,7-diol (5), and the new diterpenoid, 16,18-dihydroxykolavenic acid lactone (4). All the isolates were tested against the A2780 human ovarian cancer cell line, and compound 4 and a fraction containing 5 as the major constituent showed antiproliferative activities with IC50 values of 0.44 μM (0.14 μg/mL) and 0.045 μg/mL, respectively. A semisynthesis of compound 5 was carried out, but the pure synthetic compound was inactive, indicating that the activity of the fraction containing it must be due to a very minor and as yet unidentified substance. PMID:21480509

D-α-tocopherol polyethylene glycol succinate-based derivative nanoparticles as a novel carrier for paclitaxel delivery

Directory of Open Access Journals (Sweden)

Wu YP

2015-08-01

Full Text Available Yupei Wu,1,* Qian Chu,2,* Songwei Tan,1 Xiangting Zhuang,1 Yuling Bao,1 Tingting Wu,1 Zhiping Zhang1,3,41Tongji School of Pharmacy, 2Department of Oncology, Tongji Hospital, Tongji Medical School, 3Hubei Engineering Research Center for NDDS, 4National Engineering Research Center for Nanomedicine, Huazhong University of Science and Technology, Wuhan, People’s Republic of China*These authors contributed equally to this workAbstract: Paclitaxel (PTX is one of the most effective antineoplastic drugs. Its current clinical administration Taxol® is formulated in Cremophor EL, which causes serious side effects. Nanoparticles (NP with lower systemic toxicity and enhanced therapeutic efficiency may be an alternative formulation of the Cremophor EL-based vehicle for PTX delivery. In this study, novel amphipathic 4-arm-PEG-TPGS derivatives, the conjugation of D-α-tocopherol polyethylene glycol succinate (TPGS and 4-arm-polyethylene glycol (4-arm-PEG with different molecular weights, have been successfully synthesized and used as carriers for the delivery of PTX. These 4-arm-PEG-TPGS derivatives were able to self-assemble to form uniform NP with PTX encapsulation. Among them, 4-arm-PEG5K-TPGS NP exhibited the smallest particle size, highest drug-loading efficiency, negligible hemolysis rate, and high physiologic stability. Therefore, it was chosen for further in vitro and in vivo investigations. Facilitated by the effective uptake of the NP, the PTX-loaded 4-arm-PEG5K-TPGS NP showed greater cytotoxicity compared with free PTX against human ovarian cancer (A2780, non-small cell lung cancer (A549, and breast adenocarcinoma cancer (MCF-7 cells, as well as a higher apoptotic rate and a more significant cell cycle arrest effect at the G2/M phase in A2780 cells. More importantly, PTX-loaded 4-arm-PEG5K-TPGS NP resulted in a significantly improved tumor growth inhibitory effect in comparison to Taxol® in S180 sarcoma-bearing mice models. This study suggested

Effect of Metal (Mn, Ti) Doping on NCA Cathode Materials for Lithium Ion Batteries

OpenAIRE

Wan, Dao Yong; Fan, Zhi Yu; Dong, Yong Xiang; Baasanjav, Erdenebayar; Jun, Hang-Bae; Jin, Bo; Jin, En Mei; Jeong, Sang Mun

2018-01-01

NCA (LiNi0.85Co0.10Al0.05-x MxO2, M=Mn or Ti, x < 0.01) cathode materials are prepared by a hydrothermal reaction at 170°C and doped with Mn and Ti to improve their electrochemical properties. The crystalline phases and morphologies of various NCA cathode materials are characterized by XRD, FE-SEM, and particle size distribution analysis. The CV, EIS, and galvanostatic charge/discharge test are employed to determine the electrochemical properties of the cathode materials. Mn and Ti doping res...

Synthesis and cytotoxic evaluation of novel C-10 nitrate derivatives of colchicine

International Nuclear Information System (INIS)

Shen, L.H.; Wang, B.; Liu, S.M.

2016-01-01

In our continuing search for more potent anticancer agent, eight novel nitrates couple with C-10 colchicine nitric oxide-releasing derivatives (5a-f and 7a-b) were prepared. These target compounds were assayed for their anti-tumor activity in vitro against four cancer cell lines, including human hepatocellular carcinoma cells (BEL7402), human ovary carcinoma cells (A2780), human lung adenocarcinoma cells (A549) and human breast carcinoma cells (MCF7). Preliminary results indicated that most of them exhibited significant cytotoxic effect toward cancer cells. Compound 7a was investigated further for its more potent cytotoxicity than colchicine. (author)

Biocompatible Lipid Nanoparticles as Carriers To Improve Curcumin Efficacy in Ovarian Cancer Treatment.

Science.gov (United States)

Bondì, Maria Luisa; Emma, Maria Rita; Botto, Chiara; Augello, Giuseppa; Azzolina, Antonina; Di Gaudio, Francesca; Craparo, Emanuela Fabiola; Cavallaro, Gennara; Bachvarov, Dimcho; Cervello, Melchiorre

2017-02-22

Curcumin is a natural molecule with proved anticancer efficacy on several human cancer cell lines. However, its clinical application has been limited due to its poor bioavailability. Nanocarrier-based drug delivery approaches could make curcumin dispersible in aqueous media, thus overtaking the limits of its low solubility. The aim of this study was to increase the bioavailability and the antitumoral activity of curcumin, by entrapping it into nanostructured lipid carriers (NLCs). For this purpose here we describe the preparation and characterization of three kinds of curcumin-loaded NLCs. The nanosystems allowed the achievement of a controlled release of curcumin, the amounts of curcumin released after 24 h from Compritol-Captex, Compritol-Miglyol, and Compritol NLCs being, respectively, equal to 33, 28, and 18% w/w on the total entrapped curcumin. Considering the slower curcumin release profile, Compritol NLCs were chosen to perform successive in vitro studies on ovarian cancer cell lines. The results show that curcumin-loaded NLCs maintain anticancer activity, and reduce cell colony survival more effectively than free curcumin. As an example, the ability of A2780S cells to form colonies was decreased after treatment with 5 μM free curcumin by 50% ± 6, whereas, at the same concentration, the delivery of curcumin with NLC significantly (p < 0.05) inhibited colony formation to approximately 88% ± 1, therefore potentiating the activity of curcumin to inhibit A2780S cell growth. The obtained results clearly suggest that the entrapment of curcumin into NLCs increases curcumin efficacy in vitro, indicating the potential use of NLCs as curcumin delivery systems.

Uso problemático de internet en estudiantes universitarios : factores asociados y diferencias de género

OpenAIRE

Fernández Villa, Tania; Alguacil Ojeda, Juan; Martín, Vicente

2015-01-01

El objetivo del presente trabajo es realizar un análisis descriptivo del uso problemático de Internet en estudiantes universitarios, evaluando la posible asociación con problemas de salud y conductas adictivas, así como diferencias de género en los tipos utilización. Un total de 2780 alumnos participaron en el estudio entre los años 2011 – 2014, siendo un 29% varones (edad 20.8 ± 5.1 años) y un 71% mujeres (edad de 20.3 ± 4.4 años). La prevalencia de uso problemático de Inte...

Identification of NVP-BKM120 as a Potent, Selective, Orally Bioavailable Class I PI3 Kinase Inhibitor for Treating Cancer.

Science.gov (United States)

Burger, Matthew T; Pecchi, Sabina; Wagman, Allan; Ni, Zhi-Jie; Knapp, Mark; Hendrickson, Thomas; Atallah, Gordana; Pfister, Keith; Zhang, Yanchen; Bartulis, Sarah; Frazier, Kelly; Ng, Simon; Smith, Aaron; Verhagen, Joelle; Haznedar, Joshua; Huh, Kay; Iwanowicz, Ed; Xin, Xiaohua; Menezes, Daniel; Merritt, Hanne; Lee, Isabelle; Wiesmann, Marion; Kaufman, Susan; Crawford, Kenneth; Chin, Michael; Bussiere, Dirksen; Shoemaker, Kevin; Zaror, Isabel; Maira, Sauveur-Michel; Voliva, Charles F

2011-10-13

Phosphoinositide-3-kinases (PI3Ks) are important oncology targets due to the deregulation of this signaling pathway in a wide variety of human cancers. Herein we describe the structure guided optimization of a series of 2-morpholino, 4-substituted, 6-heterocyclic pyrimidines where the pharmacokinetic properties were improved by modulating the electronics of the 6-position heterocycle, and the overall druglike properties were fine-tuned further by modification of the 4-position substituent. The resulting 2,4-bismorpholino 6-heterocyclic pyrimidines are potent class I PI3K inhibitors showing mechanism modulation in PI3K dependent cell lines and in vivo efficacy in tumor xenograft models with PI3K pathway deregulation (A2780 ovarian and U87MG glioma). These efforts culminated in the discovery of 15 (NVP-BKM120), currently in Phase II clinical trials for the treatment of cancer.

Study of LH2 fueled subsonic passenger transport aircraft

Science.gov (United States)

Brewer, G. D.; Morris, R. E.

1976-01-01

The potential of using liquid hydrogen as fuel in subsonic transport aircraft was investigated to explore an expanded matrix of passenger aircraft sizes. Aircraft capable of carrying 130 passengers 2,780 km (1500 n.mi.); 200 passengers 5,560 km (3000 n.mi.); and 400 passengers on a 9,265 km (5000 n.mi.) radius mission, were designed parametrically. Both liquid hydrogen and conventionally fueled versions were generated for each payload/range in order that comparisons could be made. Aircraft in each mission category were compared on the basis of weight, size, cost, energy utilization, and noise.

Maritime Claims Reference Manual.

Science.gov (United States)

1997-01-01

Melenera to Peninsula de Gando From Peninsula de Gando to Moque Arinaga From Moque Arinaga to Punta Tenefe From Punta Tenefe to Playa Maspalomas (E...From Playa Maspalomas (W) to Punta Taozo From Isla de la Aldea to Punta Sardina From Punta Sardina to Punta Ortiz From Punta Ortiz to Punta...to Cabo Ancones 29° 01.10 13° 27.80 From Punta Lima 28° 55.80 13° 36.87 to Punta del Tarjalillo 28° 35.45 13° 49.25 From Punta de la Entallada 28

FUZZY LOGIC CONTROLLER AS MODELING TOOL FOR THE BURNING PROCESS OF A CEMENT PRODUCTION PLANT

Directory of Open Access Journals (Sweden)

P.B. Osofisan

2012-01-01

Full Text Available

ENGLISH ABSTRACT: A comprehensive optimisation of the cement production process presents a problem since the input variables as well as the output variables are non-linear, interdependent and contain uncertainties. To arrive at a solution, a Fuzzy Logic controller has been designed to achieve a well-defined relationship between the main and vital variables through the instrumentality of a Fuzzy Model. The Fuzzy Logic controller has been simulated on a digital computer using MATLAB 5.0 Fuzzy Logic Tool Box, using data from a local cement production plant.

AFRIKAANSE OPSOMMING: Die omvattende optimisering van 'n proses wat sement vervaardig, word beskryf deur nie-linieêre inset- en uitsetveranderlikes wat onderling afhanklik is, en ook van onsekere aard is. Om 'n optimum oplossing te verkry, word 'n Wasigheidsmodel gebruik. Die model word getoets deur gebruik te maak van die MATLAB 5.0 Fuzzy Logic Tool Box en data vanaf 'n lokale sementvervaardigingsaanleg.

Low-cost waste incineration and recycling from the operator`s point of view; Kostenguenstige thermische Abfallverwertung und Kreislaufwirtschaftsgesetz aus Betreibersicht

Energy Technology Data Exchange (ETDEWEB)

Burgorf, J [Saarberg-Oekotechnic GmbH, Saarbruecken (Germany)

1998-09-01

The 1996 Act on Recycling and Waste Management specified that waste production should be reduced first of all, and that waste still produced should be recycled or used for power generation. Dumping and `classic` incineration are permissible only if it is the more acceptable solution from an environmental point of view. There are two categories of thermal treatment: Thermal treatment of `waste for dumping`, and use of the energy content of `waste for utilisation`. The contribution analyzes the effects of the law on future waste management concepts in consideration of the current situation of thermal treatment of residual waste. (orig.) [Deutsch] Das im Oktober 1996 in Kraft getretene Kreislaufwirtschafts- und Abfallgesetz (KrW-/AbfG) schreibt in den Grundsaetzen der Kreislaufwirtschaft fest, dass Abfaelle in erster Linie zu vermeiden und in zweiter Linie stofflich oder energetisch zu verwerten sind. Die Beseitigung von Abfaellen - und darunter faellt auch die `klassische` Muellverbrennung - ist nur dann zugelassen, wenn sie gegenueber der Verwertung die umweltvertraeglichere Loesung darstellt. Fuer die thermische Behandlung von Abfaellen denfiniert das KrW-/AbfG deshalb zwei Wege mit unterschiedlichen Ansaetzen: Zum einen die thermische Behandlung von `Abfaellen zur Beseitigung`, wie sie bisher in vielen Anlagen zur Muellverbrennung realisiert worden ist und zum anderen die energetische Nutzung von `Abfaellen zur Verwertung`. Der vorliegende Beitrag soll die Auswirkung dieser Vorgabe auf zukuenftige Abfallwirtschaftskonzepte unter Beruecksichtigung der derzeitigen Situation der thermischen Restabfallbehandlung darstellen. (orig.)

Biopanning and characterization of peptides with Fe3O4 nanoparticles-binding capability via phage display random peptide library technique.

Science.gov (United States)

You, Fei; Yin, Guangfu; Pu, Ximing; Li, Yucan; Hu, Yang; Huang, Zhongbin; Liao, Xiaoming; Yao, Yadong; Chen, Xianchun

2016-05-01

Functionalization of inorganic nanoparticles (NPs) play an important role in biomedical applications. A proper functionalization of NPs can improve biocompatibility, avoid a loss of bioactivity, and further endow NPs with unique performances. Modification with vairous specific binding biomolecules from random biological libraries has been explored. In this work, two 7-mer peptides with sequences of HYIDFRW and TVNFKLY were selected from a phage display random peptide library by using ferromagnetic NPs as targets, and were verified to display strong binding affinity to Fe3O4 NPs. Fourier transform infrared spectrometry, fluorescence microscopy, thermal analysis and X-ray photoelectron spectroscopy confirmed the presence of peptides on the surface of Fe3O4 NPs. Sequence analyses revealed that the probable binding mechanism between the peptide and Fe3O4 NPs might be driven by Pearson hard acid-hard base specific interaction and hydrogen bonds, accompanied with hydrophilic interactions and non-specific electrostatic attractions. The cell viability assay indicated a good cytocompatibility of peptide-bound Fe3O4 NPs. Furthermore, TVNFKLY peptide and an ovarian tumor cell A2780 specific binding peptide (QQTNWSL) were conjugated to afford a liner 14-mer peptide (QQTNWSLTVNFKLY). The binding and targeting studies showed that 14-mer peptide was able to retain both the strong binding ability to Fe3O4 NPs and the specific binding ability to A2780 cells. The results suggested that the Fe3O4-binding peptides would be of great potential in the functionalization of Fe3O4 NPs for the tumor-targeted drug delivery and magnetic hyperthermia. Copyright © 2016 Elsevier B.V. All rights reserved.

Antiproliferative compounds of Cyphostemma greveana from a Madagascar dry forest.

Science.gov (United States)

Cao, Shugeng; Hou, Yanpeng; Brodie, Peggy; Miller, James S; Randrianaivo, Richard; Rakotobe, Etienne; Rasamison, Vincent E; Kingston, David G I

2011-04-01

Bioassay-guided fractionation of the EtOH extracts obtained from a plant identified as Cyphostemma greveana Desc. (Vitaceae) led to the identification of one macrolide, lasiodiplodin (1), three sesquiterpenoids, 12-hydroxy-15-oxoselina-4,11-diene (2), 1β,6α-dihydroxyeudesm-4(15)-ene (3), and (7R*)-opposit-4(15)-ene-1β,7-diol (5), and a new diterpenoid, 16,18-dihydroxykolavenic acid lactone (4). All the isolates were tested against the A2780 human ovarian cancer cell line, and compound 4 and a fraction containing 5 as the major constituent showed antiproliferative activities with IC(50) values of 0.44 μM (0.14 μg/ml) and 0.045 μg/ml, respectively. A partial synthesis of compound 5 was carried out, but the pure synthetic compound was inactive, indicating that the activity of the fraction containing it must be due to a very minor and as yet unidentified substance. Copyright © 2011 Verlag Helvetica Chimica Acta AG, Zürich.

A new photoelectric ink based on nanocellulose/CdS quantum dots for screen-printing.

Science.gov (United States)

Tang, Aimin; Liu, Yuan; Wang, Qinwen; Chen, Ruisong; Liu, Wangyu; Fang, Zhiqiang; Wang, Lishi

2016-09-05

CdS quantum dots with excellent photoelectrical properties embedded in nanocellulose could be exploited for use in photoelectrical ink. In this work, nanocellulose/CdS quantum dot composites were fabricated by controlling the carboxylate content of the nanocellulose and the molar ratio of Cd(2+)/-COOH. New photoelectric inks were prepared based on the composites, in which the CdS quantum dots acted as the pigment and the nanocellulose as the binder. The results of the photocurrent of the composites showed that the photocurrent could be tailored by the carboxylate content and the molar ratio of Cd(2+)/-COOH. And the photocurrent could be as high as 2μA. The surface tension of the photoelectric ink was 27.80±0.03mN/m and its viscosity was 30.3mPas. The photoelectric ink was stable with excellent fluidity and rheology, it could therefore be applied to screen-printing and three-dimensional (3D) printing. Copyright © 2016 Elsevier Ltd. All rights reserved.

On The Problem of Constructing Routes, Part I: Preface

Directory of Open Access Journals (Sweden)

Gertsbakh Ilya B.

2017-09-01

Full Text Available This is a preface of the translation of the 1967 paper by Linis and Maksim, “On the problem of constructing routes” (in Russian (in the Proceedings of the Institute of Civil Aviation Engineering, Issue 102, pp. 36-45. It marks 50-year to the deficit function (DF model initially developed in this 1967 work; the DF model then paved the way to further research of vehicle-fleet management in terms of optimal routing and scheduling. The merit of this translation is to describe the roots of the DF modelling to enable further studies to emerge with more contributions.

IZBOLJŠANJE PROCESA VZDRŽEVANJA V PODJETJU ELEKTRODE JESENICE D.O.O.

OpenAIRE

Filipov, Slobodan

2016-01-01

V podjetju Elektrode Jesenice, d. o. o., se soočajo s pomanjkljivim in neučinkovitim vzdrževanjem. Glavni namen diplomskega dela je izboljšanje procesa vzdrževanja v podjetju, saj je trenutno stanje precej neurejeno, učinkovito vzdrževanje pa je eden od pomembnih dejavnikov uspešnosti podjetja. V prvem delu diplomskega dela smo predstavili nekaj načinov vzdrževanja, ki jih podjetja dandanes najpogosteje uporabljajo. Osredotočili smo se na preventivno vzdrževanje in za vlečno-rezalno lini...

Synergistic efficacy in human ovarian cancer cells by histone deacetylase inhibitor TSA and proteasome inhibitor PS-341.

Science.gov (United States)

Fang, Yong; Hu, Yi; Wu, Peng; Wang, Beibei; Tian, Yuan; Xia, Xi; Zhang, Qinghua; Chen, Tong; Jiang, Xuefeng; Ma, Quanfu; Xu, Gang; Wang, Shixuan; Zhou, Jianfeng; Ma, Ding; Meng, Li

2011-05-01

Histone deacetylase inhibitors and proteasome inhibitor are all emerging as new classes of anticancer agents. We chose TSA and PS-341 to identify whether they have a synergistic efficacy on human ovarian cancer cells. After incubated with 500 nM TSA or/and 40 nM PS-341, we found that combined groups resulted in a striking increase of apoptosis and G2/M blocking rates, no matter in A2780, cisplatin-sensitive ovarian cancer cell line OV2008 or its resistant variant C13*. This demonstrated that TSA interacted synergistically with PS-341, which raised the possibility that combined the two drugs may represent a novel strategy in ovarian cancer.

Poster - 14: Batch Effect Reduction in in-vitro Raman Microscopic Radiosensitivity Study Using Ovarian Cancer Cells

International Nuclear Information System (INIS)

Moradi, Hamid; Murugkar, Sangeeta; Ahmad, Abrar; Shepherdson, Dean; Nyiri, Balazs; Vuong, Nhung; Niedbala, Gosia; Vanderhyden, Barbara; Eapen, Libni

2016-01-01

Purpose: To improve classification by reducing batch effect in samples from the ovarian carcinoma cell lines A2780s (parental wild type) and A2780cp (cisplatin cross-radio-resistant), before, right after, and 24 hours after irradiation to 10Gy. Methods: Spectra were acquired with a home built confocal Raman microscope in 3 distinct runs of six samples: unirradiated s&cp (control pair), then 0h and 24h after irradiation. The Raman spectra were noise reduced, then background subtracted with SMIRF algorithm. ∼35 cell spectra were collected from each sample in 1024 channels from 700cm-1 to 1618cm-1. The spectra were analyzed by regularized multiclass LDA. For feature reduction the spectra were grouped into 3 overlapping group pairs: s-cp, 0Gy–10Gy0h and 0Gy10–Gy24h. The three features, the three differences of the mean spectra were mapped to the analysis sub-space by the inverse regularized covariance matrix. The batch effect noticeably confounded the dose and time effect. Results: To remove the batch effect, the 2+2=4D subspace extended by the covariance matrix of the means of the 0Gy control groups was subtracted from the spectra of each sample. Repeating the analysis on the spectra with the control group variability removed, the batch effect was dramatically reduced in the dose and time directions enabling sharp linear discrimination. The cell type classification also improved. Conclusions: We identified a efficient batch effect removal technique crucial to the applicability of Raman microscopy to radiosensitivity studies both on cell cultures and potential clinical diagnostic applications.

Poster - 14: Batch Effect Reduction in in-vitro Raman Microscopic Radiosensitivity Study Using Ovarian Cancer Cells

Energy Technology Data Exchange (ETDEWEB)

Moradi, Hamid; Murugkar, Sangeeta; Ahmad, Abrar; Shepherdson, Dean; Nyiri, Balazs; Vuong, Nhung; Niedbala, Gosia; Vanderhyden, Barbara; Eapen, Libni [Carleton University, Carleton University, Carleton University, Carleton University, The Ottawa Hospital Cancer Centre, University of Ottawa, The Ottawa Hospital Cancer Centre, University of Ottawa, The Ottawa Hospital Cancer Centre (Canada)

2016-08-15

Purpose: To improve classification by reducing batch effect in samples from the ovarian carcinoma cell lines A2780s (parental wild type) and A2780cp (cisplatin cross-radio-resistant), before, right after, and 24 hours after irradiation to 10Gy. Methods: Spectra were acquired with a home built confocal Raman microscope in 3 distinct runs of six samples: unirradiated s&cp (control pair), then 0h and 24h after irradiation. The Raman spectra were noise reduced, then background subtracted with SMIRF algorithm. ∼35 cell spectra were collected from each sample in 1024 channels from 700cm-1 to 1618cm-1. The spectra were analyzed by regularized multiclass LDA. For feature reduction the spectra were grouped into 3 overlapping group pairs: s-cp, 0Gy–10Gy0h and 0Gy10–Gy24h. The three features, the three differences of the mean spectra were mapped to the analysis sub-space by the inverse regularized covariance matrix. The batch effect noticeably confounded the dose and time effect. Results: To remove the batch effect, the 2+2=4D subspace extended by the covariance matrix of the means of the 0Gy control groups was subtracted from the spectra of each sample. Repeating the analysis on the spectra with the control group variability removed, the batch effect was dramatically reduced in the dose and time directions enabling sharp linear discrimination. The cell type classification also improved. Conclusions: We identified a efficient batch effect removal technique crucial to the applicability of Raman microscopy to radiosensitivity studies both on cell cultures and potential clinical diagnostic applications.

Problematic Internet Use in University Students: associated factors and differences of gender

OpenAIRE

Fernández-Villa, Tania; Alguacil Ojeda, Juan; Almaraz Gómez, Ana; Cancela Carral, José María; Delgado-Rodríguez, Miguel; García-Martín, Miguel; Jiménez-Mejías, Eladio; Llorca, Javier; Molina, Antonio José; Ortiz-Moncada, Rocío; Valero-Juan, Luiz Félix; Martín, Vicente

2015-01-01

El objetivo del presente trabajo es realizar un análisis descriptivo del uso problemático de Internet en estudiantes universitarios, evaluando la posible asociación con problemas de salud y conductas adictivas, así como diferencias de género en los tipos utilización. Un total de 2780 alumnos participaron en el estudio entre los años 2011 – 2014, siendo un 29% varones (edad 20.8 ± 5.1 años) y un 71% mujeres (edad de 20.3 ± 4.4 años). La prevalencia de uso problemático de Internet evaluada medi...

Characterization and regulation of glycine transport in Fusarium oxysporum var. lini.

Science.gov (United States)

Castro, I M; Lima, A A; Nascimento, A F; Ruas, M M; Nicoli, J R; Brandão, R L

1996-08-01

Glycine was transported in Fusarium oxysporum cells, grown on glycine as the sole source of carbon and nitrogen, by a facilitated diffusion transport system with a half-saturation constant (Ks) of 11 mM and a maximum velocity (Vmax) of 1.2 mM (g dry weight)-1 h-1 at pH 5.0 and 26 degrees C. Under conditions of nitrogen starvation, the same system was present together with a high-affinity one (Ks) of about 47 microM and Vmax of about 60 microM (g dry weight)-1 h-1). The low-affinity system was more specific than the high-affinity system. Cells grown on gelatine showed the same behavior. In cells grown on glucose-gelatine medium, the low-affinity system was poorly expressed even after carbon and nitrogen starvation. Moreover, addition of glucose to cells grown on glycine and resuspended in mineral medium caused an increase of the glycine transport probably due to a boost in protein synthesis. This stimulation did not affect the Ks of the low-affinity system. These results demonstrate that, as is the case for other eukaryotic systems, F. oxysporum glycine transport is under control of nitrogen sources but its regulation by carbon sources appears to be more complex.

Meroterpenoids and isoberkedienolactone from endophytic fungus Penicillium sp. associated with Dysosma versipellis.

Science.gov (United States)

Li, Jun-Wei; Duan, Rui-Gang; Zou, Jian-Hua; Chen, Ri-Dao; Chen, Xiao-Guang; Dai, Jun-Gui

2014-06-01

Seven meroterpenoids and five small-molecular precursors were isolated from Penicillium sp., an endophytic fungus from Dysosma versipellis. The structures of new compounds, 11beta-acetoxyisoaustinone (1) and isoberkedienolactone (2) were elucidated based on analysis of the spectral data, and the absolute configuration of 2 was established by TDDFT ECD calculation with satisfactory match to its experimental ECD data. Meroterpenoids originated tetraketide and pentaketide precursors, resepectively, were found to be simultaneously produced in specific fungus of Penicillium species. These compounds showed weak cytotoxicity in vitro against HCT-116, HepG2, BGC-823, NCI-H1650, and A2780 cell lines with IC 50 > 10 micromol x L(-1).

Sergio Benvenuto: Perversionen. Sexualität, Ethik und Psychoanalyse. Wien u.a.: Verlag Turia + Kant 2009.

Directory of Open Access Journals (Sweden)

Stefan Müller

2010-07-01

Full Text Available Sergio Benvenuto entkoppelt die beiden Bereiche Moral und Perversion – um stattdessen ein basales Verhältnis von Ethik und Perversion zu skizzieren. Dieses diskutiert er zum einen im Rückgriff auf die freudsche Psychoanalyse. Zum anderen greift der Autor auf sozial- und moralphilosophische Erwägungen zurück. In erster Linie erweist sich der Kantische Imperativ als wegweisend für die letztlich favorisierte soziale Verhältnisbestimmung von Moral, Sexualität und Perversion.  Sergio Benvenuto decouples the fields of morals and perversions – in order to sketch a fundamental relationship between ethics and perversions instead. On the one hand, he discusses this with the aid of Freudian psychoanalysis. On the other hand, the author relies on social, moral, and philosophical deliberations. The Kantian imperative reveals itself to be most decisive for the social correlation between morals, sexuality, and perversions, which is here ultimately favored.

Nuclear COMMD1 Is Associated with Cisplatin Sensitivity in Ovarian Cancer.

Directory of Open Access Journals (Sweden)

Alina Fedoseienko

Full Text Available Copper metabolism MURR1 domain 1 (COMMD1 protein is a multifunctional protein, and its expression has been correlated with patients' survival in different types of cancer. In vitro studies revealed that COMMD1 plays a role in sensitizing cancer cell lines to cisplatin, however, the mechanism and its role in platinum sensitivity in cancer has yet to be established. We evaluated the role of COMMD1 in cisplatin sensitivity in A2780 ovarian cancer cells and the relation between COMMD1 expression and response to platinum-based therapy in advanced stage high-grade serous ovarian cancer (HGSOC patients. We found that elevation of nuclear COMMD1 expression sensitized A2780 ovarian cancer cells to cisplatin-mediated cytotoxicity. This was accompanied by a more effective G2/M checkpoint, and decreased protein expression of the DNA repair gene BRCA1, and the apoptosis inhibitor BCL2. Furthermore, COMMD1 expression was immunohistochemically analyzed in two tissue micro-arrays (TMAs, representing a historical cohort and a randomized clinical trial-based cohort of advanced stage HGSOC tumor specimens. Expression of COMMD1 was observed in all ovarian cancer samples, however, specifically nuclear expression of COMMD1 was only observed in a subset of ovarian cancers. In our historical cohort, nuclear COMMD1 expression was associated with an improved response to chemotherapy (OR = 0.167; P = 0.038, although this association could not be confirmed in the second cohort, likely due to sample size. Taken together, these results suggest that nuclear expression of COMMD1 sensitize ovarian cancer to cisplatin, possibly by modulating the G2/M checkpoint and through controlling expression of genes involved in DNA repair and apoptosis.

Soluplus/TPGS mixed micelles for dioscin delivery in cancer therapy.

