The Coulomb dissociation of 8B and the 8B solar neutrino flux
International Nuclear Information System (INIS)
Gai, M.
1994-01-01
The Coulomb Dissociation of 8 B was measured using 46.5 MeV/u 8 B radioactive beams from the RIKEN-RIPS Radioactive Beam Facility, in an attempt to measure the 7 Be(p,γ) 8 B reaction at low energy, of relevance to estimating the 8 B solar neutrino flux. The experimental setup is discussed and the results are consistent with the lower value of S 17 measured by Filippone et al and Vaughn et al
7Be(p, γ)8B and the high-energy solar neutrino flux
International Nuclear Information System (INIS)
Csoto, A.
1997-01-01
Despite thirty years of extensive experimental and theoretical work, the predicted solar neutrino flux is still in sharp disagreement with measurements. The solar neutrino measurements strongly suggest that the problem cannot be solved within the standard electroweak and astrophysical theories. Thus, the solar neutrino problem constitutes the strongest evidence for physics beyond the Standard Model. Whatever the solution of the solar neutrino problem turns out to be, it is of paramount importance that the input parameters of the underlying electroweak and solar theories rest upon solid ground. The most uncertain nuclear input parameter in standard solar models is the low-energy 7 Be(p, γ) 8 B radiative capture cross section. This reaction produces 8 B in the Sun, whose β + decay is the main source of the high-energy solar neutrinos. Here, the importance of the 7 Be(p, γ) 8 B reaction in predicting the high energy solar neutrino flux is discussed. The author presents a microscopic eight-body model and a potential model for the calculation of the 7 Be(p, γ) 8 B cross section
DETECTING GRAVITY MODES IN THE SOLAR {sup 8} B NEUTRINO FLUX
Energy Technology Data Exchange (ETDEWEB)
Lopes, Ilídio [Centro Multidisciplinar de Astrofísica, Instituto Superior Técnico, Universidade de Lisboa, Av. Rovisco Pais, 1049-001 Lisboa (Portugal); Turck-Chièze, Sylvaine, E-mail: ilidio.lopes@ist.utl.pt, E-mail: ilopes@uevora.pt, E-mail: sylvaine.turck-chieze@cea.fr [CEA/IRFU/Service d' Astrophysique, CE Saclay, F-91191 Gif sur Yvette (France)
2014-09-10
The detection of gravity modes produced in the solar radiative zone has been a challenge in modern astrophysics for more than 30 yr and their amplitude in the core is not yet determined. In this Letter, we develop a new strategy to look for standing gravity modes through solar neutrino fluxes. We note that due to a resonance effect, the gravity modes of low degree and low order have the largest impact on the {sup 8} B neutrino flux. The strongest effect is expected to occur for the dipole mode with radial order 2, corresponding to periods of about 1.5 hr. These standing gravity waves produce temperature fluctuations that are amplified by a factor of 170 in the boron neutrino flux for the corresponding period, in consonance with the gravity modes. From current neutrino observations, we determine that the maximum temperature variation due to the gravity modes in the Sun's core is smaller than 5.8 × 10{sup –4}. This study clearly shows that due to their high sensitivity to the temperature, the {sup 8} B neutrino flux time series is an excellent tool to determine the properties of gravity modes in the solar core. Moreover, if gravity mode footprints are discovered in the {sup 8} B neutrino flux, this opens a new line of research to probe the physics of the solar core as non-standing gravity waves of higher periods cannot be directly detected by helioseismology but could leave their signature on boron neutrino or on other neutrino fluxes.
Measurement of 7Be and 8B solar neutrinos with Borexino
International Nuclear Information System (INIS)
Zavatarelli, S.; Bellini, G.; Bonetti, S.; Buizza-Avanzini, M.; Caccianiga, B.
2009-01-01
Borexino is a real-time liquid-scintillator detector for low-energy neutrino spectroscopy located at the Gran Sasso National Laboratories (Italy). Thanks to the unprecedented radio purity of the target mass it is providing the first direct and simultaneous measurements of the solar neutrino survival probability in both vacuum-dominated (7 B e ν) and matter-enhanced regions (8 B ν) by a single experiment. The measured interaction rates for both 7 B e and 8 B solar neutrinos are in fair agreement with the SSM predictions in case of the Lma-Msw oscillation solution and a further confirmation of the Lma scenario is provided by the absence of a day-night asymmetry in the 7 B e signal. These experimental results allow to improve the upper limit on the neutrino effective magnetic moment. Calibration campaigns aiming to reduce the systematical errors on fiducial volume definition and detector energy response are presently in progress.
The photodissociation of 8B and the solar neutrino problem
International Nuclear Information System (INIS)
Bertulani, C.A.
1995-01-01
The extraction of the photodissociation cross sections of 8 B from Coulomb dissociation experiments is investigated. A careful study is done on the contributions of the E1, E2 and M1 multipolarities to the breakup. A comparison with the data of a recent experiment is performed. It is shown that the extraction of the radiative capture cross sections 7 Be(p, γ) 8 B which are relevant for the solar neutrino problem is not affected appreciably by Coulomb reacceleration. A non-perturbative model is used for the purpose. Emphasis is put on the perspectives for future experiments which are planned at the University of Notre Dame, RIKEN (Japan), and GSI (Germany). An analysis of the total yields of ''photon-point'' processes in inelastic electron scattering is also done. (orig.)
Solar Spots - Activities to Introduce Solar Energy into the K-8 Curricula.
Longe, Karen M.; McClelland, Michael J.
Following an introduction to solar technology which reviews solar heating and cooling, passive solar systems (direct gain systems, thermal storage walls, sun spaces, roof ponds, and convection loops), active solar systems, solar electricity (photovoltaic and solar thermal conversion systems), wind energy, and biomass, activities to introduce solar…
Constraining the 7Be(p,γ)8B S-factor with the new precise 7Be solar neutrino flux from Borexino
Takács, M. P.; Bemmerer, D.; Junghans, A. R.; Zuber, K.
2018-02-01
Among the solar fusion reactions, the rate of the 7Be(p , γ)8B reaction is one of the most difficult to determine rates. In a number of previous experiments, its astrophysical S-factor has been measured at E = 0.1- 2.5 MeV centre-of-mass energy. However, no experimental data is available below 0.1 MeV. Thus, an extrapolation to solar energies is necessary, resulting in significant uncertainty for the extrapolated S-factor. On the other hand, the measured solar neutrino fluxes are now very precise. Therefore, the problem of the S-factor determination is turned around here: Using the measured 7Be and 8B neutrino fluxes and the Standard Solar Model, the 7Be(p , γ)8B astrophysical S-factor is determined at the solar Gamow peak. In addition, the 3He(α , γ)7Be S-factor is redetermined with a similar method.
International Nuclear Information System (INIS)
Igamov, S.B.; Yarmukhamedov, R.
2007-01-01
Full text: The 7 Be(p,γ) 8 B reaction rate given by in terms of the zero-energy astrophysical S-factor S(0) is one of the main input data in the solar neutrino problem because the high energy neutrinos are produced via the decay 8 B→ 7 Be+e + + n e . This quantity is determined by both extrapolating the measured absolute cross sections σexp (E) (or equivalently its experimental S-factors S exp (E) ) to solar energies (≅ 25 keV) and the theoretical predictions. Despite the steady and impressive progress in our understanding of this reaction have been made in last years in measurements S exp (E) at extremely low energies and the theoretical predictions S(E) at solar energies (E≤25 keV), ambiguities (up to about 35%) associated with prediction for S(0) however still exist, and it may considerably influence the predictions of the standard solar model. In this work the modified two - body potential approach is applied for a new analysis of the highly precise experimental astrophysical S-factors for the direct capture 7 Be(p, γ) 8 B reaction at E≤400 keV and 1000≤E≤1200 keV to obtain 'indirectly measured' values both of the asymptotic normalization coefficient (ANC) for the p+ 7 Be→ 8 B and of S(E) at E≤115 keV, including E=0. In this approach S(E) is expressed in the terms of ANC C Aα;lj 2 but not in the terms of the usual spectroscopic factor Z Aα;lj , which is related to the ANC C Aα;l. j as Z aα;lj =C Aα;lj 2 /b lj 2 , where b lj is the single-particle ANC for the wave function of the bound 8 B( 7 Be+p) state calculated within the shell model using the phenomenological Woods-Saxon potential with the geometric parameters (a radius r o and a diffuseness a). The approach allows one to remove the model dependence of the calculated direct on S(E) on the geometric parameters r o and a both for the two-body bound ( 7 Be+p) state and the p 7 Be- scattering state in minimum. The analysis of the experimental S exp (E) is performed by verifying values of
A comment on the 7Be(p,γ)8B cross section and the solar neutrino problem
International Nuclear Information System (INIS)
Barker, F.C.; Spear, R.H.
1986-02-01
Evidence is presented which indicates that the accepted value for the cross section of the 7 Be(p,γ) 8 B reaction at stellar energies is probably too large. It is suggested that the accepted value of the 7 Li(d,p) 8 Li cross section, which has been used for normalization purposes, is too large; that the accepted value for the ratio of the 7 Be(p,γ) 8 B and 7 Li(d,p) 8 Li cross sections is too large; and that the energy dependence used to extrapolate to stellar energies from the higher energies at which measurements have been made is inaccurate. The consequent reduction of the 7 Be(p,γ) 8 B cross section by about 30% would not be sufficient to resolve the solar neutrino problem but would significantly lessen the discrepancy between observation and calculation
Low Energy 8 B Solar Neutrinos with the Wideband Intelligent Trigger at Super-Kamiokande
Elnimr, Muhammad; Super-Kamiokande Collaboration
2017-09-01
The water Cherenkov experiment Super-Kamiokande (SK) has accumulated a sample of ˜ 90k solar neutrino data in the past two decades. Currently, the detector measures recoil electrons from solar 8 B neutrino-electron scattering above a kinetic energy of ˜ 3.5 MeV, limited by the capacity of the software trigger, although electrons as low as 2.5 MeV can be reconstructed. The next frontier for the low energy program at Super-K is the current operation of the Wideband Intelligent Trigger (WIT) to push the trigger threshold to the event reconstruction limit of 2.5 MeV. This opens up the possibility to explore the lower energy edge of the Mikheyev-Smirnov-Wolfenstein (MSW) effect in the sun. In this work we will present the prelimiary analysis of the accumlated WIT data taken so far as well as future prospects.
Beyond Solar-B: MTRAP, the Magnetic TRAnsition Region Probe
Davis, J. M.; Moore, R. L.; Hathaway, D. H.; Science Definition CommitteeHigh-Resolution Solar Magnetography Beyond Solar-B Team
2003-05-01
The next generation of solar missions will reveal and measure fine-scale solar magnetic fields and their effects in the solar atmosphere at heights, small scales, sensitivities, and fields of view well beyond the reach of Solar-B. The necessity for, and potential of, such observations for understanding solar magnetic fields, their generation in and below the photosphere, and their control of the solar atmosphere and heliosphere, were the focus of a science definition workshop, "High-Resolution Solar Magnetography from Space: Beyond Solar-B," held in Huntsville Alabama in April 2001. Forty internationally prominent scientists active in solar research involving fine-scale solar magnetism participated in this Workshop and reached consensus that the key science objective to be pursued beyond Solar-B is a physical understanding of the fine-scale magnetic structure and activity in the magnetic transition region, defined as the region between the photosphere and corona where neither the plasma nor the magnetic field strongly dominates the other. The observational objective requires high cadence (x 16K pixels) with high QE at 150 nm, and extendable spacecraft structures. The Science Organizing Committee of the Beyond Solar-B Workshop recommends that: 1. Science and Technology Definition Teams should be established in FY04 to finalize the science requirements and to define technology development efforts needed to ensure the practicality of MTRAP's observational goals. 2. The necessary technology development funding should be included in Code S budgets for FY06 and beyond to prepare MTRAP for a new start no later than the nominal end of the Solar-B mission, around 2010.
Energy Technology Data Exchange (ETDEWEB)
Aharmim, B.; Ahmad, Q.R.; Ahmed, S.N.; Allen, R.C.; Andersen,T.C.; Anglin, J.D.; Buehler, G.; Barton, J.C.; Beier, E.W.; Bercovitch,M.; Bergevin, M.; Bigu, J.; Biller, S.D.; Black, R.A.; Blevis, I.; Boardman, R.J.; Boger, J.; Bonvin, E.; Boulay, M.G.; Bowler, M.G.; Bowles, T.J.; Brice, S.J.; Browne, M.C.; Bullard, T.V.; Burritt, T.H.; Cameron, J.; Chan, Y.D.; Chen, H.H.; Chen, M.; Chen, X.; Cleveland, B.T.; Cowan, J.H.M.; Cowen, D.F.; Cox, G.A.; Currat, C.A.; Dai, X.; Dalnoki-Veress, F.; Davidson, W.F.; Deng, H.; DiMarco, M.; Doe, P.J.; Doucas, G.; Dragowsky, M.R.; Duba, C.A.; Duncan, F.A.; Dunford, M.; Dunmore, J.A.; Earle, E.D.; Elliott, S.R.; Evans, H.C.; Ewan, G.T.; Farine, J.; Fergani, H.; Ferraris, A.P.; Fleurot, F.; Ford, R.J.; Formaggio, J.A.; Fowler, M.M.; Frame, K.; Frank, E.D.; Frati, W.; Gagnon,N.; Germani, J.V.; Gil, S.; Goldschmidt, A.; Goon, J.T.M.; Graham, K.; Grant, D.R.; Guillian, E.; Hahn, R.L.; Hallin, A.L.; Hallman, E.D.; Hamer, A.S.; Hamian, A.A.; Handler, W.B.; Haq, R.U.; Hargrove, C.K.; Harvey, P.J.; Hazama, R.; Heeger, K.M.; Heintzelman, W.J.; Heise, J.; Helmer, R.L.; Henning, R.; Hepburn, J.D.; Heron, H.; Hewett, J.; Hime,A.; Howard, C.; Howe, M.A.; Huang, M.; Hykawy, J.G.; Isaac, M.C.P.; Jagam, P.; Jamieson, B.; Jelley, N.A.; Jillings, C.; Jonkmans, G.; Kazkaz, K.; Keener, P.T.; Kirch, K.; Klein, J.R.; Knox, A.B.; Komar,R.J.; Kormos, L.L.; Kos, M.; Kouzes, R.; Krueger, A.; Kraus, C.; Krauss,C.B.; Kutter, T.; Kyba, C.C.M.; Labranche, H.; Lange, R.; Law, J.; Lawson, I.T.; Lay, M.; Lee, H.W.; Lesko, K.T.; Leslie, J.R.; Levine, I.; Loach, J.C.; Locke, W.; Luoma, S.; Lyon, J.; MacLellan, R.; Majerus, S.; Mak, H.B.; Maneira, J.; Marino, A.D.; Martin, R.; McCauley, N.; McDonald,A.B.; McDonald, D.S.; McFarlane, K.; McGee, S.; McGregor, G.; MeijerDrees, R.; Mes, H.; Mifflin, C.; Miknaitis, K.K.S.; Miller, M.L.; Milton,G.; Moffat, B.A.; Monreal, B.; Moorhead, M.; Morrissette, B.; Nally,C.W.; Neubauer, M.S.; et al.
2007-02-01
This article provides the complete description of resultsfrom the Phase I data set of the Sudbury Neutrino Observatory (SNO). ThePhase I data set is based on a 0.65 kt-year exposure of heavy water tothe solar 8B neutrino flux. Included here are details of the SNO physicsand detector model, evaluations of systematic uncertainties, andestimates of backgrounds. Also discussed are SNO's approach tostatistical extraction of the signals from the three neutrino reactions(charged current, neutral current, and elastic scattering) and theresults of a search for a day-night asymmetry in the ?e flux. Under theassumption that the 8B spectrum is undistorted, the measurements fromthis phase yield a solar ?e flux of ?(?e) =1.76+0.05?0.05(stat.)+0.09?0.09 (syst.) x 106 cm?2 s?1, and a non-?ecomponent ?(? mu) = 3.41+0.45?0.45(stat.)+0.48?0.45 (syst.) x 106 cm?2s?1. The sum of these components provides a total flux in excellentagreement with the predictions of Standard Solar Models. The day-nightasymmetry in the ?e flux is found to be Ae = 7.0 +- 4.9 (stat.)+1.3?1.2percent (sys.), when the asymmetry in the total flux is constrained to bezero.
International Nuclear Information System (INIS)
Hammache, Fairouz
1999-01-01
The 8 B produced inside the sun through the reaction 7 Be(p,γ) 8 B is the main, and even unique, source of high energy neutrinos detected in most solar neutrino detection experiments, except with Gallex and Sage. These experiments have all measured a neutrinos flux lower than the one predicted by solar models. Several explanations have been proposed to explain this deficit, but all require a precise knowledge of the efficient cross-section of the reaction 7 Be(p,γ) 8 B, because the neutrinos flux of 8 B is directly proportional to this reaction. The direct measurement of this cross section for the solar energy is impossible because of its low value (about 1 femto-barn). In order to get round this problem, the cross sections are measured at higher energy and extrapolated to the solar energy using a theoretical energy dependence. The 6 previous experimental determinations of the efficient cross section were shared in two distinct groups with differences of about 30% which leads to an uncertainty of the same order on the high energy neutrinos flux. The re-measurement of the cross section of this reaction with a better precision is thus of prime importance. A direct measurement of the cross section in the energy range comprised between 0.35 and 1.4 MeV (cm) has been performed first. These experiments have permitted the precise measurement of each parameter involved in the determination of the cross section. Then, measurements of the cross section have been carried out with the PAPAP accelerator at 185.8, 134.7 and 111.7 keV, the lowest mass center energy never reached before. The results are in excellent agreement with those obtained at higher energies. The value obtained by extrapolation of these data for the astrophysical factor S 17 (0) is 19.21.3 EV-B, which leads to a significant reduction of the uncertainty on the high energy neutrinos flux of 8 B. (J.S.)