Science.gov (United States)

Zhao, Jing; Xu, Youwei; Wang, Changyuan; Ding, Yanfang; Chen, Manyu; Wang, Yifei; Peng, Jinyong; Li, Lei; Lv, Li

2017-07-01

Dioscin has shown cytotoxicity against cancer cells, but its poor solubility and stability have limited its clinical application. In this study, we designed mixed micelles composed of TPGS and Soluplus ® copolymers entrapping the poorly soluble anticancer drug dioscin. In order to improve the aqueous solubility and bioactivity of dioscin, TPGS/Soluplus ® mixed micelles with an optimal ratio were prepared using a thin-film hydration method, and their physicochemical properties were characterized. Cellular cytotoxicity and uptake of the dioscin-loaded TPGS/Soluplus ® mixed micelles were studied in MCF-7 breast cancer cells and A2780s ovarian cancer cells. The pharmacokinetics of free dioscin and dioscin-loaded TPGS/Soluplus ® mixed micelles was studied in vivo in male Sprague-Dawley rats via a single intravenous injection in the tail vein. The average size of the optimized mixed micelle was 67.15 nm, with 92.59% drug encapsulation efficiency and 4.63% drug loading efficiency. The in vitro release profile showed that the mixed micelles presented sustained release behavior compared to the anhydrous ethanol solution of dioscin. In vitro cytotoxicity assays were conducted on human cancer cell lines including A2780s ovarian cancer cells and MCF-7 breast cancer cells. The mixed micelles exhibited better antitumor activity compared to free dioscin against all cell lines, which may benefit from the significant increase in the cellular uptake of dioscin from mixed micelles compared to free dioscin. The pharmacokinetic study showed that the mixed micelle formulation achieved a 1.3 times longer mean residual time (MRT) in circulation and a 2.16 times larger area under the plasma concentration-time curve (AUC) than the free dioscin solution. Our results suggest that the dioscin-loaded mixed micelles developed in this study might be a potential nano drug-delivery system for cancer chemotherapy.

Copper(II) Complexes of Phenanthroline and Histidine Containing Ligands: Synthesis, Characterization and Evaluation of their DNA Cleavage and Cytotoxic Activity.

Science.gov (United States)

Leite, Sílvia M G; Lima, Luís M P; Gama, Sofia; Mendes, Filipa; Orio, Maylis; Bento, Isabel; Paulo, António; Delgado, Rita; Iranzo, Olga

2016-11-21

Copper(II) complexes have been intensely investigated in a variety of diseases and pathological conditions due to their therapeutic potential. The development of these complexes requires a good knowledge of metal coordination chemistry and ligand design to control species distribution in solution and tailor the copper(II) centers in the right environment for the desired biological activity. Herein we present the synthesis and characterization of two ligands HL1 and H 2 L2 containing a phenanthroline unit (phen) attached to the amino group of histidine (His). Their copper(II) coordination properties were studied using potentiometry, spectroscopy techniques (UV-vis and EPR), mass spectrometry (ESI-MS) and DFT calculations. The data showed the formation of single copper complexes, [CuL1] + and [CuL2], with high stability within a large pH range (from 3.0 to 9.0 for [CuL1] + and from 4.5 to 10.0 for [CuL2]). In both complexes the Cu 2+ ion is bound to the phen unit, the imidazole ring and the deprotonated amide group, and displays a distorted square pyramidal geometry as confirmed by single crystal X-ray crystallography. Interestingly, despite having similar structures, these copper complexes show different redox potentials, DNA cleavage properties and cytotoxic activity against different cancer cell lines (human ovarian (A2780), its cisplatin-resistant variant (A2780cisR) and human breast (MCF7) cancer cell lines). The [CuL2] complex has lower reduction potential (E pc = -0.722 V vs -0.452 V for [CuL1] + ) but higher biological activity. These results highlight the effect of different pendant functional groups (carboxylate vs amide), placed out of the coordination sphere, in the properties of these copper complexes.

PC based electrolytes with LiDFOB as an alternative salt for lithium-ion batteries

Science.gov (United States)

Knight, Brandon M.

Lithium-ion batteries (LIBs) have been greatly sought after as a source of renewable energy storage. LIBs have a wide range of applications including but not limited portable electronic devices, electric vehicles, and power tools. As a direct result of their commercial viability an insatiable hunger for knowledge, advancement within the field of LIBs has been omnipresent for the last two decades. However, there are set backs evident within the LIB field; most notably the limitations of standard electrolyte formulations and LiPF6 lithium salt. The standard primary carbonate of ethylene carbonate (EC) has a very limited operating range due to its innate physical properties, and the LiPF6 salt is known to readily decompose to form HF which can further degrade LIB longevity. The goal of our research is to explore the use of a new primary salt LiDFOB in conjunction with a propylene carbonate based electrolyte to establish a more flexible electrolyte formulation by constructing coin cells and cycling them under various conditions to give a clear understanding of each formulation inherent performance capabilities. Our studies show that 1.2M LiDFOB in 3:7 PC/EMC + 1.5% VC is capable of performing comparably to the standard 1.2M LiPF6 in 3:7 EC/EMC at 25°C and the PC electrolyte also illustrates performance superior to the standard at 55°C. The degradation of lithium manganese spinel electrodes, including LiNi 0.5Mn1.5O4, is an area of great concern within the field of lithium ion batteries (LIBs). Manganese containing cathode materials frequently have problems associated with Mn dissolution which significantly reduces the cycle life of LIB. Thus the stability of the cathode material is paramount to the performance of Mn spinel cathode materials in LIBs. In an effort to gain a better understanding of the stability of LiNi0.5 Mn1.5O4 in common LiPF6/carbonate electrolytes, samples were stored at elevated temperature in the presence of electrolyte. Then after storage both

Formation of stable small cell number three-dimensional ovarian cancer spheroids using hanging drop arrays for preclinical drug sensitivity assays.

Science.gov (United States)

Raghavan, Shreya; Ward, Maria R; Rowley, Katelyn R; Wold, Rachel M; Takayama, Shuichi; Buckanovich, Ronald J; Mehta, Geeta

2015-07-01

Ovarian cancer grows and metastasizes from multicellular spheroidal aggregates within the ascites fluid. Multicellular tumor spheroids are therefore physiologically significant 3D in vitro models for ovarian cancer research. Conventional hanging drop cultures require high starting cell numbers, and are tedious for long-term maintenance. In this study, we generate stable, uniform multicellular spheroids using very small number of ovarian cancer cells in a novel 384 well hanging drop array platform. We used novel tumor spheroid platform and two ovarian cancer cell lines (A2780 and OVCAR3) to demonstrate the stable incorporation of as few as 10 cells into a single spheroid. Spheroids had uniform geometry, with projected areas (42.60×10(3)μm-475.22×10(3)μm(2) for A2780 spheroids and 37.24×10(3)μm(2)-281.01×10(3)μm(2) for OVCAR3 spheroids) that varied as a function of the initial cell seeding density. Phalloidin and nuclear stains indicated cells formed tightly packed spheroids with demarcated boundaries and cell-cell interaction within spheroids. Cells within spheroids demonstrated over 85% viability. 3D tumor spheroids demonstrated greater resistance (70-80% viability) to cisplatin chemotherapy compared to 2D cultures (30-50% viability). Ovarian cancer spheroids can be generated from limited cell numbers in high throughput 384 well plates with high viability. Spheroids demonstrate therapeutic resistance relative to cells in traditional 2D culture. Stable incorporation of low cell numbers is advantageous when translating this research to rare patient-derived cells. This system can be used to understand ovarian cancer spheroid biology, as well as carry out preclinical drug sensitivity assays. Copyright © 2015 Elsevier Inc. All rights reserved.

Progress on the biphase turbine at Cerro Prieto

Energy Technology Data Exchange (ETDEWEB)

Cerini, D.; Hays, L.; Studhalter, W. [Douglas Energy Company, Placentia, CA (United States)

1997-12-31

The status of a Biphase turbine power plant being installed at the Cerro Prieto geothermal field is presented. The major modules for the power plant are completed except for a back pressure steam turbine. The power plant will be started in April 1997 with the Biphase turbine alone followed by the addition of the steam turbine module two months later. The current power plant performance level is 2780 kWe due to a decline in the well. An increase in power output to 4060 kWe by adding the flow from another well is planned. The addition of five Biphase power plants with a total power output of 21.2 megawatts is described.

Optimization of environment compatible analysis methods for mineral hydrocarbons in the soil; Optimierung umweltvertraeglicher Analysenverfahren fuer Mineraloelkohlenwasserstoffe im Boden

Energy Technology Data Exchange (ETDEWEB)

Flachowsky, J.; Borsdorf, H. [eds.] [UFZ - Umweltforschungszentrum Leipzig-Halle GmbH, Leipzig (Germany); Loehmannsroeben, H.G.; Roch, T. [Erlangen-Nuernberg Univ., Erlangen (Germany); Leopom, P. [Umweltbundesamt, Berlin (Germany); Reimers, C. [Technische Univ. Hamburg-Harburg, Hamburg (Germany); Matz, G.; Kuebler, J. [MOBILAB GmbH, Hamburg (Germany); Christall, B. [SOFIA GmbH, Berlin (Germany); Hahn, M.; Matschiner, H. [Elektrochemie Halle GmbH (Germany); Baermann, A. [Dr. Baermann und Partner Mikroanalytik, Hamburg (Germany)

1997-12-31

This paper describes several analytical methods for the quantitative chemical analysis of mineral oil hydrocarbons in soils. The measuring methods are investigated on accuracy, errors, sample preparation methods, analysis of reference materials and real materials. (SR) [Deutsch] Mit dieser Schrift praesentiert die Deutsche Bundesstiftung Umwelt der Oeffentlichkeit Ergebnisse zu alternativen umweltvertraeglichen Bestimmungsmethoden fuer Mineraloelkohlenwasserstoffe in Boeden. Es war in erster Linie das Ziel aller beteiligten Forscher und Entwickler, die heute noch in der Anwendung befindliche Vorschrift nach DIN 38409 H18 zur Analytik von Mineraloelkohlenwasserstoffen durch eine sowohl umweltfreundliche als auch insgesamt aussagekraeftige Methode zu substituieren. (orig.)

Experimental therapy of ovarian cancer with synthetic makaluvamine analog: in vitro and in vivo anticancer activity and molecular mechanisms of action.

Directory of Open Access Journals (Sweden)

Tao Chen

Full Text Available The present study was designed to determine the biological effects of novel marine alkaloid analog 7-(4-fluorobenzylamino-1,3,4,8-tetrahydropyrrolo[4,3,2-de]quinolin-8(1H-one (FBA-TPQ on human ovarian cancer cells for its anti-tumor potential and the underlying mechanisms as a novel chemotherapeutic agent. Human ovarian cancer cells (A2780 and OVCAR-3, and Immortalized non-tumorigenic human Ovarian Surface Epithelial cells (IOSE-144, were exposed to FBA-TPQ for initial cytotoxicity evaluation (via MTS assay kit, Promega. The detailed in-vitro (cell level and in-vivo (animal model studies on the antitumor effects and possible underlying mechanisms of action of the compounds were then performed. FBA-TPQ exerted potent cytotoxicity against human ovarian cancer A2780 and OVCAR-3 cells as an effective inhibitor of cell growth and proliferation, while exerting lesser effects on non-tumorigenic IOSE-144 cells. Further study in the more sensitive OVCAR-3 cell line showed that it could potently induce cell apoptosis (Annexin V-FITC assay, G2/M cell cycle arrest (PI staining analysis and also dose-dependently inhibit OVCAR-3 xenograft tumors' growth on female athymic nude mice (BALB/c, nu/nu. Mechanistic studies (both in vitro and in vivo revealed that FBA-TPQ might exert its activity through Reactive Oxygen Species (ROS-associated activation of the death receptor, p53-MDM2, and PI3K-Akt pathways in OVCAR-3 cells, which is in accordance with in vitro microarray (Human genome microarrays, Agilent data analysis (GEO accession number: GSE25317. In conclusion, FBA-TPQ exhibits significant anticancer activity against ovarian cancer cells, with minimal toxicity to non-tumorigenic human IOSE-144 cells, indicating that it may be a potential therapeutic agent for ovarian cancer.

Particle size effect of Ni-rich cathode materials on lithium ion battery performance

International Nuclear Information System (INIS)

Hwang, Ilkyu; Lee, Chul Wee; Kim, Jae Chang; Yoon, Songhun

2012-01-01

Graphical abstract: The preparation condition of Ni-rich cathode materials was investigated. When the retention time was short, a poor cathode performance was observed. For long retention time condition, cathode performance displayed a best result at pH 12. Highlights: ► Ni-rich cathode materials (LiNi 0.8 Co 0.15 Al 0.05 O 2 ) were prepared by co-precipitation method using separate addition of Al salt. ► Particle size of Ni-rich cathode materials became larger with increase of retention time and solution pH. ► Cathode performance was poor for low retention time. ► Optimal pH for co-precipitation was 12. -- Abstract: Herein, Ni-rich cathode materials (LiNi 0.8 Co 0.15 Al 0.05 O 2 ) in lithium ion batteries are prepared by a separate addition of Ni/Co salt and Al sol solution using a continuously stirred tank reactor. Retention time and solution pH were controlled in order to obtain high performance cathode material. Particle size increase was observed with a higher retention time of the reactants. Also, primary and secondary particles became smaller according to an increase of solution pH, which was probably due to a decrease of growth rate. From the cathode application, a high discharge capacity (175 mAh g −1 ), a high initial efficiency (90%) and a good cycleability were observed in the cathode material prepared under pH 12 condition, which was attributed to its well-developed layered property and the optimal particle size. However, rate capability was inversely proportional to the particle size, which was clarified by a decrease of charge-transfer resistance measured in the electrochemical impedance spectroscopy.

Methotrexate induces DNA damage and inhibits homologous recombination repair in choriocarcinoma cells

Directory of Open Access Journals (Sweden)

Xie L

2016-11-01

Full Text Available Lisha Xie,1,* Tiancen Zhao,1,2,* Jing Cai,1 You Su,1 Zehua Wang,1 Weihong Dong1 1Department of Obstetrics and Gynecology, Union Hospital, Tongji Medical College, Huazhong University of Science and Technology, 2Department of Obstetrics and Gynecology, Central Hospital of Wuhan, Wuhan, China *These authors contributed equally to this work Objective: The objective of this study was to investigate the mechanism of sensitivity to methotrexate (MTX in human choriocarcinoma cells regarding DNA damage response. Methods: Two choriocarcinoma cancer cell lines, JAR and JEG-3, were utilized in this study. An MTX-sensitive osteosarcoma cell line MG63, an MTX-resistant epithelial ovarian cancer cell line A2780 and an MTX-resistant cervical adenocarcinoma cell line Hela served as controls. Cell viability assay was carried out to assess MTX sensitivity of cell lines. MTX-induced DNA damage was evaluated by comet assay. Quantitative reverse transcription polymerase chain reaction was used to detect the mRNA levels of BRCA1, BRCA2, RAD51 and RAD52. The protein levels of γH2AX, RAD 51 and p53 were analyzed by Western blot. Results: Remarkable DNA strand breaks were observed in MTX-sensitive cell lines (JAR, JEG-3 and MG63 but not in MTX-resistant cancer cells (A2780 and Hela after 48 h of MTX treatment. Only in the choriocarcinoma cells, the expression of homologous recombination (HR repair gene RAD51 was dramatically suppressed by MTX in a dose- and time-dependent manner, accompanied with the increase in p53. Conclusion: The MTX-induced DNA strand breaks accompanied by deficiencies in HR repair may contribute to the hypersensitivity to chemotherapy in choriocarcinoma. Keywords: choriocarcinoma, chemotherapy hypersensitivity, DNA double-strand break, RAD51, p53

Synthesis, Molecular Structure and Cytotoxicity of Molecular Materials Based on Water Soluble Half-Sandwich Rh(III) and Ir(III) Tetranuclear Metalla-Cycles

Science.gov (United States)

Gupta, Gajendra; Murray, Benjamin S.; Dyson, Paul J.; Therrien, Bruno

2013-01-01

The neutral dinuclear complexes [(η5-C5Me5)2Rh2(μ-dhnq)Cl2] (1) and [(η5-C5Me5)2Ir2(μ-dhnq)Cl2] (2) (dhnqH2 = 5,8-dihydroxy-1,4-naphthoquinone) were obtained from the reaction of [(η5-C5Me5)M(μ-Cl)Cl]2 (M = Rh, Ir) with dhnqH2 in the presence of CH3COONa. Treatment of 1 or 2 in methanol with linear ditopic ligands L (L = pyrazine, 4,4′-bipyridine or 1,2-bis(4-pyridyl)ethylene), in the presence of AgCF3SO3, affords the corresponding tetranuclear metalla-rectangles [(η5-C5Me5)4M4(μ-dhnq)2(μ-L)2]4+ (L = pyrazine, M = Rh, 3; M = Ir, 4; L = 4,4′-bipyridine, M = Rh, 5; M = Ir, 6; L = 1,2-bis(4-pyridyl)ethylene, M = Rh, 7; M = Ir, 8). All complexes were isolated as their triflate salts and were fully characterized by infrared, 1H and 13C NMR spectroscopy, and some representative complexes by single-crystal X-ray structure analysis. The X-ray structures of 3, 5 and 6 confirm the formation of the tetranuclear metalla-cycles, and suggest that complexes 5 and 6 possess a cavity of sufficient size to encapsulate small guest molecules. In addition, the antiproliferative activity of the metalla-cycles 3–8 was evaluated against the human ovarian A2780 (cisplatin sensitive) and A2780cisR (cisplatin resistant) cancer cell lines and on non-tumorigenic human embryonic kidney HEK293 cells. All cationic tetranuclear metalla-rectangles were found to be highly cytotoxic, with IC50 values in the low micromolar range. PMID:28788394

Synthesis, Molecular Structure and Cytotoxicity of Molecular Materials Based on Water Soluble Half-Sandwich Rh(III and Ir(III Tetranuclear Metalla-Cycles

Directory of Open Access Journals (Sweden)

Gajendra Gupta

2013-11-01

Full Text Available The neutral dinuclear complexes [(η5-C5Me52Rh2(μ-dhnqCl2] (1 and [(η5-C5Me52Ir2(μ-dhnqCl2] (2 (dhnqH2 = 5,8-dihydroxy-1,4-naphthoquinone were obtained from the reaction of [(η5-C5Me5M(μ-ClCl]2 (M = Rh, Ir with dhnqH2 in the presence of CH3COONa. Treatment of 1 or 2 in methanol with linear ditopic ligands L (L = pyrazine, 4,4′-bipyridine or 1,2-bis(4-pyridylethylene, in the presence of AgCF3SO3, affords the corresponding tetranuclear metalla-rectangles [(η5-C5Me54M4(μ-dhnq2(μ-L2]4+ (L = pyrazine, M = Rh, 3; M = Ir, 4; L = 4,4′-bipyridine, M = Rh, 5; M = Ir, 6; L = 1,2-bis(4-pyridylethylene, M = Rh, 7; M = Ir, 8. All complexes were isolated as their triflate salts and were fully characterized by infrared, 1H and 13C NMR spectroscopy, and some representative complexes by single-crystal X-ray structure analysis. The X-ray structures of 3, 5 and 6 confirm the formation of the tetranuclear metalla-cycles, and suggest that complexes 5 and 6 possess a cavity of sufficient size to encapsulate small guest molecules. In addition, the antiproliferative activity of the metalla-cycles 3–8 was evaluated against the human ovarian A2780 (cisplatin sensitive and A2780cisR (cisplatin resistant cancer cell lines and on non-tumorigenic human embryonic kidney HEK293 cells. All cationic tetranuclear metalla-rectangles were found to be highly cytotoxic, with IC50 values in the low micromolar range.

Aligned Li+ Tunnels in Core-Shell Li(NixMnyCoz)O2@LiFePO4 Enhances Its High Voltage Cycling Stability as Li-ion Battery Cathode.

Science.gov (United States)

Wu, Zhongzhen; Ji, Shunping; Liu, Tongchao; Duan, Yandong; Xiao, Shu; Lin, Yuan; Xu, Kang; Pan, Feng

2016-10-12

Layered transition-metal oxides (Li[Ni x Mn y Co z ]O 2 , NMC, or NMCxyz) due to their poor stability when cycled at a high operating voltage (>4.5 V) have limited their practical applications in industry. Earlier researches have identified Mn(II)-dissolution and some parasitic reactions between NMC surface and electrolyte, especially when NMC is charged to a high potential, as primarily factors responsible for the fading. In our previous work, we have achieved a capacity of NMC active material close to theoretical value and optimized its cycling performance by a depolarized carbon nanotubes (CNTs) network and an unique "pre-lithiation process" that generates an in situ organic coating (∼40 nm) to prevent Mn(II) dissolution and minimize the parasitic reactions. Unfortunately, this organic coating is not durable enough during a long-term cycling when the cathode operates at a high potential (>4.5 V). This work attempts to improve the surface protection of the NMC532 particles by applying an active inorganic coating consisting of nanosized- and crystal-orientated LiFePO 4 (LFP) (about 50 nm, exposed (010) face) to generate a core-shell nanostructure of Li(Ni x Mn y Co z )O 2 @LiFePO 4 . Transmission electron microscopy (TEM) and etching X-ray photoelectron spectroscopy have confirmed an intimate contact coating (about 50 nm) between the original structure of NMC and LFP single-particle with atomic interdiffusion at the core-shell interface, and an array of interconnected aligned Li + tunnels are observed at the interface by cross-sectional high-resolution TEM, which were formed by ball-milling and then strictly controlling the temperature below 100 °C. Batteries based on this modified NMC cathode material show a high reversible capacity when cycled between 3.0 and 4.6 V during a long-term cycling.

Surface and in-depth characterization of lithium-ion battery cathodes at different cycle states using confocal micro-X-ray fluorescence-X-ray absorption near edge structure analysis

International Nuclear Information System (INIS)

Menzel, Magnus; Schlifke, Annalena; Falk, Mareike; Janek, Jürgen; Fröba, Michael; Fittschen, Ursula Elisabeth Adriane

2013-01-01

The cathode material LiNi 0.5 Mn 1.5 O 4 for lithium-ion batteries has been studied with confocal micro-X-ray fluorescence (CMXRF) combined with X-ray absorption near edge structure (XANES) at the Mn-K edge and the Ni-K edge. This technique allows for a non-destructive, spatially resolved (x, y and z) investigation of the oxidation states of surface areas and to some extent of deeper layers of the electrode. Until now CMXRF-XANES has been applied to a limited number of applications, mainly geo-science. Here, we introduce this technique to material science applications and show its performance to study a part of a working system. A novel mesoporous LiNi 0.5 Mn 1.5 O 4 material was cycled (charged and discharged) to investigate the effects on the oxidation states at the cathode/electrolyte interface. With this approach the degradation of Mn 3+ to Mn 4+ only observable at the surface of the electrode could be directly shown. The spatially resolved non-destructive analysis provides knowledge helpful for further understanding of deterioration and the development of high voltage battery materials, because of its nondestructive nature it will be also suitable to monitor processes during battery cycling. - Highlights: • The potential of confocal micro-XRF-XANES for spatial resolved species analysis in a part of a working system is shown. • The spatial resolution enables differentiation of the oxidized interface from deeper layers. • With the analytical technique confocal micro-XRF-XANES 3D in-situ analyses of working systems are feasible. • The multidimensional and nondestructive analysis of Li-ion battery cathodes is shown. • The analysis will allow for a deeper understanding of processes at interfaces in battery science and others

KARAKTERISASI ENZIM POLIFENOL OKSIDASE BIJI KAKAO (Theobroma cacao Linn. Characterization of Polyphenol Oxidase Enzyme of Cocoa Beans (Theobroma cacao Linn.

Directory of Open Access Journals (Sweden)

G.P. Ganda Putra

2012-05-01

max equals to 595,24 U/gram (db of cocoa beans and K equals to 0,20 M; result of SDS- PAGE of enzyme shows protein bands at M� of 11,75; 17,80; 27,80; 36,03 and 131,52 kDa; and finally, optimumcondition of enzyme activity is at the temperature of 53,43oC; pH 5,42 and incubation time of 80,91 minutes. ABSTRAK Telah dilakukan penelitian dengan tujuan untuk: (1 mengetahui karakteristik enzim polifenol oksidase dan (2 menen- tukan kondisi (suhu, pH dan waktu inkubasi optimum aktivitas enzim polifenol oksidase, yang diisolasi dari biji kakao kering. Hasil penelitian berupa kondisi (suhu, pH dan waktu inkubasi optimum aktivitas enzim polifenol oksidase akan diaplikasikan untuk perbaikan mutu biji kakao kering melalui teknik rehidrasi. Penelitian ini dilakukan melalui tahapan: (1 isolasi enzim polifenol oksidase dari 10 sampel biji kakao kering di Provinsi Bali, (2 karakterisasi enzim polifenol oksidase (aktivitas, kinetika enzim, BM dan (3 penentuan kondisi suhu, pH dan waktu inkubasi optimum. Hasil yang diperoleh menunjukkan bahwa: (1 aktivitas enzim polifenol oksidase rata-rata 157,49 ± 58,03 U/gram (bk biji kakao dengan aktivitas maksimum 258,22 U/gram (bk biji kakao dan minimum 59,01 U/gram (bk biji kakao; maks sebesar 595,24 U/gram (bk biji kakao dan K sebesar 0,20 M; hasil SDS-PAGE enzim menunjukkan pita-pita protein yang terbentuk pada BM 11,75; 17,80; 27,80; 36,03 dan 131,52 kDa; dan (2 kondisi optimum aktivitas enzimadalah suhu 53,43oC; pH 5,42 dan waktu inkubasi 80,91 menit.

Superconcentrated electrolytes for a high-voltage lithium-ion battery

Science.gov (United States)

Wang, Jianhui; Yamada, Yuki; Sodeyama, Keitaro; Chiang, Ching Hua; Tateyama, Yoshitaka; Yamada, Atsuo

2016-01-01

Finding a viable electrolyte for next-generation 5 V-class lithium-ion batteries is of primary importance. A long-standing obstacle has been metal-ion dissolution at high voltages. The LiPF6 salt in conventional electrolytes is chemically unstable, which accelerates transition metal dissolution of the electrode material, yet beneficially suppresses oxidative dissolution of the aluminium current collector; replacing LiPF6 with more stable lithium salts may diminish transition metal dissolution but unfortunately encounters severe aluminium oxidation. Here we report an electrolyte design that can solve this dilemma. By mixing a stable lithium salt LiN(SO2F)2 with dimethyl carbonate solvent at extremely high concentrations, we obtain an unusual liquid showing a three-dimensional network of anions and solvent molecules that coordinate strongly to Li+ ions. This simple formulation of superconcentrated LiN(SO2F)2/dimethyl carbonate electrolyte inhibits the dissolution of both aluminium and transition metal at around 5 V, and realizes a high-voltage LiNi0.5Mn1.5O4/graphite battery that exhibits excellent cycling durability, high rate capability and enhanced safety. PMID:27354162

Twitter.com kā korporatīvo sabiedrisko attiecību instruments Latvijā: satura analīze

OpenAIRE

Lulle, Katrīna

2010-01-01

Bakalaura darba tēma ir „Twitter.com kā korporatīvo sabiedrisko attiecību instruments Latvijā: satura analīze”. Darba ietvaros analizēti 10 Latvijas uzľēmumu Twitter.com profilu ieraksti laika periodā no 2009. gada decembra līdz 2010. gada februārim, kopumā 2780 ieraksti. Darba mērķis ir veikt Latvijas uzľēmumu Twitter.com profilu satura analīzi, lai noteiktu, kā Twitter.com tiek izmantots kā korporatīvo sabiedrisko attiecību instruments. Darbā ir divas teorētiskās nodaļas par sabied...

Understanding Mn-Based Intercalation Cathodes from Thermodynamics and Kinetics

Directory of Open Access Journals (Sweden)

Yin Xie

2017-07-01

Full Text Available A series of Mn-based intercalation compounds have been applied as the cathode materials of Li-ion batteries, such as LiMn2O4, LiNi1−x−yCoxMnyO2, etc. With open structures, intercalation compounds exhibit a wide variety of thermodynamic and kinetic properties depending on their crystal structures, host chemistries, etc. Understanding these materials from thermodynamic and kinetic points of view can facilitate the exploration of cathodes with better electrochemical performances. This article reviews the current available thermodynamic and kinetic knowledge on Mn-based intercalation compounds, including the thermal stability, structural intrinsic features, involved redox couples, phase transformations as well as the electrical and ionic conductivity.

Methanol adsorption on Pt(111)

International Nuclear Information System (INIS)

Melo, A.V.; Chottiner, G.S.; Hoffman, R.W.; O'Grady, W.E.