Climatic forcing before, during, and after the 8.2 Kyr B.P. global ...
Indian Academy of Sciences (India)
This paper attempts at full characterization of the unique global 8.2 Kyr B.P. cooling event. Signifi- ... of its global character and magnitude and occur- rence in the ... in the 1 A.U. interplanetary space, and is inversely correlated with solar activity. It is not influenced by any changes in the geomagnetic field strength or climate.
Sturrock, Peter A.
1993-01-01
The aim of the research activity was to increase our understanding of solar activity through data analysis, theoretical analysis, and computer modeling. Because the research subjects were diverse and many researchers were supported by this grant, a select few key areas of research are described in detail. Areas of research include: (1) energy storage and force-free magnetic field; (2) energy release and particle acceleration; (3) radiation by nonthermal electrons; (4) coronal loops; (5) flare classification; (6) longitude distributions of flares; (7) periodicities detected in the solar activity; (8) coronal heating and related problems; and (9) plasma processes.
Liang, Ru-Ze
2017-07-14
Solution-processable small molecule (SM) donors are promising alternatives to their polymer counterparts in bulk-heterojunction (BHJ) solar cells. While SM donors with favorable spectral absorption, self-assembly patterns, optimum thin-film morphologies, and high carrier mobilities in optimized donor–acceptor blends are required to further BHJ device efficiencies, material structure governs each one of those attributes. As a result, the rational design of SM donors with gradually improved BHJ solar cell efficiencies must concurrently address: (i) bandgap tuning and optimization of spectral absorption (inherent to the SM main chain) and (ii) pendant-group substitution promoting structural order and mediating morphological effects. In this paper, the rational pendant-group substitution in benzo[1,2-b:4,5-b′]dithiophene–6,7-difluoroquinoxaline SMs is shown to be an effective approach to narrowing the optical gap (Eopt) of the SM donors (SM1 and SM2), without altering their propensity to order and form favorable thin-film BHJ morphologies with PC71BM. Systematic device examinations show that power conversion efficiencies >8% and open-circuit voltages (VOC) nearing 1 V can be achieved with the narrow-gap SM donor analog (SM2, Eopt = 1.6 eV) and that charge transport in optimized BHJ solar cells proceeds with minimal, nearly trap-free recombination. Detailed device simulations, light intensity dependence, and transient photocurrent analyses emphasize how carrier recombination impacts BHJ device performance upon optimization of active layer thickness and morphology.
Archiving, Distribution and Analysis of Solar-B Data
Shimojo, M.
2007-10-01
The Solar-B Mission Operation and Data Analysis (MODA) working group has been discussing the data analysis system for Solar-B data since 2001. In the paper, based on the Solar-B MODA document and the recent work in Japan, we introduce the dataflow from Solar-B to scientists, the data format and data-level of Solar-B data, and the data searching/providing system.
Directory of Open Access Journals (Sweden)
Refsnes M
2014-12-01
Full Text Available Magne Refsnes, Tonje Skuland, Marit Låg, Per E Schwarze, Johan Øvrevik Department of Air Pollution and Noise, Division of Environmental Medicine, Norwegian Institute of Public Health, Oslo, Norway Abstract: Different toxic agents have a varying potential to induce the production of the proinflammatory chemokine, CXCL8 (interleukin [IL]-8, in lung cells. A critical question is which mechanisms determine the magnitude and persistence of the CXCL8 responses to different stimuli. To approach this, we compared the potential of the phorbol ester, 12-O-tetradecanoylphorbol-13-acetate (TPA, and sodium fluoride (NaF to induce CXCL8 responses in A549 cells, with emphasis on the importance of nuclear factor kappa B (NF-κB- and mitogen-activated protein kinase (MAPK signaling. Notably, TPA induced a greater release of CXCL8 than did NaF. Furthermore, TPA induced a strong, rapid, but transient upregulation of CXCL8 messenger (mRNA, whereas NaF induced a weaker, more delayed, but persistent upregulation. With respect to signaling, TPA led to an early, strong, and relatively transient extracellular signal-regulated kinase (ERK1/2 phosphorylation, and a less marked and even more transient phosphorylation of c-jun-N-terminal kinases (JNK1/2 and p38. In contrast, NaF elicited a lower, but relatively sustained increase in phosphorylation of ERK1/2, and a marked phosphorylation of p38 and JNK1/2, with the JNK1/2 response as most transient. Only ERK1/2 inhibition affected the TPA response, whereas inhibition of all the three MAPK cascades reduced NaF-induced CXCL8 release. TPA also induced an early, marked phosphorylation/translocation of p65 (NF-κB, whereas NaF induced slower, less pronounced effects on p65. The CXCL8 responses by TPA and NaF were reduced by p65-siRNA. In conclusion, all MAPK cascades were involved in NaF-induced CXCL8 release, whereas only ERK1/2 activation was involved in response to TPA. Furthermore, NF-κB activation appeared to be
Valacchi, Giuseppe; Pagnin, Elisa; Phung, Anh; Nardini, Mirella; Schock, Bettina C; Cross, Carroll E; van der Vliet, Albert
2005-01-01
Lipid oxidation and environmental pollutants are major sources of alpha,beta-unsaturated aldehydes such as acrolein and 4-hydroxynonenal. Acrolein (2-propenal), a major product of organic combustion such as tobacco smoke, represents the most reactive alpha,beta-unsaturated aldehyde, with high reactivity toward nucleophilic targets such as sulfhydryl groups. To investigate how acrolein affects respiratory tract cell activation, we exposed either primary (NHBE) or immortalized human bronchial epithelial cells (HBE1) to 0-25 microM acrolein, and determined effects on basal and tumor necrosis factor-alpha (TNFalpha)-induced production of the chemokine interleukin (IL)-8. Cell exposure to acrolein dose-dependently suppressed IL-8 mRNA levels in HBE1 cells (26, 40, and 79% at 5, 10, and 25 microM acrolein concentrations, respectively) and resulted in corresponding decreases in IL-8 production. Studies of nuclear factor-kappaB (NFkappaB) activation, an essential event in IL-8 production, showed decreased TNFalpha-induced NFkappaB activation by acrolein, illustrated by inhibition of nuclear translocation of NFkappaB and reduced IkappaBalpha degradation. Immunochemical analysis of IkappaB kinase (IKK), a redox-sensitive regulator of NFkappaB activation, indicated direct modification of the IKK beta-subunit by acrolein, suggesting that acrolein may act directly on IKK. In summary, our results demonstrate that acrolein can suppress inflammatory processes in the airways by inhibiting epithelial IL-8 production through direct or indirect inhibitory effects on NFkappaB activation.
2010-01-01
... of handicap in any program or activity receiving Federal financial assistance. The purpose of this... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Purpose. 8b.1 Section 8b.1 Commerce... HANDICAPPED IN FEDERALLY ASSISTED PROGRAMS OPERATED BY THE DEPARTMENT OF COMMERCE General Provisions § 8b.1...
International Nuclear Information System (INIS)
Germ, M.
2005-01-01
The effects of ambient and filtered solar UV-B radiation and of selenium treatment on respiratory potential measured by electron transport system (ETS) activity in pumpkins, Cucurbita pepo L. were studied. Measurements were conducted three times in the growth period. Solar UV-B radiation decreased ETS activity in plants, regardless selenium treatment. The results suggested that the solar UV-B radiation impaired flow of electrons in the respiratory chain. Selenium decreased ETS activity in plants exposed to solar UV-B radiation in the end of the vegetation period
Solar irridiance variations and solar activity
International Nuclear Information System (INIS)
Willson, R.C.
1982-01-01
A mean value for the 1 AU total solar irradiance of 1368.2 W/m 2 and a downward trend of 0.05% per year were derived from measurements by the Active Cavity Radiometer Irradiance Monitor (ACRIM) experiment on the Solar Maximum Mission during 1980. Distinct temporary solar irradiance decreases associated with solar activity maxima were observed with a series of nine dips from April to October recurring at fairly regular intervals averaging 24 days. The decreases correlate inversely with sunspot area, 2800-MHz flux, and Zurich sunspot number. Dominant periods common to the irradiance and sunspot area power spectra link the irradiance decreases to sunspot flux deficit in solar active regions. Evidence of significant total irradiance modulation by facular flux excess is cited. A persistent radiative cycle of active regions consistent with the ACRIM irradiance results and the morphology of solar active regions was found. The pattern of regularly recurrent active region maxima between April and October suggests an asymmetry in solar activity generation during this period
Prolonged activation of virus-specific CD8+T cells after acute B19 infection.
Directory of Open Access Journals (Sweden)
Adiba Isa
2005-12-01
Full Text Available Human parvovirus B19 (B19 is a ubiquitous and clinically significant pathogen, causing erythema infectiosum, arthropathy, transient aplastic crisis, and intrauterine fetal death. The phenotype of CD8+ T cells in acute B19 infection has not been studied previously.The number and phenotype of B19-specific CD8+ T cell responses during and after acute adult infection was studied using HLA-peptide multimeric complexes. Surprisingly, these responses increased in magnitude over the first year post-infection despite resolution of clinical symptoms and control of viraemia, with T cell populations specific for individual epitopes comprising up to 4% of CD8+ T cells. B19-specific T cells developed and maintained an activated CD38+ phenotype, with strong expression of perforin and CD57 and downregulation of CD28 and CD27. These cells possessed strong effector function and intact proliferative capacity. Individuals tested many years after infection exhibited lower frequencies of B19-specific cytotoxic T lymphocytes, typically 0.05%-0.5% of CD8+ T cells, which were perforin, CD38, and CCR7 low.This is the first example to our knowledge of an "acute" human viral infection inducing a persistent activated CD8+ T cell response. The likely explanation--analogous to that for cytomegalovirus infection--is that this persistent response is due to low-level antigen exposure. CD8+ T cells may contribute to the long-term control of this significant pathogen and should be considered during vaccine development.
Prolonged activation of virus-specific CD8+T cells after acute B19 infection.
Directory of Open Access Journals (Sweden)
2005-12-01
Full Text Available BACKGROUND: Human parvovirus B19 (B19 is a ubiquitous and clinically significant pathogen, causing erythema infectiosum, arthropathy, transient aplastic crisis, and intrauterine fetal death. The phenotype of CD8+ T cells in acute B19 infection has not been studied previously. METHODS AND FINDINGS: The number and phenotype of B19-specific CD8+ T cell responses during and after acute adult infection was studied using HLA-peptide multimeric complexes. Surprisingly, these responses increased in magnitude over the first year post-infection despite resolution of clinical symptoms and control of viraemia, with T cell populations specific for individual epitopes comprising up to 4% of CD8+ T cells. B19-specific T cells developed and maintained an activated CD38+ phenotype, with strong expression of perforin and CD57 and downregulation of CD28 and CD27. These cells possessed strong effector function and intact proliferative capacity. Individuals tested many years after infection exhibited lower frequencies of B19-specific cytotoxic T lymphocytes, typically 0.05%-0.5% of CD8+ T cells, which were perforin, CD38, and CCR7 low. CONCLUSION: This is the first example to our knowledge of an "acute" human viral infection inducing a persistent activated CD8+ T cell response. The likely explanation--analogous to that for cytomegalovirus infection--is that this persistent response is due to low-level antigen exposure. CD8+ T cells may contribute to the long-term control of this significant pathogen and should be considered during vaccine development.
Evolution of the Sunspot Number and Solar Wind B Time Series
Cliver, Edward W.; Herbst, Konstantin
2018-03-01
The past two decades have witnessed significant changes in our knowledge of long-term solar and solar wind activity. The sunspot number time series (1700-present) developed by Rudolf Wolf during the second half of the 19th century was revised and extended by the group sunspot number series (1610-1995) of Hoyt and Schatten during the 1990s. The group sunspot number is significantly lower than the Wolf series before ˜1885. An effort from 2011-2015 to understand and remove differences between these two series via a series of workshops had the unintended consequence of prompting several alternative constructions of the sunspot number. Thus it has been necessary to expand and extend the sunspot number reconciliation process. On the solar wind side, after a decade of controversy, an ISSI International Team used geomagnetic and sunspot data to obtain a high-confidence time series of the solar wind magnetic field strength (B) from 1750-present that can be compared with two independent long-term (> ˜600 year) series of annual B-values based on cosmogenic nuclides. In this paper, we trace the twists and turns leading to our current understanding of long-term solar and solar wind activity.
Schisandrin B protects against solar irradiation-induced oxidative injury in BJ human fibroblasts.
Chiu, Po Yee; Lam, Philip Y; Yan, Chung Wai; Ko, Kam Ming
2011-06-01
The effects of schisandrin B (Sch B) and its analogs on solar irradiation-induced oxidative injury were examined in BJ human fibroblasts. Sch B and schisandrin C (Sch C) increased cellular reduced glutathione (GSH) level and protected against solar irradiation-induced oxidative injury. The photoprotection was paralleled by decreases in the elastases-type protease activity and matrix-metalloproteinases-1 expression in solar-irradiated fibroblasts. The cytochrome P-450-mediated metabolism of Sch B or Sch C caused ROS production. The results suggest that by virtue of its pro-oxidant action and the subsequent glutathione antioxidant response, Sch B or Sch C may offer the prospect of preventing skin photo-aging. Copyright © 2011 Elsevier B.V. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Hammache, Fairouz
1999-07-01
The {sup 8}B produced inside the sun through the reaction {sup 7}Be(p,{gamma}){sup 8}B is the main, and even unique, source of high energy neutrinos detected in most solar neutrino detection experiments, except with Gallex and Sage. These experiments have all measured a neutrinos flux lower than the one predicted by solar models. Several explanations have been proposed to explain this deficit, but all require a precise knowledge of the efficient cross-section of the reaction {sup 7}Be(p,{gamma}){sup 8}B, because the neutrinos flux of {sup 8}B is directly proportional to this reaction. The direct measurement of this cross section for the solar energy is impossible because of its low value (about 1 femto-barn). In order to get round this problem, the cross sections are measured at higher energy and extrapolated to the solar energy using a theoretical energy dependence. The 6 previous experimental determinations of the efficient cross section were shared in two distinct groups with differences of about 30% which leads to an uncertainty of the same order on the high energy neutrinos flux. The re-measurement of the cross section of this reaction with a better precision is thus of prime importance. A direct measurement of the cross section in the energy range comprised between 0.35 and 1.4 MeV (cm) has been performed first. These experiments have permitted the precise measurement of each parameter involved in the determination of the cross section. Then, measurements of the cross section have been carried out with the PAPAP accelerator at 185.8, 134.7 and 111.7 keV, the lowest mass center energy never reached before. The results are in excellent agreement with those obtained at higher energies. The value obtained by extrapolation of these data for the astrophysical factor S{sub 17}(0) is 19.21.3 EV-B, which leads to a significant reduction of the uncertainty on the high energy neutrinos flux of {sup 8}B. (J.S.)
The Relation Between Magnetic Fields and X-ray Emission for Solar Microflares and Active Regions
Kirichenko, A. S.; Bogachev, S. A.
2017-09-01
We present the result of a comparison between magnetic field parameters and the intensity of X-ray emission for solar microflares with Geosynchronous Operational Environmental Satellites (GOES) classes from A0.02 to B5.1. For our study, we used the monochromatic MgXII Imaging Spectroheliometer (MISH), the Full-disk EUV Telescope (FET), and the Solar PHotometer in X-rays (SphinX) instruments onboard the Complex Orbital Observations Near-Earth of Activity of the Sun-Photon CORONAS- Photon spacecraft because of their high sensitivity in soft X-rays. The peak flare flux (PFF) for solar microflares was found to depend on the strength of the magnetic field and on the total unsigned magnetic flux as a power-law function. In the spectral range 2.8 - 36.6 Å, which shows very little increase related to microflares, the power-law index of the relation between the X-ray flux and magnetic flux for active regions is 1.48 ±0.86, which is close to the value obtained previously by Pevtsov et al. ( Astrophys. J. 598, 1387, 2003) for different types of solar and stellar objects. In the spectral range 1 - 8 Å, the power-law indices for PFF(B) and PFF(Φ) for microflares are 3.87 ±2.16 and 3 ±1.6, respectively. We also make suggestions on the heating mechanisms in active regions and microflares under the assumption of loops with constant pressure and heating using the Rosner-Tucker-Vaiana scaling laws.
Solar Spicules: Prospects for Breakthroughs in Understanding with Solar-B
Sterling, A.
Spicules densely populate the lower solar atmosphere; any image or movie of the chromosphere shows a plethora of them or their "cousins," such as mottles or fibrils. Yet despite several decades of effort we still do not know the mechanism that generates them, or how important their contribution is to the material and energy balance of the overall solar atmosphere. Solar-B will provide exciting new chromospheric observations at high time- and spatial-resolution, along with associated quality magnetic field data, that promise to open doors to revolutionary breakthroughs in spicule research. In this presentation we will review the current observational and theoretical status of spicule studies, and discuss prospects for advances in spicule understanding during the Solar-B era.
Prolonged activation of virus-specific CD8+T cells after acute B19 infection
DEFF Research Database (Denmark)
Isa, Adiba; Kasprowicz, Victoria; Norbeck, Oscar
2005-01-01
BACKGROUND: Human parvovirus B19 (B19) is a ubiquitous and clinically significant pathogen, causing erythema infectiosum, arthropathy, transient aplastic crisis, and intrauterine fetal death. The phenotype of CD8+ T cells in acute B19 infection has not been studied previously. METHODS AND FINDINGS......: The number and phenotype of B19-specific CD8+ T cell responses during and after acute adult infection was studied using HLA-peptide multimeric complexes. Surprisingly, these responses increased in magnitude over the first year post-infection despite resolution of clinical symptoms and control of viraemia......, with T cell populations specific for individual epitopes comprising up to 4% of CD8+ T cells. B19-specific T cells developed and maintained an activated CD38+ phenotype, with strong expression of perforin and CD57 and downregulation of CD28 and CD27. These cells possessed strong effector function...
Active Longitude and Solar Flare Occurrences
Gyenge, N.; Ludmány, A.; Baranyi, T.
2016-02-01
The aim of the present work is to specify the spatio-temporal characteristics of flare activity observed by the Reuven Ramaty High Energy Solar Spectroscopic Imager (RHESSI) and the Geostationary Operational Environmental Satellite (GOES) in connection with the behavior of the longitudinal domain of enhanced sunspot activity known as active longitude (AL). By using our method developed for this purpose, we identified the AL in every Carrington Rotation provided by the Debrecen Photoheliographic Data. The spatial probability of flare occurrence has been estimated depending on the longitudinal distance from AL in the northern and southern hemispheres separately. We have found that more than 60% of the RHESSI and GOES flares is located within +/- 36^\\circ from the AL. Hence, the most flare-productive active regions tend to be located in or close to the active longitudinal belt. This observed feature may allow for the prediction of the geo-effective position of the domain of enhanced flaring probability. Furthermore, we studied the temporal properties of flare occurrence near the AL and several significant fluctuations were found. More precisely, the results of the method are the following fluctuations: 0.8, 1.3, and 1.8 years. These temporal and spatial properties of the solar flare occurrence within the active longitudinal belts could provide us with an enhanced solar flare forecasting opportunity.
Periodic Variation of the North-South Asymmetry of Solar Activity ...
Indian Academy of Sciences (India)
Abstract. We report here a study of various solar activity phenomena occurring in both north and south hemispheres of the Sun during solar cycles 8-23. In the study we have used sunspot data for the period 1832—. 1976, flare index data for the period 1936-1993, Hα flare data 1993-1998 and solar active prominences data ...
Solar Radius at Subterahertz Frequencies and Its Relation to Solar Activity
Menezes, Fabian; Valio, Adriana
2017-12-01
The Sun emits radiation at several wavelengths of the electromagnetic spectrum. In the optical band, the solar radius is 695 700 km, and this defines the photosphere, which is the visible surface of the Sun. However, as the altitude increases, the electromagnetic radiation is produced at other frequencies, causing the solar radius to change as a function of wavelength. These measurements enable a better understanding of the solar atmosphere, and the radius dependence on the solar cycle is a good indicator of the changes that occur in the atmospheric structure. We measure the solar radius at the subterahertz frequencies of 0.212 and 0.405 THz, which is the altitude at which these emissions are primarily generated, and also analyze the radius variation over the 11-year solar activity cycle. For this, we used radio maps of the solar disk for the period between 1999 and 2017, reconstructed from daily scans made by the Solar Submillimeter-wave Telescope (SST), installed at El Leoncito Astronomical Complex (CASLEO) in the Argentinean Andes. Our measurements yield radii of 966.5'' ±2.8'' for 0.2 THz and 966.5'' ±2.7'' for 0.4 THz. This implies a height of 5.0 ±2.0 ×106 m above the photosphere. Furthermore, we also observed a strong anticorrelation between the radius variation and the solar activity at both frequencies.
IEA Task 24 active solar procurement - subtask B: The book of tools
International Nuclear Information System (INIS)
Ellehauge, K.; Oestergaard, I.
2000-01-01
Under the International Energy Agency Solar Heating and Cooling Programme, Task 24 Solar Procurement 5 countries co-operate (the Netherlands, Sweden, Canada, Switzerland and Denmark) on increased sale of solar heating plants i.a. by identifying buyer groups, joint calls for tenders and specification of requirements. The work is divided into 2 subtasks. Subtask A concerns the work connected with identifying buyer groups and starting sales and subtask B concerns the delivery of the necessary background material. Subtask B is managed by Denmark, which has been responsible for collecting and organising background material. This work started in 1998. From the beginning, the idea was to organise the background material in a book called 'The Book of Tools', but during the course of preparation it became obvious that it would be an advantage to place the material on the Internet. An initial version of the material has been finished in the winter 1999/2000 and has been incorporated in IEA's Task 24 homepage on the Internet address: www.ieatask24.org. The Internet home page is up-dated by the Canadian participants in IEA task 24. The target group is partly new potential buyer groups and current buyer groups and their advisors. It is possible to download the material for printing. (au)
Hu, Suwen; Nian, Siyun; Qin, Kuiyou; Xiao, Tong; Li, Lingna; Qi, Xiaolu; Ye, Faqing; Liang, Guang; Hu, Guoxin; He, Jincai; Yu, Yinfei; Song, Bo
2012-01-01
The design and synthesis of two series of 8-(substituted styrol-formamido)phenyl-xanthine derivatives are described. Their in vitro monoamine oxidase B (MAO-B) inhibition were tested and the effect of substituents on the N-7, phenyl and the substituted positions are discussed. It was observed that compound 9b displayed significant MAO-B inhibition activity and selectivity, fluorine substitution plays a key role in the selectivity of MAO-B inhibition, and the styrol-formamido group at position-3' may enhance the activity and selectivity of 8-phenyl-xanthine analogues. These results suggest that such compounds may be utilized for the development of new candidate MAO-B inhibitors for treatment of Parkinson's disease.
SOLAR TRACKER CERDAS DAN MURAH BERBASIS MIKROKONTROLER 8 BIT ATMega8535
Directory of Open Access Journals (Sweden)
I Wayan Sutaya
2016-08-01
Full Text Available prototipe produk solar tracker cerdas berbasis mikrokontroler AVR 8 bit. Solar tracker ini memasukkan filter digital IIR (Infinite Impulse Response pada bagian program. Memprogram filter ini membutuhkan perkalian 32 bit sedangkan prosesor yang tersedia pada mikrokontroler yang dipakai adalah 8 bit. Proses perkalian ini hanya bisa dilakukan pada mikrokontroler 8 bit dengan menggunakan bahasa assembly yang merupakan bahasa level hardware. Solar tracker cerdas yang menggunakan mikrokontroler 8 bit sebagai otak utama pada penelitian ini menjadikan produk ini berbiaya rendah. Pengujian yang dilakukan menunjukkan bahwa solar tracker cerdas dibandingkan dengan solar tracker biasa mempunyai perbedaan konsumsi daya baterai yang sangat signifikan yaitu terjadi penghematan sebesar 85 %. Besar penghematan konsumsi daya ini tentunya bukan sebuah angka konstan melainkan tergantung seberapa besar noise yang dikenakan pada alat solar tracker. Untuk sebuah perlakuan yang sama, maka semakin besar noise semakin besar pula perbedaan penghematan konsumsi daya pada solar tracker yang cerdas. Kata-kata kunci: solar tracker, filter digital, mikrokontroler 8 bit, konsumsi daya Abstract This research had made a prototype of smart solar tracker product based on microcontroller AVR 8 bit. The solar tracker used digital filter IIR (Infinite Impulse Response on its software. Filter programming needs 32 bit multiplication but the processor inside of the microcontroller that used in this research is 8 bit. This multiplication is only can be solved on microcontroller 8 bit by using assembly language in programming. The language is a hardware level language. The smart solar tracker using the microcontroller 8 bit as a main brain in this research made the product had a low cost. The test results show that the comparison in saving of baterai power consumption between the smart solar tracker and the normal one is 85 %. The percentage of the saving indubitably is not a constant
Deciphering solar magnetic activity: on grand minima in solar activity
Energy Technology Data Exchange (ETDEWEB)
McIntosh, Scott W. [High Altitude Observatory, National Center for Atmospheric Research, Boulder, CO (United States); Leamon, Robert J., E-mail: mscott@ucar.edu [Department of Physics, Montana State University, Bozeman, MT (United States)
2015-07-08
The Sun provides the energy necessary to sustain our existence. While the Sun provides for us, it is also capable of taking away. The weather and climatic scales of solar evolution and the Sun-Earth connection are not well- understood. There has been tremendous progress in the century since the discovery of solar magnetism—magnetism that ultimately drives the electromagnetic, particulate, and eruptive forcing of our planetary system. There is contemporary evidence of a decrease in solar magnetism, perhaps even indicators of a significant downward trend, over recent decades. Are we entering a minimum in solar activity that is deeper and longer than a typical solar minimum, a “grand minimum”? How could we tell if we are? What is a grand minimum and how does the Sun recover? These are very pertinent questions for modern civilization. In this paper we present a hypothetical demonstration of entry and exit from grand minimum conditions based on a recent analysis of solar features over the past 20 years and their possible connection to the origins of the 11(&ish) year solar activity cycle.
Deciphering Solar Magnetic Activity: On Grand Minima in Solar Activity
Directory of Open Access Journals (Sweden)
Scott William Mcintosh
2015-07-01
Full Text Available The Sun provides the energy necessary to sustain our existence. While the Sun provides for us, it is also capable of taking away. The weather and climatic scales of solar evolution and the Sun-Earth connection are not well understood. There has been tremendous progress in the century since the discovery of solar magnetism - magnetism that ultimately drives the electromagnetic, particulate and eruptive forcing of our planetary system. There is contemporary evidence of a decrease in solar magnetism, perhaps even indicators of a significant downward trend, over recent decades. Are we entering a minimum in solar activity that is deeper and longer than a typical solar minimum, a grand minimum? How could we tell if we are? What is a grand minimum and how does the Sun recover? These are very pertinent questions for modern civilization. In this paper we present a hypothetical demonstration of entry and exit from grand minimum conditions based on a recent analysis of solar features over the past 20 years and their possible connection to the origins of the 11(-ish year solar activity cycle.
Deciphering Solar Magnetic Activity: On Grand Minima in Solar Activity
Mcintosh, Scott; Leamon, Robert
2015-07-01
The Sun provides the energy necessary to sustain our existence. While the Sun provides for us, it is also capable of taking away. The weather and climatic scales of solar evolution and the Sun-Earth connection are not well understood. There has been tremendous progress in the century since the discovery of solar magnetism - magnetism that ultimately drives the electromagnetic, particulate and eruptive forcing of our planetary system. There is contemporary evidence of a decrease in solar magnetism, perhaps even indicators of a significant downward trend, over recent decades. Are we entering a minimum in solar activity that is deeper and longer than a typical solar minimum, a "grand minimum"? How could we tell if we are? What is a grand minimum and how does the Sun recover? These are very pertinent questions for modern civilization. In this paper we present a hypothetical demonstration of entry and exit from grand minimum conditions based on a recent analysis of solar features over the past 20 years and their possible connection to the origins of the 11(-ish) year solar activity cycle.
Effects of solar UV-B radiation on aquatic ecosystems
Häder, D.-P.
Solar UV degrades dissolved organic carbon photolytically so that they can readily be taken up by bacterioplankton. On the other hand solar UV radiation inhibits bacterioplankton activity. Bacterioplankton productivity is far greater than previously thought and is comparable to phytoplankton primary productivity. According to the "microbial loop hypothesis," bacterioplankton is seen in the center of a food web, having a similar function to phytoplankton and protists. The penetration of UV and PAR into the water column can be measured. Marine waters show large temporal and regional differences in their concentrations of dissolved and particulate absorbing substances. A network of dosimeters (ELDONET) has been installed in Europe ranging from Abisko in Northern Sweden to Gran Canaria. Cyanobacteria are capable of fixing atmospheric nitrogen which is then made available to higher plants. The agricultural potential of cyanobacteria has been recognized as a biological fertilizer for wet soils such as in rice paddies. UV-B is known to impair processes such as growth, survival, pigmentation, motility, as well as the enzymes of nitrogen metabolism and CO 2 fixation. The marine phytoplankton represents the single most important ecosystem on our planet and produces about the same biomass as all terrestrial ecosystems taken together. It is the base of the aquatic food chain and any changes in the size and composition of phytoplankton communities will directly affect food production for humans from marine sources. Another important role of marine phytoplankton is to serve as a sink for atmospheric carbon dioxide. Recent investigations have shown a large sensitivity of most phytoplankton organisms toward solar short-wavelength ultraviolet radiation (UV-B); even at ambient levels of UV-B radiation many organisms seem to be under UV stress. Because of their requirement for solar energy, the phytoplankton dwell in the top layers of the water column. In this near-surface position
Directory of Open Access Journals (Sweden)
Ching-Gong Lin
2009-09-01
Full Text Available In our previous study, 8-hydroxydaidzein (8-OHDe was demonstrated to be a potent and unique suicide substrate of mushroom tyrosinase. In this study, the compound was evaluated for in vitro cellular tyrosinase and melanogenesis inhibitory activities in mouse B16 melanoma cells and for in vivo skin-whitening activity in human volunteers. Tyrosinase activity and melanogenesis in the cell culture incubated with 10 µM of 8-OHDe were decreased to 20.1% and 51.8% of control, respectively, while no obvious cytotoxicity was observed in this concentration. In contrast, a standard tyrosinase inhibitor, kojic acid, showed 69.9% and 71.3% of control in cellular tyrosinase and melanogenesis activity, respectively, at a concentration as high as 100 µM. Hence, 8-OHDe exhibited more than an inhibitory effects on melanin production in B16 cells 10-fold stronger than kojic acid. In addition, when a cream containing 4% 8-OHDe was applied to human skin in an in vivo study, significant increases in the dL*-values were observed after three weeks. Moreover, the increase in the dL*-values after 8-week treatment with 4% 8-OHDe (from -0.57 to 1.94 is stronger than those of 2% 8-OHDe treatment (from 0.26 to 0.94 and 2% ascorbic acid-2-glucoside treatment (from 0.07 to 1.54. From the results of the study, it was concluded that 8-OHDe, the potent suicide substrate of mushroom tyrosinase, has depigmenting activities in both mouse melanoma cells and in human volunteers. Thus, the compound has significant potential for use in cosmetics as a skin-whitening ingredient.
Bello, S. A.; Abdullah, M.; Hamid, N. S. A.; Yoshikawa, A.; Olawepo, A. O.
2017-07-01
The ionospheric thickness (B0) and shape (B1) are bottomside profile parameters introduced by the International Reference Ionosphere (IRI) model. We have validated these parameters with the latest version of the IRI-2012 model and compared them with the solar quiet of geomagnetic H-component (SqH). The B0, B1 and SqH are calculated from the measurements obtained from digisonde DPS-4 sounder and the Magnetic Data Acquisition System (MAGDAS) magnetometer, respectively at Ilorin (geo latitude 8.50°N, geo longitude 4.68°E, and Magnetic dip 4.1°S) an equatorial station in the African sector. The study was for the year 2010, a year of low solar activity (with 27-day averaged solar index, F10.7 = 80 sfu). The results show that B0 for the entire months was higher during the daytime than during the night time. On the other hand, the magnitude of B1during the daytime period is lower than nighttime values and exhibit oscillatory pattern. By comparing the experimental observations of the profile parameters with the IRI-2012 model prediction, we found that B0 was fairly represented by the IRI model options during the nighttime period while discrepancies exist between the model estimates and the experimental values during the morning till midday. A close agreement exists between the observed B1 values and IRI model options. We observed a positive and significant correlation coefficient between B0 and SqH indicating a plausible relationship between these parameters while a weak and negative correlation coefficient between B1 and SqH was observed. We concluded that the difference in the relationship of SqH and the profile parameters B0 and B1 observed can be attributed to their sensitivity to the electric field which is responsible for the E × B drift which in turn modulate the height of the F2.
International Nuclear Information System (INIS)
Mazza, C.A.; Battista, D.; Zima, A.M.; Szwarcberg-Bracchitta, M.; Giordano, C.V.; Acevedo, A.; Scopel, A.L.; Ballare, C.L.
1999-01-01
There is limited information on the impacts of present-day solar ultraviolet-B radiation (UV-B) on biomass and grain yield of field crops and on the mechanisms that confer tolerance to UV-B radiation under field conditions. We investigated the effects of solar UV-B on aspects of the biochemistry, growth and yield of barley crops using replicated field plots and two barley strains, a catalase (CAT)-deficient mutant (RPr 79/4) and its wild-type mother line (Maris Mink). Solar UV-B reduced biomass accumulation and grain yield in both strains. The effects on crop biomass accumulation tended to be more severe in RPr 79/4 (≈ 32% reduction) than in the mother line (≈ 20% reduction). Solar UV-B caused measurable DNA damage in leaf tissue, in spite of inducing a significant increase in UV-absorbing sunscreens in the two lines. Maris Mink responded to solar UV-B with increased CAT and ascorbate peroxidase (APx) activity. No effects of UV-B on total superoxide dismutase (SOD) activity were detected. Compared with the wild type, RPr 79/4 had lower CAT activity, as expected, but higher APx activity. Neither of these activities increased in response to UV-B in RPr 79/4. These results suggest that growth inhibition by solar UV-B involves DNA damage and oxidative stress, and that constitutive and UV-B-induced antioxidant capacity may play an important role in UV-B tolerance. (author)
Dynamics of longitudinal-latitudinal asymmetry of solar activity at various solar cycle phases
International Nuclear Information System (INIS)
Baranov, D.G.; Vernova, E.S.; Grigoryan, M.S.; Tyasto, M.I.
1995-01-01
Solar activity longitudinal asymmetry in 1943-1984 was studied by means of the polar diagram technique. Longitudinal changes of the activity distribution for northern and southern hemispheres were considered separately. Heliolongitudinal asymmetry was compared with the first harmonic of the 27-days cosmic ray intensity variation and with phases of the Quasi-Biennial Oscillation. There is certain correspondence between the dominance of the asymmetry in one of the solar hemispheres and the phase of the Quasi-Biennial Oscillation. Correlation exists between the amplitude of the 27-days galactic cosmic ray variation and the phase of the Quasi-Biennial Oscillation. 8 refs.; 3 figs
El-Borie, M. A.; El-Taher, A. M.; Aly, N. E.; Bishara, A. A.