1984-12-01

High resolution electron energy loss spectroscopy has been used to study the decomposition of methanol on a Pt(111) surface. Several intermediate states in the decomposition are identified by quenching the sample when reactions occur. At 100 K a set of peaks at 800, 1040, 1350, and 2890 cm -1 indicates the presence of a multilayer molecularly adsorbed methanol. As the sample is warmed to 130 K peaks develop at 1700 and 2780 cm -1 , suggesting the formation of formaldehyde on the surface. With further heating, peaks grow at 1820 and 2560 cm -1 due to the formation of a formyl species during the decomposition of methanol over Pt(111). Further heating leads to the final conversion of the surface species to adsorbed CO and carbonaceous residues

Investigation of positive electrode materials based on MnO2 for lithium batteries

International Nuclear Information System (INIS)

Le, My Loan Phung; Lam, Thi Xuan Binh; Pham, Quoc Trung; Nguyen, Thi Phuong Thoa

2011-01-01

Various composite materials of MnO 2 /C have been synthesized by electrochemical deposition and then used for the synthesis of lithium manganese oxide (LiMn 2 O 4 ) spinel as a cathode material for lithium ion batteries. The structure and electrochemical properties of electrode materials based on MnO 2 /C, spinel LiMn 2 O 4 and doped spinel LiNi 0.5 Mn 1.5 O 4 have been studied. The influence of synthesis conditions on the structural and electrochemical properties of synthesized materials was investigated by x-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electronic microscopy (TEM) and charge–discharge experiments. Some of the studied materials exhibit good performance of cycling and discharge capacity

Iz novõh stihhov / Jaan Kaplinski ; per. Svetlan Semenenko

Index Scriptorium Estoniae

Kaplinski, Jaan, 1941-

2001-01-01

J. Kaplinski elu- ja loomeloost lk. 2-12. Sisu: "Rasskazõval studentam o natshale gretsheskoi kulturõ..." ; "Net boga..." ; "Mezhdu dvumja porõvami vetra..." ; "Na ulitse Vallikraavi odinoki muravei tashtshil..." ; "Tshto v stihhah glavnoje? - ne soderzhanje, ne forma..." ; "Otnosja na pomoiku slantsevuju zolu i banki..." ; "Stihhi kak zelen - vesnoi ona rozhdajetsja..." ; "Vizhu tvoju reshitelnost: prevrashtshajesh svoju zhizn..." ; "Lini, kazhetsja, ne sushtshestvujet, jest tolko totshki..." ; "Natshal stirat rubashku sõna. Nashol v karmane bumazhku..." ; "Vspomnit, podumat o sginuvshem dne..." ; "Smert ne prihhodit izvne. Smert vnutri..." ; "Ja ne pishu stihhov o lete, ob osseni..." ; "Stihhi zhivut na zemle uzhe s eotsena. Ih predki zhili..." ; "Vneshnim vidom idealõ napominajut krolikov ili beshvostnõh..."

Thermal behavior and failure mechanism of lithium ion cells during overcharge under adiabatic conditions

International Nuclear Information System (INIS)

Ye, Jiana; Chen, Haodong; Wang, Qingsong; Huang, Peifeng; Sun, Jinhua; Lo, Siuming

2016-01-01

Highlights: • The modified adiabatic method is used to measure the heat generation under overcharge. • Side reactions contribute 80% heat to thermal runaway in the cases with cycling rate below 1.0 C. • The inflection and maximum voltages increase linearly with the increasing current rates. • The decomposed products of cathode materials are soluble with that of SiO_x. • Lithium plating on anode is due to changes of distance between the cathode and anode. - Abstract: Cells in battery packs are easily overcharged when battery management system (BMS) is out of order, causing thermal runaway. However, the traditional calorimetry could not estimate dynamic overcharging heat release. In this study, commercial LiCoO_2 + Li(Ni_0_._5Co_0_._2Mn_0_._3)O_2/C + SiO_x cells are employed to investigate the dynamic thermal behaviors during overcharge under adiabatic condition by combining a multi-channel battery cycler with an accelerating rate calorimeter. The results indicate that overcharging with galvanostatic - potentiostatic - galvanostatic regime is more dangerous than that with galvanostatic way. Side reactions contribute 80% heat to thermal runaway in cases below 1.0 C charging rate. To prevent the thermal runaway, the effective methods should be taken within 2 min to cool down the batteries as soon as the cells pass inflection point voltage. Hereinto, the inflection and maximum voltages increase linearly with the increasing current rates. By scanning electron microscope and energy dispersive spectrometer, the decomposed products of cathode materials are suspected to be soluble with SiOx. The overcharge induced decomposition reaction of Li(Ni_0_._5Co_0_._2Mn_0_._3)O_2 is also proposed. These results can provide support for the safety designs of lithium ion batteries and BMS.

Optically pumped FIR lasers and their application in plasma diagnostics

International Nuclear Information System (INIS)

Bakos, J.S.

1986-06-01

The pysics and the construction of the far infrared lasers (FIRL) and of the infrared lasers pumping them are reviewed. The details of the construction, resonating and pumping systems, spectral and power characteristics of the FIRLs are discussed. Recently more than 1000 laser lines are known and used in the 27-80 mm wavelength range, but in many cases the laser kinetics are not fully understood, and some instability phenomena cannot be prevented. New nonlinear processes were found: two-photon pumping, hyper Raman laser tuning and relaxation phenomena. A broad application field, the plasma diagnostics by far infrared lasers is described. Scattering of infrared laser radiation can give new interesting information on the not understood effect of the anomalous transport in the high temperature plasma. (D.Gy.)

Low MAD2 expression levels associate with reduced progression-free survival in patients with high-grade serous epithelial ovarian cancer.

LENUS (Irish Health Repository)

Furlong, Fiona

2012-04-01

Epithelial ovarian cancer (EOC) has an innate susceptibility to become chemoresistant. Up to 30% of patients do not respond to conventional chemotherapy [paclitaxel (Taxol®) in combination with carboplatin] and, of those who have an initial response, many patients relapse. Therefore, an understanding of the molecular mechanisms that regulate cellular chemotherapeutic responses in EOC cells has the potential to impact significantly on patient outcome. The mitotic arrest deficiency protein 2 (MAD2), is a centrally important mediator of the cellular response to paclitaxel. MAD2 immunohistochemical analysis was performed on 82 high-grade serous EOC samples. A multivariate Cox regression analysis of nuclear MAD2 IHC intensity adjusting for stage, tumour grade and optimum surgical debulking revealed that low MAD2 IHC staining intensity was significantly associated with reduced progression-free survival (PFS) (p = 0.0003), with a hazard ratio of 4.689. The in vitro analyses of five ovarian cancer cell lines demonstrated that cells with low MAD2 expression were less sensitive to paclitaxel. Furthermore, paclitaxel-induced activation of the spindle assembly checkpoint (SAC) and apoptotic cell death was abrogated in cells transfected with MAD2 siRNA. In silico analysis identified a miR-433 binding domain in the MAD2 3\\' UTR, which was verified in a series of experiments. Firstly, MAD2 protein expression levels were down-regulated in pre-miR-433 transfected A2780 cells. Secondly, pre-miR-433 suppressed the activity of a reporter construct containing the 3\\'-UTR of MAD2. Thirdly, blocking miR-433 binding to the MAD2 3\\' UTR protected MAD2 from miR-433 induced protein down-regulation. Importantly, reduced MAD2 protein expression in pre-miR-433-transfected A2780 cells rendered these cells less sensitive to paclitaxel. In conclusion, loss of MAD2 protein expression results in increased resistance to paclitaxel in EOC cells. Measuring MAD2 IHC staining intensity may predict

Reaction mechanism and thermal stability study on cathode materials for rechargeable lithium ion batteries

Science.gov (United States)

Fang, Jin

(0≤y≤0.4) is stable up to 600 °C with particle size above 100 nm particle. And in this work Mn rich olivine phase Fe1-yMnyPO4 is found to be thermally stable up to at least 450 °C with particle size down to below 50 nm, different delithiation methods result in different decomposition routes, electrochemical delithiation results in decreased thermal stability. Moisture exposure appears the most detrimental to the thermal stability of Mn-rich samples. LiNi0.5Mn1.5O4 has attracted a lot of attentions because the potential is even higher (˜ 4.7 V vs Li +/Li0). However, electrolyte decomposition is quite often observed during electrochemistry cycles due to the high voltage operation window. Spinel LiNi0.5Mn1.5O4 is known as ordered and disordered according to the distribution of cations which relates to the synthesis conditions. Mn and Ni ions distribute either randomly in 16d sites of an Fd3m-space group or ordered in 4a and 12d sites of P4332 space group. During discharge and charge processes, Li ions insert and extract from the structure with the oxidation state of Ni changing between +2 and +4 while Mn remains as Mn4+. So far the correlation between cation distribution and electrochemical performance is still unclear, mostly the disordered samples are observed to have better rate capabilities. In order to study the reaction mechanism, combined XRD and XAS are used to investigate the oxidation state of transition metals and structure change of LiNi0.5Mn1.5O4 during electrochemical cycling, disordered and ordered samples were compared and studied, and both samples show three phases transformation during charge and discharge. However, the samples suffer from severe electrolyte decomposition which has influence on the results. Good spinel samples with nice electrochemistry performance is required, pure spinel samples are obtained by using co-precipitation method, the distribution of transition metal ions can be controlled by controlling the synthesis temperature

ZnO based transparent conductive oxide films with controlled type of conduction

Energy Technology Data Exchange (ETDEWEB)

Zaharescu, M., E-mail: mzaharescu@icf.ro [Institute of Physical Chemistry “Ilie Murgulescu”, Romanian Academy, 202 Splaiul Independentei, 060021 Bucharest (Romania); Mihaiu, S., E-mail: smihaiu@icf.ro [Institute of Physical Chemistry “Ilie Murgulescu”, Romanian Academy, 202 Splaiul Independentei, 060021 Bucharest (Romania); Toader, A. [Institute of Physical Chemistry “Ilie Murgulescu”, Romanian Academy, 202 Splaiul Independentei, 060021 Bucharest (Romania); Atkinson, I., E-mail: irinaatkinson@yahoo.com [Institute of Physical Chemistry “Ilie Murgulescu”, Romanian Academy, 202 Splaiul Independentei, 060021 Bucharest (Romania); Calderon-Moreno, J.; Anastasescu, M.; Nicolescu, M.; Duta, M.; Gartner, M. [Institute of Physical Chemistry “Ilie Murgulescu”, Romanian Academy, 202 Splaiul Independentei, 060021 Bucharest (Romania); Vojisavljevic, K.; Malic, B. [Institute Jožef Stefan, Ljubljana (Slovenia); Ivanov, V.A.; Zaretskaya, E.P. [State Scientific and Production Association “Scientific-Practical Materials Research Center of the National Academy of Science Belarus, P. Brovska str.19, 220072, Minsk (Belarus)

2014-11-28

The transparent conductive oxide films with controlled type of conduction are of great importance and their preparation is intensively studied. In our work, the preparation of such films based on doped ZnO was realized in order to achieve controlled type of conduction and high concentration of the charge carriers. Sol–gel method was used for films preparation and several dopants were tested (Sn, Li, Ni). Multilayer deposition was performed on several substrates: SiO{sub 2}/Si wafers, silica-soda-lime and/or silica glasses. The structural and morphological characterization of the obtained films were done by scanning electron microscopy, X-ray diffraction, X-ray fluorescence, X-ray photoelectron spectroscopy and atomic force microscopy respectively, while spectroscopic ellipsometry and transmittance measurements were done for determination of optical properties. The selected samples with the best structural, morphological and optical properties were subjected to electrical measurement (Hall and Seebeck effect). In all studied cases, samples with good adherence and homogeneous morphology as well as monophasic wurtzite type structure were obtained. The optical constants (refractive index and extinction coefficient) were calculated from spectroscopic ellipsometry data using Cauchy model. Films with n- or p-type conduction were obtained depending on the composition, number of deposition and thermal treatment temperature. - Highlights: • Transparent conductive ZnO based thin films were prepared by the sol–gel method. • Controlled type of conduction is obtained in (Sn, Li) doped and Li-Ni co-doped ZnO films. • Hall and Seebeck measurements proved the p-type conductivity for Li-Ni co-doped ZnO films. • The p-type conductivity was maintained even after 4-months of storage. • Influence of dopant- and substrate-type on the ZnO films properties was established.

PENGARUH PSYCHOLOGICAL EMPOWERMENT, EMPOWERING LEADERSHIP, SISTEM PENGUKURAN KINERJA PADA MOTIVASI INTRINSIK FIRST-LINE EMPLOYEES PERBANKAN

Directory of Open Access Journals (Sweden)

I Gusti Ayu Purnamawati

2016-10-01

Full Text Available Penelitian ini bertujuan untuk mengetahui pengaruh Psychological Empowerment, Empowering Leadership, dan Sistem Pengukuran Kinerja Pada Motivasi Intrinsik First-Line Employees Perbankan. Penelitian ini adalah penelitian kuantitatif. Data yang digunakan adalah data primer berupa kuesioner yang menggunakan skala likert 1-5 dan terdiri atas 36 item pertanyaan. Responden pada penelitian ini adalah manajemen lini garis pertama pada sektor perbankan yaitu sejumlah 35 orang yang berasal dari 7 BPR yang ada di Kabupaten Buleleng. Metode analisis data menggunakan model regresi linear berganda dengan bantuan alat statistik SPSS. Hasil penelitian menunjukkan bahwa  Psychological Empowerment, Empowering Leadership, dan Sistem Pengukuran Kinerja berpengaruh positif dan signifikan pada Motivasi Intrinsik First-Line Employees Perbankan dengan menggunakan taraf signifikansi 5%.

Gold(III) complexes with 2-substituted pyridines as experimental anticancer agents: solution behavior, reactions with model proteins, antiproliferative properties.

Science.gov (United States)

Maiore, Laura; Cinellu, Maria Agostina; Nobili, Stefania; Landini, Ida; Mini, Enrico; Gabbiani, Chiara; Messori, Luigi

2012-03-01

Gold(III) compounds form a family of promising cytotoxic and potentially anticancer agents that are currently undergoing intense preclinical investigations. Four recently synthesized and characterized gold(III) derivatives of 2-substituted pyridines are evaluated here for their biological and pharmacological behavior. These include two cationic adducts with 2-pyridinyl-oxazolines, [Au(pyox(R))Cl(2)][PF(6)], [pyox(R)=(S)-4-benzyl-2-(pyridin-2-yl)-4,5-dihydrooxazole, I; (S)-4-iso-propyl-2-(pyridin-2-yl)-4,5-dihydrooxazole, II] and two neutral complexes [Au(N,N'OH)Cl(2)], III, and [Au(N,N',O)Cl], IV, containing the deprotonated ligand N-(1-hydroxy-3-iso-propyl-2-yl)pyridine-2-carboxamide, N,N'H,OH, resulting from ring opening of bound pyox(R) ligand of complex II by hydroxide ions. The solution behavior of these compounds was analyzed. These behave as classical prodrugs: activation of the metal center typically takes place through release of the labile chloride ligands while the rest of the molecule is not altered; alternatively, activation may occur through gold(III) reduction. All compounds react eagerly with the model protein cyt c leading to extensive protein metalation. ESI MS experiments revealed details of gold-cyt c interactions and allowed us to establish the nature of protein bound metal containing fragments. The different behavior displayed by I and II compared to III and IV is highlighted. Remarkable cytotoxic properties, against the reference human ovarian carcinoma cell lines A2780/S and A2780/R were disclosed for all tested compounds with IC(50) values ranging from 1.43 to 6.18 μM in the sensitive cell line and from 1.59 to 10.86 μM in the resistant one. The common ability of these compounds to overcome cisplatin resistance is highlighted. The obtained results are thoroughly discussed in the frame of current knowledge on cytotoxic gold compounds. Copyright © 2011 Elsevier Inc. All rights reserved.

Poly(amido)amine (PAMAM) dendrimer-cisplatin complexes for chemotherapy of cisplatin-resistant ovarian cancer cells

Science.gov (United States)

Yellepeddi, Venkata Kashyap; Vangara, Kiran Kumar; Palakurthi, Srinath

2013-09-01

Dendrimer-cisplatin complexes were prepared using PAMAM dendrimers with terminal -NH2 and -COOH groups as well as biotin-conjugated dendrimers. Preformulation parameters of dendrimer-cisplatin complexes were studied using differential scanning calorimetry (DSC) and inductively coupled plasma-mass spectrometry (ICP-MS). Cytotoxicity and mechanism of cytotoxicity of dendrimer-cisplatin complexes was investigated in OVCAR-3, SKOV, A2780 and cisplatin-resistant CP70 human ovarian cancer cell lines. The loading of cisplatin in dendrimers was 11 % (w/w). PAMAM G4 dendrimers with amine surface groups (biotinylated and native) have shown 2.5- to 3.0-fold reduction in IC50 values in ovarian cancer cells when compared with carboxylate surface dendrimers ( p cisplatin complexes resulted in a 7.0-fold increase ( p cisplatin chemotherapy of ovarian cancer.

OPTIMASI LINI PRODUKSI DENGAN VALUE STREAM MAPPING DAN VALUE STREAM ANALYSIS TOOLS

Directory of Open Access Journals (Sweden)

Yosua Caesar Fernando

2014-12-01

Full Text Available Meminimalkan pemborosan dalam proses produksi adalah salah satu tujuan dari suatu perusahaan. Lean adalah metode yang dapat meminimalkan pemborosan dalam proses produksi. Dalam penelitian ini, metode yang digunakan untuk meminimalkan limbah di PT. Bonindo Abadi adalah Value Stream Analysis Tools (VALSAT dan Value Stream Mapping (VSM. VSM digunakan untuk melihat kondisi peta keadaan pada perusahaan. Pengurangan pemborosan dilakukan dengan menggunakan salah satu alat dari VALSAT yaitu Process Activity Mapping (PAM. Jumlah non value added (NVA yang ditemukan dalam proses produksi PT. X adalah 90,17% diikuti oleh necessary but non value added (NNVA dengan jumlah 9,79% dan value added (VA sebesar 0,04%. Usulan perbaikan yang diberikan adalah dengan mengurangi jumlah waktu aktivitas NVA atau menghilangkannya.

Making a commercial carbon fiber cloth having comparable capacitances to carbon nanotubes and graphene in supercapacitors through a "top-down" approach.

Science.gov (United States)

Zhang, Tianchang; Kim, Christine H J; Cheng, Yingwen; Ma, Yanwen; Zhang, Hongbo; Liu, Jie

2015-02-21

A "top-down" and scalable approach for processing carbon fiber cloth (CFC) into flexible and all-carbon electrodes with remarkable areal capacity and cyclic stability was developed. CFC is commercially available in large quantities but its use as an electrode material in supercapacitors is not satisfactory. The approach demonstrated in this work is based on the sequential treatment of CFC with KOH activation and high temperature annealing that can effectively improve its specific surface area to a remarkable 2780 m(2) g(-1) while at the same time achieving a good electrical conductivity of 320 S m(-1) without sacrificing its intrinsic mechanical strength and flexibility. The processed CFC can be directly used as an electrode for supercapacitors without any binders, conductive additives and current collectors while avoiding elaborate electrode processing steps to deliver a specific capacitance of ∼0.5 F cm(-2) and ∼197 F g(-1) with remarkable rate performance and excellent cyclic stability. The properties of these processed CFCs are comparable or better than graphene and carbon nanotube based electrodes. We further demonstrate symmetric solid-state supercapacitors based on these processed CFCs with very good flexibility. This "top-down" and scalable approach can be readily applied to other types of commercially available carbon materials and therefore can have a substantial significance for high performance supercapacitor devices.

Solar radiation transfer in the inhomogeneous atmosphere; Solarer Strahlungstransport in der inhomogenen Atmosphaere

Energy Technology Data Exchange (ETDEWEB)

Scheirer, R.

2001-07-01

A most profound knowledge about the radiative characteristics of clouds is required for the development of realistic atmospheric circulation models and cloud remote sensing algorithms. At present, cloud fields are treated extremely simplified in both application areas. Cloud radiative flux parameterizations in atmospheric circulation models as well as the correlation between radiance and cloud properties as required for remote sensing algorithm are usually based on the assumption of plane-parallel homogeneous (PPHOM) clouds. Compared to realistically 3D cloud fields, this simplification leads to large systematic errors. In order to quantify these errors a Monte Carlo radiative transfer model has been developed and applied to 3D cloud fields. The latter origin from the non-hydrostatic 3D atmospheric model GESIMA. Absorption and scattering properties of the cloud particles have been calculated by means of Mie-theory for spherical water droplets and a ray-tracing code for non-spherical ice, rain, and snow particles. Line by line calculations have been used to obtain the absorption properties of the relevant atmospheric gases. (orig.) [German] Die Erstellung realistischer Zirkulationsmodelle der Atmosphaere erfordert unter Anderem eine moeglichst genaue Kenntnis der Strahlungseigenschaften von Wolken. Auch fuer Ableitung und Korrektur von Fernerkundungsalgorithmen sind die Einfluesse der Wolken auf die zu messenden Strahldichten von grosser Bedeutung. In den beiden genannten Anwendungen werden Wolkenfelder zur Zeit nur in stark vereinfachter Weise beruecksichtigt. Parameterisierungen der Strahlungsfluesse bei bewoelkter Atmosphaere in atmosphaerischen Zirkulationsmodellen, sowie die Ableitung der Zusammenhaenge zwischen Strahldichten und optischen Wolkeneigenschaften basieren auf der Annahme von planparallelen und horizontal homogenen Wolken (PPHOM). Diese Approximation kann gegenueber der dreidimensionalen Strahlungstransportberechnung (3D) zu erheblichen Fehlern

Forschungsdatenmanagement als überregionale Aufgabe der Informationsversorgung - was kann eine Zentrale Fachbibliothek wie ZB MED Leibniz-Informationszentrum Lebenswissenschaften leisten?

Directory of Open Access Journals (Sweden)

Birte Lindstädt

2015-12-01

Full Text Available Forschungsdaten sind in aller Munde. Soll sich eine überregionale tätige Bibliothek deshalb auf diesem Feld engagieren? Und falls ja, für wen und wie? Auf der Grundlage einer breit angelegten Markt- und Zielgruppenanalyse strebt ZB MED ein zielgruppengerechtes Angebot im Bereich Forschungsdatenmanagement an, das sich in erster Linie an den Bedürfnissen der lebenswissenschaftlichen Fächer ausrichtet. Research Data Management is much talked about at present. Should a national library get involved in this field? If the answer is yes, what exactly should be offered and for whom? Based on a broad analysis of the market and the target groups, ZB MED is developing services in the field of research data management which focus on the special needs of the life sciences.

Daikin Advanced Lithium Ion Battery Technology – High Voltage Electrolyte - REVISED

Energy Technology Data Exchange (ETDEWEB)

Sunstrom, Joseph [Daikin America, Inc., Orangeburg, NY (United States); Hendershot, Ron E. [Daikin America, Inc., Orangeburg, NY (United States)

2017-03-06

An evaluation of high voltage electrolytes which contain fluorochemicals as solvents/additive has been completed with the objective of formulating a safe, stable electrolyte capable of operation to 4.6 V. Stable cycle performance has been demonstrated in LiNi1/3Mn1/3Co1/3O2 (NMC111)/graphite cells to 4.5 V. The ability to operate at high voltage results in significant energy density gain (>30%) which would manifest as longer battery life resulting in higher range for electric vehicles. Alternatively, a higher energy density battery can be made smaller without sacrificing existing energy. In addition, the fluorinated electrolytes examined showed better safety performance when tested in abuse conditions. The results are promising for future advanced battery development for vehicles as well as other applications.

Synthesis and in Vitro and in Vivo Evaluation of Phosphoinositide-3-kinase Inhibitors.

Science.gov (United States)

Burger, Matthew T; Knapp, Mark; Wagman, Allan; Ni, Zhi-Jie; Hendrickson, Thomas; Atallah, Gordana; Zhang, Yanchen; Frazier, Kelly; Verhagen, Joelle; Pfister, Keith; Ng, Simon; Smith, Aaron; Bartulis, Sarah; Merrit, Hanne; Weismann, Marion; Xin, Xiaohua; Haznedar, Joshua; Voliva, Charles F; Iwanowicz, Ed; Pecchi, Sabina

2011-01-13

Phospoinositide-3-kinases (PI3K) are important oncology targets due to the deregulation of this signaling pathway in a wide variety of human cancers. A series of 2-morpholino, 4-substituted, 6-(3-hydroxyphenyl) pyrimidines have been reported as potent inhibitors of PI3Ks. Herein, we describe the structure-guided optimization of these pyrimidines with a focus on replacing the phenol moiety, while maintaining potent target inhibition and improving in vivo properties. A series of 2-morpholino, 4-substituted, 6-heterocyclic pyrimidines, which potently inhibit PI3K, were discovered. Within this series a compound, 17, was identified with suitable pharmacokinetic (PK) properties, which allowed for the establishment of a PI3K PK/pharmacodynamic-efficacy relationship as determined by in vivo inhibition of AKT(Ser473) phosphorylation and tumor growth inhibition in a mouse A2780 tumor xenograft model.

Characterization of Taurine Transporting Systems During Acquirement of Resistance to Platinum(II)-based, Chemotherapeutic Drugs

DEFF Research Database (Denmark)

Sørensen, Belinda Halling

Although, cisplatin is one of the most effective broad-spectrum anticancer drugs, prolonged cisplatin treatment often results in development of chemoresistance and subsequent therapeutic failure. Dysregulation of the taurine transporting systems i.e., the taurine transporter (TauT) and volume....... Cisplatin resistance correlates with a reduction in the volume regulated anion current and taurine release mediated by VRACs, as well as an improved cellular accumulation of taurine through TauT. In human ovarian A2780 cancer cells, for instance, cisplatin resistance is associated with an absent swelling......-induced taurine release and inability to volume regulate. The dismissed taurine release was due to an almost absent leucin-rich-repeat containing 8A (LRRC8A) total protein expression. LRRC8A is an important component of VRACs. Cellular taurine contributes to the intracellular pool of organic osmolytes. Moreover...

Risk assessment, spatial distribution, and source apportionment of heavy metals in Chinese surface soils from a typically tobacco cultivated area.

Science.gov (United States)

Liu, Haiwei; Wang, Haiyun; Zhang, Yan; Yuan, Jumin; Peng, Yaodong; Li, Xiuchun; Shi, Yi; He, Kuanxin; Zhang, Qiming

2018-06-01

The heavy metals (As, Cd, Cr, Cu, Hg, Ni, Pb, and Zn) in the surface soils of tobacco (Nicotiana tabacum L.) fields in Jiangxi Province were analyzed, and the mean heavy metal concentrations were 3.55, 0.19, 25.89, 14.96, 0.25, 10.89, 27.80, and 44.00 mg/kg, respectively. Spatial distribution analysis showed that the highest concentrations were recorded in the north-western, south-western, and mid-eastern parts of the study area. The index of geo-accumulation and pollution index indicated modest enrichment with Cd and Hg, which were the only two metals posing a potentially high ecological risk to the local agricultural environment. The health risk assessment showed no considerable non-carcinogenic or carcinogenic risks for children and adults from these elements. The principal component analysis (PCA) and cluster analysis (CA) found that the variations in the Cr and Ni concentrations were largely on account of the soil parent rocks, but the As, Cd, Cu, and Hg variations in the soil were largely owing to agricultural practices of years. However, the main factor influencing Pb and Zn was atmospheric deposition.

Chair of geotechnical processes at the Institute for geotechnics and mine surveying at Clausthal Technological University; Professur fuer Geotechnische Verfahren am Institut fuer Geotechnik und Marktscheidewesen der TU Clausthal

Energy Technology Data Exchange (ETDEWEB)

Meyer, N. [Technische Univ. Clausthal, Institut fuer Geotechnik und Marktscheidewesen (Germany)

2003-08-14

The Chair of Geotechnical Processes at the Institute for Geotechnics and Mine Surveying at Clausthal Technological University is concerned primarily with practical fundamental research in addition to teaching, in which comprehensive theoretical and practical experience from all areas of geotechnics is imparted. (orig.) [German] Der Lehrstuhl Geotechnische Verfahren am Institut fuer Geotechnik und Markscheidewesen der TU Clausthal befasst sich neben der Lehre, in der umfangreiche theoretische und praktische Erfahrungen aus allen Bereichen der Geotechnik vermittelt werden, in erster Linie mit der praxisnahen Grundlagenforschung. Die bearbeiteten Problemstellungen liegen bei der Bauwerk-Baugrund-Interaktion, Stabilitaetsproblemen bei Unterwasserboeschungen, der Umweltgeotechnik, der Geomesstechnik und dem Einsatz von Geokunststoffen in der Geotechnik und dem Bergbau. Die Forschungsvorhaben werden in enger Kooperation mit der Industrie durchgefuehrt. (orig.)

Heterogeneous Photo catalytic Degradation of Hazardous Waste in Aqueous Suspension

International Nuclear Information System (INIS)

Sadek, S.A.; Ebraheem, S.; Friesen, K.J.

1999-01-01

The photo catalytic degradation of hazardous waste like chlorinated paraffin compound (1,12-Dichlorodoecane Ded) was investigated in different aquatic media using GC-MSD. The direct photolysis of Ded in HPLC water was considered to be negligible (k = 0.0020+-0.0007h - 1 ) . An acceleration of the photodegradation rate was occurred in presence of different TiO 2 catalyst systems. Molecular oxygen was found to play a vital role in the degradation process. Anatase TiO 2 was proved to be the most efficient one (k=0.7670+-0.0876h -1 ), while the rate constant of the rutile TiO 2 was calculated to be 0.2780+-0.0342h -1 . Improvement of photo catalytic efficiency of rutile TiO 2 was achieved by addition of Fe +2 giving a rate constant =0.6710+-0.0786h -1

Revealing the Cytotoxicity of Residues of Phosphazene Catalysts Used for Synthesis of Poly(ethylene oxide)

KAUST Repository

Xia, Yening

2017-08-24

We herein report a case study on the toxicity of residual catalyst in metal-free polymer. Eight-arm star-like poly(ethylene oxide)s were successfully synthesized via phosphazene-catalyzed ring-opening polymerization of ethylene oxide using sucrose as an octahydroxy initiator. The products were subjected to MTT assay using human cancer cell lines (MDA-MB-231 and A2780). Comparison between the crude and purified products clearly revealed that the residual phosphazenium salts were considerably cytotoxic regardless of the anionic species, and that the cytotoxicity of more bulky t-BuP4 salt was higher than that of t-BuP2 salt. Such results have therefore put forward the necessity for removal of the catalyst residues from PEO-based polymers synthesized through phosphazene catalysis for bio-related applications, and for the development of less or non-toxic organocatalysts for such polymers.

Revealing the Cytotoxicity of Residues of Phosphazene Catalysts Used for Synthesis of Poly(ethylene oxide)

KAUST Repository

Xia, Yening; Shen, Jizhou; Alamri, Haleema; Hadjichristidis, Nikolaos; Zhao, Junpeng; Wang, Yucai; Zhang, Guangzhao

2017-01-01

We herein report a case study on the toxicity of residual catalyst in metal-free polymer. Eight-arm star-like poly(ethylene oxide)s were successfully synthesized via phosphazene-catalyzed ring-opening polymerization of ethylene oxide using sucrose as an octahydroxy initiator. The products were subjected to MTT assay using human cancer cell lines (MDA-MB-231 and A2780). Comparison between the crude and purified products clearly revealed that the residual phosphazenium salts were considerably cytotoxic regardless of the anionic species, and that the cytotoxicity of more bulky t-BuP4 salt was higher than that of t-BuP2 salt. Such results have therefore put forward the necessity for removal of the catalyst residues from PEO-based polymers synthesized through phosphazene catalysis for bio-related applications, and for the development of less or non-toxic organocatalysts for such polymers.

Leaf curl diseases of two solanaceous species in Southwest Arabia are caused by a monopartite begomovirus evolutionarily most closely related to a species from the Nile Basin and unique suite of betasatellites

KAUST Repository

Idris, Ali

2012-10-01

The complete genome of 2780 bases was amplified using rolling circle amplification, and cloned, and sequenced for two distinct strains of the monopartite begomovirus Tomato leaf curl Sudan virus (ToLCSDV). The two strains shared 86-91% identity with the previously described ToLCSDV from the Nile Basin, and 90-91% identity with one another. One strain was cloned from symptomatic tomato plants from Tihamah (ToLCSDV-YE[YE:Tih:05]) while the other was cloned from symptomatic tobacco plants collected from Wadi Hadramaut (ToLCSDV-YE[YE:Had:89]). A distinct full-length betasatellite molecule (1352 bases) was cloned from the respective field-infected tomato and tobacco plants. Agro-inoculation of tomato and Nicotiana benthamiana plants with cloned partial tandem repeats of ToLCSDV-YE[YE:Tih11:05]) and the associated betasatellite, Tomato leaf curl Yemen betasatellite (ToLCYEB-[Tih:tom:137:05]), resulted in the reproduction of leaf curl disease symptoms in test plants like those observed in the field-infected plants. The betasatellite contributed to symptom severity in N. benthamiana test plants when it was co-inoculated with ToLCSDV-YE, compared to the milder symptoms that were observed in tobacco plants infected with the helper virus alone. © 2012 Elsevier B.V.

Leaf curl diseases of two solanaceous species in Southwest Arabia are caused by a monopartite begomovirus evolutionarily most closely related to a species from the Nile Basin and unique suite of betasatellites

KAUST Repository

Idris, Ali; Abdullah, N.; Brown, Judith K.

2012-01-01

The complete genome of 2780 bases was amplified using rolling circle amplification, and cloned, and sequenced for two distinct strains of the monopartite begomovirus Tomato leaf curl Sudan virus (ToLCSDV). The two strains shared 86-91% identity with the previously described ToLCSDV from the Nile Basin, and 90-91% identity with one another. One strain was cloned from symptomatic tomato plants from Tihamah (ToLCSDV-YE[YE:Tih:05]) while the other was cloned from symptomatic tobacco plants collected from Wadi Hadramaut (ToLCSDV-YE[YE:Had:89]). A distinct full-length betasatellite molecule (1352 bases) was cloned from the respective field-infected tomato and tobacco plants. Agro-inoculation of tomato and Nicotiana benthamiana plants with cloned partial tandem repeats of ToLCSDV-YE[YE:Tih11:05]) and the associated betasatellite, Tomato leaf curl Yemen betasatellite (ToLCYEB-[Tih:tom:137:05]), resulted in the reproduction of leaf curl disease symptoms in test plants like those observed in the field-infected plants. The betasatellite contributed to symptom severity in N. benthamiana test plants when it was co-inoculated with ToLCSDV-YE, compared to the milder symptoms that were observed in tobacco plants infected with the helper virus alone. © 2012 Elsevier B.V.

Quantitative estimation of itopride hydrochloride and rabeprazole sodium from capsule formulation.

Science.gov (United States)

Pillai, S; Singhvi, I

2008-09-01

Two simple, accurate, economical and reproducible UV spectrophotometric methods and one HPLC method for simultaneous estimation of two component drug mixture of itopride hydrochloride and rabeprazole sodium from combined capsule dosage form have been developed. First developed method involves formation and solving of simultaneous equations using 265.2 nm and 290.8 nm as two wavelengths. Second method is based on two wavelength calculation, wavelengths selected for estimation of itopride hydrochloride was 278.0 nm and 298.8 nm and for rabeprazole sodium 253.6 nm and 275.2 nm. Developed HPLC method is a reverse phase chromatographic method using phenomenex C(18) column and acetonitrile: phosphate buffer (35:65 v/v) pH 7.0 as mobile phase. All developed methods obey Beer's law in concentration range employed for respective methods. Results of analysis were validated statistically and by recovery studies.

Measurement of nitrogen in the body using a commercial PGNAA system--phantom experiments.

Science.gov (United States)

Chichester, D L; Empey, E

2004-01-01

An industrial prompt-gamma neutron activation analysis (PGNAA) system, originally designed for the real-time elemental analyses of bulk coal on a conveyor belt, has been studied to examine the feasibility of using such a system for body composition analysis. Experiments were conducted to measure nitrogen in a simple, tissue equivalent phantom comprised of 2.7 wt% of nitrogen. The neutron source for these experiments was 365 MBq (18.38 microg) of 252Cf located within an engineered low Z moderator and it yielded a dose rate in the measurement position of 3.91 mSv/h; data were collected using a 2780 cm(3) NaI(Tl) cylindrical detector with a digital signal processor and a 512 channel MCA. Source, moderator and detector geometries were unaltered from the system's standard configuration, where they have been optimized for considerations such as neutron thermalization, measurement sensitivity and uniformity, background radiation and external dose minimization. Based on net counts in the 10.8 MeV PGNAA nitrogen photopeak and its escape peaks the dose dependent nitrogen count rate was 11,600 counts/mSv with an uncertainty of 3.0% after 0.32 mSv (4.9 min), 2.0% after 0.74 mSv (11.4 min) and 1.0% after 3.02 mSv (46.4 min).

Niosome Encapsulation of Curcumin: Characterization and Cytotoxic Effect on Ovarian Cancer Cells

Directory of Open Access Journals (Sweden)

Ying-Qi Xu

2016-01-01

Full Text Available Curcumin, a natural chemical compound found in Curcuma longa, has been applied in multiple medicinal areas from antibiotic to antitumor treatment. However, the chemical structure of curcumin results in poor stability, low solubility, and rapid degradation in vivo, hindering its clinical utilization. To address these issues, we have developed a novel niosome system composed of nonionic surfactants: Span 80, Tween 80, and Poloxamer 188. Curcumin was encapsulated in the niosomes with a high entrapment efficiency of 92.3±0.4%. This system provided controlled release of curcumin, thereby improving its therapeutic capability. Dynamic dialysis was conducted to evaluate the in vitro drug release of curcumin-niosomes. Curcumin-niosomes exhibited enhanced cytotoxic activity and apoptotic rate against ovarian cancer A2780 cells compared with freely dispersed curcumin. These results demonstrate that the curcumin-niosome system is a promising strategy for the delivery of curcumin and ovarian cancer therapy.

A Lithium-Ion Battery with Enhanced Safety Prepared using an Environmentally Friendly Process.

Science.gov (United States)

Mueller, Franziska; Loeffler, Nicholas; Kim, Guk-Tae; Diemant, Thomas; Behm, R Jürgen; Passerini, Stefano

2016-06-08

A new lithium-ion battery chemistry is presented based on a conversion-alloying anode material, a carbon-coated Fe-doped ZnO (TMO-C), and a LiNi1/3 Mn1/3 Co1/3 O2 (NMC) cathode. Both electrodes were fabricated using an environmentally friendly cellulose-based binding agent. The performance of the new lithium-ion battery was evaluated with a conventional, carbonate-based electrolyte (ethylene carbonate:diethyl carbonate-1 m lithium hexafluorophosphate, EC:DEC 1 m LiPF6 ) and an ionic liquid (IL)-based electrolyte (N-butyl-N-methylpyrrolidinium bis(trifluoromethanesulfonyl)imide-0.2 m lithium bis(trifluoromethanesulfonyl)imide, Pyr14 TFSI 0.2 m LiTFSI), respectively. Galvanostatic charge/discharge tests revealed a reduced rate capability of the TMO-C/Pyr14 TFSI 0.2 m LiTFSI/NMC full-cell compared to the organic electrolyte, but the coulombic efficiency was significantly enhanced. Moreover, the IL-based electrolyte substantially improves the safety of the system due to a higher thermal stability of the formed anodic solid electrolyte interphase and the IL electrolyte itself. While the carbonate-based electrolyte shows sudden degradation reactions, the IL exhibits a slowly increasing heat flow, which does not constitute a serious safety risk. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Cytotoxic cassaine diterpenoid-diterpenoid amide dimers and diterpenoid amides from the leaves of Erythrophleum fordii.

Science.gov (United States)

Du, Dan; Qu, Jing; Wang, Jia-Ming; Yu, Shi-Shan; Chen, Xiao-Guang; Xu, Song; Ma, Shuang-Gang; Li, Yong; Ding, Guang-Zhi; Fang, Lei

2010-10-01

Detailed phytochemical investigation from the leaves of Erythrophleum fordii resulted in the isolation of 13 compounds, including three cassaine diterpenoid-diterpenoid amide dimers (1, 3 and 5), and seven cassaine diterpenoid amides (6 and 8-13), together with three previously reported ones, erythrophlesins D (2), C (4) and 3beta-hydroxynorerythrosuamide (7). Compounds 1, 3 and 5 are further additions to the small group of cassaine diterpenoid dimers represented by erythrophlesins A-D. Their structures were determined by analysis of extensive one- and two-dimensional NMR experiments and ESIMS methods. Cytotoxic activities of the isolated compounds were tested against HCT-8, Bel-7402, BGC-823, A549 and A2780 human cancer cell lines in the MTT test. Results showed that compounds 1 and 3-5 exhibited significantly selective cytotoxic activities (IC(50)<10 microM) against these cells, respectively. Copyright © 2010 Elsevier Ltd. All rights reserved.

Production of the Allergenic Protein Alt a 1 by Alternaria Isolates from Working Environments

Directory of Open Access Journals (Sweden)

Justyna Skóra

2015-02-01

Full Text Available The aim of the study was to evaluate the ability of Alternaria isolates from workplaces to produce Alt a 1 allergenic protein, and to analyze whether technical materials (cellulose, compost, leather present within the working environment stimulate or inhibit Alt a 1 production (ELISA test. Studies included identification of the isolated molds by nucleotide sequences analyzing of the ITS1/ITS2 regions, actin, calmodulin and Alt a 1 genes. It has been shown that Alternaria molds are significant part of microbiocenosis in the archive, museum, library, composting plant and tannery (14%–16% frequency in the air. The presence of the gene encoding the Alt a 1 protein has been detected for the strains: Alternaria alternata, A. lini, A. limoniasperae A. nobilis and A. tenuissima. Environmental strains produced Alt a 1 at higher concentrations (1.103–6.528 ng/mL than a ATCC strain (0.551–0.975 ng/mL. It has been shown that the homogenization of the mycelium and the use of ultrafiltration allow a considerable increase of Alt a 1 concentration. Variations in the production of Alt a 1 protein, depend on the strain and extraction methods. These studies revealed no impact of the technical material from the workplaces on the production of Alt a 1 protein.

Identification and characterization of SSE15206, a microtubule depolymerizing agent that overcomes multidrug resistance

KAUST Repository

Manzoor, Safia

2018-02-13

Microtubules are highly dynamic structures that form spindle fibres during mitosis and are one of the most validated cancer targets. The success of drugs targeting microtubules, however, is often limited by the development of multidrug resistance. Here we describe the discovery and characterization of SSE15206, a pyrazolinethioamide derivative [3-phenyl-5-(3,4,5-trimethoxyphenyl)-4,5-dihydro-1H-pyrazole-1-carbothioamide] that has potent antiproliferative activities in cancer cell lines of different origins and overcomes resistance to microtubule-targeting agents. Treatment of cells with SSE15206 causes aberrant mitosis resulting in G2/M arrest due to incomplete spindle formation, a phenotype often associated with drugs that interfere with microtubule dynamics. SSE15206 inhibits microtubule polymerization both in biochemical and cellular assays by binding to colchicine site in tubulin as shown by docking and competition studies. Prolonged treatment of cells with the compound results in apoptotic cell death [increased Poly (ADP-ribose) polymerase cleavage and Annexin V/PI staining] accompanied by p53 induction. More importantly, we demonstrate that SSE15206 is able to overcome resistance to chemotherapeutic drugs in different cancer cell lines including multidrug-resistant KB-V1 and A2780-Pac-Res cell lines overexpressing MDR-1, making it a promising hit for the lead optimization studies to target multidrug resistance.

Satellitenbewegung, band III: Natiirliche und gesteuerte bewegung.

Science.gov (United States)

Jochim, E. F.

2014-12-01

Im dritten Band der Satellitenbewegung werden in fortlaufender Nummerierung einige für Untersuchungen der Bewegung der künstlichen Satelliten wichtige Grundlagen der Astrodynamik mit ausführlichen mathematischen Formelsystemen behandelt. Dazu zählen die unterschiedlichen Aspekte der Bewegung der natürlichen Himmelskörper, die Steuerung und Kontrolle von künstlichen Objekten, und insbesondere die für eine Satellitenbahnanalyse wichtigen physikalischen Beeinflussungen einer Satellitenbewegung. Mathematisch entscheidend ist die Wahl geeigneter Bahnparameter, die ein bestimmtes Bewegungsproblem widerspruchsfrei und singularitätenfrei zu behandeln gestatten. Für die Behandlung routinemäßiger Aufgabenstellungen der Satellitenbewegung, in erster Linie einer präzisen Bahnbestimmung und Bahnverbesserung, kann auf eine Fülle von lehrbuchartigen Monographien verwiesen werden, so dass diese Problematik in der vorliegenden Arbeit nur angedeutet werden soll.

Tweaking the spin-wave dispersion and suppressing the incommensurate phase in LiNiPO4 by iron substitution

DEFF Research Database (Denmark)

Li, Jiying; Jensen, Thomas Bagger Stibius; Andersen, Niels Hessel

2009-01-01

) indicates the instability of the Ising-type ground state that eventually evolves into the incommensurate phase as the temperature is raised. The pure LiNiPO4 system (x=0) undergoes a first-order magnetic phase transition from a long-range incommensurate phase to an antiferromagnetic (AFM) ground state at TN......Elastic and inelastic neutron-scattering studies of Li(Ni1−xFex)PO4 single crystals reveal anomalous spin-wave dispersions along the crystallographic direction parallel to the characteristic wave vector of the magnetic incommensurate phase. The anomalous spin-wave dispersion (magnetic soft mode......=20.8 K. At 20% Fe concentrations, although the AFM ground state is to a large extent preserved as that of the pure system, the phase transition is second order, and the incommensurate phase is completely suppressed. Analysis of the dispersion curves using a Heisenberg spin Hamiltonian that includes...

A Dyadic Perspective on Childhood Maltreatment for Women With Provoked Vestibulodynia and Their Partners: Associations With Pain and Sexual and Psychosocial Functioning.

Science.gov (United States)

Corsini-Munt, Serena; Bergeron, Sophie; Rosen, Natalie O; Beaulieu, Noémie; Steben, Marc

2017-01-01

Childhood maltreatment is robustly associated with adult-onset vulvodynia, a common form of female genito-pelvic pain/penetration disorder. However, little is known about the impact of childhood maltreatment on current sexual, psychological, and relationship adaptation for couples with provoked vestibulodynia (PVD). This study examined the associations between childhood maltreatment and sexual and psychosocial functioning and pain in women with PVD, the most common subtype of vulvodynia, and their partners. A total of 49 couples (M age women = 27.80, SD = 6.05; M age men = 30.04; SD = 6.48) with PVD completed the Childhood Trauma Questionnaire (CTQ), as well as measures of sexual functioning, couple satisfaction, and anxiety. Women also reported on their pain during intercourse. Analyses were guided by the actor-partner interdependence model. Women's higher reports of childhood maltreatment were associated with their lower sexual functioning and higher anxiety. Partners' higher reports of childhood maltreatment were associated with their lower sexual functioning, lower couple satisfaction, and higher anxiety, as well as women's lower couple satisfaction and higher anxiety. Both women's and partners' higher reports of childhood maltreatment were associated with higher affective pain for women. Findings suggest childhood maltreatment experienced by women with PVD and their partners should be considered as part of treatment planning.

Spatial dynamics of the noble crayfish (Astacus astacus, L. in the Paklenica National Park

Directory of Open Access Journals (Sweden)

G.I.V. Klobucar

2008-07-01

Full Text Available The aim of this work was to analyse the spatial dynamics of a noble crayfish population inhabiting the Velika Paklenica Stream (Paklenica National Park, Croatia. The study was conducted in July 2000, and between March and September 2002. Crayfish were trapped by baited LiNi traps and hand-made traps at two localities over 25 nights. We recorded the precise position of the captured crayfish, their sex, and total length. Crayfish were individually marked and then released back into the stream at the same spot where they were caught. Spatial analyses included determination of movement direction, distribution type, home range, total distance travelled, and mean daily movement. A mean home range of approximately 19 m was calculated. No difference in home range between the sexes was found. There was a large individual variation in the extent of movement without any effect of sex or size.

Excision of oral mucocele by different wavelength lasers

Directory of Open Access Journals (Sweden)

Umberto Romeo

2013-01-01

Full Text Available Background: Mucocele is a common benign neoplasm of oral soft tissues and the most common after fibroma. It generally occurs in the lower lip and its treatment includes excision of cyst and the responsible salivary gland, in order to prevent recurrences. Aims: To evaluate the capability of three different lasers in performing the excision of labial mucocele with two different techniques. Materials and Methods: In the presented cases, excision was performed using two different techniques (circumferential incision technique and mucosal preservation technique and three different laser wavelengths (Er,Cr:YSGG 2780 nm, diode 808 nm, and KTP 532 nm. Results: All the tested lasers, regardless of wavelength, showed many advantages (bloodless surgical field, no postoperative pain, relative speed, and easy execution. The most useful surgical technique depends on clinical features of the lesion. Conclusion: Tested lasers, with both techniques, are helpful in the management of labial mucocele.

Role of complex utilization of mineral raw materials In geological research

Energy Technology Data Exchange (ETDEWEB)

Takacs, P.; Varju, G.

1979-01-01

Presents Hungarian research efforts on ways of utilizing the secondary raw materials alunite, pumice and slate coal from various mines. The slate coal is separated from brown coal and disposed of at spoil banks of brown coal mines, due to its high ash content (up to 56.8% under dry conditions), silicate content up to 58.2% and low calorific value between 1500 and 2780 kcal/kg. The research proposal for utilizing slate coal is directed at partial separation of the mineral and coal content by comminution, peptization and hydrocentrifugal separation. The larger part of the silicate content is held in the colloid suspension, which could be used for conditioning drilling mud or foundry sand. The produced coal concentrate has a reduced ash content and higher calorific value (between 500 and 800 kcal/kg) and could be employed in soil amelioration or combustion. (10 refs.) (In German)

Evoluţia diversităţii structurale şi compoziţionale a arboretelor cu ajutorul indicelui UMF: un studiu de caz la nivel de unitate de producţie[The evolution of stand structural and compositional diversity assessed with the UMF index: A case study at production unit level

Directory of Open Access Journals (Sweden)

Mihai Catalin Burlui

2014-08-01

Full Text Available In this article we present the UMF index (Uneven-aged, Mixed, Forest an index because the forest management, whose values are determined easily, data from management planning are the main support. The study was conducted in the Suha Mare area from Mălini, Suceava county. Wet analyzed stand descriptions for all stands for two periods (1956, 1995, using structural and site characteristics required by index. Data were obtained from management plans of the studied forest area. The index values were calculated for each stand, and its value for the total forest area was determined by summing the values calculated for stand, weighted by stand area. Index values vary between the two periods analyzed (1956, 1995, there are differences from a subplot to another, which is explained by the different treatments applied, the number of tree species and the structural heterogeneity, but also - for 1995 - by functional zoning that changed the forest management. UMF index is a good tool to determine structural and compositional diversity of a given area, using data from forest management plans. The results can be analyzed for longer periods of time and may indicate the direction of evolution of an area in relation with anthropogenic changes: from even-aged structure to uneven-aged, from monocultures to mixed stands.

Franchising; Franchising: Nachmachen ist Trumpf

Energy Technology Data Exchange (ETDEWEB)

Iken, J.

2000-08-01

Franchising is booming. In many fields of industry, it is the optimal solution for better marketing and development of know-how. The solar industry still has a long way to go. Franchising systems offer a good option for starting one's own enterprise and also for expansion on the market. Four franchising systems are compared in detail. [German] Franchising boomt. Fuer viele Branchen scheint es die Idealloesung fuer gestiegene Ansprueche an Marketing und Knowhow-Entwicklung zu sein. Die Solarbranche steht hier erst am Anfang. Franchise-Systeme bieten also eine gute Starthilfe fuer den Sprung in die Selbststaendigkeit in der verhaeltnismaessig jungen Branche der Solartechnik. Da klassisches Franchising in erster Linie eine Strategie zur Expansion im Markt ist, kann es ebenso gut von etablierten Installationsbetrieben genutzt werden, um sich das Standbein Solartechnik mit abgeschwaechtem Risiko zusaetzlich aufzubauen. Vier Franchise-Systeme werden im Detail verglichen. (orig./AKF)

Welding, a risk factor of lung cancer: the ICARE study.

Science.gov (United States)

Matrat, Mireille; Guida, Florence; Mattei, Francesca; Cénée, Sylvie; Cyr, Diane; Févotte, Joëlle; Sanchez, Marie; Menvielle, Gwenn; Radoï, Loredana; Schmaus, Annie; Woronoff, Anne-Sophie; Luce, Danièle; Stücker, Isabelle

2016-04-01

We investigated the relationship between lung cancer and occupational exposure to welding activity in ICARE, a population-based case-control study. Analyses were restricted to men (2276 cases, 2780 controls). Welding exposure was assessed through detailed questionnaires, including lifelong occupational history. ORs were computed using unconditional logistic regression, adjusted for lifelong cigarette smoking and occupational exposure to asbestos. Among the regular welders, welding was associated with a risk of lung cancer (OR=1.7, 95% CI 1.1 to 2.5), which increased with the duration (OR=2.0, 95% CI 1.0 to 3.9 when duration >10 years), and was maximum 10-20 years since last welding. The risk was more pronounced in case of gas welding (OR=2.0, 95% CI 1.2 to 3.3), when the workpiece was covered by paint, grease, or other substances (OR=2.0, 95% CI 1.2 to 3.4) and when it was cleaned with chemical substances before welding. No statistically significant increase in lung cancer risk was observed among occasional welders. Although these results should be confirmed, we showed that type of welding and mode of workpiece preparation are important determinants of the lung cancer risk in regular welders. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/

Contributions of mobile, stationary and biogenic sources to air pollution in the Amazon rainforest: a numerical study with the WRF-Chem model

Science.gov (United States)

Abou Rafee, Sameh A.; Martins, Leila D.; Kawashima, Ana B.; Almeida, Daniela S.; Morais, Marcos V. B.; Souza, Rita V. A.; Oliveira, Maria B. L.; Souza, Rodrigo A. F.; Medeiros, Adan S. S.; Urbina, Viviana; Freitas, Edmilson D.; Martin, Scot T.; Martins, Jorge A.

2017-06-01

This paper evaluates the contributions of the emissions from mobile, stationary and biogenic sources on air pollution in the Amazon rainforest by using the Weather Research and Forecasting with Chemistry (WRF-Chem) model. The analyzed air pollutants were CO, NOx, SO2, O3, PM2. 5, PM10 and volatile organic compounds (VOCs). Five scenarios were defined in order to evaluate the emissions by biogenic, mobile and stationary sources, as well as a future scenario to assess the potential air quality impact of doubled anthropogenic emissions. The stationary sources explain the highest concentrations for all air pollutants evaluated, except for CO, for which the mobile sources are predominant. The anthropogenic sources considered resulted an increasing in the spatial peak-temporal average concentrations of pollutants in 3 to 2780 times in relation to those with only biogenic sources. The future scenario showed an increase in the range of 3 to 62 % in average concentrations and 45 to 109 % in peak concentrations depending on the pollutant. In addition, the spatial distributions of the scenarios has shown that the air pollution plume from the city of Manaus is predominantly transported west and southwest, and it can reach hundreds of kilometers in length.

Contributions of mobile, stationary and biogenic sources to air pollution in the Amazon rainforest: a numerical study with the WRF-Chem model

Directory of Open Access Journals (Sweden)

S. A. Abou Rafee

2017-06-01

Full Text Available This paper evaluates the contributions of the emissions from mobile, stationary and biogenic sources on air pollution in the Amazon rainforest by using the Weather Research and Forecasting with Chemistry (WRF-Chem model. The analyzed air pollutants were CO, NOx, SO2, O3, PM2. 5, PM10 and volatile organic compounds (VOCs. Five scenarios were defined in order to evaluate the emissions by biogenic, mobile and stationary sources, as well as a future scenario to assess the potential air quality impact of doubled anthropogenic emissions. The stationary sources explain the highest concentrations for all air pollutants evaluated, except for CO, for which the mobile sources are predominant. The anthropogenic sources considered resulted an increasing in the spatial peak-temporal average concentrations of pollutants in 3 to 2780 times in relation to those with only biogenic sources. The future scenario showed an increase in the range of 3 to 62 % in average concentrations and 45 to 109 % in peak concentrations depending on the pollutant. In addition, the spatial distributions of the scenarios has shown that the air pollution plume from the city of Manaus is predominantly transported west and southwest, and it can reach hundreds of kilometers in length.

Die kommunikatiewe struktuur in eietydse gereformeerde prediking – van liniêre na sirkulêre gang?

Directory of Open Access Journals (Sweden)

F. W. de Wet

2006-07-01

Full Text Available Communicative structure in contemporary reformed preaching – from linear to circular process? Reformed preaching stems from a tradition in which Scripture has been viewed as the primary source for composing a sermon (the Sola Scriptura principle. In this tradition a sermon is composed starting with the exposition of the text, and then proceeding to the application of its message in the context of contemporary listeners. This process may lead to the perception that the communicative structure of this kind of preaching functions in a linear fashion. Since the second half of the twentieth century ever-stronger critical voices have surfaced against a linear communicative structure in preaching, and a tendency to emphasise listeners’ needs has manifested itself. Hermeneutical interchange between text and listener in the process of understanding has become the prime concern. The result of this new focus has been a growing trend among homiletical scholars to define and qualify the communicative structure in a sermon as a circular process. Taking note of critical voices against the traditional linear model, it is thus attempted to investigate the possibility of a third way – a way in which the authority of the message of the biblical text with the unchanging truth that proceeds from it, as well as the unique- ness of the situation of contemporary listeners is fully taken into account. The point of departure is taken in a spatial model in which the simultaneous action of listening to the text as well as to contemporary listeners is anchored in an underlying depth-structure, that is, the pneumatological anchoring of faith in the living Christ.

Particle-in-cell Simulations of Raman Laser Amplification in Ionizing Plasmas

International Nuclear Information System (INIS)

Clark, Daniel S.; Fisch, Nathaniel J.

2003-01-01

By using the amplifying laser pulse in a plasma-based backward Raman laser amplifier to generate the plasma by photo-ionization of a gas simultaneous with the amplification process, possible instabilities of the pumping laser pulse can be avoided. Particle-in-cell simulations are used to study this amplification mechanism, and earlier results using more elementary models of the Raman interaction are verified [D.S. Clark and N.J. Fisch, Phys. Plasmas, 9 (6): 2772-2780, 2002]. The effects (unique to amplification in ionizing plasmas and not included in previous simulations) of blue-shifting of the pump and seed laser pulses and the generation of a wake are observed not significantly to impact the amplification process. As expected theoretically, the peak output intensity is found to be limited to I ∼ 10 17 W/cm 2 by forward Raman scattering of the amplifying seed. The integrity of the ionization front of the seed pulse against the development of a possible transverse modulation instability is also demonstrated

Evaluation of zeolite mixtures for decontaminating high-activity-level water at the Three Mile Island Unit 2 Nuclear Power Station

International Nuclear Information System (INIS)

Collins, E.D.; Campbell, D.O.; King, L.J.; Knauer, J.B.; Wallace, R.M.

1984-05-01

Mixtures of Linde Ionsiv IE-96 and Ionsiv A-51 were evaluated for use in the Submerged Demineralizer System (SDS) that was installed at the Three Mile Island Unit 2 Nuclear Power Station to decontaminate approx. 2780 m 3 of high-activity-level water. The original SDS flowsheet was conservatively designed for removal of cesium and strontium and would have required the use of approx. 60 SDS columns. Mixed zeolite tests were made on a 10 -5 scale and indicated that the appropriate ratio of IE-96/A-51 was 3/2. A mathematical model was used to predict the performance of the mixed zeolite columns in the SDS configuration and with the intended method of operation. Actual loading results were similar to those predicted for strontium and better than those predicted for cesium. The number of SDS columns needed to process the HALW was reduced to approx. 10. 6 references, 4 figures, 2 tables

Polymeric micelles with ionic cores containing biodegradable cross-links for delivery of chemotherapeutic agents.

Science.gov (United States)

Kim, Jong Oh; Sahay, Gaurav; Kabanov, Alexander V; Bronich, Tatiana K

2010-04-12

Novel functional polymeric nanocarriers with ionic cores containing biodegradable cross-links were developed for delivery of chemotherapeutic agents. Block ionomer complexes (BIC) of poly(ethylene oxide)-b-poly(methacylic acid) (PEO-b-PMA) and divalent metal cations (Ca(2+)) were utilized as templates. Disulfide bonds were introduced into the ionic cores by using cystamine as a biodegradable cross-linker. The resulting cross-linked micelles with disulfide bonds represented soft, hydrogel-like nanospheres and demonstrated a time-dependent degradation in the conditions mimicking the intracellular reducing environment. The ionic character of the cores allowed to achieve a very high level of doxorubicin (DOX) loading (50% w/w) into the cross-linked micelles. DOX-loaded degradable cross-linked micelles exhibited more potent cytotoxicity against human A2780 ovarian carcinoma cells as compared to micellar formulations without disulfide linkages. These novel biodegradable cross-linked micelles are expected to be attractive candidates for delivery of anticancer drugs.