2018-04-01
The impact of asymmetrical distribution of hemispheric sunspot areas (SSAs) on the interplanetary magnetic field, plasma, and solar parameters from 1967 to 2016 has been studied. The N-S asymmetry of solar-plasma activities based on SSAs has a northern dominance during solar cycles 20 and 24. However, it has a tendency to shift to the southern hemisphere in cycles 21, 22, and 23. The solar cycle 23 showed that the sorted southern SSAs days predominated over the northern days by ˜17%. Through the solar cycles 21-24, the SSAs of the southern hemisphere were more active. In contrast, the northern SSAs predominate over the southern one by 9% throughout solar cycle 20. On the other hand, the average differences of field magnitude for the sorted northern and southern groups during solar cycles 20-24 are statistically insignificant. Clearly, twenty years showed that the solar plasma ion density from the sorted northern group was denser than that of southern group and a highest northern dominant peak occurred in 1971. In contrast, seventeen out of fifty years showed the reverse. In addition, there are fifteen clear asymmetries of solar wind speed (SWS), with SWS (N) > SWS (S), and during the years 1972, 2002, and 2008, the SWS from the sorted northern group was faster than that of southern activity group by 6.16 ± 0.65 km/s, 5.70 ± 0.86 km/s, and 5.76 ± 1.35 km/s, respectively. For the solar cycles 20-24, the grand-averages of P from the sorted solar northern and southern have nearly the same parameter values. The solar plasma was hotter for the sorted northern activity group than the southern ones for 17 years out of 50. Most significant northern prevalent asymmetries were found in 1972 (5.76 ± 0.66 × 103 K) and 1996 (4.7 ± 0.8 × 103 K), while two significant equivalent dominant southern asymmetries (˜3.8 ± 0.3 × 103 K) occurred in 1978 and 1993. The grand averages of sunspot numbers have symmetric activity for the two sorted northern and southern hemispheres
The CVD ZrB2 as a selective solar absorber
Randich, E.; Allred, D. D.
Coatings of ZrB2 and TiB2 for photothermal solar absorber applications were prepared using chemical vapor deposition (CVD) techniques. Oxidation tests suggest a maximum temperature limit for air exposure of 600 K for TiB2 and 800 K for Z4B2. Both materials exhibit innate spectral selectivity with emittance at 375 K ranging from 0.06 to 0.09 and solar absorptance for ZrB2 ranging from 0.67 to 0.77 and solar absorptance for TiB2 ranging from 0.46 to 0.58. ZrB2 has better solar selectivity and more desirable oxidation behavior than TiB2. A 0.071 micrometer antireflection coating of Si3N4 deposited on the ZrB2 coating leads to an increase in absorptance from 0.77 to 0.93, while the emittance remains unchanged.
Directory of Open Access Journals (Sweden)
Masakazu Ito
2014-01-01
Full Text Available Organic thin film solar cells (OTFSCs were fabricated with blended active layers of poly[[4,8-bis[(2-ethylhexyloxy]benzo[1,2-b:4,5-b′]dithiophene-2,6-diyl][3-fluoro-2-[(2-ethylhexylcarbonyl]thieno[3,4-b]thiophenediyl
Magnetohydrodynamic process in solar activity
Directory of Open Access Journals (Sweden)
Jingxiu Wang
2014-01-01
Full Text Available Magnetohydrodynamics is one of the major disciplines in solar physics. Vigorous magnetohydrodynamic process is taking place in the solar convection zone and atmosphere. It controls the generating and structuring of the solar magnetic fields, causes the accumulation of magnetic non-potential energy in the solar atmosphere and triggers the explosive magnetic energy release, manifested as violent solar flares and coronal mass ejections. Nowadays detailed observations in solar astrophysics from space and on the ground urge a great need for the studies of magnetohydrodynamics and plasma physics to achieve better understanding of the mechanism or mechanisms of solar activity. On the other hand, the spectacular solar activity always serves as a great laboratory of magnetohydrodynamics. In this article, we reviewed a few key unresolved problems in solar activity studies and discussed the relevant issues in solar magnetohydrodynamics.
SOLAR TRACKER CERDAS DAN MURAH BERBASIS MIKROKONTROLER 8 BIT ATMega8535
I Wayan Sutaya; Ketut Udy Ariawan
2016-01-01
prototipe produk solar tracker cerdas berbasis mikrokontroler AVR 8 bit. Solar tracker ini memasukkan filter digital IIR (Infinite Impulse Response) pada bagian program. Memprogram filter ini membutuhkan perkalian 32 bit sedangkan prosesor yang tersedia pada mikrokontroler yang dipakai adalah 8 bit. Proses perkalian ini hanya bisa dilakukan pada mikrokontroler 8 bit dengan menggunakan bahasa assembly yang merupakan bahasa level hardware. Solar tracker cerdas yang menggunakan mikrokontroler 8 ...
Monitoring of the solar activity and solar energetic particles
International Nuclear Information System (INIS)
Akioka, Maki; Kubo, Yuki; Nagatsuma, Tsutomu; Ohtaka, Kazuhiro
2009-01-01
Solar activity is the source of various space weather phenomena in geospace and deep space. Solar X-ray radiation in flare, energetic particles, coronal mass ejection (CME) can cause various kind of disturbance near earth space. Therefore, detailed monitoring of the solar activity and its propagation in the interplanetary space is essential task for space weather. For example, solar energetic particle which sometimes affect spacecraft operation and manned space flight, is considered to be produced by solar flares and travelling shockwave caused by flares and CME. The research and development of monitoring technique and system for various solar activity has been an important topic of space weather forecast program in NICT. In this article, we will introduce the real time data acquisitions of STEREO and optical and radio observations of the Sun at Hiraiso Solar Observatory. (author)
Dillon, Francisco M; Chludil, Hugo D; Zavala, Jorge A
2017-09-01
Although it is well known that solar ultraviolet B (UV-B) radiation enhances plant defenses, there is less knowledge about traits that define insect resistance in field-grown soybean. Here we study the effects of solar UV-B radiation on: a) the induction of phenolic compounds and trypsin proteinase inhibitors (TPI) in soybean undamaged leaves or damaged by Anticarsia gemmatalis neonates during six days, and b) the survival and mass gain of A. gemmatalis larvae that fed on soybean foliage. Two soybean cultivars (cv.), Charata and Williams, were grown under plastic with different transmittance to solar UV-B radiation, which generated two treatments: ambient UV-B (UVB+) and reduced UV-B (UVB-) radiation. Solar UV-B radiation decreased survivorship by 30% and mass gain by 45% of larvae that fed on cv. Charata, but no effect was found in those larvae that fed on cv. Williams. TPI activity and malonyl genistin were induced by A. gemmatalis damage in both cultivars, but solar UV-B radiation and damage only synergistically increased the induction of these compounds in cv. Williams. Although TPI activity and genistein derivatives were induced by herbivory, these results did not explain the differences found in survivorship and mass gain of larvae that fed on cv. Charata. However, we found a positive association between lower larval performance and the presence of two quercetin triglycosides and a kaempferol triglycoside in foliage of cv. Charata, which were identified by HPLC-DAD/MS 2 . We conclude that exclusion of solar UV-B radiation reduce resistance to A. gemmatalis, due to a reduction in flavonol concentration in a cultivar that has low levels of genistein derivatives like cv. Charata. Copyright © 2017 Elsevier Ltd. All rights reserved.
The influence of urban area opacity on biologically active UV-B irradiance
Chubarova, Nataly; Rozental', Victor
2013-04-01
The study of UV irradiance changes in urban area is an essential problem due to the significant effect of UV irradiance on human health which can be positive (vitamin D synthesis) and negative (erythema, skin cancer, eye damage). According to the results of several experiments within the Moscow megacity we studied the effects of urban area opacity on the different types of biologically active UV-B irradiance on the base of a specially developed mobile photometric complex snd additional measurements of the urban opacity by Nikon Fisheye Converter FC-E8. We analyzed both the level of erythemally-active irradiance and the UV eye damaging radiation using the broadband UVB-1 YES pyranometer calibrated against ultraviolet spectroradiometer Bentham DTM-300 of the Medical University of Innsbruck (courtesy of Dr. M.Blumthaler). In order to estimate the effects of the urban opacity the measurements were normalized on similar measurements at the Meteorological Observatory of Moscow State University with zero opacity. This ratio is defined as an urban radiative transmittance (URT). Different atmospheric conditions were considered. In cloudy conditions the effect of opacity on URT is much less than that in conditions when the sun disk is open from clouds. We revealed some spectral features in transmittance of biologically active UV-B irradiance which is characterized by higher URT variations in overcast cloudy conditions due to more intensive scattering and smaller direct solar radiation component. In the absence of cloudiness the effect of opacity was studied for open and screening solar disk conditions. We obtained much higher URT in UVB spectral region compared with that for total solar irradiance for screening solar disk conditions with a significant URT dependence on the opacity only in UVB spectral region. No URT dependence was obtained for total solar irradiance in these conditions. Some model calculations were fulfilled to match the experimental results.
Are cold winters in Europe associated with low solar activity?
International Nuclear Information System (INIS)
Lockwood, M; Harrison, R G; Woollings, T; Solanki, S K
2010-01-01
Solar activity during the current sunspot minimum has fallen to levels unknown since the start of the 20th century. The Maunder minimum (about 1650-1700) was a prolonged episode of low solar activity which coincided with more severe winters in the United Kingdom and continental Europe. Motivated by recent relatively cold winters in the UK, we investigate the possible connection with solar activity. We identify regionally anomalous cold winters by detrending the Central England temperature (CET) record using reconstructions of the northern hemisphere mean temperature. We show that cold winter excursions from the hemispheric trend occur more commonly in the UK during low solar activity, consistent with the solar influence on the occurrence of persistent blocking events in the eastern Atlantic. We stress that this is a regional and seasonal effect relating to European winters and not a global effect. Average solar activity has declined rapidly since 1985 and cosmogenic isotopes suggest an 8% chance of a return to Maunder minimum conditions within the next 50 years (Lockwood 2010 Proc. R. Soc. A 466 303-29): the results presented here indicate that, despite hemispheric warming, the UK and Europe could experience more cold winters than during recent decades.
Deciphering Solar Magnetic Activity: Spotting Solar Cycle 25
Energy Technology Data Exchange (ETDEWEB)
McIntosh, Scott W. [High Altitude Observatory, National Center for Atmospheric Research, Boulder, CO (United States); Leamon, Robert J., E-mail: mscott@ucar.edu [Department of Astronomy, University of Maryland, College Park, MD (United States)
2017-06-26
We present observational signatures of solar cycle 25 onset. Those signatures are visibly following a migratory path from high to low latitudes. They had starting points that are asymmetrically offset in each hemisphere at times that are 21–22 years after the corresponding, same polarity, activity bands of solar cycle 23 started their migration. Those bands define the so-called “extended solar cycle.” The four magnetic bands currently present in the system are approaching a mutually cancelling configuration, and solar minimum conditions are imminent. Further, using a tuned analysis of the daily band latitude-time diagnostics, we are able to utilize the longitudinal wave number (m = 1) variation in the data to more clearly reveal the presence of the solar cycle 25 bands. This clarification illustrates that prevalently active longitudes (different in each hemisphere) exist at mid-latitudes presently, lasting many solar rotations, that can be used for detailed study over the next several years with instruments like the Spectrograph on IRIS, the Spectropolarimeter on Hinode, and, when they come online, similar instruments on the Daniel K. Inouye Solar Telescope (DKIST) as we watch those bands evolve following the cancellation of the solar cycle 24 activity bands at the equator late in 2019.
Quasi-biennial modulation of solar neutrino flux: connections with solar activity
Vecchio, A.; Laurenza, M.; D'alessi, L.; Carbone, V.; Storini, M.
2011-12-01
A quasi-biennial periodicity has been recently found (Vecchio et al., 2010) in the solar neutrino flux, as detected at the Homestake experiment, as well as in the flux of solar energetic protons, by means of the Empirical Modes Decomposition technique. Moreover, both fluxes have been found to be significantly correlated at the quasi-biennial timescale, thus supporting the hypothesis of a connection between solar neutrinos and solar activity. The origin of this connection is investigated, by modeling how the standard Mikheyev-Smirnov-Wolfenstein (MSW) effect (the process for which the well-known neutrino flavor oscillations are modified in passing through the material) could be influenced by matter fluctuations. As proposed by Burgess et al., 2004, by introducing a background magnetic field in the helioseismic model, density fluctuations can be excited in the radiative zone by the resonance between helioseismic g-modes and Alfvén waves. In particular, with reasonable values of the background magnetic field (10-100 kG), the distance between resonant layers could be of the same order of neutrino oscillation length. We study the effect over this distance of a background magnetic field which is variable with a ~2 yr period, in agreement with typical variations of solar activity. Our findings suggest that the quasi-biennial modulation of the neutrino flux is theoretically possible as a consequence of the magnetic field variations in the solar interior. A. Vecchio, M. Laurenza, V. Carbone, M. Storini, The Astrophysical Journal Letters, 709, L1-L5 (2010). C. Burgess, N. S. Dzhalilov, T. I. Rashba, V., B.Semikoz, J. W. F. Valle, Mon. Not. R. Astron. Soc., 348, 609-624 (2004).
Analysis of Human TAAR8 and Murine Taar8b Mediated Signaling Pathways and Expression Profile
Directory of Open Access Journals (Sweden)
Jessica Mühlhaus
2014-11-01
Full Text Available The thyroid hormone derivative 3-iodothyronamine (3-T1AM exerts metabolic effects in vivo that contradict known effects of thyroid hormones. 3-T1AM acts as a trace amine-associated receptor 1 (TAAR1 agonist and activates Gs signaling in vitro. Interestingly, 3-T1AM-meditated in vivo effects persist in Taar1 knockout-mice indicating that further targets of 3-T1AM might exist. Here, we investigated another member of the TAAR family, the only scarcely studied mouse and human trace-amine-associated receptor 8 (Taar8b, TAAR8. By RT-qPCR and locked-nucleic-acid (LNA in situ hybridization, Taar8b expression in different mouse tissues was analyzed. Functionally, we characterized TAAR8 and Taar8b with regard to cell surface expression and signaling via different G-protein-mediated pathways. Cell surface expression was verified by ELISA, and cAMP accumulation was quantified by AlphaScreen for detection of Gs and/or Gi/o signaling. Activation of G-proteins Gq/11 and G12/13 was analyzed by reporter gene assays. Expression analyses revealed at most marginal Taar8b expression and no gender differences for almost all analyzed tissues. In heart, LNA-in situ hybridization demonstrated the absence of Taar8b expression. We could not identify 3-T1AM as a ligand for TAAR8 and Taar8b, but both receptors were characterized by a basal Gi/o signaling activity, a so far unknown signaling pathway for TAARs.
Chemically vapor-deposited ZrB2 as a selective solar absorber
International Nuclear Information System (INIS)
Randich, E.; Allred, D.D.
1981-01-01
Coatings of ZrB 2 and TiB 2 for photothermal solar absorber applications were prepared using chemical vapor deposition (CVD) techniques. Oxidation tests suggest a maximum temperature limit for air exposure of 600 K for TiB 2 and 800 K for ZrB 2 . Both materials exhibit innate spectral selectivity with an emittance at 375 K ranging from 0.06 to 0.09, a solar absorptance for ZrB 2 ranging from 0.67 to 0.77 and a solar absorptance for TiB 2 ranging from 0.46 to 0.59. ZrB 2 has better solar selectivity and more desirable oxidation behavior than TiB 2 . A 0.071 μm antireflection coating of Si 3 N 4 deposited onto the ZrB 2 coating leads to an increase in absorptance from 0.77 to 0.93, while the emittance remains unchanged. (Auth.)
Solar Activity, Ultraviolet Radiation and Consequences in Birds in Mexico City, 2001- 2002
Valdes, M.; Velasco, V.
2008-12-01
Anomalous behavior in commercial and pet birds in Mexico City was reported during 2002 by veterinarians at the Universidad Nacional Autonoma de Mexico. This was attributed to variations in the surrounding luminosity. The solar components, direct, diffuse, global, ultraviolet band A and B, as well as some meteorological parameters, temperature, relative humidity, and precipitation, were then analyzed at the Solar Radiation Laboratory. Although the total annual radiance of the previously mentioned radiation components did not show important changes, ultraviolet Band-B solar radiation did vary significantly. During 2001 the total annual irradiance , 61.05 Hjcm² to 58.32 Hjcm², was 1.6 standard deviations lower than one year later, in 2002 and increased above the mean total annual irradiance, to 65.75 Hjcm², 2.04 standard deviations, giving a total of 3.73 standard deviations for 2001-2002. Since these differences did not show up clearly in the other solar radiation components, daily extra-atmosphere irradiance was analyzed and used to calculate the total annual extra-atmosphere irradiance, which showed a descent for 2001. Our conclusions imply that Ultraviolet Band-B solar radiation is representative of solar activity and has an important impact on commercial activity related with birds.
Empty conformers of HLA-B preferentially bind CD8 and regulate CD8+ T cell function.
Geng, Jie; Altman, John D; Krishnakumar, Sujatha; Raghavan, Malini
2018-05-09
When complexed with antigenic peptides, human leukocyte antigen (HLA) class I (HLA-I) molecules initiate CD8 + T cell responses via interaction with the T cell receptor (TCR) and co-receptor CD8. Peptides are generally critical for the stable cell surface expression of HLA-I molecules. However, for HLA-I alleles such as HLA-B*35:01, peptide-deficient (empty) heterodimers are thermostable and detectable on the cell surface. Additionally, peptide-deficient HLA-B*35:01 tetramers preferentially bind CD8 and to a majority of blood-derived CD8 + T cells via a CD8-dependent binding mode. Further functional studies reveal that peptide-deficient conformers of HLA-B*35:01 do not directly activate CD8 + T cells, but accumulate at the immunological synapse in antigen-induced responses, and enhance cognate peptide-induced cell adhesion and CD8 + T cell activation. Together, these findings indicate that HLA-I peptide occupancy influences CD8 binding affinity, and reveal a new set of regulators of CD8 + T cell activation, mediated by the binding of empty HLA-I to CD8. © 2018, Geng et al.
Damé, Luc; Bolsée, David; Meftah, Mustapha; Irbah, Abdenour; Hauchecorne, Alain; Bekki, Slimane; Pereira, Nuno; Cessateur, Marchand; Gäel; , Marion; et al.
2016-10-01
Accurate measurements of Solar Spectral Irradiance (SSI) are of primary importance for a better understanding of solar physics and of the impact of solar variability on climate (via Earth's atmospheric photochemistry). The acquisition of a top of atmosphere reference solar spectrum and of its temporal and spectral variability during the unusual solar cycle 24 is of prime interest for these studies. These measurements are performed since April 2008 with the SOLSPEC spectro-radiometer from the far ultraviolet to the infrared (166 nm to 3088 nm). This instrument, developed under a fruitful LATMOS/BIRA-IASB collaboration, is part of the Solar Monitoring Observatory (SOLAR) payload, externally mounted on the Columbus module of the International Space Station (ISS). The SOLAR mission, with its actual 8 years duration, will cover almost the entire solar cycle 24. We present here the in-flight operations and performances of the SOLSPEC instrument, including the engineering corrections, calibrations and improved know-how procedure for aging corrections. Accordingly, a SSI reference spectrum from the UV to the NIR will be presented, together with its variability in the UV, as measured by SOLAR/SOLSPEC for 8 years. Uncertainties on these measurements and comparisons with other instruments will be briefly discussed.
International Nuclear Information System (INIS)
Lites, B.W.; Bruner, E.C. Jr.; Chipman, E.G.; Shine, R.A.; Rottman, G.J.; White, O.R.; Athay, R.G.
1976-01-01
Velocity images, or tachograms, of the solar chromosphere and chromosphere-corona transition region were made by measuring the Si II 1816.93 A chromospheric line and the Si IV 1393.8 A transition region line with the University of Colorado spectrometer aboard OSO-8. Persistent flows are indicated in both active and quiet regions of the solar atmosphere. In quiet regions, areas of enhanced emission (the chromospheric network) are apparently systematically redshifted with respect to the areas of lower intensity. This correlation does not hold in active regions, where long-lived downflows into sunspots have been observed
Morales, Luis O.; Brosché, Mikael; Vainonen, Julia; Jenkins, Gareth I.; Wargent, Jason J.; Sipari, Nina; Strid, Åke; Lindfors, Anders V.; Tegelberg, Riitta; Aphalo, Pedro J.
2013-01-01
Photomorphogenic responses triggered by low fluence rates of ultraviolet B radiation (UV-B; 280–315 nm) are mediated by the UV-B photoreceptor UV RESISTANCE LOCUS8 (UVR8). Beyond our understanding of the molecular mechanisms of UV-B perception by UVR8, there is still limited information on how the UVR8 pathway functions under natural sunlight. Here, wild-type Arabidopsis (Arabidopsis thaliana) and the uvr8-2 mutant were used in an experiment outdoors where UV-A (315–400 nm) and UV-B irradiances were attenuated using plastic films. Gene expression, PYRIDOXINE BIOSYNTHESIS1 (PDX1) accumulation, and leaf metabolite signatures were analyzed. The results show that UVR8 is required for transcript accumulation of genes involved in UV protection, oxidative stress, hormone signal transduction, and defense against herbivores under solar UV. Under natural UV-A irradiance, UVR8 is likely to interact with UV-A/blue light signaling pathways to moderate UV-B-driven transcript and PDX1 accumulation. UVR8 both positively and negatively affects UV-A-regulated gene expression and metabolite accumulation but is required for the UV-B induction of phenolics. Moreover, UVR8-dependent UV-B acclimation during the early stages of plant development may enhance normal growth under long-term exposure to solar UV. PMID:23250626
Seasonal behaviour of B0 and B1
International Nuclear Information System (INIS)
Mosert Gonzalez, M. de; Radicella, S.M.
1997-01-01
A preliminary analysis of the thickness parameter B0 and the shape parameter B1 is presented. Noon electron density profiles recorded at five ionospheric stations during different seasonal and solar activity conditions are used in the study. The results show that both parameters present a seasonal trend with minimum value for B0 during the local winter and maximum during the local summer. This behaviour is inverted for B1. Discrepancies with IRI-90 model are found. (author). 8 refs, 4 figs, 2 tabs
High-efficiency, deep-junction, epitaxial InP solar cells on (100) and (111)B InP substrates
Venkatasubramanian, R.; Timmons, M. L.; Hutchby, J. A.; Walters, Robert J.; Summers, Geoffrey P.
1994-01-01
We report on the development and performance of deep-junction (approximately 0.25 micron), graded-emitter-doped, n(sup +)-p InP solar cells grown by metallorganic chemical vapor deposition (MOCVD). A novel, diffusion-transport process for obtaining lightly-doped p-type base regions of the solar cell is described. The I-V data and external quantum-efficiency response of these cells are presented. The best active-area AMO efficiency for these deep-junction cells on (100)-oriented InP substrates is 16.8 percent, with a J(sub SC) of 31.8 mA/sq cm, a V(sub OC) of 0.843 V, and a fill-factor of 0.85. By comparison, the best cell efficiency on the (111)B-oriented InP substrates was 15.0 percent. These efficiency values for deep-junction cells are encouraging and compare favorably with performance of thin-emitter (0.03 micron) epitaxial cells as well as that of deep-emitter diffused cells. The cell performance and breakdown voltage characteristics of a batch of 20 cells on each of the orientations are presented, indicating the superior breakdown voltage properties and other characteristics of InP cells on the (111)B orientation. Spectral response, dark I-V data, and photoluminescence (PL) measurements on the InP cells are presented with an analysis on the variation in J(sub SC) and V(sub OC) of the cells. It is observed, under open-circuit conditions, that lower-V(sub OC) cells exhibit higher band-edge PL intensity for both the (100) and (111)B orientations. This anomalous behavior suggests that radiative recombination in the heavily-doped n(sup +)-InP emitter may be detrimental to achieving higher V(sub OC) in n(sup +)-p InP solar cells.
SEARCH FOR GLOBAL f-MODES AND p-MODES IN THE {sup 8}B NEUTRINO FLUX
Energy Technology Data Exchange (ETDEWEB)
Lopes, Ilídio, E-mail: ilidio.lopes@ist.utl.pt, E-mail: ilopes@uevora.pt [Centro Multidisciplinar de Astrofísica, Instituto Superior Técnico, Universidade de Lisboa, Av. Rovisco Pais, 1049-001 Lisboa (Portugal); Departamento de Física, Escola de Ciências e Tecnologia, Universidade de Évora, Colégio Luis António Verney, 7002-554 Évora (Portugal)
2013-11-01
The impact of global acoustic modes on the {sup 8}B neutrino flux time series is computed for the first time. It is shown that the time fluctuations of the {sup 8}B neutrino flux depend on the amplitude of acoustic eigenfunctions in the region where the {sup 8}B neutrino flux is produced: modes with low n (or order) that have eigenfunctions with a relatively large amplitude in the Sun's core strongly affect the neutrino flux; conversely, modes with high n that have eigenfunctions with a minimal amplitude in the Sun's core have a very small impact on the neutrino flux. It was found that the global modes with a larger impact on the {sup 8}B neutrino flux have a frequency of oscillation in the interval 250 μHz to 500 μHz (or a period in the interval 30 minutes to 70 minutes), such as the f-modes (n = 0) for the low degrees, radial modes of order n ≤ 3, and the dipole mode of order n = 1. Their corresponding neutrino eigenfunctions are very sensitive to the solar inner core and are unaffected by the variability of the external layers of the solar surface. If time variability of neutrinos is observed for these modes, it will lead to new ways of improving the sound speed profile inversion in the central region of the Sun.
Fragmentation of the CRISPR-Cas Type I-B signature protein Cas8b.
Richter, Hagen; Rompf, Judith; Wiegel, Julia; Rau, Kristina; Randau, Lennart
2017-11-01
CRISPR arrays are transcribed into long precursor RNA species, which are further processed into mature CRISPR RNAs (crRNAs). Cas proteins utilize these crRNAs, which contain spacer sequences that can be derived from mobile genetic elements, to mediate immunity during a reoccurring virus infection. Type I CRISPR-Cas systems are defined by the presence of different Cascade interference complexes containing large and small subunits that play major roles during target DNA selection. Here, we produce the protein and crRNA components of the Type I-B CRISPR-Cas complex of Clostridium thermocellum and Methanococcus maripaludis. The C. thermocellum Cascade complexes were reconstituted and analyzed via size-exclusion chromatography. Activity of the heterologous M. maripaludis CRISPR-Cas system was followed using phage lambda plaques assays. The reconstituted Type-I-B Cascade complex contains Cas7, Cas5, Cas6b and the large subunit Cas8b. Cas6b can be omitted from the reconstitution protocol. The large subunit Cas8b was found to be represented by two tightly associated protein fragments and a small C-terminal Cas8b segment was identified in recombinant complexes and C. thermocellum cell lysate. Production of Cas8b generates a small C-terminal fragment, which is suggested to fulfill the role of the missing small subunit. A heterologous, synthetic M. maripaludis Type I-B system is active in E. coli against phage lambda, highlighting a potential for genome editing using endogenous Type-I-B CRISPR-Cas machineries. This article is part of a Special Issue entitled "Biochemistry of Synthetic Biology - Recent Developments" Guest Editor: Dr. Ilka Heinemann and Dr. Patrick O'Donoghue. Copyright © 2017 Elsevier B.V. All rights reserved.
Chemically vapor-deposited ZrB/sub 2/ as a selective solar absorber
Energy Technology Data Exchange (ETDEWEB)
Randich, E.; Allred, D.D.
1981-09-25
Coatings of ZrB/sub 2/ and TiB/sub 2/ for photothermal solar absorber applications were prepared using chemical vapor deposition (CVD) techniques. Oxidation tests suggest a maximum temperature limit for air exposure of 600 K for TiB/sub 2/ and 800 K for ZrB/sub 2/. Both materials exhibit innate spectral selectivity with an emittance at 375 K ranging from 0.06 to 0.09, a solar absorptance for ZrB/sub 2/ ranging from 0.67 to 0.77 and a solar absorptance for TiB/sub 2/ ranging from 0.46 to 0.59. ZrB/sub 2/ has better solar selectivity and more desirable oxidation behavior than TiB/sub 2/. A 0.071 ..mu..m antireflection coating of Si/sub 3/N/sub 4/ deposited onto the ZrB/sub 2/ coating leads to an increase in absorptance from 0.77 to 0.93, while the emittance remains unchanged.
Jayakumar, Asha; Donovan, Michael J.; Tripathi, Vinita; Ramalho-Ortigao, Marcelo; McDowell, Mary Ann
2008-01-01
The salient feature of dendritic cells (DC) is the initiation of appropriate adaptive immune responses by discriminating between pathogens. Using a prototypic model of intracellular infection, we previously showed that Leishmania major parasites prime human DC for efficient interleukin-12 (IL-12) secretion. L. major infection is associated with self-limiting cutaneous disease and powerful immunity. In stark contrast, the causative agent of visceral leishmaniasis, Leishmania donovani, does not prime human DC for IL-12 production. Here, we report that DC priming by L. major infection results in the early activation of NF-κB transcription factors and the up-regulation and nuclear translocation of interferon regulatory factor 1 (IRF-1) and IRF-8. The inhibition of NF-κB activation by the pretreatment of DC with caffeic acid phenethyl ester blocks L. major-induced IRF-1 and IRF-8 activation and IL-12 expression. We further demonstrate that IRF-1 and IRF-8 obtained from L. major-infected human DC specifically bind to their consensus binding sites on the IL-12p35 promoter, indicating that L. major infection either directly stimulates a signaling cascade or induces an autocrine pathway that activates IRF-1 and IRF-8, ultimately resulting in IL-12 transcription. PMID:18316378
Active control of the Chinese Giant Solar Telescope
Dai, Yichun; Yang, Dehua; Jin, Zhenyu; Liu, Zhong; Qin, Wei
2014-07-01
The Chinese Giant Solar Telescope (CGST) is the next generation solar telescope of China with diameter of 8 meter. The unique feature of CGST is that its primary is a ring, which facilitates the polarization detection and thermal control. In its present design and development phase, two primary mirror patterns are considered. For one thing, the primary mirror is expected to construct with mosaic mirror with 24 trapezoidal (or petal) segments, for another thing, a monolithic mirror is also a candidate for its primary mirror. Both of them depend on active control technique to maintain the optical quality of the ring mirror. As a solar telescope, the working conditions of the CGST are quite different from those of the stellar telescopes. To avoid the image deterioration due to the mirror seeing and dome seeing, especially in the case of the concentration of flux in a solar telescope, large aperture solar projects prefer to adopt open telescopes and open domes. In this circumstance, higher wind loads act on the primary mirror directly, which will cause position errors and figure errors of the primary with matters worse than those of the current 10-meter stellar telescopes with dome protect. Therefore, it gives new challenges to the active control capability, telescope structure design, and wind shielding design. In this paper, the study progress of active control of CGST for its mosaic and monolithic mirror are presented, and the wind effects on such two primary mirrors are also investigated.
Relationships between the solar wind and the polar cap magnetic activity
International Nuclear Information System (INIS)
Berthelier, A.
1981-01-01
The influence of solar wind conditions on magnetic activity is described in order to delineate the differences in the response of the magnetic activity to the arrival on the magnetopause of different typical solar wind variations. By determining a new index of local magnetic activity free from seasonal and diurnal effects we put in evidence the dependence of the various effects upon the invariant latitude. Most important results are: (1) the main increase of the magnetic activity does not occur at the same invariant latitude for different interplanetary variations, e.g. peaks of Bz tend to increase magnetic activity mainly in the auroral zones while peaks of B correspond to a uniform increase in magnetic activity over the polar cap and auroral zone; (2) there is a two steps response of magnetic activity to the high speed plasma streams; (3) an increase of magnetic activity is observed for large and northward Bz, which probably indicates that the solar wind-magnetosphere coupling is efficient under these circumstances. The specific influences of the IMF polarity are also briefly reviewed. (orig.)
Ecological and nonhuman biological effects of solar UV-B radiation
International Nuclear Information System (INIS)
Worrest, R.C.
1984-01-01
Recent studies regarding the impact of UV-B radiation upon ecological and nonhuman biological systems is the subject of the report. For years scientists and laymen alike have causally noted the impact of solar ultraviolet radiation upon the nonhuman component of the biosphere. Stratospheric ozone functions effectively as an ultraviolet screen by filtering out solar radiation in the 220-320 nm waveband as it penetrates through the atmosphere, thus allowing only small amounts of the longer wavelengths of radiation in the waveband to leak through to the surface of the earth. Although this radiation (UV-B radiation, 290-320 nm) comprises only a small fraction (lesser tha 1%) of the total solar spectrum, it can have a major impact on biological systems due to its actinic nature. Many organic molecules, most notably DNA, absorb UV-B radiation which can initiate photochemical reactions. It is life's ability, or lack thereof, to cope with enhanced levels of solar UV-B radiation that has generated concern over the potential depletion of stratospheric ozone
Directory of Open Access Journals (Sweden)
Sanjay Singh Baroniya
2014-12-01
Full Text Available A field experiment was conducted to study the impact of the exclusion of the solar UV components on growth, photosynthesis and nitrogen metabolism in soybean (Glycine max varieties PK-472, Pusa-24, JS 71-05, JS-335, NRC-7 and Kalitur. The plants were grown in specially designed UV exclusion chambers wrapped with filters to exclude UV-B or UV-A/B and transmitted all UV. Exclusion of UV significantly enhanced the growth of the aerial parts as well as the growth of the below ground parts in all of the six soybean varieties. Nitrate reductase activity (NRA was significantly reduced, whereas leghemoglobin (Lb content, total soluble protein, net photosynthesis (Pn and α-tocopherol content were enhanced after UV exclusion. The exclusion of solar UV-A/B enhanced all parameters to a larger extent than the exclusion of solar UV-B in four of the six varieties of soybean except for NRC-7 and Kalitur. These two varieties responded more to UV-B exclusion compared to UV-A/B exclusion. A significant inverse correlation between the NRA and the number of nodules per plant was observed. The extent of response in all parameters was greater in PK-472 and JS71-05 than that in Kalitur and JS-335 after UV exclusion. The exclusion of UV augmented the growth of nodules, Lb content and α-tocopherol levels and conferred higher rates of Pn to support better growth of nodules. Control plants (+ UV-A/B seemed to fulfill their N demand through the assimilation of NO3− resulting in lower symbiotic nitrogen fixation and higher NR activity.
A Relationship Between the Solar Rotation and Activity Analysed by Tracing Sunspot Groups
Ruždjak, Domagoj; Brajša, Roman; Sudar, Davor; Skokić, Ivica; Poljančić Beljan, Ivana
2017-12-01
The sunspot position published in the data bases of the Greenwich Photoheliographic Results (GPR), the US Air Force Solar Optical Observing Network and National Oceanic and Atmospheric Administration (USAF/NOAA), and of the Debrecen Photoheliographic Data (DPD) in the period 1874 to 2016 were used to calculate yearly values of the solar differential-rotation parameters A and B. These differential-rotation parameters were compared with the solar-activity level. We found that the Sun rotates more differentially at the minimum than at the maximum of activity during the epoch 1977 - 2016. An inverse correlation between equatorial rotation and solar activity was found using the recently revised sunspot number. The secular decrease of the equatorial rotation rate that accompanies the increase in activity stopped in the last part of the twentieth century. It was noted that when a significant peak in equatorial rotation velocity is observed during activity minimum, the next maximum is weaker than the previous one.