Characteristics and outcomes of patients with Ewing sarcoma over 40 years of age at diagnosis.

Science.gov (United States)

Karski, Erin E; Matthay, Katherine K; Neuhaus, John M; Goldsby, Robert E; Dubois, Steven G

2013-02-01

The peak incidence of Ewing sarcoma (EWS) is in adolescence, with little known about patients who are ≥40 years at diagnosis. We describe the clinical characteristics and survival of this rare group. This retrospective cohort study utilized the Surveillance Epidemiology and End Results database. 2780 patients were identified; including 383 patients diagnosed ≥40 years. Patient characteristics between age groups were compared using chi-squared tests. Survival from diagnosis to death was estimated via Kaplan-Meier methods, compared with log-rank tests, and modeled using multivariable Cox methods. A competing risks analysis was performed to evaluate death due to cancer. Patients ≥40 years of age were more likely to have extra-skeletal tumors (66.1% vs. 31.7%; p extra-skeletal tumors, metastatic disease, and axial primary tumors suggesting a difference in tumor biology. Independent of differences in these characteristics, older patients also have a lower survival rate. Copyright © 2012 Elsevier Ltd. All rights reserved.

Fine mapping of the sunflower resistance locus Pl(ARG) introduced from the wild species Helianthus argophyllus.

Science.gov (United States)

Wieckhorst, S; Bachlava, E; Dussle, C M; Tang, S; Gao, W; Saski, C; Knapp, S J; Schön, C-C; Hahn, V; Bauer, E

2010-11-01

Downy mildew, caused by Plasmopara halstedii, is one of the most destructive diseases in cultivated sunflower (Helianthus annuus L.). The dominant resistance locus Pl(ARG) originates from silverleaf sunflower (H. argophyllus Torrey and Gray) and confers resistance to all known races of P. halstedii. We mapped Pl(ARG) on linkage group (LG) 1 of (cms)HA342 × ARG1575-2, a population consisting of 2,145 F(2) individuals. Further, we identified resistance gene candidates (RGCs) that cosegregated with Pl(ARG) as well as closely linked flanking markers. Markers from the target region were mapped with higher resolution in NDBLOS(sel) × KWS04, a population consisting of 2,780 F(2) individuals that does not segregate for Pl(ARG). A large-insert sunflower bacterial artificial chromosome (BAC) library was screened with overgo probes designed for markers RGC52 and RGC151, which cosegregated with Pl(ARG). Two RGC-containing BAC contigs were anchored to the Pl(ARG) region on LG 1.

The use of deuterated ethyl acetate in highly concentrated electrolyte as a low-cost solvent for in situ neutron diffraction measurements of Li-ion battery electrodes

International Nuclear Information System (INIS)

Petibon, R.; Li, Jing; Sharma, Neeraj; Pang, Wei Kong; Peterson, Vanessa K.; Dahn, J.R.

2015-01-01

A low-cost deuterated electrolyte suitable for in situ neutron diffraction measurements of normal and high voltage Li-ion battery electrodes is reported here. Li[Ni 0.4 Mn 0.4 Co 0.2 ]O 2 /graphite (NMC(442)/graphite) pouch cells filled with 1:0.1:2 (molar ratio) of lithium bis(fluorosulfonyl) imide (LiFSi):LiPF 6 : ethyl acetate (EA) and LiFSi:LiPF 6 :deuterated EA (d8-EA) electrolytes were successfully cycled between 2.8 V and 4.7 V at 40°C for 250 h without significant capacity loss, polarization growth, or gas production. The signal-to-noise ratio of neutron powder diffraction patterns taken on NMC(442) powder with a conventional deuterated organic carbonate-based electrolyte and filled with LiFSi:LiPF 6 :d8-EA electrolyte were virtually identical. Out of all the solvents widely available in deuterated form tested in highly-concentrated systems, EA was the only one providing a good balance between cost and charge-discharge capacity retention to 4.7 V. The use of such an electrolyte blend would half the cost of deuterated solvents needed for in situ neutron diffraction measurements of Li-ion batteries compared to conventional deuterated carbonate-based electrolytes

Transformation of the flax rust fungus, Melampsora lini: selection via silencing of an avirulence gene

OpenAIRE

Lawrence, Gregory J.; Dodds, Peter N.; Ellis, Jeffrey G.

2009-01-01

Rust fungi cause devastating diseases on many important food crops, with a damaging stem rust epidemic currently affecting wheat production in Africa and the Middle East. These parasitic fungi propagate exclusively on plants, precluding the use of many biotechnological tools available for other culturable fungi. In particular the lack of a stable transformation system has been an impediment to the genetic manipulation required for molecular analysis of rust pathogenicity. We have developed an...

Cisplatin Loaded Hyaluronic Acid Modified TiO2 Nanoparticles for Neoadjuvant Chemotherapy of Ovarian Cancer

Directory of Open Access Journals (Sweden)

Enling Liu

2015-01-01

Full Text Available Novel tumor-targeting titanium dioxide (TiO2 nanoparticles modified with hyaluronic acid (HA were developed to explore the feasibility of exploiting the pH-responsive drug release property of TiO2 and the tumor-targeting ability of HA to construct a tumor-targeting cisplatin (CDDP delivery system (HA-TiO2 for potential neoadjuvant chemotherapy of ovarian cancer. The experimental results indicated that CDDP release from the HA-TiO2 nanoparticles was significantly accelerated by decreasing pH from 7.4 to 5.0, which is of particular benefit to cancer therapy. CDDP-loaded HA-TiO2 nanoparticles increased the accumulation of CDDP in A2780 ovarian cancer cells via HA-mediated endocytosis and exhibited superior anticancer activity in vitro. In vivo real-time imaging assay revealed that HA-TiO2 nanoparticles possessed preferable tumor-targeting ability which might potentially minimize the toxic side effects of CDDP in clinical application.

Eliciting the Intension of Drug Value Sets – Principles and Quality Assurance Applications

Science.gov (United States)

Bahr, Nathan J.; Nelson, Scott D.; Winnenburg, Rainer; Bodenreider, Olivier

2018-01-01

Value sets (VSs) used in electronic clinical quality measures are lists of codes from standard terminologies (“extensional” VSs), whose purpose (“intension”) is not always explicitly stated. We elicited the intension for the 09/01/2014 release of extensional medication value sets by comparison to drug classes from the October 2014 release of RxClass. Value sets matched drug classes if they shared common ingredients, as evidenced by Jaccard similarity score. We elicited the intension of 80 extensional value sets. The average Jaccard similarity was 0.65 for single classes and 0.80 for combination classes, with 34% (27/80) of the value sets having high similarity scores. Manual review by a pharmacist indicated 51% (41/80) of the drug classes selected as the best mapping for a value set matched the intension reflected in that value set name. This approach has the potential for facilitating the development and maintenance of medication value sets. PMID:29295218

New benzimidazoles and their antitumor effects with Aurora A kinase and KSP inhibitory activities.

Science.gov (United States)

Abd El-All, Amira S; Magd-El-Din, Asmaa A; Ragab, Fatma A F; ElHefnawi, Mahmoud; Abdalla, Mohamed M; Galal, Shadia A; El-Rashedy, Ahmed A

2015-07-01

A newly synthesized series of anticancer compounds comprising thiazolo[3,2-a]pyrimidine derivatives 6a-q bearing a benzimidazole moiety was produced via a one-pot reaction of N-(4-(1H-benzo[d]imidazol-2-yl)phenyl)-2-cyanoacetamide 5 with 2-aminothiazole and an appropriate aromatic aldehyde. Compound 7 was obtained via the reaction of 4-(1H-benzo[d]imidazol-2yl)benzenamide 1 with carbon disulphide and methyl iodide in the presence of concentrated aqueous solution of NaOH, then treated with o-phenylenediamine to give N-(4-1H-benzo[d]imidazol-2-yl)phenyl)-1H-benzo[d]imidazol-2-amine 8. The structures of the newly synthesized compounds were confirmed by analytical and spectroscopic measurements (IR, MS, and (1) H NMR). The synthesized products were screened and studied for their in vitro antitumor activity against three human cancer cell lines (namely colorectal cancer cell line HCT116, human liver cancer cell line HepG2, and human ovarian cancer cell line A2780) and their Aurora A kinase and KSP inhibitory activities. All newly synthesized compounds revealed marked results comparable with the standard drug CK0106023. The compounds 6e and 6k of the thiazolopyrimidine derivatives were the most active compounds when tested against the three cell lines in comparison with the standard drug CK0106023, and showed potent dual KSP and Aurora A kinase inhibition. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Improving the specific energy of Li-Ion capacitor laminate cell using hybrid activated Carbon/LiNi0.5Co0.2Mn0.3O2 as positive electrodes

Science.gov (United States)

Hagen, M.; Cao, W. J.; Shellikeri, A.; Adams, D.; Chen, X. J.; Brandt, W.; Yturriaga, S. R.; Wu, Q.; Read, J. A.; Jow, T. R.; Zheng, J. P.

2018-03-01

In this work, we investigated the performance impact of LiNi0.5Co0.2Mn0.3O2 (NMC) as an additive to activated carbon (AC) electrodes within a high-performance Li-ion capacitor (LIC) fabricated with activated carbon positive electrodes (PEs) and hard carbon negative electrodes (NEs) having lithium thin films as Li sources loaded on the surface of the negative electrodes. The NMC additive impact in initial testing showed an increase in specific energy of the LIC of nearly 50.5% with a 32% maximum specific power loss. Contrary to its typical low rate battery decay at high rate cycling the cell having a hybrid PE is still able to maintain over 90% capacity at a 0.7C rate after 11,000 cycles at rate of 18C and an additional 9000 cycles at a rate of 36C. We conclude at high rate cycling minimal impacts occurs to the NMC properties which can be seen with low rate intercepts.

Hydrothermal synthesis of cathode materials

Science.gov (United States)

Chen, Jiajun; Wang, Shijun; Whittingham, M. Stanley

A number of cathodes are being considered for the next generation of lithium ion batteries to replace the expensive LiCoO 2 presently used. Besides the layered oxides, such as LiNi yMn yCo 1-2 yO 2, a leading candidate is lithium iron phosphate with the olivine structure. Although this material is inherently low cost, a manufacturing process that produces electrochemically active LiFePO 4 at a low cost is also required. Hydrothermal reactions are one such possibility. A number of pure phosphates have been prepared using this technique, including LiFePO 4, LiMnPO 4 and LiCoPO 4; this method has also successfully produced mixed metal phosphates, such as LiFe 0.33Mn 0.33Co 0.33PO 4. Ascorbic acid was found to be better than hydrazine or sugar at preventing the formation of ferric ions in aqueous media. When conductive carbons are added to the reaction medium excellent electrochemical behavior is observed.

Galvanostatic Intermittent Titration and Performance Based Analysis of LiNi_0.5Co_0.2 Mn_0.3O₂Cathode

Energy Technology Data Exchange (ETDEWEB)

Verma, Ankit; Smith, Kandler; Santhanagopalan, Shriram; Abraham, Daniel; Yao, Koffi Pierre; Mukherjee, Partha P.

2017-01-01

Galvanostatic intermittent titration technique (GITT) – a popular method for characterizing kinetic and transport properties of battery electrodes – is predicated on the proper evaluation of electrode active area. LiNi0.5044Co0.1986Mn0.2970O2 (NCM523) material exhibits a complex morphology in which sub-micron primary particles aggregate to form secondary particle agglomerates. This work proposes a new active area formulation for primary/secondary particle agglomerate materials to better mimic the morphology of NCM532 electrodes. This formulation is then coupled with macro-homogeneous models to simulate GITT and half-cell performance of NCM523 electrodes. Subsequently, the model results are compared against the experimental results to refine the area formulation. A single parameter, the surface roughness factor, is proposed to mimic the change in interfacial area, diffusivity and exchange current density simultaneously and detailed modeling results are presented to provide valuable insights into the efficacy of the formulation.

A gargantuan acetaminophen level in an acidemic patient treated solely with intravenous N-acetylcysteine.

Science.gov (United States)

Zell-Kanter, Michele; Coleman, Patrick; Whiteley, Patrick M; Leikin, Jerrold B

2013-01-01

The objective of this report is to describe an acidemic patient with one of the largest recorded acetaminophen ingestions in a patient with acidemia who was treated with supportive care and intravenous (IV) N-acetylcysteine. A 59-year-old female with a history of depression was found comatose. In the Emergency Department, she was obtunded with agonal respirations and immediately intubated. Activated charcoal was given through a nasogastric tube. An initial acetaminophen serum level was 1141 mg/L. The patient was started on IV N-acetylcysteine. The acetaminophen level peaked 2 hours later at 1193 mg/L. She was continued on the IV N-acetylcysteine protocol. The next day her aspartate aminotransferase was 3150 U/L, alanine aminotransferase was 2780 U/L, and creatinine phosphokinase was 16,197 U/L. There was no elevation in bilirubin or international normalized ratio (INR). Transaminase levels decreased on day 3 and normalized by day 4 when she was transferred to a psychiatric unit. Few cases have been reported of strikingly elevated acetaminophen levels in poisoned patients who did not receive hemodialysis. These patients did have increased lactate levels, and some had normal liver function tests. All of these patients received N-acetylcysteine and survived the poisoning without sequelae. This patient in this report was unique in that she had the highest reported serum acetaminophen level with acidosis and was treated successfully with only IV N-acetylcysteine and supportive care.

graft-carbon nanotubes with LiNi0.5Mn1.5O4 and

Indian Academy of Sciences (India)

... were investigated by cyclic voltammetry and electrochemical impedance spectroscopy and exhibited the high diffusion of lithium ions .... polymer was precipitated from cold methanol and washed .... for incorporation of metal-oxide particles.

Curcumin induces chemo/radio-sensitization in ovarian cancer cells and curcumin nanoparticles inhibit ovarian cancer cell growth

Directory of Open Access Journals (Sweden)

Yallapu Murali M

2010-04-01

Full Text Available Abstract Background Chemo/radio-resistance is a major obstacle in treating advanced ovarian cancer. The efficacy of current treatments may be improved by increasing the sensitivity of cancer cells to chemo/radiation therapies. Curcumin is a naturally occurring compound with anti-cancer activity in multiple cancers; however, its chemo/radio-sensitizing potential is not well studied in ovarian cancer. Herein, we demonstrate the effectiveness of a curcumin pre-treatment strategy for chemo/radio-sensitizing cisplatin resistant ovarian cancer cells. To improve the efficacy and specificity of curcumin induced chemo/radio sensitization, we developed a curcumin nanoparticle formulation conjugated with a monoclonal antibody specific for cancer cells. Methods Cisplatin resistant A2780CP ovarian cancer cells were pre-treated with curcumin followed by exposure to cisplatin or radiation and the effect on cell growth was determined by MTS and colony formation assays. The effect of curcumin pre-treatment on the expression of apoptosis related proteins and β-catenin was determined by Western blotting or Flow Cytometry. A luciferase reporter assay was used to determine the effect of curcumin on β-catenin transcription activity. The poly(lactic acid-co-glycolic acid (PLGA nanoparticle formulation of curcumin (Nano-CUR was developed by a modified nano-precipitation method and physico-chemical characterization was performed by transmission electron microscopy and dynamic light scattering methods. Results Curcumin pre-treatment considerably reduced the dose of cisplatin and radiation required to inhibit the growth of cisplatin resistant ovarian cancer cells. During the 6 hr pre-treatment, curcumin down regulated the expression of Bcl-XL and Mcl-1 pro-survival proteins. Curcumin pre-treatment followed by exposure to low doses of cisplatin increased apoptosis as indicated by annexin V staining and cleavage of caspase 9 and PARP. Additionally, curcumin pre

Antiproliferative and Antioxidant Properties of Anthocyanin Rich Extracts from Blueberry and Blackcurrant Juice

Directory of Open Access Journals (Sweden)

Zoriţa Diaconeasa

2015-01-01

Full Text Available The present study was aimed at evaluating the antiproliferative potential of anthocyanin-rich fractions (ARFs obtained from two commercially available juices (blueberry and blackcurrant juices on three tumor cell lines; B16F10 (murine melanoma, A2780 (ovarian cancer and HeLa (cervical cancer. Individual anthocyanin determination, identification and quantification were done using HPLC-MS. Antioxidant activity of the juices was determined through different mechanism methods such as DPPH and ORAC. For biological testing, the juices were purified through C18 cartridges in order to obtain fractions rich in anthocyanins. The major anthocyanins identified were glycosylated cyanidin derivatives. The antiproliferative activity of the fractions was tested using the MTT assay. The antiproliferative potential of ARF was found to be associated with those bioactive molecules, anthocyanins due to their antioxidant potential. The results obtained indicated that both blueberry and blackcurrants are rich sources of antioxidants including anthocyanins and therefore these fruits are highly recommended for daily consumption to prevent numerous degenerative diseases.

Nitrile functionalized silyl ether with dissolved LiTFSI as new electrolyte solvent for lithium-ion batteries

International Nuclear Information System (INIS)

Pohl, Benjamin; Grünebaum, Mariano; Drews, Mathias; Passerini, Stefano; Winter, Martin; Wiemhöfer, Hans‑Dieter

2015-01-01

Highlights: • A new electrolyte based on a nitrile-silyl ether solvent and LiTFSI as lithium salt was successfully tested. • This electrolyte shows higher ionic conductivities as compared to earlier published silicon based solvents. • Due to the absence of ether groups, the electrochemical stability is extended to 5.4 V vs. Li/Li + . • With LiTFSI, the electrolyte can be cycled up to 4.15 V vs. Li/Li + without causing anodic aluminum dissolution. - Abstract: 3-((Trimethylsilyl) oxy) propionitrile is introduced as non-volatile solvent for lithium-ion battery electrolytes using LiTFSI as lithium salt. The thermal and chemical stability of the electrolytes offer an enhanced safety as compared to conventional volatile carbonate electrolytes. In cell tests, the investigated LiTFSI nitrile silyl ether electrolyte shows compatibility with LiFePO 4 , LiNi 0.33 Mn 0.33 Co 0.33 O 2 and graphite active materials.

Olivine-Based Blended Compounds as Positive Electrodes for Lithium Batteries

Directory of Open Access Journals (Sweden)

Christian M. Julien

2016-05-01

Full Text Available Blended cathode materials made by mixing LiFePO4 (LFP with LiMnPO4 (LMP or LiNi1/3Mn1/3Co1/3O2 (NMC that exhibit either high specific energy and high rate capability were investigated. The layered blend LMP–LFP and the physically mixed blend NMC–LFP are evaluated in terms of particle morphology and electrochemical performance. Results indicate that the LMP–LFP (66:33 blend has a better discharge rate than the LiMn1−yFeyPO4 with the same composition (y = 0.33, and NMC–LFP (70:30 delivers a remarkable stable capacity over 125 cycles. Finally, in situ voltage measurement methods were applied for the evaluation of the phase evolution of blended cathodes and gradual changes in cell behavior upon cycling. We also discuss through these examples the promising development of blends as future electrodes for new generations of Li-ion batteries.

Influence of aging on the heat and gas emissions from commercial lithium ion cells in case of thermal failure

Directory of Open Access Journals (Sweden)

Michael Lammer

2018-03-01

Full Text Available A method for thermal ramp experiments on cylindrical 18650 Li-ion cells has been established. The method was applied on pristine cells as well as on devices aged by cyclisation or by storage at elevated temperature respectively. The tested cells comprise three types of LiNi0.8Co0.15Al0.05O2 cells for either high power or high energy applications. The heat flux to and from the cell was investigated. Degradation and exothermic breakdown released large amounts of heat and gas. The total gas and heat emission from cycled cells was significantly larger than emission from cells aged by storage. After aging, the low energy cell ICR18650HE4 did not transgress into thermal runaway. Gas composition changed mainly in the early stage of the experiment. The composition of the initial gas release changed from predominantly CO2 towards hydrocarbons. The thermal runaway emitted for all tests a comparable mixture of H2, CO and CO2.

Configuring PSx tetrahedral clusters in Li-excess Li7P3S11 solid electrolyte

Directory of Open Access Journals (Sweden)

Wo Dum Jung

2018-04-01

Full Text Available We demonstrate that the Li-ion conductivity can be improved by adding a certain amount of Li (x = 0.25–0.5 as a charge carrier to the composition of glass-ceramic Li7+xP3S11. Structural analysis clarified that the structural changes caused by the ratio of ortho-thiophosphate tetrahedra PS43− and pyro-thiophosphate ditetrahedra P2S74− affect the Li-ion conductivity. The ratio of PS43− and P2S74− varies depending on x and the highest Li-ion conductivity (2.5 × 10−3 S cm−1 at x = 0.25. All-solid-state LiNi0.8Co0.15Al0.05O2/Li7.25P3S11/In-metal cell exhibits the discharge capacity of 106.2 mAh g−1. This ion conduction enhancement from excess Li is expected to contribute to the future design of sulfide-type electrolytes.

Half-Sandwich Ru(II and Os(II Bathophenanthroline Complexes Containing a Releasable Dichloroacetato Ligand

Directory of Open Access Journals (Sweden)

Pavel Štarha

2018-02-01

Full Text Available We report on the preparation and thorough characterization of cytotoxic half-sandwich complexes [Ru(η6-pcym(bphen(dca]PF6 (Ru-dca and [Os(η6-pcym(bphen(dca]PF6 (Os-dca containing dichloroacetate(1– (dca as the releasable O-donor ligand bearing its own cytotoxicity; pcym = 1-methyl-4-(propan-2-ylbenzene (p-cymene, bphen = 4,7-diphenyl-1,10-phenanthroline (bathophenanthroline. Complexes Ru-dca and Os-dca hydrolyzed in the water-containing media, which led to the dca ligand release (supported by 1H NMR and electrospray ionization mass spectra. Mass spectrometry studies revealed that complexes Ru-dca and Os-dca do not interact covalently with the model proteins cytochrome c and lysozyme. Both complexes exhibited slightly higher in vitro cytotoxicity (IC50 = 3.5 μM for Ru-dca, and 2.6 μM for Os-dca against the A2780 human ovarian carcinoma cells than cisplatin (IC50 = 5.9 μM, while their toxicity on the healthy human hepatocytes was found to be IC50 = 19.1 μM for Ru-dca and IC50 = 19.7 μM for Os-dca. Despite comparable cytotoxicity of complexes Ru-dca and Os-dca, both the complexes modified the cell cycle, mitochondrial membrane potential, and mitochondrial cytochrome c release by a different way, as revealed by flow cytometry experiments. The obtained results point out the different mechanisms of action between the complexes.

Short-range contacts govern the performance of industry-relevant battery cathodes

Science.gov (United States)

Morelly, Samantha L.; Alvarez, Nicolas J.; Tang, Maureen H.

2018-05-01

Fundamental understanding of how processing affects composite battery electrode structure and performance is still lacking, especially for industry-relevant electrodes with low fractions of inactive material. This work combines rheology, electronic conductivity measurements, and battery rate capability tests to prove that short-range electronic contacts are more important to cathode rate capability than either ion transport or long-range electronic conductivity. LiNi0.33Mn0.33Co0.33O2, carbon black, and polyvinylidene difluoride in 1-methyl-2-pyrrolidinone represent a typical commercial electrode with films. Improvements in battery rate capability at constant electrode porosity do not correlate to electronic conductivity, but rather show an optimum fraction of free carbon. Simple comparison of rate capability in electrodes with increased total carbon loading (3 wt%) shows improvement for all fractions of free carbon. These results clearly indicate that ion transport cannot be limiting and highlight the critical importance of short-range electronic contacts for controlling battery performance.

The effects of waste-gas recirculation on the formation and reduction of NO{sub x} in gas flames; Einfluss der Abgasrezirkulation auf Bildung und Reduzierung von NO{sub x} in Gasflammen

Energy Technology Data Exchange (ETDEWEB)

Al-Halbouni, A. [Magdeburg Univ. (Germany); Sontag, R. [Magdeburg Univ. (Germany); Giese, R. [Magdeburg Univ. (Germany)

1996-10-01

The mechanisms responsible for the production and reduction of environmentally and medically harmful oxides of nitrogen and carbon (NO and CO) can predominantly be influenced by means of primary provisions at the burner muzzle. This article therefore examines on the basis of measured and calculated data the extent to which forced waste-gas recirculation modifies the field variables prevailing in the combustion chamber in general, and NO{sub x} concentration in particular. It is demonstrated that the flow of recirculating gas plays a decisive role. (orig.) [Deutsch] Entstehungs- und Reduzierungsmechanismen der fuer Mensch und Umwelt schaedlichen Stickstoff- und Kohlenstoffmonoxide (NO und CO) lassen sich in erster Linie durch primaere Massnahmen am Brennerkopf beeinflussen. In diesem Sinne wird im vorliegenden Beitrag anhand von Mess- und Rechendaten untersucht, inwieweit die zwangserzeugte Abgasrezirkulation die im Feuerraum herrschenden Feldgroessen, insbesondere aber die NO{sub x}-Konzentration veraendert. Es wird gezeigt, dass dabei die rezirkulierende Abgasmenge eine entscheidende Rolle spielt. (orig.)

PENDEKATAN TOTAL QUALITY MANAGEMENT PRODUK BROILER TOLAKAN

Directory of Open Access Journals (Sweden)

Zeetpy Maisana

2012-11-01

Full Text Available ABSTRACTThe purpose of this study was to analyze rejected product in slaughterhouse division using total quality management approach. The secondary data were collected from the company archives and judgmental sampling was used to collect primary data from six experienced respondents. The analysis method used was total quality management, include stratification, Pareto diagrams, control charts, fishbone diagrams, and quality function deployment. The findings of this study showed that the use of line production system by the slaughterhouse to produce the product; where products’ redness/bruises, size uniformity, bloodless feature, incorrect delivery, delivery delay, and damaged package were the cause of product rejection. The strategies ordered based on the priority to improve the management quality are: tools repair and replacement, creating quality based projects, build an information system between the production lines, training and seminar. The managerial implications of the study suggested the slaughterhouse to replace or repair the plucker, scalder and automatic weighing machine. It also suggested the slaughterhouse to tighten the span of control in the chilling room to maintain product freshness.Keywords: rejected product analysis, TQM, QFD, chicken slaughterhouse, carcassABSTRAKPenelitian ini bertujuan menganalisis produk tolakan pada rumah potong ayam melalui pendekatan total quality management. Pengumpulan data sekunder penelitian diperoleh dari arsip perusahaan dan judgemental sampling digunakan terhadap enam responden ahli untuk memperoleh data primer penelitian. Metode analisis data yang digunakan total quality management, meliputi stratifikasi, diagram pareto, peta kendali, diagram tulang ikan, dan quality function deployment.  Hasil penelitian menunjukkan penggunaan sistem lini produksi pada proses produksi di perusahaan, dimana memar pada produk, keseragaman ukuran, kesegaran produk, pengiriman tidak sesuai pesanan

[4,4‧-bi(1,3,2-dioxathiolane)] 2,2‧-dioxide: A novel cathode additive for high-voltage performance in lithium ion batteries

Science.gov (United States)

Lee, Sang Hyun; Yoon, Sukeun; Hwang, Eui-Hyung; Kwon, Young-Gil; Lee, Young-Gi; Cho, Kuk Young

2018-02-01

High-voltage operation of lithium-ion batteries (LIBs) is a facile approach to obtaining high specific energy density, especially for LiNi0·5Mn0·3Co0·2O2 (NMC532) cathodes currently used in mid- and large-sized energy storage devices. However, high-voltage charging (>4.3 V) is accompanied by a rapid capacity fade over long cycles due to severe continuous electrolyte decomposition and instability at the cathode surface. In this study, the sulfite-based compound, [4,4‧-bi(1,3,2-dioxathiolane)] 2,2‧-dioxide (BDTD) is introduced as a novel electrolyte additive to enhance electrochemical performances of alumina-coated NMC532 cathodes cycled in the voltage range of 3.0-4.6 V. X-ray photoelectron spectroscopy (XPS) and AC impedance of cells reveal that BDTD preferentially oxidizes prior to the electrolyte solvents and forms stable film layers on to the cathode surface, preventing increased impedance caused by repeated electrolyte solvent decomposition in high-voltage operation. The cycling performance of the Li/NMC532 half-cell using an electrolyte of 1.0 M LiPF6 in ethylene carbonate/ethyl methyl carbonate (3/7, in volume) can be improved by adding a small amount of BDTD into the electrolyte. BDTD enables the usage of sulfite-type additives for cathodes in high-voltage operation.

SACCHAROTHRIX SP. ABH26, A NEW ACTINOBACTERIAL STRAIN FROM ALGERIAN SAHARAN SOIL: ISOLATION, IDENTIFICATION AND ANTIMICROBIAL ACTIVITY

Directory of Open Access Journals (Sweden)

Abdelhadi Lahoum

2015-04-01

Full Text Available A new strain of actinobacteria, designated ABH26, was isolated from a Saharan soil in the Adrar region (Algeria, by the dilution agar plating method using a chitin-vitamins B medium supplemented with polymyxin and penicillin. The morphological studies showed that this strain represents a member of the Saccharothrix genus. Phylogenetic analysis showed that this strain had 16S rRNA gene sequence similarities ranging from 97.63% (with Saccharothrix violaceirubra NBRC 102064T to 99.86% (with Saccharothrix xinjiangensis NBRC 101911T. Furthermore, strain ABH26 presented a strong activity against mycotoxigenic and phytopathogenic fungi including Aspergillus carbonarius (M333, A. flavus (NRRL 3251, A. westerdijkiae (ATCC 3174, Fusarium oxysporum f. sp. lini (Fol and F. solani (Fsol. Additionally, the strain exhibited an important antimicrobial activity against many strains of the pathogenic yeast Candida albicans (M2, M3 and IPA200 and against methicillin resistant Staphylococcus aureus (MRSA 639c. Thus, four solvents (n-hexane, dichloromethane, ethyl acetate and n-butanol were used for the extraction of produced antibiotic compounds. The highest antimicrobial activities were obtained using the butanolic extract. The thin layer chromatography (TLC method showed two bioactive spots, named HAD1 and HAD2, which were reveled negatively by using chemical revelators (ninhydrin, naphtoresorcinol-sulfuric acid, ferrous iron chloride and formaldehyde-sulfuric. These results indicated the absence of amine group, sugar, hydroxamic acid, phenol and aromatic compound.