(4bS,8aS-1-Isopropyl-4b,8,8-trimethyl-4b,5,6,7,8,8a,9,10-octahydrophenanthren-2-yl acetate
Directory of Open Access Journals (Sweden)
Radouane Oubabi
2014-03-01
Full Text Available The hemisynthesis of the title compound, C22H32O2, was carried out through direct acetylation reaction of the naturally occurring diterpene totarol [systematic name: (4bS,8aS-4b,8,8-trimethyl-1-propan-2-yl-5,6,7,8a,9,10-hexahydrophenanthren-2-ol]. The molecule is built up from three fused six membered rings, one saturated and two unsaturated. The central unsaturated ring has a half-chair conformation, whereas the other unsaturated ring displays a chair conformation. The absolute configuration is deduced from the chemical pathway. The value of the Hooft parameter [−0.10 (6] allowed this absolute configuration to be confirmed.
8 years of Solar Spectral Irradiance Observations from the ISS with the SOLAR/SOLSPEC Instrument
Damé, L.; Bolsée, D.; Meftah, M.; Irbah, A.; Hauchecorne, A.; Bekki, S.; Pereira, N.; Cessateur, G.; Marchand, M.; Thiéblemont, R.; Foujols, T.
2016-12-01
Accurate measurements of Solar Spectral Irradiance (SSI) are of primary importance for a better understanding of solar physics and of the impact of solar variability on climate (via Earth's atmospheric photochemistry). The acquisition of a top of atmosphere reference solar spectrum and of its temporal and spectral variability during the unusual solar cycle 24 is of prime interest for these studies. These measurements are performed since April 2008 with the SOLSPEC spectro-radiometer from the far ultraviolet to the infrared (166 nm to 3088 nm). This instrument, developed under a fruitful LATMOS/BIRA-IASB collaboration, is part of the Solar Monitoring Observatory (SOLAR) payload, externally mounted on the Columbus module of the International Space Station (ISS). The SOLAR mission, with its actual 8 years duration, will cover almost the entire solar cycle 24. We present here the in-flight operations and performances of the SOLSPEC instrument, including the engineering corrections, calibrations and improved know-how procedure for aging corrections. Accordingly, a SSI reference spectrum from the UV to the NIR will be presented, together with its UV variability, as measured by SOLAR/SOLSPEC. Uncertainties on these measurements and comparisons with other instruments will be briefly discussed.
Energy Technology Data Exchange (ETDEWEB)
Muraoka, Y; Murata, H; Sato, T [Hyogo Coll. Of Medicine (Japan). Dept. of Physics
1977-07-01
An attempt is made to investigate the quantitative relationship between VLF phase deviations in SPA (sudden phase anomalies) events and associated solar X-ray fluxes in the 1 to 8 A band during solar flares. The phase deviations (..delta..phi) of the 18.6 kHz VLF wave transmitted from NLK, USA are used in this analysis which were recorded at Nishinomiya, Japan during the period June 1974 to May 1975. The solar X-ray fluxes (F/sub 0/) in the 1 to 8 A band are estimated from fsub(min) variations using the empirical expression given by Sato (J.Geomag.Geoelectr.;27: 95(1975)), because no observed data were available on the 1 to 8 a X-ray fluxes during the period of the VLF observation. The result shows that the normalized phase variation, ..delta..phi/coschisub(min), where chisub(min) represents the minimum solar zenith angle on the VLF propagation path, increases with increasing logF/sub 0/. A theoretical explanation for this is presented assuming that enhanced ionizations produced in the lower ionosphere by a monochromatic solar X-ray emission are responsible for the VLF phase deviations. Also it is found that a threshold X-ray flux to produce a detectable SPA effect is approximately 1.5 x 10/sup -3/ cm/sup -2/ sec/sup -1/ in the 1 to 8 a band.
ASTEROSEISMOLOGY OF THE SOLAR ANALOGS 16 Cyg A AND B FROM KEPLER OBSERVATIONS
Energy Technology Data Exchange (ETDEWEB)
Metcalfe, T. S.; Dogan, G. [High Altitude Observatory, NCAR, P.O. Box 3000, Boulder, CO 80307 (United States); Chaplin, W. J.; Garcia, R. A.; Basu, S.; Deheuvels, S.; Miglio, A. [Kavli Institute for Theoretical Physics, Kohn Hall, University of California, Santa Barbara, CA 93106 (United States); Appourchaux, T. [Institut d' Astrophysique Spatiale, Univ Paris-Sud, UMR8617, CNRS, Batiment 121, 91405 Orsay Cedex (France); Brandao, I. [Centro de Astrofisica and Faculdade de Ciencias, Universidade do Porto, Rua das Estrelas, 4150-762 Porto (Portugal); Creevey, O. L.; Salabert, D. [Laboratoire Lagrange, UMR7293, Observatoire de la Cote d' Azur, Universite de Nice Sophia-Antipolis, CNRS, BP 4229, 06304 Nice Cedex 4 (France); Eggenberger, P. [Observatoire de Geneve, Universite de Geneve, 51 Ch. des Maillettes, CH-1290 Sauverny (Switzerland); Karoff, C. [Department of Physics and Astronomy, Aarhus University, DK-8000 Aarhus C (Denmark); Stello, D.; Benomar, O. [Sydney Institute for Astronomy (SIfA), School of Physics, University of Sydney, NSW 2006 (Australia); Y Latin-Small-Letter-Dotless-I ld Latin-Small-Letter-Dotless-I z, M.; Celik, Z. [Department of Astronomy and Space Sciences, Ege University, Bornova, 35100 Izmir (Turkey); Antia, H. M. [Tata Institute of Fundamental Research, Homi Bhabha Road, Mumbai 400005 (India); Howe, R. [School of Physics and Astronomy, University of Birmingham, Edgbaston, Birmingham B15 2TT (United Kingdom); Regulo, C. [Instituto de Astrofisica de Canarias, 38205 La Laguna, Tenerife (Spain); and others
2012-03-20
The evolved solar-type stars 16 Cyg A and B have long been studied as solar analogs, yielding a glimpse into the future of our own Sun. The orbital period of the binary system is too long to provide meaningful dynamical constraints on the stellar properties, but asteroseismology can help because the stars are among the brightest in the Kepler field. We present an analysis of three months of nearly uninterrupted photometry of 16 Cyg A and B from the Kepler space telescope. We extract a total of 46 and 41 oscillation frequencies for the two components, respectively, including a clear detection of octupole (l = 3) modes in both stars. We derive the properties of each star independently using the Asteroseismic Modeling Portal, fitting the individual oscillation frequencies and other observational constraints simultaneously. We evaluate the systematic uncertainties from an ensemble of results generated by a variety of stellar evolution codes and fitting methods. The optimal models derived by fitting each component individually yield a common age (t = 6.8 {+-} 0.4 Gyr) and initial composition (Z{sub i} = 0.024 {+-} 0.002, Y{sub i} = 0.25 {+-} 0.01) within the uncertainties, as expected for the components of a binary system, bolstering our confidence in the reliability of asteroseismic techniques. The longer data sets that will ultimately become available will allow future studies of differential rotation, convection zone depths, and long-term changes due to stellar activity cycles.
Molybdenum solar neutrino experiment
International Nuclear Information System (INIS)
Wolfsberg, K.; Cowan, G.A.; Bryant, E.A.
1984-01-01
The goal of the molybdenum solar neutrino experiment is to deduce the 8 B solar neutrino flux, averaged over the past several million years, from the concentration of 98 Tc in a deeply buried molybdenum deposit. The experiment is important to an understanding of stellar processes because it will shed light on the reason for the discrepancy between theory and observation of the chlorine solar neutrino experiment. Possible reasons for the discrepancy may lie in the properties of neutrinos (neutrino oscillations or massive neutrinos) or in deficiencies of the standard solar model. The chlorine experiment only measures the 8 B neutrino flux in current times and does not address possible temporal variations in the interior of the sun, which are also not considered in the standard model. In the molybdenum experiment, we plan to measure 98 Tc (4.2 Myr), also produced by 8 B neutrinos, and possibly 97 Tc (2.6 Myr), produced by lower energy neutrinos
International Nuclear Information System (INIS)
Li, Jinpeng; Phadnis-Moghe, Ashwini S.; Crawford, Robert B.; Kaminski, Norbert E.
2017-01-01
The homeostasis of peripheral B cell compartment requires lifelong B lymphopoiesis from hematopoietic stem cells (HSC). As a result, the B cell repertoire is susceptible to disruptions of hematopoiesis. Increasing evidence, primarily from rodent models, shows that the aryl hydrocarbon receptor (AHR) regulates hematopoiesis. To study the effects of persistent AHR activation on human B cell development, a potent AHR agonist and known environmental contaminant, 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD) was utilized. An in vitro B cell development model system was established by co-culturing human cord blood-derived HSCs with irradiated human primary bone marrow stromal cells. Using this in vitro model, we found that TCDD significantly suppressed the total number of hematopoietic stem and progenitor cells (HSPC) in a concentration-dependent manner. Cell death analysis demonstrated that the decrease in cell number was not due to cytotoxicity by TCDD. In addition, TCDD markedly decreased CD34 expression on HSPCs. Structure-activity relationship studies using dioxin congeners demonstrated a correlation between the relative AHR binding affinity and the magnitude of decrease in the number of HSPCs and CD34 expression, suggesting that AHR mediates the observed TCDD-elicited changes in HSPCs. Moreover, a significant reduction in lineage committed B cell-derived from HSCs was observed in the presence of TCDD, indicating impairment of human B cell development. Similar effects of TCDD were observed regardless of the use of stromal cells in cultures indicating a direct effect of TCDD on HSCs. Collectively, we demonstrate that AHR activation by TCDD on human HSCs impairs early stages of human B lymphopoiesis.
Dillon, Francisco M; Tejedor, M Daniela; Ilina, Natalia; Chludil, Hugo D; Mithöfer, Axel; Pagano, Eduardo A; Zavala, Jorge A
2018-02-01
Solar UV-B radiation has been reported to enhance plant defenses against herbivore insects in many species. However, the mechanism and traits involved in the UV-B mediated increment of plant resistance are unknown in crops species, such as soybean. Here, we studied defense-related responses in undamaged and Anticarsia gemmatalis larvae-damaged leaves of two soybean cultivars grown under attenuated or full solar UV-B radiation. We determined changes in jasmonates, ethylene (ET), salicylic acid, trypsin protease inhibitor activity, flavonoids, and mRNA expression of genes related with defenses. ET emission induced by Anticarsia gemmatalis damage was synergistically increased in plants grown under solar UV-B radiation and was positively correlated with malonyl genistin concentration, trypsin proteinase inhibitor activity and expression of IFS2, and the pathogenesis protein PR2, while was negatively correlated with leaf consumption. The precursor of ET, aminocyclopropane-carboxylic acid, applied exogenously to soybean was sufficient to strongly induce leaf isoflavonoids. Our results showed that in field-grown soybean isoflavonoids were regulated by both herbivory and solar UV-B inducible ET, whereas flavonols were regulated by solar UV-B radiation only and not by herbivory or ET. Our study suggests that, although ET can modulate UV-B-mediated priming of inducible plant defenses, some plant defenses, such as isoflavonoids, are regulated by ET alone. © 2017 John Wiley & Sons Ltd.
ALAT SOLAR TRACKER BERBASIS MIKROKONTROLER 8 BIT ATMega8535
Directory of Open Access Journals (Sweden)
I Wayan Sutaya
2015-07-01
Full Text Available Penelitian yang telah dilakukan ini adalah membuat prototipe alat solar tracker. Alat ini berfungsi untuk menggerakkan modul sel surya sehingga permukaan sel surya bisa terkena sinar matahari secara maksimal. Saat ini sel surya di Indonesia banyak terpasang secara statis atau tidak dilengkapi alat solar tracker sehingga energi matahari tidak diterima secara maksimal. Hal ini menyebabkan sel surya yang terpasang di beberapa daerah di Indonesia tidak memberikan manfaat yang optimal. Alat solar tracker yang dihasilkan pada penelitian ini diharapkan sebagai solusi dari permasalahan yang ada saat ini. Mikrokontroler 8 bit ATMega8535 yang digunakan sebagai otak utama dari alat solar tracker menjadikan alat ini menjadi berbiaya murah. Serta teknik memprogram dengan bahasa assembly menjadikan alat ini tahan terhadap kegagalan sistem. Solar tracker ini sudah bisa beroperasi dengan baik dan cocok digunakan pada modul sel surya berukuran kecil.
The SOLAR-C Mission: Plan B Payload Concept
Shimizu, T.; Sakao, T.; Katsukawa, Y.; Group, J. S. W.
2012-08-01
The telescope concepts for the SOLAR-C Plan B mission as of the time of the Hinode-3 meeting were briefly presented for having comments from the international solar physics community. The telescope candidates are 1) near IR-visible-UV telescope with 1.5m aperture and enhanced spectro-polarimetric capability, 2) UV/EUV high throughput spectrometer, and 3) next generation X-ray telescope.
Active solar distillation - A detailed review
Energy Technology Data Exchange (ETDEWEB)
Sampathkumar, K.; Pitchandi, P. [Department of Mechanical Engineering, Tamilnadu College of Engineering, Coimbatore 641659, Tamilnadu (India); Arjunan, T.V. [Department of Automobile Engineering, PSG College of Technology, Coimbatore 641004, Tamilnadu (India); Senthilkumar, P. [Department of Mechanical Engineering, KSR College of Engineering, Tiruchengode 637215, Tamilnadu (India)
2010-08-15
All over the world, access to potable water to the people are narrowing down day by day. Most of the human diseases are due to polluted or non-purified water resources. Even today, under developed countries and developing countries face a huge water scarcity because of unplanned mechanism and pollution created by manmade activities. Water purification without affecting the ecosystem is the need of the hour. In this context, many conventional and non-conventional techniques have been developed for purification of saline water. Among these, solar distillation proves to be both economical and eco-friendly technique particularly in rural areas. Many active distillation systems have been developed to overcome the problem of lower distillate output in passive solar stills. This article provides a detailed review of different studies on active solar distillation system over the years. Thermal modelling was done for various types of active single slope solar distillation system. This review would also throw light on the scope for further research and recommendations in active solar distillation system. (author)
Solar activity monitoring and forecasting capabilities at Big Bear Solar Observatory
Directory of Open Access Journals (Sweden)
P. T. Gallagher
2002-07-01
Full Text Available The availability of full-disk, high-resolution Ha images from Big Bear Solar Observatory (USA, Kanzelhöhe Solar Observatory (Austria, and Yunnan Astronomical Observatory (China allows for the continual monitoring of solar activity with unprecedented spatial and temporal resolution. Typically, this Global Ha Network (GHN provides almost uninterrupted Ha images with a cadence of 1 min and an image scale of 1'' per pixel. Every hour, GHN images are transferred to the web-based BBSO Active Region Monitor (ARM; www.bbso.njit.edu/arm, which includes the most recent EUV, continuum, and magnetogram data from the Solar and Heliospheric Observatory, together with magnetograms from the Global Oscillation Network Group. ARM also includes a variety of active region properties from the National Oceanic and Atmospheric Administration’s Space Environment Center, such as up-to-date active region positions, GOES 5-min X-ray data, and flare identification. Stokes I, V, Q, and U images are available from the recently operational BBSO Digital Vector Magnetograph and the Vector Magnetograph at the Huairou Solar Observing Station of Beijing Observatory. Vector magnetograms provide complete information on the photospheric magnetic field, and allow for magnetic flux gradients, electric currents, and shear forces to be calculated: these measurements are extremely sensitive to conditions resulting in flaring activity. Furthermore, we have developed a Flare Prediction System which estimates the probability for each region to produce C-, M-, or X-class flares based on nearly eight years of NOAA data from cycle 22. This, in addition to BBSO’s daily solar activity reports, has proven a useful resource for activity forecasting.Key words. Solar physics, astronomy and astrophysics (flares and mass ejections; instruments and techniques; photosphere and chromosphere
Directory of Open Access Journals (Sweden)
Teresa D. Elo
2010-11-01
Full Text Available Expression of fibroblast growth factor 8 (FGF-8 is commonly increased in prostate cancer. Experimental studies have provided evidence that it plays a role in prostate tumorigenesis and tumor progression. To study how increased FGF-8 affects the prostate, we generated and analyzed transgenic (TG mice expressing FGF-8b under the probasin promoter that targets expression to prostate epithelium. Prostates of the TG mice showed an increased size and changes in stromal and epithelialmorphology progressing fromatypia and prostatic intraepithelial neoplasia (mouse PIN, mPIN lesions to tumors with highly variable phenotype bearing features of adenocarcinoma, carcinosarcoma, and sarcoma. The development of mPIN lesions was preceded by formation of activated stroma containing increased proportion of fibroblastic cells, rich vasculature, and inflammation. The association between advancing stromal and epithelial alterations was statistically significant. Microarray analysis and validation with quantitative polymerase chain reaction revealed that expression of osteopontin and connective tissue growth factor was markedly upregulated in TG mouse prostates compared with wild type prostates. Androgen receptor staining was decreased in transformed epithelium and in hypercellular stroma but strongly increased in the sarcoma-like lesions. In conclusion, our data demonstrate that disruption of FGF signaling pathways by increased epithelial production of FGF-8b leads to strongly activated and atypical stroma, which precedes development of mPIN lesions and prostate cancer with mixed features of adenocarcinoma and sarcoma in the prostates of TG mice. The results suggest that increased FGF-8 in human prostate may also contribute to prostate tumorigenesis by stromal activation.
Solar collector manufacturing activity, 1990
International Nuclear Information System (INIS)
1992-01-01
The Solar Collector Manufacturing Activity 1990 report prepared by the Energy Information Administration (EIA) presents summary and detailed data provided by domestic manufacturers on shipments of solar thermal collectors and photovoltaic cells and modules. Summary data on solar thermal collector shipments are presented for the period 1974 through 1990. Summary data on photovoltaic cell and module shipments are presented for the period 1982 through 1990. Detailed information for solar thermal collectors and photovoltaic cells and modules are presented for 1990
Radial evolution of the solar wind from IMP 8 to Voyager 2
Richardson, John D.; Paularena, Karolen I.; Lazarus, Alan J.; Belcher, John W.
1995-01-01
Voyager 2 and Interplanetary Monitoring Platform (IMP) 8 data from 1977 through 1994 are presented and compared. Radial velocity and temperature structures remain intact over the distance from 1 to 43 AU, but density structures do not. Temperature and velocity changes are correlated and nearly in phase at 1 AU, but in the outer heliosphere temperature changes lead velocity changes by tens of days. Solar cycle variations are detected by both spacecraft, with minima in flux density and dynamic pressure near solar maxima. Differences between Voyager 2 and IMP 8 observations near the solar minimum in 1986-1987 are attributed to latitudinal gradients in solar wind properties. Solar rotation variations are often present even at 40 AU. The Voyager 2 temperature profile is best fit with a R(exp -0.49 +/- 0.01) decrease, much less steep than an adiabatic profile.
Modulation of thalamocortical oscillations by TRIP8b, an auxiliary subunit for HCN channels
Zobeiri, M.; Chaudhary, R.; Datunashvili, M.; Heuermann, R.J.; Lüttjohann, A.; Narayanan, V.; Balfanz, S.; Meuth, P.; Chetkovich, D.M.; Pape, H.C.; Baumann, A.; Luijtelaar, E.L.J.M. van; Budde, T.
2018-01-01
Hyperpolarization-activated cyclic nucleotide-gated cation (HCN) channels have important functions in controlling neuronal excitability and generating rhythmic oscillatory activity. The role of tetratricopeptide repeat-containing Rab8b-interacting protein (TRIP8b) in regulation of
Effects of breakup couplings on 8B + 58 Ni elastic scattering
International Nuclear Information System (INIS)
Lubian, J.; Correa, T.; Gomes, P.R.S.; Canto, L.F.; Aguilera, E.F.; Gomez-Camacho, A.; Quiroz, E.M.
2009-01-01
Full text: Nuclear reactions involving weakly bound nuclei have been extensively investigated over the last years. Because of the low breakup threshold, collisions of weakly bound systems have large breakup cross sections. Nuclear reactions induced by 8 B projectiles have attracted particular interest, because the Coulomb dissociation of this nucleus leads to important information for understanding solar neutrino emission. Because the breakup process involves unbound states of the projectile's fragments is necessary to approximate the continuum by a finite number of channels. This is achieved by continuum discretized coupled channel (CDCC) method. Recently, new data have become available for the 8 B + 58 Ni system. Aguilera et al measured elastic angular distributions at several collisions energies, in the barrier region. In the present work, we perform a theoretical study of the effect of the breakup channel on the elastic angular distributions for the 8 B + 58 Ni system, using the CDCC method. The result of our calculations were in excellent agreement with the experimental results. We have also investigated the effects of inelastic excitations and of continuum-continuum couplings on the angular distributions. We found that inelastic excitations do not have an appreciable influence while continuum- continuum couplings are of utmost importance. We have shown that the multipole expansion of the coupling interaction is dominated by monopole, dipole, and quadrupole terms. Higher multipoles can be neglected. (author)
Experimental evaluation of an active solar thermoelectric radiant wall system
International Nuclear Information System (INIS)
Liu, ZhongBing; Zhang, Ling; Gong, GuangCai; Han, TianHe
2015-01-01
Highlights: • A novel active solar thermoelectric radiant wall are proposed and tested. • The novel wall can control thermal flux of building envelope by using solar energy. • The novel wall can eliminate building envelop thermal loads and provide cooling capacity for space cooling. • Typical application issues including connection strategies, coupling with PV system etc. are discussed. - Abstract: Active solar thermoelectric radiant wall (ASTRW) system is a new solar wall technology which integrates thermoelectric radiant cooling and photovoltaic (PV) technologies. In ASTRW system, a PV system transfers solar energy directly into electrical energy to power thermoelectric cooling modes. Both the thermoelectric cooling modes and PV system are integrated into one enclosure surface as radiant panel for space cooling and heating. Hence, ASTRW system presents fundamental shift from minimizing building envelope energy losses by optimizing the insulation thickness to a new regime where active solar envelop is designed to eliminate thermal loads and increase the building’s solar gains while providing occupant comfort in all seasons. This article presents an experimental study of an ASTRW system with a dimension of 1580 × 810 mm. Experimental results showed that the inner surface temperature of the ASTRW is 3–8 °C lower than the indoor temperature of the test room, which indicated that the ASTRW system has the ability to control thermal flux of building envelope by using solar energy and reduce the air conditioning system requirements. Based on the optimal operating current of TE modules and the analysis based upon PV modeling theories, the number and type of the electrical connections for the TE modules in ASTRW system are discussed in order to get an excellent performance in the operation of the ASTRW system
Searches for high frequency variations in the 8-B neutrino flux at the Sudbury neutrino observatory
Energy Technology Data Exchange (ETDEWEB)
Rielage, Keith [Los Alamos National Laboratory; Seibert, Stanley R [Los Alamos National Laboratory; Hime, Andrew [Los Alamos National Laboratory; Elliott, Steven R [Los Alamos National Laboratory; Stonehill, L C [Los Alamos National Laboratory; Wouters, J M [Los Alamos National Laboratory; Aharmim, B [LAURENTIAN UNIV; Ahmed, S N [QUEEN' S UNIV; Anthony, A E [UNIV OF TEXAS; Barros, N [PORTUGAL; Beier, E W [UNIV OF PA; Bellerive, A [CARLETON UNIV; Belttran, B [UNIV OF ALBERTA; Bergevin, M [LBNL; Biller, S D [UNIV OF OXFORD; Boudjemline, K [CARLETON UNIV; Burritt, T H [UNIV OF WASHINGTON; Cai, B [QUEEN' S UNIV; Chan, Y D [LBNL; Chauhan, D [LAURENTIAN UNIV; Chen, M [QUEEN' S UNIV; Cleveland, B T [UNIV OF OXFORD; Cox - Mobrand, G A [UNIV OF WASHINGTON; Dai, X [QUEEN' S UNIV; Deng, H [UNIV OF PA; Detwiler, J [LBNL; Dimarco, M [QUEEN' S UNIV; Doe, P J [UNIV OF WASHINGTON; Drouin, P - L [CARLTON UNIV; Duba, C A [UNIV OF WASHINGTON; Duncan, F A [SNOLAB, SUDBURY; Dunford, M [UNIV OF PA; Earle, E D [QUEEN' S UNIV; Evans, H C [QUEEN' S UNIV; Ewan, G T [QUEEN' S UNIV; Farine, J [LAURENTTIAN UNIV; Fergani, H [UNIV OF OXFORD; Fleurot, F [LAURENTIAN UNIV; Ford, R J [SNOLAB, SUDBURY; Formaggilo, J A [MASSACHUSETTS INST. OF TECH.; Gagnon, N [UNIV OF WASHINGTON; Goon, J Tm [LOUISIANA STATE UNIV; Guillian, E [QUEEN' S UNIV; Habib, S [UNIV OF ALBERTA; Hahn, R L [BNL; Hallin, A L [UNIV OF ALBERTA; Hallman, E D [LAURENTIAN UNIV; Harvey, P J [QUEEN' S UNIV; Hazama, R [UNIV OF WASHINGTON; Heintzelman, W J [UNIV OF PA; Heise, J [SNOLAB, SUDBURY; Helmer, R L [TRIUMF; Howard, C [UNIV OF ALBERTA; Howe, M A [UNIV OF WASHINGTON; Huang, M [UNIV OF TEXAS; Jamieson, B [UNIV OF BRITISH COLUMBIA; Jelley, N A [UNIV OF OXFORD; Keeter, K J [SNOLAB, SUDBURY; Klein, J R [UNIV OF TEXAS; Kos, M [QUEEN' S UNIV; Kraus, C [QUEEN' S UNIV; Krauss, C B [UNIV OF ALBERTA; Kutter, T [LOUISIANA STATE UNIV; Kyba, C C M [UNIV OF PA; Law, J [UNIV OF GUELPH; Lawson, I T [SNOLAB, SUDBURY; Lesko, K T [LBNL; Leslie, J R [QUEEN' S UNIV; Loach, J C [UNIV OF OXFORD; Maclellan, R [QUEEN' S UNIV; Majerus, S [UNIV OF OXFORD; Mak, H B [QUEEN' S UNIV; Maneira, J [PORTUGAL; Martin, R [QUEEN' S UNIV; Mccauley, N [UNIV OF PA; Mc Donald, A B [QUEEN' S UNIV; Mcgee, S [UNIV OF WASHINGTON; Miffin, C [CARLETON UNIV; Miller, M L [MASSACHUSETTS INST. OF TECH.; Monreal, B [MASSACHUSETTS INST. OF TECH.; Monroe, J [MASSACHUSETTS INST. OF TECH; Morissette, B [SNOLAB, SUDBURY; Nickel, B G [UNIV OF GUELPH; Noble, A J [QUEEN' S UNIV; O' Keeffe, H M [UNIV OF OXFORD; Oblath, N S [UNIV OF WASHINGTON; Orebi Gann, G D [UNIV OF OXFORD; Oser, S M [UNIV OF BRITISH COLUMBIA; Ott, R A [MASSACHUSETTS INST. OF TECH.; Peeters, S J M [UNIV OF OXFORD; Poon, A W P [LBNL; Prior, G [LBNL; Reitzner, S D [UNIV OF GUELPH; Robertson, B C [QUEEN' S UNIV; Robertson, R G H [UNIV OF WASHINGTON; Rollin, E [CARLETON UNIV; Schwendener, M H [LAURENTIAN UNIV; Secrest, J A [UNIV OF PA; Seibert, S R [UNIV OF TEXAS; Simard, O [CARLETON UNIV; Sinclair, D [CARLETON UNIV; Sinclair, L [CARLETON UNIV; Skensved, P [QUEEN' S UNIV; Sonley, T J [MASSACHUSETTS INST. OF TECH.; Tesic, G [CARLETON UNIV; Tolich, N [UNIV OF WASHINGTON; Tsui, T [UNIV OF BRITISH COLUMBIA; Tunnell, C D [UNIV OF TEXAS; Van Berg, R [UNIV OF PA; Van Devender, B A [UNIV OF WASHINGTON; Virtue, C J [LAURENTIAN UNIV; Wall, B L [UNIV OF WASHINGTON; Waller, D [CARLETON UNIV; Wan Chan Tseung, H [UNIV OF OXFORD; West, N [UNIV OF OXFORD; Wilkerson, J F [UNIV OF WASHINGTON; Wilson, J R [UNIV OF OXFORD; Wright, A [QUEEN' S UNIV; Yeh, M [BNL; Zhang, F [CARLETON UNIV; Zuber, K [UNIV OF OXFORD
2009-01-01
We have peformed three searches for high-frequency signals in the solar neutrino flux measured by the Sudbury Neutrino Observatory (SNO), motivated by the possibility that solar g-mode oscillations could affect the production or propagation of solar {sup 8}B neutrinos. The first search looked for any significant peak in the frequency range l/day to 144/day, with a sensitivity to sinusoidal signals with amplitudes of 12% or greater. The second search focused on regions in which g-mode signals have been claimed by experiments aboard the SoHO satellite, and was sensitive to signals with amplitudes of 10% or greater. The third search looked for extra power across the entire frequency band. No statistically significant signal was detected in any of the three searches.
Chintzoglou, Georgios
2016-04-01
Magnetic fields govern all aspects of solar activity from the 11-year solar cycle to the most energetic events in the solar system, such as solar flares and Coronal Mass Ejections (CMEs). As seen on the surface of the sun, this activity emanates from localized concentrations of magnetic fields emerging sporadically from the solar interior. These locations are called solar Active Regions (ARs). However, the fundamental processes regarding the origin, emergence and evolution of solar magnetic fields as well as the generation of solar activity are largely unknown or remain controversial. In this dissertation, multiple important issues regarding solar magnetism and activities are addressed, based on advanced observations obtained by AIA and HMI instruments aboard the SDO spacecraft. First, this work investigates the formation of coronal magnetic flux ropes (MFRs), structures associated with major solar activity such as CMEs. In the past, several theories have been proposed to explain the cause of this major activity, which can be categorized in two contrasting groups (a) the MFR is formed in the eruption, and (b) the MFR pre-exists the eruption. This remains a topic of heated debate in modern solar physics. This dissertation provides a complete treatment of the role of MFRs from their genesis all the way to their eruption and even destruction. The study has uncovered the pre-existence of two weakly twisted MFRs, which formed during confined flaring 12 hours before their associated CMEs. Thus, it provides unambiguous evidence for MFRs truly existing before the CME eruptions, resolving the pre-existing MFR controversy. Second, this dissertation addresses the 3-D magnetic structure of complex emerging ARs. In ARs the photospheric fields might show all aspects of complexity, from simple bipolar regions to extremely complex multi-polar surface magnetic distributions. In this thesis, we introduce a novel technique to infer the subphotospheric configuration of emerging
Construction of a century solar chromosphere data set for solar activity related research
Lin, Ganghua; Wang, Xiao Fan; Yang, Xiao; Liu, Suo; Zhang, Mei; Wang, Haimin; Liu, Chang; Xu, Yan; Tlatov, Andrey; Demidov, Mihail; Borovik, Aleksandr; Golovko, Aleksey
2017-06-01
This article introduces our ongoing project "Construction of a Century Solar Chromosphere Data Set for Solar Activity Related Research". Solar activities are the major sources of space weather that affects human lives. Some of the serious space weather consequences, for instance, include interruption of space communication and navigation, compromising the safety of astronauts and satellites, and damaging power grids. Therefore, the solar activity research has both scientific and social impacts. The major database is built up from digitized and standardized film data obtained by several observatories around the world and covers a time span of more than 100 years. After careful calibration, we will develop feature extraction and data mining tools and provide them together with the comprehensive database for the astronomical community. Our final goal is to address several physical issues: filament behavior in solar cycles, abnormal behavior of solar cycle 24, large-scale solar eruptions, and sympathetic remote brightenings. Significant signs of progress are expected in data mining algorithms and software development, which will benefit the scientific analysis and eventually advance our understanding of solar cycles.
Construction of a century solar chromosphere data set for solar activity related research
Directory of Open Access Journals (Sweden)
Ganghua Lin
2017-06-01
Full Text Available This article introduces our ongoing project “Construction of a Century Solar Chromosphere Data Set for Solar Activity Related Research”. Solar activities are the major sources of space weather that affects human lives. Some of the serious space weather consequences, for instance, include interruption of space communication and navigation, compromising the safety of astronauts and satellites, and damaging power grids. Therefore, the solar activity research has both scientific and social impacts. The major database is built up from digitized and standardized film data obtained by several observatories around the world and covers a timespan more than 100 years. After careful calibration, we will develop feature extraction and data mining tools and provide them together with the comprehensive database for the astronomical community. Our final goal is to address several physical issues: filament behavior in solar cycles, abnormal behavior of solar cycle 24, large-scale solar eruptions, and sympathetic remote brightenings. Significant progresses are expected in data mining algorithms and software development, which will benefit the scientific analysis and eventually advance our understanding of solar cycles.
Parisi, A V; Downs, N; Turner, J; Amar, A
2016-09-01
A set of online activities for children and the community that are based on an integrated real-time solar UV and cloud measurement system are described. These activities use the functionality of the internet to provide an educative tool for school children and the public on the influence of cloud and the angle of the sun above the horizon on the global erythemal UV or sunburning UV, the diffuse erythemal UV, the global UVA (320-400nm) and the vitamin D effective UV. Additionally, the units of UV exposure and UV irradiance are investigated, along with the meaning and calculation of the UV index (UVI). This research will help ensure that children and the general public are better informed about sun safety by improving their personal understanding of the daily and the atmospheric factors that influence solar UV radiation and the solar UV exposures of the various wavebands in the natural environment. The activities may correct common misconceptions of children and the public about UV irradiances and exposure, utilising the widespread reach of the internet to increase the public's awareness of the factors influencing UV irradiances and exposures in order to provide clear information for minimizing UV exposure, while maintaining healthy, outdoor lifestyles. Copyright © 2016 Elsevier B.V. All rights reserved.
Solar active region display system
Golightly, M.; Raben, V.; Weyland, M.