Effects of the preparation process on the quality of refuse-derived fuels: The example of chlorine; Einfluss der Aufbereitung auf die Qualitaet der Ersatzbrennstoffe am Beispiel von Chlor

Energy Technology Data Exchange (ETDEWEB)

Kost, T.; Roetter, S.; Bilitewski, B. [Technische Univ. Dresden (Germany)

2000-07-01

The different interest groups (environmental authorities, licensing authorities, producers and users of refuse-derived fuels) have different guidelines, proposals and product specifications for quality assurance. While the limiting values for heavy metals reflect the controversial positions of the parties concerned, limiting values for chlorine are generally set at less than 1 percent by weight. This is not an ecological consideration but derives from the technical aspects of safe operation in the industries concerned. [German] Fuer die Guetesicherung von Ersatzbrennstoffen liegen von den beteiligten Interessengruppen (Umweltaemter, Genehmigungsbehoerden, Hersteller und Anwender von Ersatzbrennstoffen) verschiedene Grenzwerte als Richtlinien, Vorschlaege und Produktspezifikationen vor. Waehrend die Werte fuer Schwermetalle die teilweise kontraere Positionen der Beteiligten widerspiegeln, besteht fuer den Parameter Chlor dagegen eine einheitliche Spezifikation von <1 Gew.-% (wf). Dieser Wert ergibt sich nicht in erster Linie aus oekologischen Anforderungen, sondern ist vielmehr an technischen Aspekten der Betriebssicherheit beim Einsatz in den Anwenderindustrien orientiert. (orig.)

Toxicological study of a new maintenance fluid, Veen 3G, in rats.

Science.gov (United States)

Kamei, J; Onodera, K; Kawaguchi, M; Shibata, M; Kagawa, M; Wachi, M; Kojima, J

2002-10-01

A study of the different volume and infusion rates of a new maintenance fluid, Veen 3G, on the general conditions of rats was investigated during the 14 days after infusion. In Experiment I, 100 ml/kg and 200 ml/kg of Veen 3G were infused at a rate of 300 ml/kg/h in male and female rats. Results were compared with those for Gurunon Ringer solution (GRS) in male and female rats. We observed only transient polyuria in animals administered by each dose of Veen 3G and GRS for 0-15 min after infusion. Necropsy was not observed in any of the animals tested 14 days after infusion. In Experiment II, 200 ml/kg of Veen 3G was infused at rates of 200, 400, 800 and 1600 ml/kg/h in male rats. At 800 and 1600 ml/kg/h, irregular respiration and decrease in movement were observed concomitantly with polyuria. Three out of 4 rats died immediately after the infusion of Veen 3G at a rate of 1600 ml/kg/h, and one rat was still alive 14 days after the infusion. In this experiment, 200 ml/kg Veen 3G was safe when we infused at a rate of less than 400 ml/kg/h in male rats. Since this rate is about 27-80 times higher than that used clinically in maintenance treatment, Veen 3G is suggested to be safe, with the exception of polyuria, in clinical situations at the standard infusion rate (5-15 ml/kg/h).

USER-CENTERED DESIGN SEBAGAI METODE PENINGKATAN KONTROL KOGNITIF PADA LINI ASSEMBLY (STUDI KASUS PT. KUBOTA INDONESIA

Directory of Open Access Journals (Sweden)

Novie Susanto

2012-02-01

Full Text Available In developing countries like Indonesia, the rationalization of production processes and systems will increase.Challenge that emerged significantly is the increase in planning efficiency. A prospective approach to reduce theplanning effort is the development of a production system capable of optimizing itself during the process. On theassembly line PT. Kubota Indonesia found that the workers perform assembly process with a sequence that is notplanned as a result of the lack of a standardized sequence of process companies and lead to cognitive controlthat are not stable and continuous learning process. Because this issue contrary to the concept of efficiency inplanning, it takes an automated system with a complete and fully optimized (self-optimizing production system.The purpose of this study is to apply the planning efficiency through implementation of optimized productionsystem (self-optimizing production systems in assembly-line PT. Kubota Indonesia. Data obtaining done by thedetermination of primary and secondary variables include the perception of cognitive control, a solution basedon the memory (memory, and action. Repairs are carried out is by applying self-optimizing production systemconsisting of 4 steps: the development of cognitive architecture is to determine the sequence of work andapplying it to extend the software, implementation of individual modules is through the use of hand screw, thedevelopment of human machine interfaces in hand tool screw is through the explanation task analysis andimplementation and evaluation of improvement is the use of robotic assembly in the assembly processenvironment.

Indoor Air Quality and Thermal Conditions in a Primary School with a Green Roof System

Directory of Open Access Journals (Sweden)

Nikolaos Barmparesos

2018-02-01

Full Text Available This paper presents experimental results from a typical school building in Athens, equipped partly with a green roof system (GRS. Environmental monitoring took place in six classrooms located both under the concrete roof and the GRS sectors as well as in the immediate external environment during the warm and cold periods of a school year. Daily measurements of pollutants CO2, TVOCs (Total Volatile Organic Compound, PM1, PM2.5, and PM10 were performed in selected classes. Moreover, indoor ambient temperature (T and relative humidity (RH measurements were implemented in order to estimate the absolute humidity (AH and assess the indoor environmental conditions. The results highlight that during summer, the GRS reduces temperature in a classroom on the top floor by about 2.8 °C, in comparison with the respective classroom under the concrete roof and that AH remained relatively stable for both classrooms. Amid winter, a reverse behavior occurs only for temperature. Moreover, air exchange rates (AER were calculated by using the CO2 decay method for all of the classrooms. The results demonstrated insufficient ventilation for all experimental sights. Finally, concentrations of PM1, PM2.5 and PM10, were found to be relatively decreased, with average values of 0.79, 3.39, and 27.80 μg m−3. Levels of CO2 and TVOCs were elevated during class hours ranging from 469 to 779 ppm and from 6.63 ppm to 13.33 ppm, respectively, but generally within the respective limits of exposure. The examination of the indoor/outdoor (I/O ratio of air pollutants, demonstrated that the outdoor meteorology affects only PM1 and PM2.5, as PM10 and TVOCs are strongly affected by internal sources and the activities of pupils.

Paracetamol as a Post Prandial Marker for Gastric Emptying, A Food-Drug Interaction on Absorption.

Directory of Open Access Journals (Sweden)

R Bartholomé

Full Text Available The use of paracetamol as tool to determine gastric emptying was evaluated in a cross over study. Twelve healthy volunteers were included and each of them consumed two low and two high caloric meals. Paracetamol was mixed with a liquid meal and administered by a nasogastric feeding tube. The post prandial paracetamol plasma concentration time curve in all participants and the paracetamol concentration in the stomach content in six participants were determined. It was found that after paracetamol has left the stomach, based on analysis of the stomach content, there was still a substantial rise in the plasma paracetamol concentration time curve. Moreover, the difference in gastric emptying between high and low caloric meals was missed using the plasma paracetamol concentration time curve. The latter curves indicate that (i part of the paracetamol may leave the stomach much quicker than the meal and (ii part of the paracetamol may be relatively slowly absorbed in the duodenum. This can be explained by the partition of the homogenous paracetamol-meal mixture in the stomach in an aqueous phase and a solid bolus. The aqueous phase leaves the stomach quickly and the paracetamol in this phase is quickly absorbed in the duodenum, giving rise to the relatively steep increase of the paracetamol concentration in the plasma. The bolus leaves the stomach relatively slowly, and encapsulation by the bolus results in relatively slow uptake of paracetamol from the bolus in the duodenum. These findings implicate that paracetamol is not an accurate post prandial marker for gastric emptying. The paracetamol concentration time curve rather illustrates the food-drug interaction on absorption, which is not only governed by gastric emptying.ClinicalTrials.gov NCT01335503 Nederlands Trial Register NTR2780.

Sesquiterpenes from Neurolaena lobata and their antiproliferative and anti-inflammatory activities.

Science.gov (United States)

Lajter, Ildikó; Vasas, Andrea; Béni, Zoltán; Forgo, Peter; Binder, Markus; Bochkov, Valery; Zupkó, István; Krupitza, Georg; Frisch, Richard; Kopp, Brigitte; Hohmann, Judit

2014-03-28

Five new sesquiterpenes, neurolobatin A (1), neurolobatin B (2), 5β-hydroxy-8β-isovaleroyloxy-9α-hydroxycalyculatolide (3), 3-epi-desacetylisovaleroylheliangine (4), and 3β-acetoxy-8β-isovaleroyloxyreynosin (5), were isolated from the aerial parts of Neurolaena lobata. The structures were established by means of a combined spectroscopic data analysis, including ESIMS, APCI-MS, and 1D- and 2D-NMR techniques. Neurolobatin A (1) and B (2) are unusual isomeric seco-germacranolide sesquiterpenes with a bicyclic acetal moiety, compounds 3 and 4 are unsaturated epoxy-germacranolide esters, and compound 5 is the first eudesmanolide isolated from the genus Neurolaena. The isolated compounds (1-5) were shown to have noteworthy antiproliferative activities against human tumor cell lines (A2780, A431, HeLa, and MCF7). The anti-inflammatory effects of 1-5, evaluated in vitro using LPS- and TNF-α-induced IL-8 expression inhibitory assays, revealed that all these compounds strongly down-regulated the LPS-induced production of IL-8 protein, with neurolobatin B (2) and 3-epi-desacetylisovaleroylheliangine (4) being the most effective.

Repeated cisplatin treatment can lead to a multiresistant tumor cell population with stem cell features and sensitivity to 3-bromopyruvate.

Science.gov (United States)

Wintzell, My; Löfstedt, Lina; Johansson, Joel; Pedersen, Anne B; Fuxe, Jonas; Shoshan, Maria

2012-12-01

Cisplatin is used in treatment of several types of cancer, including epithelial ovarian carcinoma (EOC). In order to mimic clinical treatment and to investigate longterm effects of cisplatin in surviving cancer cells, two EOC cell lines were repeatedly treated with low doses. In the SKOV-3 cell line originating from malignant ascites, but not in A2780 cells from a primary tumor, this led to emergence of a stable population (SKOV-3-R) which in the absence of cisplatin showed increased motility, epithelial-mesenchymal transition (EMT) and expression of cancer stem cell markers CD117, CD44 and ALDH1. Accordingly, the cells formed self-renewing spheres in serum-free stem cell medium. Despite upregulation of mitochondrial mass and cytochrome c, and no upregulation of Bcl-2/Bcl-xL, SKOV-3-R were multiresistant to antineoplastic drugs. Cancer stem cells, or tumor-initiating cells (TICs) are highly chemoresistant and are believed to cause relapse into disseminated and resistant EOC. Our second aim was therefore to target resistance in these TIC-like cells. Resistance could be correlated with upregulation of hexokinase-II and VDAC, which are known to form a survival-promoting mitochondrial complex. The cells were thus sensitive to 3-bromopyruvate, which dissociates hexokinase-II from this complex, and were particularly sensitive to combination treatment with cisplatin at doses down to 0.1 x IC 50. 3-bromopyruvate might thus be of use in targeting the especially aggressive TIC populations.

Targeting Gallium to Cancer Cells through the Folate Receptor

Directory of Open Access Journals (Sweden)

Nerissa Viola-Villegas

2008-01-01

Full Text Available The development of gallium(III compounds as anti-cancer agents for both treatment and diagnosis is a rapidly developing field of research. Problems remain in exploring the full potential of gallium(III as a safe and successful therapeutic agent or as an imaging agent. One of the major issues is that gallium(III compounds have little tropism for cancer cells. We have combined the targeting properties of folic acid (FA with long chain liquid polymer poly(ethylene glycol (PEG 'spacers’. This FA-PEG unit has been coupled to the gallium coordination complex of 1,4,7,10-tetraazacyclo-dodecane-N, N′, N′, N′′-tetraacetic acid (DOTA through amide linkages for delivery into target cells overexpressing the folate receptor (FR. In vitro cytotoxicity assays were conducted against a multi-drug resistant ovarian cell line (A2780/AD that overexpresses the FR and contrasted against a FR free Chinese hamster ovary (CHO cell line. Results are rationalized taking into account stability studies conducted in RPMI 1640 media and HEPES buffer at pH 7.4.

Targeting Gallium to Cancer Cells through the Folate Receptor

Directory of Open Access Journals (Sweden)

Nerissa Viola-Villegas

2008-01-01

Full Text Available The development of gallium(III compounds as anti-cancer agents for both treatment and diagnosis is a rapidly developing field of research. Problems remain in exploring the full potential of gallium(III as a safe and successful therapeutic agent or as an imaging agent. One of the major issues is that gallium(III compounds have little tropism for cancer cells. We have combined the targeting properties of folic acid (FA with long chain liquid polymer poly(ethylene glycol (PEG ‘spacers’. This FA-PEG unit has been coupled to the gallium coordination complex of 1,4,7,10-tetraazacyclo-dodecane-N,N′,N′′,N′′′-tetraacetic acid (DOTA through amide linkages for delivery into target cells overexpressing the folate receptor (FR. In vitro cytotoxicity assays were conducted against a multi-drug resistant ovarian cell line (A2780/AD that overexpresses the FR and contrasted against a FR free Chinese hamster ovary (CHO cell line. Results are rationalized taking into account stability studies conducted in RPMI 1640 media and HEPES buffer at pH 7.4.

Pain Flare Is a Common Adverse Event in Steroid-Naïve Patients After Spine Stereotactic Body Radiation Therapy: A Prospective Clinical Trial

Energy Technology Data Exchange (ETDEWEB)

Chiang, Andrew [Department of Radiation Oncology, Sunnybrook Health Sciences Centre, University of Toronto, Toronto, ON (Canada); Department of Radiation Oncology, Princess Margaret Hospital, University of Toronto, Toronto, ON (Canada); Zeng, Liang; Zhang, Liying; Lochray, Fiona; Korol, Renee; Loblaw, Andrew; Chow, Edward [Department of Radiation Oncology, Sunnybrook Health Sciences Centre, University of Toronto, Toronto, ON (Canada); Sahgal, Arjun, E-mail: arjun.sahgal@sunnybrook.ca [Department of Radiation Oncology, Sunnybrook Health Sciences Centre, University of Toronto, Toronto, ON (Canada); Department of Radiation Oncology, Princess Margaret Hospital, University of Toronto, Toronto, ON (Canada)

2013-07-15

Purpose: To determine the incidence of pain flare after spine stereotactic body radiation therapy (SBRT) in steroid-naïve patients and identify predictive factors. Methods and Materials: Forty-one patients were treated with spine SBRT between February 2010 and April 2012. All patients had their pain assessed at baseline, during, and for 10 days after SBRT using the Brief Pain Inventory. All pain medications were recorded daily and narcotics converted to an oral morphine equivalent dose. Pain flare was defined as a 2-point increase in worst pain score as compared with baseline with no decrease in analgesic intake, a 25% increase in analgesic intake as compared with baseline with no decrease in worst pain score, or if corticosteroids were initiated at any point during or after SBRT because of pain. Results: The median age and Karnofsky performance status were 57.5 years (range, 27-80 years) and 80 (range, 50-100), respectively. Eighteen patients were treated with 20-24 Gy in a single fraction, whereas 23 patients were treated with 24-35 Gy in 2-5 fractions. Pain flare was observed in 68.3% of patients (28 of 41), most commonly on day 1 after SBRT (29%, 8 of 28). Multivariate analysis identified a higher Karnofsky performance status (P=.02) and cervical (P=.049) or lumbar (P=.02) locations as significant predictors of pain flare. In those rescued with dexamethasone, a significant decrease in pain scores over time was subsequently observed (P<.0001). Conclusions: Pain flare is a common adverse event after spine SBRT and occurs most commonly the day after treatment completion. Patients should be appropriately consented for this adverse event.

Ginsenoside 20(S)-Rg3 Inhibits the Warburg Effect Via Modulating DNMT3A/ MiR-532-3p/HK2 Pathway in Ovarian Cancer Cells.

Science.gov (United States)

Zhou, Yuanyuan; Zheng, Xia; Lu, Jiaojiao; Chen, Wei; Li, Xu; Zhao, Le

2018-01-01

The Warburg effect is one of the main energy metabolism features supporting cancer cell growth. 20(S)-Rg3 exerts anti-tumor effect on ovarian cancer partly by inhibiting the Warburg effect. microRNAs are important regulators of the Warburg effect. However, the microRNA regulatory network mediating the anti-Warburg effect of 20(S)-Rg3 was largely unknown. microRNA deep sequencing was performed to identify the 20(S)-Rg3-influenced microRNAs in SKOV3 ovarian cancer cells. miR-532-3p was overexpressed by mimic532-3p transfection in SKOV3 and A2780 cells or inhibited by inhibitor532-3p transfection in 20(S)-Rg3-treated cells to examine the changes in HK2 and PKM2 expression, glucose consumption, lactate production and cell growth. Dual-luciferase reporter assay was conducted to verify the direct binding of miR-532-3p to HK2. The methylation status in the promoter region of pre-miR-532-3p gene was examined by methylation-specific PCR. Expression changes of key molecules controlling DNA methylation including DNMT1, DNMT3A, DNMT3B, and TET1-3 were examined in 20(S)-Rg3-treated cells. DNMT3A was overexpressed in 20(S)-Rg3-treated cells to examine its influence on miR-532-3p level, HK2 and PKM2 expression, glucose consumption and lactate production. Deep sequencing results showed that 11 microRNAs were increased and 9 microRNAs were decreased by 20(S)-Rg3 in SKOV3 cells, which were verified by qPCR. More than 2-fold increase of miR-532-3p was found in 20(S)-Rg3-treated SKOV3 cells. Forced expression of miR-532-3p reduced HK2 and PKM2 expression, glucose consumption and lactate production in SKOV3 and A2780 ovarian cancer cells. Inhibition of miR-532-3p antagonized the suppressive effect of 20(S)-Rg3 on HK2 and PKM2 expression, glucose consumption and lactate production in ovarian cancer cells. Dual-luciferase reporter assay showed that miR-532-3p directly suppressed HK2 rather than PKM2. miR-532-3p level was controlled by the methylation in the promoter region of its host

p21 promotes oncolytic adenoviral activity in ovarian cancer and is a potential biomarker

Directory of Open Access Journals (Sweden)

Lockley Michelle

2010-07-01

Full Text Available Abstract The oncolytic adenovirus dl922-947 replicates selectively within and lyses cells with a dysregulated Rb pathway, a finding seen in > 90% human cancers. dl922-947 is more potent than wild type adenovirus and the E1B-deletion mutant dl1520 (Onyx-015. We wished to determine which host cell factors influence cytotoxicity. SV40 large T-transformed MRC5-VA cells are 3-logs more sensitive to dl922-947 than isogenic parental MRC5 cells, confirming that an abnormal G1/S checkpoint increases viral efficacy. The sensitivity of ovarian cancer cells to dl922-947 varied widely: IC50 values ranged from 51 (SKOV3ip1 to 0.03 pfu/cell (TOV21G. Cells sensitive to dl922-947 had higher S phase populations and supported earlier E1A expression. Cytotoxicity correlated poorly with both infectivity and replication, but well with expression of p21 by microarray and western blot analyses. Matched p21+/+ and -/- Hct116 cells confirmed that p21 influences dl922-947 activity in vitro and in vivo. siRNA-mediated p21 knockdown in sensitive TOV21G cells decreases E1A expression and viral cytotoxicity, whilst expression of p21 in resistant A2780CP cells increases virus activity in vitro and in intraperitoneal xenografts. These results highlight that host cell factors beyond simple infectivity can influence the efficacy of oncolytic adenoviruses. p21 expression may be an important biomarker of response in clinical trials.

Study of the betulin enriched birch bark extracts effects on human carcinoma cells and ear inflammation

Directory of Open Access Journals (Sweden)

Dehelean Cristina A

2012-11-01

Full Text Available Abstract Background Pentacyclic triterpenes, mainly betulin and betulinic acid, are valuable anticancer agents found in the bark of birch tree. This study evaluates birch bark extracts for the active principles composition. Results New improved extraction methods were applied on the bark of Betula pendula in order to reach the maximum content in active principles. Extracts were analyzed by HPLC-MS, Raman, SERS and 13C NMR spectroscopy which revealed a very high yield of betulin (over 90%. Growth inhibiting effects were measured in vitro on four malignant human cell lines: A431 (skin epidermoid carcinoma, A2780 (ovarian carcinoma, HeLa (cervix adenocarcinoma and MCF7 (breast adenocarcinoma, by means of MTT assay. All of the prepared bark extracts exerted a pronounced antiproliferative effect against human cancer cell lines. In vivo studies involved the anti-inflammatory effect of birch extracts on TPA-induced model of inflammation in mice. Conclusions The research revealed the efficacy of the extraction procedures as well as the antiproliferative and anti-inflammatory effects of birch extracts.

Low-Cytotoxic Synthetic Bromorutaecarpine Exhibits Anti-Inflammation and Activation of Transient Receptor Potential Vanilloid Type 1 Activities

Directory of Open Access Journals (Sweden)

Chi-Ming Lee

2013-01-01

Full Text Available Rutaecarpine (RUT, the major bioactive ingredient isolated from the Chinese herb Evodia rutaecarpa, possesses a wide spectrum of biological activities, including anti-inflammation and preventing cardiovascular diseases. However, its high cytotoxicity hampers pharmaceutical development. We designed and synthesized a derivative of RUT, bromo-dimethoxyrutaecarpine (Br-RUT, which showed no cytotoxicity at 20 μM. Br-RUT suppressed nitric oxide (NO production and tumor necrosis factor-α release in concentration-dependent (0~20 μM manners in lipopolysaccharide (LPS-treated RAW 264.7 macrophages; protein levels of inducible NO synthase (iNOS and cyclooxygenase-2 induced by LPS were downregulated. Br-RUT inhibited cell migration and invasion of ovarian carcinoma A2780 cells with 0~48 h of treatment. Furthermore, Br-RUT enhanced the expression of transient receptor potential vanilloid type 1 and activated endothelial NOS in human aortic endothelial cells. These results suggest that the synthetic Br-RUT possesses very low cytotoxicity but retains its activities against inflammation and vasodilation that could be beneficial for cardiovascular disease therapeutics.

Ecological and health risk-based characterization of agricultural soils contaminated with polycyclic aromatic hydrocarbons in the vicinity of a chemical plant in China.

Science.gov (United States)

Liu, Geng; Niu, Junjie; Guo, Wenjiong; An, Xiangsheng; Zhao, Long

2016-11-01

Polycyclic aromatic hydrocarbons (PAHs) from chemical plants can cause serious pollution of surrounding agricultural soils. A comprehensive study of agricultural soils was conducted in the vicinity of a chemical plant in China to characterize the soil PAH concentration, as well as their composition and sources. Human health and a screening-level ecological risk assessment were conducted for PAH contamination in agricultural soils. The results showed that the total concentrations of 16 priority PAHs ranged from 250.49 to 9387.26 ng g(-1), with an average of 2780.42 ng g(-1). High molecular weight PAHs (four to six rings) were the dominant component, accounting for more than 60% of all PAHs. Principal component analysis (PCA) and positive matrix factorization model (PMF) suggested that diesel emissions, coal combustion, coke ovens, and fuel combustion and gasoline emissions were the main sources of PAHs in agricultural soils. The ecological risk assessment results based on the effects range-low (ERL), the effects range-median (ERM), and the ecological screening levels (ESL) indicated that the exposure to ∑PAH16 was >ERL, >ERM, and ≥ERL and ESL at 78.1% of the soil sampling stations, and could induce biological effects in mammals. The Bapeq concentrations posed a potential carcinogenic risk to humans. Further risk management and control of soil PAHs in these agricultural soils is required to ensure the safety of the biocoenosis and human health. Copyright © 2016 Elsevier Ltd. All rights reserved.

Fast ion transport at solid-solid interfaces in hybrid battery anodes

Science.gov (United States)

Tu, Zhengyuan; Choudhury, Snehashis; Zachman, Michael J.; Wei, Shuya; Zhang, Kaihang; Kourkoutis, Lena F.; Archer, Lynden A.

2018-04-01

Carefully designed solid-electrolyte interphases are required for stable, reversible and efficient electrochemical energy storage in batteries. We report that hybrid battery anodes created by depositing an electrochemically active metal (for example, Sn, In or Si) on a reactive alkali metal electrode by a facile ion-exchange chemistry lead to very high exchange currents and stable long-term performance of electrochemical cells based on Li and Na electrodes. By means of direct visualization and ex situ electrodeposition studies, Sn-Li anodes are shown to be stable at 3 mA cm-2 and 3 mAh cm-2. Prototype full cells in which the hybrid anodes are paired with high-loading LiNi0.8Co0.15Al0.05O2(NCA) cathodes are also reported. As a second demonstration, we create and study Sn-Na hybrid anodes and show that they can be cycled stably for more than 1,700 hours with minimal voltage divergence. Charge storage at the hybrid anodes is reported to involve a combination of alloying and electrodeposition reactions.

Facile and Reliable in Situ Polymerization of Poly(Ethyl Cyanoacrylate)-Based Polymer Electrolytes toward Flexible Lithium Batteries.

Science.gov (United States)

Cui, Yanyan; Chai, Jingchao; Du, Huiping; Duan, Yulong; Xie, Guangwen; Liu, Zhihong; Cui, Guanglei

2017-03-15

Polycyanoacrylate is a very promising matrix for polymer electrolyte, which possesses advantages of strong binding and high electrochemical stability owing to the functional nitrile groups. Herein, a facile and reliable in situ polymerization strategy of poly(ethyl cyanoacrylate) (PECA) based gel polymer electrolytes (GPE) via a high efficient anionic polymerization was introduced consisting of PECA and 4 M LiClO 4 in carbonate solvents. The in situ polymerized PECA gel polymer electrolyte achieved an excellent ionic conductivity (2.7 × 10 -3 S cm -1 ) at room temperature, and exhibited a considerable electrochemical stability window up to 4.8 V vs Li/Li + . The LiFePO 4 /PECA-GPE/Li and LiNi 1.5 Mn 0.5 O 4 /PECA-GPE/Li batteries using this in-situ-polymerized GPE delivered stable charge/discharge profiles, considerable rate capability, and excellent cycling performance. These results demonstrated this reliable in situ polymerization process is a very promising strategy to prepare high performance polymer electrolytes for flexible thin-film batteries, micropower lithium batteries, and deformable lithium batteries for special purpose.

Analysis of structural and thermal stability in the positive electrode for sulfide-based all-solid-state lithium batteries

Science.gov (United States)

Tsukasaki, Hirofumi; Otoyama, Misae; Mori, Yota; Mori, Shigeo; Morimoto, Hideyuki; Hayashi, Akitoshi; Tatsumisago, Masahiro

2017-11-01

Sulfide-based all-solid-state batteries using a non-flammable inorganic solid electrolyte are promising candidates as a next-generation power source owing to their safety and excellent charge-discharge cycle characteristics. In this study, we thus focus on the positive electrode and investigated structural stabilities of the interface between the positive electrode active material LiNi1/3Mn1/3Co1/3O2 (NMC) and the 75Li2S·25P2S5 (LPS) glass electrolyte after charge-discharge cycles via transmission electron microscopy (TEM). To evaluate the thermal stability of the fabricated all-solid-state cell, in-situ TEM observations for the positive electrode during heating are conducted. As a result, structural and morphological changes are detected in the LPS glasses. Thus, exothermal reaction present in the NMC-LPS composite positive electrode after the initial charging is attributable to the crystallization of LPS glasses. On the basis of a comparison with crystallization behavior in single LPS glasses, the origin of exothermal reaction in the NMC-LPS composites is discussed.

Ein statistisches Modell zum Einfluß der thermischen Bewegung auf NMR-Festkörperspektren

Science.gov (United States)

Ploss, W.; Freude, D.; Pfeifer, H.; Schmiedel, H.

Es wird ein statistisches Modell zum Einfluß der thermischen Bewegung auf die NMR-Linienform vorgestellt, das die Verschmälerung von Festkörper-Spektren bei wachsender Temperatur beschreibt. Das Modell geht von der Annahme aus, daß nach einer Ortsveränderung eines Kerns infolge thermischer Bewegung jede beliebige Kernresonanzfrequenz mit der durch das Festkörperspektrum vorgegebenen Wahrscheinlichkeit angenommen werden kann. Am Beispiel der Festkörper-Gaußlinie wird der Unterschied zu dem bekannten Modell von ANDERSON und WEISS verdeutlicht.Translated AbstractA Statistical Model for the Influence of Thermal Motion on N. M. R. Spectra in SolidsA theory is proposed which allows to describe the narrowing of n. m. r.-line width in the presence of thermal motions of the spins. The model is based on the assumption, that the local resonance frequency of a given spin immediately after the jump is distributed according to the n. m. r.-line shape of the rigid lattice. The difference to the well-known ANDERSON-WEISS-model of spectral narrowing is demonstrated for a gaussian line shape.

Feasibility of the optical imaging of thrombus formation in a rotary blood pump by near-infrared light.

Science.gov (United States)

Sakota, Daisuke; Murashige, Tomotaka; Kosaka, Ryo; Nishida, Masahiro; Maruyama, Osamu

2014-09-01

Blood coagulation is one of the primary concerns when using mechanical circulatory support devices such as blood pumps. Noninvasive detection and imaging of thrombus formation is useful not only for the development of more hemocompatible devices but also for the management of blood coagulation to avoid risk of infarction. The objective of this study is to investigate the use of near-infrared light for imaging of thrombus formation in a rotary blood pump. The optical properties of a thrombus at wavelengths ranging from 600 to 750 nm were analyzed using a hyperspectral imaging (HSI) system. A specially designed hydrodynamically levitated centrifugal blood pump with a visible bottom area was used. In vitro antithrombogenic testing was conducted five times with the pump using bovine whole blood in which the activated blood clotting time was adjusted to 200 s prior to the experiment. Two halogen lights were used for the light sources. The forward scattering through the pump and backward scattering on the pump bottom area were imaged using the HSI system. HSI showed an increase in forward scattering at wavelengths ranging from 670 to 750 nm in the location of thrombus formation. The time at which the thrombus began to form in the impeller rotating at 2780 rpm could be detected. The spectral difference between the whole blood and the thrombus was utilized to image thrombus formation. The results indicate the feasibility of dynamically detecting and imaging thrombus formation in a rotary blood pump. Copyright © 2014 International Center for Artificial Organs and Transplantation and Wiley Periodicals, Inc.

Novel synthetic approach for 1, 4-dihydroxyanthraquinone and the development of its Lithiated salts as anode material for aqueous rechargeable Lithium-ion batteries

KAUST Repository

Gurukar, Suresh Shivappa

2015-08-17

The influence of organic electrode materials in the field of lithium ion battery is becoming a keen interest for the present generation scientists. Here we are reporting a novel method of synthesis of electrode material by the combination of sono-chemical and thermal methods. The advantages of organic active material towards lithium ion battery are of core interest of this study. The structural confirmations are by FT-IR, 1H NMR, MALDI-TOF Mass Spectroscopy and powder XRD data. The electrochemical properties of Lithiated-1,4-dihydroxyanthraquinone were studied using electrochemical-techniques such as Cyclic Voltammetry, Galvanostatic Cyclic Potential Limitation and Potentiostatic Electrochemical Impedance Spectroscopy. The satisfactory results towards stability of active species in the aqueous media, reasonable discharge capacity with 0.9 V average voltages and agreeable cycling performance during charge-discharge process with reproducibility are achieved. For the construction of the full cell, the anode material was coupled with the LiNi1/3Co1/3Mn1/3O2 as a cathode material.

Alkyl Substitution Effect on Oxidation Stability of Sulfone-Based Electrolytes

Energy Technology Data Exchange (ETDEWEB)

Su, Chi-Cheung [Chemical Sciences and Engineering Division, Argonne National Laboratory, 9700 S. Cass Ave. Argonne IL 60439 USA; He, Meinan [Chemical Sciences and Engineering Division, Argonne National Laboratory, 9700 S. Cass Ave. Argonne IL 60439 USA; Redfern, Paul [Materials Science Division, Argonne National Laboratory, 9700 S. Cass Ave. Argonne IL 60439 USA; Curtiss, Larry A. [Materials Science Division, Argonne National Laboratory, 9700 S. Cass Ave. Argonne IL 60439 USA; Liao, Chen [Chemical Sciences and Engineering Division, Argonne National Laboratory, 9700 S. Cass Ave. Argonne IL 60439 USA; Zhang, Lu [Chemical Sciences and Engineering Division, Argonne National Laboratory, 9700 S. Cass Ave. Argonne IL 60439 USA; Burrell, Anthony K. [Chemical Sciences and Engineering Division, Argonne National Laboratory, 9700 S. Cass Ave. Argonne IL 60439 USA; Zhang, Zhengcheng [Chemical Sciences and Engineering Division, Argonne National Laboratory, 9700 S. Cass Ave. Argonne IL 60439 USA

2016-02-16

Organic sulfone compounds have been widely used as high-voltage electrolytes for lithium-ion batteries for decades. However, owing to the complexity of the synthesis of new sulfones, only a few commercially available sulfones have been studied. In this paper, we report the synthesis of new sulfone compounds with various substituent groups and the impact of the substituent group on the oxidation stability of sulfones. Electrochemical floating tests using a 5 V LiNi0.5Mn1.5O4 spinel cathode and density functional theory calculations showed that the cyclopentyl-substituted sulfone McPS suffered from oxidation instability, starting from 4.9 V versus Li+/Li, as observed by the large leakage currents. On the other hand, the isopropyl-substituted sulfone MiPS and tetramethylene substituted sulfone TMS showed much improved oxidation stability under identical testing conditions. The substitution structure of the sulfone plays a significant role in the determination of its oxidative stability and should first be considered for the development of new sulfone-based electrolytes for high-voltage, high-energy lithium-ion batteries.

Practical considerations on frenectomy

Science.gov (United States)

Moldoveanu, Lucia; Badea, Florin Ciprian; Odor, Alin A.

2014-01-01

Besides surgically classical frenectomy, modern dentistry currently allows its approach by dental laser. Materials and Method: We proposed clinical observation of the results obtained by frenectomy with/without frenoplasty made by laser Er,Cr:YSGG 2780 nm. Results: The patients reported no pain, bleeding, swelling or major discomfort during the postoperative control of the following day. In terms of psycho-emotional reactions, both patients well behave well, the calm being given by no pain, bleeding, suture or edema. Discussions: The accuracy of this method, as well as the use of additional means of healing, allow satisfactory results both for patient and physician. Working parameters depend on the type of laser that is used, in our case Biolase Waterlase MD Turbo, regularly used in Toldimed Clinic in Constanta. Conclusions: Our study reveals that the possibilities regarding the surgical modeling of the lower lip frenulum are higher due to laser than the classical surgical approach. Moreover, a major role in the prevention of relapse by inappropriate healing is represented by the approach of frenectomy accompanied by frenuloplasty.

Lifecycle comparison of selected Li-ion battery chemistries under grid and electric vehicle duty cycle combinations

Science.gov (United States)

Crawford, Alasdair J.; Huang, Qian; Kintner-Meyer, Michael C. W.; Zhang, Ji-Guang; Reed, David M.; Sprenkle, Vincent L.; Viswanathan, Vilayanur V.; Choi, Daiwon

2018-03-01

Li-ion batteries are expected to play a vital role in stabilizing the electrical grid as solar and wind generation capacity becomes increasingly integrated into the electric infrastructure. This article describes how two different commercial Li-ion batteries based on LiNi0.8Co0.15Al0.05O2 (NCA) and LiFePO4 (LFP) chemistries were tested under grid duty cycles recently developed for two specific grid services: (1) frequency regulation (FR) and (2) peak shaving (PS) with and without being subjected to electric vehicle (EV) drive cycles. The lifecycle comparison derived from the capacity, round-trip efficiency (RTE), resistance, charge/discharge energy, and total used energy of the two battery chemistries are discussed. The LFP chemistry shows better stability for the energy-intensive PS service, while the NCA chemistry is more conducive to the FR service under the operating regimes investigated. The results can be used as a guideline for selection, deployment, operation, and cost analyses of Li-ion batteries used for different applications.

Re-Os ages for Archean molybdenite and pyrite, Kuittila-Kivisuo, Finland and Proterozoic molybdenite, Kabeliai, Lithuania: Testing the chronometer in a metamorphic and metasomatic setting

Science.gov (United States)

Stein, H.J.; Sundblad, K.; Markey, R.J.; Morgan, J.W.; Motuza, G.

1998-01-01

that the Re-Os isotopic system in pyrite has been reset on the millimeter scale and that the 21 ppt 187Os intercept reflects the in situ decay of 187Re during the ~160 to 170 m.y. interval from ~2778 Ma (time of molybdenite ± pyrite deposition) to ~2607 Ma (time of pyrite resetting). When the Re-Os data for molybdenites from the nearby Kivisuo prospect are plotted together with the Kuittila molybdenite and pyrite data, a well-constrained five-point isochron with an age of 2780 ± 8 Ma and a 187Os intercept (-2.4 ± 3.8 ppt) of essentially zero results (MSWD = 1.5). We suggest that the pyrite isochron age records a regional metamorphic and/or hydrothermal event, possibly the time of Au mineralization. A proposed Re-Os age of ~2607 Ma for Au mineralization is in good agreement with radiometric ages by other methods that address the timing of Archean Au mineralization in deposits worldwide (so-called 'late Au model'). Molybdenite, in contrast, provides a robust Re-Os chronometer, retaining its original formation age of ~2780 Ma, despite subsequent metamorphic disturbances in Archean and Proterozoic time.

Electronic, Structural, and Electrochemical Properties of LiNixCuyMn2-x-yO4 (0 < x < 0.5, 0 < y < 0.5) High-Voltage Spinel Materials

International Nuclear Information System (INIS)

Yang, Ming-Che; Xu, Bo; Cheng, Ju-Hsiang; Pan, Chun-Jern; Hwang, Bing-Joe; Meng, Ying S.

2011-01-01

First principles computation is carried out for investigating the electronic, structural, and electrochemical properties of LiM 1/2 Mn 3/2 O 4 (M = Ti, V, Cr, Fe, Co, Ni, and Cu). The computation results suggest that doping with Co or Cu can potentially lower Li diffusion barrier as compared to Ni doping. Our experimental research has focused on LiNi x Cu y Mn 2-x-y O 4 (0 x Cu y Mn 2-x-6 O 4 (0 0.25 Cu 0.25 Mn 1.50 O 4 , the proposed explanation of the voltage profile by the first principles computation was proven, a second plateau at 4.2 V originates from the oxidation of Cu 2+ to Cu 3+ , and the plateau at 4.95 V may originate from extra electrons provided by oxygen ions. Although the reversible discharge capacity decreases with increasing Cu amount, optimized composition such as LiCu 0.25 Ni 0.25 Mn 1.5 O 4 exhibits high capacities at high rates.

The Positive Outcome of MRI-Guided Vacuum Assisted Core Needle Breast Biopsies Is Not Influenced by a Prior Negative Targeted Second-Look Ultrasound.

Science.gov (United States)

Ferré, Romuald; AlSharif, Shaza; Aldis, Ann; Mesurolle, Benoît

2017-11-01

The study sought to investigate the outcome of breast magnetic resonance-guided biopsies as a function of the indication for magnetic resonance imaging (MRI), the MRI features of the lesions, and the performance or not of a targeted second-look ultrasound (SLUS) prior breast MRI-guided biopsy. We identified 158 women with MRI-detected breast lesions scheduled for MRI-guided biopsy (2007-2013). Patient demographics, performance of targeted SLUS, imaging characteristics, and subsequent pathology results were reviewed. Three biopsies were deferred, and 155 lesions were biopsied under MRI guidance (155 women; median age 55.14 years; range 27-80 years). Ninety-eight women underwent a SLUS prior to the MRI-guided biopsy (63%). Of the 155 biopsied lesions, 23 (15%) were malignant, 106 (68%) were benign, and 26 (17%) were high risk. Four of 15 surgically excised high-risk lesions were upgraded to malignancy (27%). Most of the biopsied lesions corresponded to non-mass-like enhancement (81%, 126 of 155) and most of the biopsies (52%, 81 of 155) were performed in a screening context. No demographic or MRI features were associated with malignancy. No differences were noted between the 2 subgroups (prior SLUS vs no prior SLUS) except for the presence of a synchronous carcinoma associated with a likelihood of targeted SLUS before MRI-guided biopsy (P = .001). A negative SLUS does not influence the pathology outcome of a suspicious lesion biopsied under MR guidance. Copyright © 2017 Canadian Association of Radiologists. Published by Elsevier Inc. All rights reserved.

The Antitumor Effect and Hepatotoxicity of a Hexokinase II Inhibitor 3-Bromopyruvate: In Vivo Investigation of Intraarterial Administration in a Rabbit VX2 Hepatoma Model

International Nuclear Information System (INIS)

Jae, Hwan Jun; Chung, Jin Wook; Park, Hee Sun; Lee, Min Jong; Lee, Ki Chang; Kim, Hyo Cheol; Yoon, Jung Hwan; Park, Jae Hyung; Chung, He Son

2009-01-01

The purpose of this study was to compare the antitumor effect and hepatotoxicity of an intraarterial delivery of low-dose and high-dose 3-bromopyruvate (3-BrPA) and those of a conventional Lipiodol-doxorubicin emulsion in a rabbit VX2 hepatoma model. This experiment was approved by the animal care committee at our institution. VX2 carcinoma was implanted in the livers of 36 rabbits. Transcatheter intraarterial administration was performed using low dose 3- BrPA (25 mL in a 1 mM concentration, n = 10), high dose 3-BrPA (25 mL in a 5 mM concentration, n = 10) and Lipiodol-doxorubicin emulsion (1.6 mg doxorubicin/ 0.4 mL Lipiodol, n = 10), and six rabbits were treated with normal saline alone as a control group. One week later, the proportion of tumor necrosis was calculated based on histopathologic examination. The hepatotoxicity was evaluated by biochemical analysis. The differences between these groups were statistically assessed with using Mann-Whitney U tests and Kruskal-Wallis tests. The tumor necrosis rate was significantly higher in the high dose group (93% ± 7.6 [mean ± SD]) than that in the control group (48% ± 21.7) (p = 0.0002), but the tumor necrosis rate was not significantly higher in the low dose group (62% ± 20.0) (p = 0.2780). However, the tumor necrosis rate of the high dose group was significantly lower than that of the Lipiodol-doxorubicin treatment group (99% ± 2.7) (p = 0.0015). The hepatotoxicity observed in the 3-BrPA groups was comparable to that of the Lipiodol-doxorubicin group. Even though intraarterial delivery of 3-BrPA shows a dose-related antitumor effect, single session treatment seems to have limited efficacy when compared with the conventional method

The antitumor effect and hepatotoxicity of a hexokinase II inhibitor 3-bromopyruvate: in vivo investigation of intraarterial administration in a rabbit VX2 hepatoma model.

Science.gov (United States)

Jae, Hwan Jun; Chung, Jin Wook; Park, Hee Sun; Lee, Min Jong; Lee, Ki Chang; Kim, Hyo-Cheol; Yoon, Jung Hwan; Chung, Hesson; Park, Jae Hyung

2009-01-01

The purpose of this study was to compare the antitumor effect and hepatotoxicity of an intraarterial delivery of low-dose and high-dose 3-bromopyruvate (3-BrPA) and those of a conventional Lipiodol-doxorubicin emulsion in a rabbit VX2 hepatoma model. This experiment was approved by the animal care committee at our institution. VX2 carcinoma was implanted in the livers of 36 rabbits. Transcatheter intraarterial administration was performed using low dose 3-BrPA (25 mL in a 1 mM concentration, n = 10), high dose 3-BrPA (25 mL in a 5 mM concentration, n = 10) and Lipiodol-doxorubicin emulsion (1.6 mg doxorubicin/ 0.4 mL Lipiodol, n = 10), and six rabbits were treated with normal saline alone as a control group. One week later, the proportion of tumor necrosis was calculated based on histopathologic examination. The hepatotoxicity was evaluated by biochemical analysis. The differences between these groups were statistically assessed with using Mann-Whitney U tests and Kruskal-Wallis tests. The tumor necrosis rate was significantly higher in the high dose group (93% +/- 7.6 [mean +/- SD]) than that in the control group (48% +/- 21.7) (p = 0.0002), but the tumor necrosis rate was not significantly higher in the low dose group (62% +/- 20.0) (p = 0.2780). However, the tumor necrosis rate of the high dose group was significantly lower than that of the Lipiodol-doxorubicin treatment group (99% +/- 2.7) (p = 0.0015). The hepatotoxicity observed in the 3-BrPA groups was comparable to that of the Lipiodol-doxorubicin group. Even though intraarterial delivery of 3-BrPA shows a dose-related antitumor effect, single session treatment seems to have limited efficacy when compared with the conventional method.

The Antitumor Effect and Hepatotoxicity of a Hexokinase II Inhibitor 3-Bromopyruvate: In Vivo Investigation of Intraarterial Administration in a Rabbit VX2 Hepatoma Model

Energy Technology Data Exchange (ETDEWEB)

Jae, Hwan Jun; Chung, Jin Wook; Park, Hee Sun; Lee, Min Jong; Lee, Ki Chang; Kim, Hyo Cheol; Yoon, Jung Hwan; Park, Jae Hyung [Seoul National University Hospital, Seoul (Korea, Republic of); Chung, He Son [Korea Institute of Science and Technology, Seoul (Korea, Republic of)

2009-12-15

The purpose of this study was to compare the antitumor effect and hepatotoxicity of an intraarterial delivery of low-dose and high-dose 3-bromopyruvate (3-BrPA) and those of a conventional Lipiodol-doxorubicin emulsion in a rabbit VX2 hepatoma model. This experiment was approved by the animal care committee at our institution. VX2 carcinoma was implanted in the livers of 36 rabbits. Transcatheter intraarterial administration was performed using low dose 3- BrPA (25 mL in a 1 mM concentration, n = 10), high dose 3-BrPA (25 mL in a 5 mM concentration, n = 10) and Lipiodol-doxorubicin emulsion (1.6 mg doxorubicin/ 0.4 mL Lipiodol, n = 10), and six rabbits were treated with normal saline alone as a control group. One week later, the proportion of tumor necrosis was calculated based on histopathologic examination. The hepatotoxicity was evaluated by biochemical analysis. The differences between these groups were statistically assessed with using Mann-Whitney U tests and Kruskal-Wallis tests. The tumor necrosis rate was significantly higher in the high dose group (93% +- 7.6 [mean +- SD]) than that in the control group (48% +- 21.7) (p = 0.0002), but the tumor necrosis rate was not significantly higher in the low dose group (62% +- 20.0) (p = 0.2780). However, the tumor necrosis rate of the high dose group was significantly lower than that of the Lipiodol-doxorubicin treatment group (99% +- 2.7) (p = 0.0015). The hepatotoxicity observed in the 3-BrPA groups was comparable to that of the Lipiodol-doxorubicin group. Even though intraarterial delivery of 3-BrPA shows a dose-related antitumor effect, single session treatment seems to have limited efficacy when compared with the conventional method

Therapeutic effect of Chinese herbal medicines for post stroke recovery: A traditional and network meta-analysis.

Science.gov (United States)

Han, Shi-You; Hong, Zhi-You; Xie, Yu-Hua; Zhao, Yong; Xu, Xiao

2017-12-01

Stroke is a condition with high morbidity and mortality, and 75% of stroke survivors lose their ability to work. Stroke is a burden to the family and society. The purpose of this study was to evaluate the effectiveness of Chinese herbal patent medicines in the treatment of patients after the acute phase of a stroke. We searched the following databases through August 2016: PubMed, Embase, Cochrane library, China Knowledge Resource Integrated Database (CNKI), China Science Periodical Database (CSPD), and China Biology Medicine disc (CBMdisc) for studies that evaluated Chinese herbal patent medicines for post stroke recovery. A random-effect model was used to pool therapeutic effects of Chinese herbal patent medicines on stroke recovery. Network meta-analysis was used to rank the treatment for each Chinese herbal patent medicine. In our meta-analysis, we evaluated 28 trials that included 2780 patients. Chinese herbal patent medicines were effective in promoting recovery after stroke (OR, 3.03; 95% CI: 2.53-3.64; P herbal patent medicines significantly improved neurological function defect scores when compared with the controls (standard mean difference [SMD], -0.89; 95% CI, -1.44 to -0.35; P = .001). Chinese herbal patent medicines significantly improved the Barthel index (SMD, 0.73; 95% CI, 0.53-0.94; P herbal medicines most likely to improve stroke recovery when combined with acupuncture. Our research suggests that the Chinese herbal patent medicines were effective for stroke recovery. The most effective treatments for stroke recovery were MLC601, Shuxuetong, and BuchangNaoxintong. However, to clarify the specific effective ingredients of Chinese herbal medicines, a well-designed study is warranted.

Associação entre violência por parceiro íntimo contra a mulher e infecção por HIV Asociación entre violencia contra la mujer por pareja íntima e infección por VIH Association between intimate partner violence against women and HIV infection

Directory of Open Access Journals (Sweden)

Claudia Barros

2011-04-01

Full Text Available OBJETIVO: Analisar a associação entre a violência por parceiro íntimo contra mulheres e a infecção ou suspeita de infecção pelo vírus da imunodeficiência humana (HIV. MÉTODOS: Estudo transversal com base em dados de questionários aplicados face-a-face e de prontuários médicos de 2.780 mulheres de 15 a 49 anos, atendidas em unidades do sistema único de saúde da Grande São Paulo, SP, em 2001-2002. As mulheres foram categorizadas em: usuárias em tratamento por serem "soropositivas para o HIV", com "suspeita de HIV" e aquelas que procuraram os serviços por outros motivos. A violência por parceiro íntimo contra mulheres na vida foi categorizada por gravidade e recorrência dos episódios de violência. A associação com o desfecho foi testada pelo modelo de Poisson com variância robusta e ajustada por variáveis sociodemográficas, sexuais e reprodutivas. RESULTADOS: A prevalência de violência foi de 59,8%. Sofrer violência reiterada e grave apresentou maior associação de infecção confirmada pelo HIV (RP = 1,91. A violência independente da gravidade e da recorrência dos episódios apresentou maior associação para a suspeita de infecção por HIV (RP = 1,29. CONCLUSÕES: A violência por parceiro íntimo contra mulheres tem papel relevante nas situações de suspeita e confirmação da infecção pelo HIV, sendo essencial incluir sua detecção, controle e prevenção como parte da atenção integral à saúde das mulheres.OBJETIVO: Analizar la asociación entre la violencia contra mujeres por pareja íntima y la infección o sospecha de infección por el virus de inmunodeficiencia humana (VIH. MÉTODOS: Estudio transversal con base en datos de cuestionarios aplicados cara-a cara y de prontuarios médicos de 2.780 mujeres de 15 a 49 años, atendidas en unidades del sistema único de salud de la Gran Sao Paulo, Sureste de Brasil, en 2001-2002. Las mujeres fueron categorizadas en: usuarias en tratamiento por ser

vPARP Adjusts MVP Expression in Drug-resistant Cell Lines in Conjunction with MDR Proteins.

Science.gov (United States)

Wojtowicz, Karolina; Januchowski, Radoslaw; Nowicki, Michal; Zabel, Maciej

2017-06-01

The definition of vault (ribonucleoprotein particles) function remains highly complex. Vaults may cooperate with multidrug resistance (MDR) proteins, supporting their role in drug resistance. This topic is the main theme of this publication. The cell viability was determined by an MTT assay. The protein expression was detected by western blot analysis. The proteins were knocked-down using siRNA. No major vault protein (MVP) in the LoVo/Dx and W1PR cell lines after tunicamycin treatment was shown. In W1PR cells with knocked-down MVP, a statistically significant decrease in cell viability was noted. In LoVo/Dx, W1TR and A2780TR cells were vault poly-ADP-ribose polymerase (vPARP) was knockdown, a decrease in cell viability was shown. Also, MVP silencing induced an increase in glycoprotein P (Pgp) expression in LoVo/Dx cells. MVP is important for the drug resistance of cancer cells, but it probably requires the presence of vPARP for full activation. Some correlations between MDR proteins and vaults exist. Copyright© 2017, International Institute of Anticancer Research (Dr. George J. Delinasios), All rights reserved.

Poly(amido)amine (PAMAM) dendrimer–cisplatin complexes for chemotherapy of cisplatin-resistant ovarian cancer cells

International Nuclear Information System (INIS)

Yellepeddi, Venkata Kashyap; Vangara, Kiran Kumar; Palakurthi, Srinath

2013-01-01

Dendrimer–cisplatin complexes were prepared using PAMAM dendrimers with terminal –NH 2 and –COOH groups as well as biotin-conjugated dendrimers. Preformulation parameters of dendrimer–cisplatin complexes were studied using differential scanning calorimetry (DSC) and inductively coupled plasma-mass spectrometry (ICP-MS). Cytotoxicity and mechanism of cytotoxicity of dendrimer-cisplatin complexes was investigated in OVCAR-3, SKOV, A2780 and cisplatin-resistant CP70 human ovarian cancer cell lines. The loading of cisplatin in dendrimers was ∼11 % (w/w). PAMAM G4 dendrimers with amine surface groups (biotinylated and native) have shown 2.5- to 3.0-fold reduction in IC 50 values in ovarian cancer cells when compared with carboxylate surface dendrimers (p < 0.05). A correlation was observed among cytotoxicity of the complexes, cellular uptake, and platinum–DNA adduct formation. Treatment with dendrimer–cisplatin complexes resulted in a 7.0-fold increase (p < 0.05) in expression of apoptotic genes (Bcl2, Bax, p53) and 13.2- to 27.1-fold increase (p < 0.05) in the activity of caspases 3, 8, and 9 in vitro. Results suggest that PAMAM dendrimers can be used as potential carrier for cisplatin chemotherapy of ovarian cancer

Poly(amido)amine (PAMAM) dendrimer-cisplatin complexes for chemotherapy of cisplatin-resistant ovarian cancer cells

Energy Technology Data Exchange (ETDEWEB)

Yellepeddi, Venkata Kashyap; Vangara, Kiran Kumar; Palakurthi, Srinath, E-mail: palakurthi@tamhsc.edu [Texas A and M Health Science Center, Irma Lerma Rangel College of Pharmacy (United States)

2013-09-15

Dendrimer-cisplatin complexes were prepared using PAMAM dendrimers with terminal -NH{sub 2} and -COOH groups as well as biotin-conjugated dendrimers. Preformulation parameters of dendrimer-cisplatin complexes were studied using differential scanning calorimetry (DSC) and inductively coupled plasma-mass spectrometry (ICP-MS). Cytotoxicity and mechanism of cytotoxicity of dendrimer-cisplatin complexes was investigated in OVCAR-3, SKOV, A2780 and cisplatin-resistant CP70 human ovarian cancer cell lines. The loading of cisplatin in dendrimers was {approx}11 % (w/w). PAMAM G4 dendrimers with amine surface groups (biotinylated and native) have shown 2.5- to 3.0-fold reduction in IC{sub 50} values in ovarian cancer cells when compared with carboxylate surface dendrimers (p < 0.05). A correlation was observed among cytotoxicity of the complexes, cellular uptake, and platinum-DNA adduct formation. Treatment with dendrimer-cisplatin complexes resulted in a 7.0-fold increase (p < 0.05) in expression of apoptotic genes (Bcl2, Bax, p53) and 13.2- to 27.1-fold increase (p < 0.05) in the activity of caspases 3, 8, and 9 in vitro. Results suggest that PAMAM dendrimers can be used as potential carrier for cisplatin chemotherapy of ovarian cancer.

Fine mapping of the sunflower resistance locus PlARG introduced from the wild species Helianthus argophyllus

Science.gov (United States)

Wieckhorst, S.; Bachlava, E.; Dußle, C. M.; Tang, S.; Gao, W.; Saski, C.; Knapp, S. J.; Schön, C.-C.; Hahn, V.

2010-01-01

Downy mildew, caused by Plasmopara halstedii, is one of the most destructive diseases in cultivated sunflower (Helianthus annuus L.). The dominant resistance locus PlARG originates from silverleaf sunflower (H. argophyllus Torrey and Gray) and confers resistance to all known races of P. halstedii. We mapped PlARG on linkage group (LG) 1 of (cms)HA342 × ARG1575-2, a population consisting of 2,145 F2 individuals. Further, we identified resistance gene candidates (RGCs) that cosegregated with PlARG as well as closely linked flanking markers. Markers from the target region were mapped with higher resolution in NDBLOSsel × KWS04, a population consisting of 2,780 F2 individuals that does not segregate for PlARG. A large-insert sunflower bacterial artificial chromosome (BAC) library was screened with overgo probes designed for markers RGC52 and RGC151, which cosegregated with PlARG. Two RGC-containing BAC contigs were anchored to the PlARG region on LG 1. Electronic supplementary material The online version of this article (doi:10.1007/s00122-010-1416-4) contains supplementary material, which is available to authorized users. PMID:20700574

Total phenolics and antioxidant activity of five medicinal plant

International Nuclear Information System (INIS)

Sousa, Cleyton Marcos de M.; Silva, Hilris Rocha e; Vieira-Junior, Gerardo Magela; Ayres, Mariane Cruz C.; Costa, Charllyton Luis S. da; Araajo, Delton Servulo; Cavalcante, Luis Carlos D.; Barros, Elcio Daniel S.; Araujo, Paulo Breitner de M.; Brandao, Marcela S.; Chaves, Mariana H.

2007-01-01

This paper describes total phenolics content and antioxidant activity in the ethanolic extract of leaves, bark and roots of five medicinal plants: Terminalia brasiliensis Camb., Terminalia fagifolia Mart. and Zucc., Copernicia cerifera (Miller) H.E. Moore, Cenostigma macrophyllum Tul. var. acuminata Teles Freire and Qualea grandiflora Mart. The total phenolics content of the plant extracts, determined by the Folin-Ciocalteu method, varied from 250.0 ±8,2 to 763,63 ±13.03 mg of gallic acid equivalent/g dry EtOH extract. The antioxidant activity of extracts was evaluated using the 2,2-diphenyl-1-picrylhydrazyl (DPPH) assay system. Extract of bark from T. brasiliensis, the most active, with an EC 50 value of 27.59 ± 0.82 μg/mL, was comparable to rutin (EC 50 = 27.80 ± 1.38) and gallic acid (EC 50 = 24.27 ± 0.31), used as positive controls. The relationship between total phenolic content and antioxidant activity was positive and significant for T. brasiliensis, C. macrophyllum and C. cerifera. (author)

Total phenolics and antioxidant activity of five medicinal plant; Fenois totais e atividade antioxidante de cinco plantas medicinais

Energy Technology Data Exchange (ETDEWEB)

Sousa, Cleyton Marcos de M.; Silva, Hilris Rocha e; Vieira-Junior, Gerardo Magela; Ayres, Mariane Cruz C.; Costa, Charllyton Luis S. da; Araajo, Delton Servulo; Cavalcante, Luis Carlos D.; Barros, Elcio Daniel S.; Araujo, Paulo Breitner de M.; Brandao, Marcela S.; Chaves, Mariana H. [Universidade Federal do Piaui, Teresina, PI (Brazil). Dept. de Quimica]. E-mail: mariana@ufpi.br

2007-03-15

This paper describes total phenolics content and antioxidant activity in the ethanolic extract of leaves, bark and roots of five medicinal plants: Terminalia brasiliensis Camb., Terminalia fagifolia Mart. and Zucc., Copernicia cerifera (Miller) H.E. Moore, Cenostigma macrophyllum Tul. var. acuminata Teles Freire and Qualea grandiflora Mart. The total phenolics content of the plant extracts, determined by the Folin-Ciocalteu method, varied from 250.0 {+-}8,2 to 763,63 {+-}13.03 mg of gallic acid equivalent/g dry EtOH extract. The antioxidant activity of extracts was evaluated using the 2,2-diphenyl-1-picrylhydrazyl (DPPH) assay system. Extract of bark from T. brasiliensis, the most active, with an EC{sub 50} value of 27.59 {+-} 0.82 {mu}g/mL, was comparable to rutin (EC{sub 50} = 27.80 {+-} 1.38) and gallic acid (EC{sub 50} = 24.27 {+-} 0.31), used as positive controls. The relationship between total phenolic content and antioxidant activity was positive and significant for T. brasiliensis, C. macrophyllum and C. cerifera. (author)

Interaction between doubly-excited 4p4nln'l' resonances in KrI

International Nuclear Information System (INIS)

Sukhorukov, V L; Petrov, I D; Demekhin, Ph V; Schmoranzer, H; Mickat, S; Kammer, S; Schartner, K-H; Klumpp, S; Werner, L; Ehresmann, A

2007-01-01

Photoionization cross sections for the 4p 4 ( 3 P)5s 4 P 5/2,3/2,1/2 satellites and 4s → εl, 4p → εl main lines of Kr II were measured using the photon-induced fluorescence spectroscopy in the exciting-photon energy range between 27.80 eV and 29.44 eV with extremely narrow bandwidth (1.7 meV at 28.55 eV) of the monochromatized synchrotron radiation. The observed resonances were assigned to the 4p 4 5s( 4 P 1/2 )np and 4p 4 5s( 2 P 3/2 )np Rydberg series on the basis of the calculations including core relaxation and interaction between many resonances and many continua. The calculation shows that the resonance structure in the photoionization channels exists due to the 4p 4 ( 1 D)5s 2 D 5/2 6p 3/2 and 4p 4 ( 1 D)5s 2 D 3/2 6p 3/2,1/2 promoter states which strongly perturb the above Rydberg series

Cell design and image analysis for in situ Raman mapping of inhomogeneous state-of-charge profiles in lithium-ion batteries

Science.gov (United States)

Fang, Shuyu; Yan, Min; Hamers, Robert J.

2017-06-01

The study of inhomogeneous battery failure processes requires proper tools with high spatial resolving power. Here we describe a simple way to adapt industry-standard coin cells to enable in situ Raman mapping of lithium-ion battery materials. We describe the important cell design parameters and validate that the design achieves a uniform potential distribution within the region probed by Raman. We further validate that the cell yields electrical performance characteristics equivalent to a standard, non-modified coin cell. Using this cell, we probe the local charging profiles of LiNi0.5Mn0.3Co0.2O2 ("NMC") particles during cycling and demonstrate the ability to achieve spatial maps of the Raman spectra. In order to reduce the effects of local topography, we further analyze these data by numerically extracting the local frequency of the A1g vibrational mode, which is sensitive to the local extent of lithiation, and producing spatial maps of the local frequency of the A1g mode. This work demonstrates a way to collect and analyze high quality in situ spectra with an easy-to-implement cell design that can be applied to a wide range of electrode materials.

Crystal Structure of Mycobacterium tuberculosis H37Rv AldR (Rv2779c), a Regulator of the ald Gene: DNA BINDING AND IDENTIFICATION OF SMALL MOLECULE INHIBITORS.

Science.gov (United States)

Dey, Abhishek; Shree, Sonal; Pandey, Sarvesh Kumar; Tripathi, Rama Pati; Ramachandran, Ravishankar

2016-06-03

Here we report the crystal structure of M. tuberculosis AldR (Rv2779c) showing that the N-terminal DNA-binding domains are swapped, forming a dimer, and four dimers are assembled into an octamer through crystal symmetry. The C-terminal domain is involved in oligomeric interactions that stabilize the oligomer, and it contains the effector-binding sites. The latter sites are 30-60% larger compared with homologs like MtbFFRP (Rv3291c) and can consequently accommodate larger molecules. MtbAldR binds to the region upstream to the ald gene that is highly up-regulated in nutrient-starved tuberculosis models and codes for l-alanine dehydrogenase (MtbAld; Rv2780). Further, the MtbAldR-DNA complex is inhibited upon binding of Ala, Tyr, Trp and Asp to the protein. Studies involving a ligand-binding site G131T mutant show that the mutant forms a DNA complex that cannot be inhibited by adding the amino acids. Comparative studies suggest that binding of the amino acids changes the relative spatial disposition of the DNA-binding domains and thereby disrupt the protein-DNA complex. Finally, we identified small molecules, including a tetrahydroquinoline carbonitrile derivative (S010-0261), that inhibit the MtbAldR-DNA complex. The latter molecules represent the very first inhibitors of a feast/famine regulatory protein from any source and set the stage for exploring MtbAldR as a potential anti-tuberculosis target. © 2016 by The American Society for Biochemistry and Molecular Biology, Inc.

Folic acid tagged nanoceria as a novel therapeutic agent in ovarian cancer

International Nuclear Information System (INIS)

Hijaz, Miriana; Das, Soumen; Mert, Ismail; Gupta, Ankur; Al-Wahab, Zaid; Tebbe, Calvin; Dar, Sajad; Chhina, Jasdeep; Giri, Shailendra; Munkarah, Adnan; Seal, Sudipta; Rattan, Ramandeep

2016-01-01

Nanomedicine is a very promising field and nanomedical drugs have recently been used as therapeutic agents against cancer. In a previous study, we showed that Nanoceria (NCe), nanoparticles of cerium oxide, significantly inhibited production of reactive oxygen species, cell migration and invasion of ovarian cancer cells in vitro, without affecting cell proliferation and significantly reduced tumor growth in an ovarian cancer xenograft nude model. Increased expression of folate receptor-α, an isoform of membrane-bound folate receptors, has been described in ovarian cancer. To enable NCe to specifically target ovarian cancer cells, we conjugated nanoceria to folic acid (NCe-FA). Our aim was to investigate the pre-clinical efficacy of NCe-FA alone and in combination with Cisplatin. Ovarian cancer cell lines were treated with NCe or NCe-FA. Cell viability was assessed by MTT and colony forming units. In vivo studies were carried in A2780 generated mouse xenografts treated with 0.1 mg/Kg NCe, 0.1 mg/Kg; NCe-FA and cisplatinum, 4 mg/Kg by intra-peritoneal injections. Tumor weights and burden scores were determined. Immunohistochemistry and toxicity assays were used to evaluate treatment effects. We show that folic acid conjugation of NCe increased the cellular NCe internalization and inhibited cell proliferation. Mice treated with NCe-FA had a lower tumor burden compared to NCe, without any vital organ toxicity. Combination of NCe-FA with cisplatinum decreased the tumor burden more significantly. Moreover, NCe-FA was also effective in reducing proliferation and angiogenesis in the xenograft mouse model. Thus, specific targeting of ovarian cancer cells by NCe-FA holds great potential as an effective therapeutic alone or in combination with standard chemotherapy. The online version of this article (doi:10.1186/s12885-016-2206-4) contains supplementary material, which is available to authorized users

Graphene Oxide–Silver Nanocomposite Enhances Cytotoxic and Apoptotic Potential of Salinomycin in Human Ovarian Cancer Stem Cells (OvCSCs: A Novel Approach for Cancer Therapy

Directory of Open Access Journals (Sweden)

Yun-Jung Choi

2018-03-01

Full Text Available The use of graphene to target and eliminate cancer stem cells (CSCs is an alternative approach to conventional chemotherapy. We show the biomolecule-mediated synthesis of reduced graphene oxide–silver nanoparticle nanocomposites (rGO–Ag using R-phycoerythrin (RPE; the resulting RPE–rGO–Ag was evaluated in human ovarian cancer cells and ovarian cancer stem cells (OvCSCs. The synthesized RPE–rGO–Ag nanocomposite (referred to as rGO–Ag was characterized using various analytical techniques. rGO–Ag showed significant toxicity towards both ovarian cancer cells and OvCSCs. After 3 weeks of incubating OvCSCs with rGO–Ag, the number of A2780 and ALDH+CD133+ colonies was significantly reduced. rGO–Ag was toxic to OvCSCs and reduced cell viability by mediating the generation of reactive oxygen species, leakage of lactate dehydrogenase, reduced mitochondrial membrane potential, and enhanced expression of apoptotic genes, leading to mitochondrial dysfunction and possibly triggering apoptosis. rGO–Ag showed significant cytotoxic potential towards highly tumorigenic ALDH+CD133+ cells. The combination of rGO–Ag and salinomycin induced 5-fold higher levels of apoptosis than each treatment alone. A combination of rGO–Ag and salinomycin at very low concentrations may be suitable for selectively killing OvCSCs and sensitizing tumor cells. rGO–Ag may be a novel nano-therapeutic molecule for specific targeting of highly tumorigenic ALDH+CD133+ cells and eliminating CSCs. This study highlights the potential for targeted therapy of tumor-initiating cells.

Biological determinants of plant and crop productivity of flax (Linum usitatissimum L.

Directory of Open Access Journals (Sweden)

Tadeusz Zając

2012-12-01

Full Text Available In Poland the cultivation of the fibrous form of flax (Linum usitatissimum L. is dying out, but the acreage of its oilseed form, linseed, which provides seed (Semen lini used in therapy and being a source of -linolenic acid, is expanding. Nowadays, linseed is grown in 64 countries of the world, but yield levels in these countries vary greatly. Under European conditions, seed yield of linseed shows high variation, which is evidence of little knowledge of the biology of this plant and the lack of precise cultivation solutions in agricultural technologies used. A major reason is the difficulty in obtaining optimal crop density. A sparse crop results in low above-ground biomass yield, which is translated into insufficient crop yields. The selection of highly productive domestic and foreign varieties can partially increase linseed yield; apart from some domestic varieties, the Canadian cultivar 'Flanders' and the Hungarian cultivar 'Barbara' are positive examples in this respect. There is a possibility of effective selection at early stages of linseed breeding, which bodes well for the prospect of obtaining highly productive varieties with normal or very low -linolenic acid content.

Oxygen, hydrogen, ethylene and CO 2 development in lithium-ion batteries

Science.gov (United States)

Holzapfel, M.; Würsig, A.; Scheifele, W.; Vetter, J.; Novák, P.

Gas evolution has been examined for different types of battery-related electrode materials via in situ differential electrochemical mass spectrometry (DEMS). Besides standard graphite also a novel silicon-based negative electrode was examined and it was shown that the evolution of hydrogen and ethylene is considerably reduced on this material compared to graphite. Oxygen evolution was proven to happen on the oxidative reaction of a Li 2O 2 electrode, besides a certain oxidation of the electrolyte. The 4.5 V plateau upon the oxidation of Li[Ni 0.2Li 0.2Mn 0.6]O 2 was likewise proven to be linked to oxygen evolution. Also in this case electrolyte oxidation was shown to be a side reaction. Layered positive electrode materials Li(Ni,Co,Al)O 2 and Li(Ni,Mn,Co)O 2 were also examined. The influence of different parameters on the CO 2 evolution in lithium-ion batteries was shown up. The amount of CO 2 formation is increased by high temperatures and cell voltages, while the addition of vinylene carbonate (VC) decreases it. Li(Ni,Mn,Co)O 2 shows much less CO 2 evolution than Li(Ni,Co,Al)O 2.

The Top 10 fungal pathogens in molecular plant pathology.

Science.gov (United States)

Dean, Ralph; Van Kan, Jan A L; Pretorius, Zacharias A; Hammond-Kosack, Kim E; Di Pietro, Antonio; Spanu, Pietro D; Rudd, Jason J; Dickman, Marty; Kahmann, Regine; Ellis, Jeff; Foster, Gary D

2012-05-01

The aim of this review was to survey all fungal pathologists with an association with the journal Molecular Plant Pathology and ask them to nominate which fungal pathogens they would place in a 'Top 10' based on scientific/economic importance. The survey generated 495 votes from the international community, and resulted in the generation of a Top 10 fungal plant pathogen list for Molecular Plant Pathology. The Top 10 list includes, in rank order, (1) Magnaporthe oryzae; (2) Botrytis cinerea; (3) Puccinia spp.; (4) Fusarium graminearum; (5) Fusarium oxysporum; (6) Blumeria graminis; (7) Mycosphaerella graminicola; (8) Colletotrichum spp.; (9) Ustilago maydis; (10) Melampsora lini, with honourable mentions for fungi just missing out on the Top 10, including Phakopsora pachyrhizi and Rhizoctonia solani. This article presents a short resumé of each fungus in the Top 10 list and its importance, with the intent of initiating discussion and debate amongst the plant mycology community, as well as laying down a bench-mark. It will be interesting to see in future years how perceptions change and what fungi will comprise any future Top 10. © 2012 THE AUTHORS. MOLECULAR PLANT PATHOLOGY © 2012 BSPP AND BLACKWELL PUBLISHING LTD.

Facilely solving cathode/electrolyte interfacial issue for high-voltage lithium ion batteries by constructing an effective solid electrolyte interface film

International Nuclear Information System (INIS)

Xu, Jingjing; Xia, Qingbo; Chen, Fangyuan; Liu, Tao; Li, Li; Cheng, Xueyuan; Lu, Wei; Wu, Xiaodong

2016-01-01

The cathode/electrolyte interface stability is the key factor for the cyclic performance and the safety performance of lithium ion batteries. Suppression of consuming key elements in the electrode materials is essential in this concern. In this purpose, we investigate a facile strategy to solve interfacial issue for high-voltage lithium ion batteries by adding an oxidable fluorinated phosphate, Bis(2,2,2-trifluoroethyl) Phosphite (BTFEP), as a sacrificial additive in electrolyte. We demonstrate that BTFEP additive could be oxidized at slightly above 4.28 V which is a relatively lower voltage than that of solvents, and the oxidative products facilitate in-situ forming a stable solid electrolyte interphase (SEI) film on the cathode surface. The results manifest the SEI film validly restrains the generation of HF and the interfacial side reaction between high-voltage charged LiNi 0.5 Mn 1.5 O 4 (LNMO) and electrolyte, hence, the dissolution of Mn and Ni is effectively suppressed. Finally, the cyclic performance of LNMO after 200 cycles was remarkably improved from 68.4% in blank electrolyte to 95% in 1 wt% BTFEP-adding electrolyte.

Atomic Layer Deposition of Stable LiAlF4 Lithium Ion Conductive Interfacial Layer for Stable Cathode Cycling.

Science.gov (United States)

Xie, Jin; Sendek, Austin D; Cubuk, Ekin D; Zhang, Xiaokun; Lu, Zhiyi; Gong, Yongji; Wu, Tong; Shi, Feifei; Liu, Wei; Reed, Evan J; Cui, Yi

2017-07-25

Modern lithium ion batteries are often desired to operate at a wide electrochemical window to maximize energy densities. While pushing the limit of cutoff potentials allows batteries to provide greater energy densities with enhanced specific capacities and higher voltage outputs, it raises key challenges with thermodynamic and kinetic stability in the battery. This is especially true for layered lithium transition-metal oxides, where capacities can improve but stabilities are compromised as wider electrochemical windows are applied. To overcome the above-mentioned challenges, we used atomic layer deposition to develop a LiAlF 4 solid thin film with robust stability and satisfactory ion conductivity, which is superior to commonly used LiF and AlF 3 . With a predicted stable electrochemical window of approximately 2.0 ± 0.9 to 5.7 ± 0.7 V vs Li + /Li for LiAlF 4 , excellent stability was achieved for high Ni content LiNi 0.8 Mn 0.1 Co 0.1 O 2 electrodes with LiAlF 4 interfacial layer at a wide electrochemical window of 2.75-4.50 V vs Li + /Li.

Failure modes in high-power lithium-ion batteries for use in hybrid electric vehicles

International Nuclear Information System (INIS)

Kostecki, R.; Zhang, X.; Ross Jr., P.N.; Kong, F.; Sloop, S.; Kerr, J.B.; Striebel, K.; Cairns, E.; McLarnon, F.

2001-01-01

The Advanced Technology Development (ATD) Program seeks to aid the development of high-power lithium-ion batteries for hybrid electric vehicles. Nine 18650-size ATD baseline cells were tested under a variety of conditions. The cells consisted of a carbon anode, LiNi 0.8 Co 0.2 O 2 cathode and DEC-EC-LiPF 6 electrolyte, and they were engineered for high-power applications. Selected instrumental techniques such as synchrotron IR microscopy, Raman spectroscopy, scanning electron microscopy, atomic force microscopy, gas chromatography, etc. were used to characterize the anode, cathode, current collectors and electrolyte from these cells. The goal was to identify detrimental processes which lead to battery failure under a high-current cycling regime as well as during storage at elevated temperatures. The diagnostic results suggest that the following factors contribute to the cell power loss: (a) SEI deterioration and non-uniformity on the anode, (b) morphology changes, increase of impedance and phase separation on the cathode, (c) pitting corrosion on the cathode Al current collector, and (d) decomposition of the LiPF 6 salt in the electrolyte at elevated temperature

Pharmacologic Rhythm Control versus Rate Control in Heart Failure and Atrial Fibrillation

Directory of Open Access Journals (Sweden)

Gladys Gladys

2017-01-01

Full Text Available Heart failure (HF with atrial fibrillation (AF is correlated with worse prognosis requiring special approach.Rate control has been the first line of treatment in cases of HF and HF. On the other hand, rhythm controlhas been proven to be effective in returning sinus rhythm resulting in better prognosis for patients with HFbut not HF. Its role in cocurring cases of HF and AF is not fully understood. Thus, this study aims to analysewhether pharmacologic rhythm control can be applied to cases of HF and AF to reduce mortality. A searchwas conducted via PubMed, Medline, ProQuest, and Cochrane Database on January 2016. One study wasselected after filtering process by inclusion and exclusion criteria and critical appraisal was performed. It wasfound that there was rhythm control and rate control do no have favouring effect towards mortality shown byRR 1.03 (95% CI 0.90-1.17, p=0.69. Rate control has protective effect towards hospitalizations by RR of 0.92(95% CI 0.86 – 0.98, p=0.008, NNT=19. To conclude, rhythm control is not superior to rate control in reducingmortality and rate control should be still be considered as first line treatment of HF and AF. Keywords: heart failure, pharmacologic rhythm control, rate control, atrial fibrillation   Farmakologis Rhythm Control Dibandingkan dengan Rate Control padaKasus Gagal Jantung dan Atrial Fibrilasi Abstrak Gagal jantung dengan atrial fibrilasi berhubungan dengan prognosis yang lebih buruk dan membutuhkanpenanganan khusus. Saat ini strategi rate control merupakan terapi lini pertama pada kasus gagal jantungdan atrial fibrilasi. Rhythm control memberikan prognosis yang lebih baik pada pasien gagal jantung denganmengembalikan sinus ritme. Kegunaan rhythm control pada kasus gagal jantung dan atrial fibrilasi sampaisaat ini belum sepenuhnya dimengerti. Tujuan studi ini adalah menelaah apakah terapi farmakologis rhythmcontrol dapat menurunkan mortalitas gagal jantung dan atrial fibrilasi. Pencarian data

Einfluss des Internets auf das Informations-, Einkaufs- und Verkehrsverhalten

Science.gov (United States)

Nerlich, Mark R.; Schiffner, Felix; Vogt, Walter

Mit Daten aus eigenen Erhebungen können das einkaufsbezogene Informations- und Einkaufsverhalten im Zusammenhang mit den verkehrlichen Aspekten (Distanzen, Verkehrsmittel, Wegekopplungen) dargestellt werden. Die Differenzierung in die drei Produktkategorien des täglichen, mittelfristigen und des langfristigen Bedarfs berücksichtigt in erster Linie die Wertigkeit eines Gutes, die seine Erwerbshäufigkeit unmittelbar bestimmt. Der Einsatz moderner IKT wie das Internet eröffnet dem Endverbraucher neue Möglichkeiten bei Information und Einkauf. Die verkehrliche Relevanz von Online-Shopping wird deutlich, wenn man berücksichtigt, dass im Mittel rund 17% aller Online-Einkäufe, die die Probanden durchgeführt haben, Einkäufe in Ladengeschäften ersetzen. Dies gilt in verstärktem Maße für Online-Informationen: etwa die Hälfte hätte alternativ im stationären Einzelhandel stattgefunden. Da der Erwerb von Gütern des täglichen Bedarfs häufig nahräumlich und in relevantem Anteil nicht-motorisiert erfolgen kann, sind in diesem Segment - im Gegensatz zum mittel- und langfristigen Bedarf - nur geringe Substitutionseffekte zu beobachten.

Privatiserung von Geschichte. Probleme einer differenzierten Aufarbeitung

Directory of Open Access Journals (Sweden)

Birthe Kundrus

2000-11-01

Full Text Available Ausgangspunkt der Untersuchung von Vera Neumann ist die These, daß im Krieg Erlebtes und Erlittenes in den Wiederaufbau- und Wirtschaftswunderjahren Westdeutschlands einem Thematisierungstabu unterlegen sei. Anhand von 50 Interviews, die in den 80er Jahren im Rahmen des von Lutz Niethammer geleiteten Projekts „Lebensgeschichte und Sozialgeschichte im Ruhrgebiet 1930–1960“ (LUSIR entstanden sind und die sie jetzt anhand der Tonbandprotokolle und Abschriften ein zweites Mal auswertet, möchte die Historikerin diese Verschüttungen aufspüren. Im Anschluß an Niethammers These der „Privatisierung von Geschichte“ will sie zeigen, daß seelische und körperliche Kriegsfolgen wie Deprivations- und Überlastungsgefühle, der Verlust von Angehörigen und Kriegsbeschädigungen „privatisiert“, d.h. an die Familien übertragen wurden. Dort seien dann in erster Linie die weiblichen Familienmitglieder mit der Versorgungs- und Pflegearbeit konfrontiert worden. An vier Fallbeispiele schließt sich eine detaillierte Auswertung des gesamten Interviewmaterials an. Diesen Teilen folgt ein Abschnitt zur staatlichen Kriegsopferversorgung in der frühen Bundesrepublik.

Wider participation in the EU Eco Management and Audit Scheme; Das Gemeinschaftssystem der EG-Oeko-Audit-Verordnung oeffnet sich

Energy Technology Data Exchange (ETDEWEB)

Mueller, U. [Institut fuer Management und Umwelt, Augsburg (Germany); Blaha, A.

1998-04-01

Within the framework of the EU Eco Management and Audit Scheme, which addresses primarily industry, member states can make provisions at the national level to permit trade and service firms as well as public enterprises to participate in the scheme. With the ordinance extending the eco audit ordinance which came into force in February 1998, questions of environmental management and environmental auditing are now also becoming interesting for the non-industrial sector in Germany. Unresolved issues concern, for instance, site delimitation, product ecology, and indirect environmental effects. (orig./AKF) [Deutsch] Im Rahmen des EG-Oeko-Audits, das sich in erster Linie an gewerbliche Unternehmen richtet, koennen die Mitgliedslaender im Rahmen nationaler Regelungen Handels- und Dienstleistungsunternehmen sowie oeffentliche Einrichtungen in das Gemeinschaftssystem einbeziehen. Mit der im Februar 1998 in Kraft getretenen Erweiterungsverordnung zum Umweltauditgesetz werden in Deutschland jetzt auch fuer nichtgewerbliche Bereiche Fragen des Umweltmanagements und des Oeko-Audits interessant. Eine Reihe von Fragen ergibt sich, beispielsweise nach der Standortabgrenzung, nach der Produktoekologie und nach den indirekten Umweltauswirkungen. (orig./AKF)

Batch and column studies of adsorption of Li, Ni and Br by a reference sand for contaminant transport experiments

International Nuclear Information System (INIS)

Seigel, M.D.; Ward, D.B.; Bryan, C.R.

1995-09-01

A processed quartz sand (Wedron 510), mined from the St. Peter sandstone, has been characterized by a variety of chemical and physical methods for use as a reference porous media in transport model validation experiments. Wedron 510 sand was used in an intermediate-scale experiment involving migration of Ni, Li and Br through a 6-m high x 3-m diameter caisson. Ni and Li adsorption/desorption, and Li/Ni site-competition experiments yielded information on the importance of the trace mineral phases to adsorption of Li and Ni by the sand. The presence of an iron hydroxide coating similar to goethite on the sand grains is suggested by visual observation and leaching experiments. Kaolinite was identified by SEM and XRD as a significant trace mineral phase in the sand and occurs as small particles coating the sand grains. Quartz, the predominant constituent of the sand by weight, does not appear to contribute significantly to the adsorption properties of the sand. Qualitatively, the adsorption properties of the sand can be adequately modeled as a two-mineral system (goethite and kaolinite). The studies described in this report should provide a basis for understanding transport of Ni, Li and Br through porous media similar to the reference sand. Techniques were developed for obtaining parameter values for surface complexation and kinetic adsorption models for the sand and its mineral components. These constants can be used directly in coupled hydrogeochemical transport codes. The techniques should be useful for characterization of other natural materials and elements in high-level nuclear waste in support of coupled hydrogeochemical transport calculations for Yucca Mountain

Spatial and temporal corroboration of a fire-scar-based fire history in a frequently burned ponderosa pine forest.

Science.gov (United States)

Farris, Calvin A; Baisan, Christopher H; Falk, Donald A; Yool, Stephen R; Swetnam, Thomas W

2010-09-01

Fire scars are used widely to reconstruct historical fire regime parameters in forests around the world. Because fire scars provide incomplete records of past fire occurrence at discrete points in space, inferences must be made to reconstruct fire frequency and extent across landscapes using spatial networks of fire-scar samples. Assessing the relative accuracy of fire-scar fire history reconstructions has been hampered due to a lack of empirical comparisons with independent fire history data sources. We carried out such a comparison in a 2780-ha ponderosa pine forest on Mica Mountain in southern Arizona (USA) for the time period 1937-2000. Using documentary records of fire perimeter maps and ignition locations, we compared reconstructions of key spatial and temporal fire regime parameters developed from documentary fire maps and independently collected fire-scar data (n = 60 plots). We found that fire-scar data provided spatially representative and complete inventories of all major fire years (> 100 ha) in the study area but failed to detect most small fires. There was a strong linear relationship between the percentage of samples recording fire scars in a given year (i.e., fire-scar synchrony) and total area burned for that year (y = 0.0003x + 0.0087, r2 = 0.96). There was also strong spatial coherence between cumulative fire frequency maps interpolated from fire-scar data and ground-mapped fire perimeters. Widely reported fire frequency summary statistics varied little between fire history data sets: fire-scar natural fire rotations (NFR) differed by or = 25% of study area burned) were identical between data sets (25.5 yr); fire-scar MFIs for all fire years differed by 1.2 yr from documentary records. The known seasonal timing of past fires based on documentary records was furthermore reconstructed accurately by observing intra-annual ring position of fire scars and using knowledge of tree-ring growth phenology in the Southwest. Our results demonstrate clearly

Gradiently Polymerized Solid Electrolyte Meets with Micro/Nano-Structured Cathode Array.

Science.gov (United States)

Dong, Wei; Zeng, Xian-Xiang; Zhang, Xu-Dong; Li, Jin-Yi; Shi, Ji-Lei; Xiao, Yao; Shi, Yang; Wen, Rui; Yin, Ya-Xia; Wang, Tai-Shan; Wang, Chun-Ru; Guo, Yu-Guo

2018-05-02

The poor contact between the solid-state electrolyte and cathode materials leads to high interfacial resistance, severely limiting the rate capability of solid Li metal batteries. Herein, an integrative battery design is introduced with a gradiently polymerized solid electrolyte (GPSE), a micro-channel current collector array and nano-sized cathode particles. In-situ formed GPSE encapsulates cathode nanoparticles in the micro-channel with ductile inclusions to lower interfacial impedance, and the stiff surface layer of GPSE toward anode suppresses Li dendrites growth. Li metal batteries based on GPSE and Li-free hydrogenated V2O5 (V2O5-H) cathode exhibit an outstanding high-rate response of up to 5 C (the capacity ratio of 5 C / 1 C is 90.3%) and an ultralow capacity fade rate of 0.07% per cycle over 300 cycles. Other Li-containing cathodes as LiFePO4 and LiNi0.5Mn0.3Co0.2O2 can also operate effectively at 5 C and 2 C rate, respectively. Such an ingenious design may provide new insights into other solid metal batteries through interfacial engineering manipulation at micro and nano level.

Recent advances on Fe- and Mn-based cathode materials for lithium and sodium ion batteries

Science.gov (United States)

Zhu, Xiaobo; Lin, Tongen; Manning, Eric; Zhang, Yuancheng; Yu, Mengmeng; Zuo, Bin; Wang, Lianzhou

2018-06-01

The ever-growing market of electrochemical energy storage impels the advances on cost-effective and environmentally friendly battery chemistries. Lithium-ion batteries (LIBs) are currently the most critical energy storage devices for a variety of applications, while sodium-ion batteries (SIBs) are expected to complement LIBs in large-scale applications. In respect to their constituent components, the cathode part is the most significant sector regarding weight fraction and cost. Therefore, the development of cathode materials based on Earth's abundant elements (Fe and Mn) largely determines the prospects of the batteries. Herein, we offer a comprehensive review of the up-to-date advances on Fe- and Mn-based cathode materials for LIBs and SIBs, highlighting some promising candidates, such as Li- and Mn-rich layered oxides, LiNi0.5Mn1.5O4, LiFe1-xMnxPO4, NaxFeyMn1-yO2, Na4MnFe2(PO4)(P2O7), and Prussian blue analogs. Also, challenges and prospects are discussed to direct the possible development of cost-effective and high-performance cathode materials for future rechargeable batteries.

Mechanismen der intrinsischen Cisplatinhypersensitivität bei der testikulären Keimzelltumor-Linie NTERA-2D1

OpenAIRE

Alber, Christiane

2011-01-01

Mit Einführung von Cisplatin gelang ein Durchbruch in der Therapie testikulärer Keimzelltumore, deren Heilungsrate auf über 80% gesteigert werden konnte. Die Ursache der Hypersensitivität von Hodenkarzinomen gegenüber Cisplatin ist bis heute nicht abschließend geklärt, für die Medizin jedoch von hohem Interesse, da hieraus möglicherweise neue Ansätze für die Therapie anderer Tumorentitäten gewonnen werden könnten. In der vorliegenden Arbeit konnte die hohe Sensitivität der testikulären Keimze...