2003-04-01
The Solar Active Region Display System (SARDS) is a client-server application that automatically collects a wide range of solar data and displays it in a format easy for users to assimilate and interpret. Users can rapidly identify active regions of interest or concern from color-coded indicators that visually summarize each region's size, magnetic configuration, recent growth history, and recent flare and CME production. The active region information can be overlaid onto solar maps, multiple solar images, and solar difference images in orthographic, Mercator or cylindrical equidistant projections. Near real-time graphs display the GOES soft and hard x-ray flux, flare events, and daily F10.7 value as a function of time; color-coded indicators show current trends in soft x-ray flux, flare temperature, daily F10.7 flux, and x-ray flare occurrence. Through a separate window up to 4 real-time or static graphs can simultaneously display values of KP, AP, daily F10.7 flux, GOES soft and hard x-ray flux, GOES >10 and >100 MeV proton flux, and Thule neutron monitor count rate. Climatologic displays use color-valued cells to show F10.7 and AP values as a function of Carrington/Bartel's rotation sequences - this format allows users to detect recurrent patterns in solar and geomagnetic activity as well as variations in activity levels over multiple solar cycles. Users can customize many of the display and graph features; all displays can be printed or copied to the system's clipboard for "pasting" into other applications. The system obtains and stores space weather data and images from sources such as the NOAA Space Environment Center, NOAA National Geophysical Data Center, the joint ESA/NASA SOHO spacecraft, and the Kitt Peak National Solar Observatory, and can be extended to include other data series and image sources. Data and images retrieved from the system's database are converted to XML and transported from a central server using HTTP and SOAP protocols, allowing
Institute of Scientific and Technical Information of China (English)
古力帕丽·麦曼提依明; 马海梅; 吾拉木·马木提; 陈洁; 陈璐; 丁剑冰; 马秀敏; 温浩
2011-01-01
目的 构建pET32a-AgB8/1-AgB8/2原核表达载体,并对其重组蛋白进行原核细胞表达.方法 从细粒棘球绦虫原头蚴中提取总RNA,反转录生成cDNA,以此cDNA为模板,用基因特异性引物分别扩增EgAgB8/1和EgAgB8/2基因编码其分泌型多肽的片段,经测序后,以此两条基因片段为依据,人工合成EgAgB8/1-EgAgB8/2嵌合抗原编码核酸序列,将其克隆至pUCm-T载体,测序鉴定其正确性.通过对pUCm-T/AgB8/1-AgB8/2重组质粒进行双酶切,将获得的AgB8/1-AgB8/2嵌合抗原编码核酸序列用定向克隆技术克隆至原核表达质粒pET32a上,测序鉴定插入片段正确后,转化至E.coli BL21(DE3)Lys S,IPTG初步诱导表达pET32a-AgB8/1-AgB8/2重组嵌合蛋白.用SDS-PAGE电泳分析鉴定重组蛋白的表达水平.结果 测序表明,AgB8/1-AgB8/2嵌合抗原编码核酸序列正方向插入至pET32a质粒.SDS-PAGE电泳分析显示,IPTG诱导后重组嵌合蛋白得到成功表达,在相对分子量约38 kD处有表达条带.结论 成功构建了pET32a-AgB8/1-AgB8/2原核表达质粒,并初步诱导表达出AgB8/1-AgB8/2嵌合重组蛋白,为进一步研究其免疫学特性奠定了基础.%In order to construct the pET32a-AgB8/1-AgB8/2 chimeric antigen prokaryotic expression recombinant plasmid and the expression of its recombinant protein, the total RNA was extracted from protoscoleces of Echinococcus granulosus,and reverse transcribed into cDNA, the cDNA encoding mature form of EgAgB8/land EgAgB8/2 antigen were amplified by PCR using gene specific primers.Based on the both gene fragments, a nucleotide sequence encoding EgAgB8/1-EgAgB8/2 chimeric antigen were artificially synthesized after sequence confirmation.The synthesized nucleotide sequence encoding EgAgB8/1-EgAgB8/2 chimeric antigen were conformed by sequencing after cloning into pUCm-T vector, then the target sequence was directionally ligated into pET32a plasmid after double digestion with restriction enzymes for prokaryotic
Energy Technology Data Exchange (ETDEWEB)
Menicucci, D.F.
1994-03-01
The Solar Thermal Design Assistance Center (STDAC) at Sandia National Laboratories is a resource provided by the US Department of Energy`s Solar Thermal Program. Its major objectives are to accelerate the use of solar thermal systems through (a) direct technical assistance to users, (b) cooperative test, evaluation, and development efforts with private industry, and (c) educational outreach activities. This report outlines the major activities and accomplishments of the STDAC in Fiscal Year 1993. The report also contains a comprehensive list of persons who contacted the STDAC by telephone for information or technical consulting.
Sustainable Buildings. Using Active Solar Power
Energy Technology Data Exchange (ETDEWEB)
Sharp, M. Keith [Univ. of Louisville, KY (United States); Barnett, Russell [Univ. of Louisville, KY (United States)
2015-04-20
The objective of this project is to promote awareness and knowledge of active solar energy technologies by installing and monitoring the following demonstration systems in Kentucky: 1) Pool heating system, Churchill Park School, 2) Water heating and daylighting systems, Middletown and Aiken Road Elementary Schools, 3) Photovoltaic street light comparison, Louisville Metro, 4) up to 25 domestic water heating systems across Kentucky. These tasks will be supported by outreach activities, including a solar energy installer training workshop and a Kentucky Solar Energy Conference.
Measurement of the $^{7}$Be$(p,\\gamma)^{8}$B Cross-Section with an Implanted Target
2002-01-01
% IS366\\\\ \\\\ The $^7$Be(p,$\\gamma)^8$B capture reaction is of major importance to the physics of the sun and the issues of the ``solar neutrino puzzle'' and neutrino masses. We report here on a new determination of the absolute cross section of this reaction, using a novel method which overcomes some of the major experimental uncertainties of previous measurements. We utilize an implanted $^7$Be target and a uniformly scanned particle beam larger than the target spot, eliminating issues of target homogeneity and backscattering loss of $^8$B reaction products. The target was produced using a beam of 1.8 10$^{10}$/s $^7$Be nuclei extracted at ISOLDE(CERN) from a graphite target bombarded by 1 GeV protons in a two-step resonant laser ionization source. The $^7$Be nuclei were directly implanted into a copper substrate to obtain a target of 2 mm diameter with a total of 3.10$^{15}$ atoms. The measurement of the $^8$B production cross section was carried out at the Van de Graaff laboratory of the Weizmann Institute...
Ten cycles of solar and geomagnetic activity
International Nuclear Information System (INIS)
Legrand, J.P.
1981-01-01
Series of 110 years of sunspot numbers and indices of geomagnetic activity are used with 17 years of solar wind data in order to study through solar cycles both stream and shock event solar activity. According to their patterns on Bartels diagrams of geomagnetic indices, stable wind streams and transient solar activities are separated from each other. Two classes of stable streams are identified: equatorial streams occurring sporadically, for several months, during the main phase of sunspot cycles and both polar streams established, for several years, at each cycle, before sunspot minimum. Polar streams are the first activity of solar cycles. For study of the relationship between transient geomagnetic phenomena and sunspot activity, we raise the importance of the contribution, at high spot number, of severe storms and, at low spot number, of short lived and unstable streams. Solar wind data are used to check and complete the above results. As a conclusion, we suggest a unified scheme of solar activity evolution with a starting point every eleventh year, a total duration of 17 years and an overlapping of 6 years between the first and the last phase of both successive series of phenomena: first, from polar field reversal to sunspot minimum, a phase of polar wind activity of the beginning cycle is superimposed on the weak contribution of shock events of the ending cycle; secondly, an equatorial phase mostly of shock events is superimposed on a variable contribution of short lived and sporadic stable equatorial stream activities; and thirdly a phase of low latitude shock events is superimposed on the polar stream interval of the following cycle. (orig.)
Effect of 7,8-Dihydroxyflavone, a Small-Molecule TrkB Agonist, on Emotional Learning
Andero, Raul; Heldt, Scott A.; Ye, Keqiang; Liu, Xia; Armario, Antonio; Ressler, Kerry J.
2013-01-01
Objective Despite increasing awareness of the many important roles played by brain-derived neurotrophic factor (BDNF) activation of TrkB, a fuller understanding of this system and the use of potential TrkB-acting therapeutic agents has been limited by the lack of any identified small-molecule TrkB agonists that fully mimic the actions of BDNF at brain TrkB receptors in vivo. However, 7,8-dihydroxyflavone (7,8-DHF) has recently been identified as a specific TrkB agonist that crosses the blood-brain barrier after oral or intra-peritoneal administration. The authors combined pharmacological, biochemical, and behavioral approaches in a preclinical study examining the role of 7,8-DHF in modulating emotional memory in mice. Method The authors first examined the ability of systemic 7,8-DHF to activate TrkB receptors in the amygdala. They then examined the effects of systemic 7,8-DHF on acquisition and extinction of conditioned fear, using specific and well-characterized BDNF-dependent learning paradigms in several models using naive mice and mice with prior traumatic stress exposure. Results Amygdala TrkB receptors, which have previously been shown to be required for emotional learning, were activated by systemic 7,8-DHF (at 5 mg/kg i.p.). 7,8-DHF enhanced both the acquisition of fear and its extinction. It also appeared to rescue an extinction deficit in mice with a history of immobilization stress. Conclusions These data suggest that 7,8-DHF may be an excellent agent for use in understanding the effects of TrkB activation in learning and memory paradigms and may be attractive for use in reversing learning and extinction deficits associated with psychopathology. PMID:21123312
Signatures of Slow Solar Wind Streams from Active Regions in the Inner Corona
Slemzin, V.; Harra, L.; Urnov, A.; Kuzin, S.; Goryaev, F.; Berghmans, D.
2013-08-01
The identification of solar-wind sources is an important question in solar physics. The existing solar-wind models ( e.g., the Wang-Sheeley-Arge model) provide the approximate locations of the solar wind sources based on magnetic field extrapolations. It has been suggested recently that plasma outflows observed at the edges of active regions may be a source of the slow solar wind. To explore this we analyze an isolated active region (AR) adjacent to small coronal hole (CH) in July/August 2009. On 1 August, Hinode/EUV Imaging Spectrometer observations showed two compact outflow regions in the corona. Coronal rays were observed above the active-region coronal hole (ARCH) region on the eastern limb on 31 July by STEREO-A/EUVI and at the western limb on 7 August by CORONAS- Photon/TESIS telescopes. In both cases the coronal rays were co-aligned with open magnetic-field lines given by the potential field source surface model, which expanded into the streamer. The solar-wind parameters measured by STEREO-B, ACE, Wind, and STEREO-A confirmed the identification of the ARCH as a source region of the slow solar wind. The results of the study support the suggestion that coronal rays can represent signatures of outflows from ARs propagating in the inner corona along open field lines into the heliosphere.
Tang, Chaoli; Wei, Yuanyuan; Liu, Dong; Luo, Tao; Dai, Congming; Wei, Heli
2017-12-01
The global distribution and variations of NO infrared radiative flux (NO-IRF) are presented during 2002-2016 in the thermosphere covering 100-280 km altitude based on Sounding of the Atmosphere using Broadband Emission Radiometry (SABER) data set. For investigating the spatial variations of the mutual relationship between NO-IRF and solar activity, the altitude ranges from 100 km to 280 km are divided into 90 altitude bins, and the latitude regions of 83°S-83°N are divided into 16 latitude bins. By processing about 1.8E9 NO-IRF observation values from about 5E6 vertical nighttime profiles recorded in SABER data set, we obtained more than 4.1E8 samples of NO-IRF. The annual-mean values of NO-IRF are then calculated by all available NO-IRF samples within each latitude and altitude bin. Local latitudinal maxima in NO-IRF are found between 120 and 145 km altitude, and the maximum NO-IRF located at polar regions are 3 times more than that of the minimum at equatorial region. The influences of solar and geomagnetic activity on the spatial variations of NO-IRF are investigated. Both the NO-IRF and its response to solar and geomagnetic activity show nearly symmetric distribution between the two hemispheres. It is demonstrated that the observed changes in NO-IRF at altitudes between 100 and 225 km correlate well with the changes in solar activity. The NO-IRF at solar maximum is about 4 times than that at solar minimum, and the current maximum of NO-IRF in 2014 is less than 70% of the prior maximum in 2001. For the first time, the response ranges of the NO-IRF to solar and geomagnetic activity at different altitudes and latitudes are reported.
Modulation of thalamocortical oscillations by TRIP8b, an auxiliary subunit for HCN channels.
Zobeiri, Mehrnoush; Chaudhary, Rahul; Datunashvili, Maia; Heuermann, Robert J; Lüttjohann, Annika; Narayanan, Venu; Balfanz, Sabine; Meuth, Patrick; Chetkovich, Dane M; Pape, Hans-Christian; Baumann, Arnd; van Luijtelaar, Gilles; Budde, Thomas
2018-04-01
Hyperpolarization-activated cyclic nucleotide-gated cation (HCN) channels have important functions in controlling neuronal excitability and generating rhythmic oscillatory activity. The role of tetratricopeptide repeat-containing Rab8b-interacting protein (TRIP8b) in regulation of hyperpolarization-activated inward current, I h , in the thalamocortical system and its functional relevance for the physiological thalamocortical oscillations were investigated. A significant decrease in I h current density, in both thalamocortical relay (TC) and cortical pyramidal neurons was found in TRIP8b-deficient mice (TRIP8b -/- ). In addition basal cAMP levels in the brain were found to be decreased while the availability of the fast transient A-type K + current, I A , in TC neurons was increased. These changes were associated with alterations in intrinsic properties and firing patterns of TC neurons, as well as intrathalamic and thalamocortical network oscillations, revealing a significant increase in slow oscillations in the delta frequency range (0.5-4 Hz) during episodes of active-wakefulness. In addition, absence of TRIP8b suppresses the normal desynchronization response of the EEG during the switch from slow-wave sleep to wakefulness. It is concluded that TRIP8b is necessary for the modulation of physiological thalamocortical oscillations due to its direct effect on HCN channel expression in thalamus and cortex and that mechanisms related to reduced cAMP signaling may contribute to the present findings.
International Nuclear Information System (INIS)
Tsukamoto, Yumiko; Uehara, Shoji; Mizoguchi, Chieko; Sato, Atsushi; Horikawa, Keisuke; Takatsu, Kiyoshi
2005-01-01
Mature B-2 cells expressing surface IgM and IgD proliferate upon stimulation by CD38, CD40 or lipopolysaccharide (LPS) and differentiate into IgG1-producing plasma cells in the presence of cytokines. The process of class switch recombination (CSR) from IgM to other isotypes is highly regulated by cytokines and activation-induced cytidine deaminase (AID). Blimp-1 and XBP-1 play an essential role in the terminal differentiation of switched B-2 cells to Ig-producing plasma cells. IL-5 induces AID and Blimp-1 expression in CD38- and CD40-activated B-2 cells, leading to μ to γ1 CSR at DNA level and IgG1 production. IL-4, a well-known IgG1-inducing factor, does not induce μ to γ1 CSR in CD38-activated B-2 cells or Blimp-1, while IL-4 induces μ to γ1 CSR, XBP-1 expression, and IgG1 production expression in CD40-activated B-2 cells. Interestingly, the addition of 8-mercaptoguanosine (8-SGuo) with IL-4 to the culture of CD38-activated B cells can induce μ to γ1 CSR, Blimp-1 expression, and IgG1 production. Intriguingly, 8-SGuo by itself induces AID expression in CD38-activated B cells. However, it does not induce μ to γ1 CSR. These results imply that the mode of B-cell activation for extracellular stimulation affects the outcome of cytokine stimulation with respect to the efficiency and direction of CSR, and the requirements of the transcriptional regulator and the generation of antibody-secreting cells. Furthermore, our data suggest the requirement of additional molecules in addition to AID for CSR
Panpetch, Wimonrat; Spinler, Jennifer K; Versalovic, James; Tumwasorn, Somying
2016-10-18
Interleukin (IL)-8 is the key agent for initiating an inflammatory response to infection with Helicobacter pylori. Some strains of Lactobacillus spp. are known to colonize the stomach and suppress inflammation caused by H. pylori. In this study, we characterized two gastric-derived lactobacilli, Lactobacillus salivarius (LS) strains B37 and B60, capable of inhibiting H. pylori-induced IL-8 production by gastric epithelial cells. Conditioned media from LS-B37 and LS-B60 suppressed H. pylori-induced IL-8 production and mRNA expression from AGS cells without inhibiting H. pylori growth. These conditioned media suppressed the activation of NF-κB but did not suppress c-Jun activation. IL-8 inhibitory substances in conditioned media of LS-B37 and LS-B60 are heat-stable and larger than 100 kDa in size. The inhibitory activity of LS-B37 was abolished when the conditioned medium was treated with α-amylase but still remained when treated with either proteinase K, trypsin, lipase or lysozyme. The activity of LS-B60 was abolished when the conditioned medium was treated with either amylase or proteinase K but still remained when treated with lysozyme. Treatment with lipase and trypsin also significantly affected the inhibitory activity of LS-B60 although the conditioned medium retained IL-8 suppression statistically different from media control. These results suggest that L. salivarius strains B37 and B60 produce different immunomodulatory factors capable of suppressing H. pylori-induced IL-8 production from gastric epithelial cells. Our results suggest that the large, heat-stable immunomodulatory substance(s) present in the LCM of LS-B37 is a polysaccharide, while the one(s) of LS-B60 is either complex consisting of components of polysaccharide, lipid and protein or includes multiple components such as glycoprotein and lipoprotein.
International Nuclear Information System (INIS)
Guo Changsheng; Xu Jian; He Yan; Zhang Yuan; Wang Yuqiu
2011-01-01
In this paper, two one-dimensional (1D) TiO 2 nanostructures, nanotube and nanowire were synthesized by a hydrothermal method using Degussa P25 TiO 2 as a precursor. The synthesized anatase TiO 2 nanotubes with the diameters of 10-20 nm and length of several hundred nanometers were formed from P25 and NaOH with the hydrothermal treatment temperature at 150 deg. C, and anatase TiO 2 nanowires with the diameters of 10-40 nm and length up to several micrometers were prepared at 180 deg. C. The photocatalytic activity of the two nanostructures was evaluated by degrading rhodamine B (RhB) and methyl orange (MO) in aqueous solutions under simulated solar light irradiation. The results suggested that the TiO 2 nanocatalysts displayed higher degradation activity compared to P25. For RhB, 98.9% and 91.9% of RhB were removed by nanotubes and nanowires, respectively after 60 min irradiation in comparison to the 81.8% removal by P25. Similar trend was observed for MO, with the removal percentage of 95.6%, 88.3% and 74.9%, respectively by TiO 2 nanotubes, nanowires and P25. Meanwhile, RhB and MO showed different photodegradation rates in nanotubes and nanowires suspensions, probably due to the morphology and crystal structure of the TiO 2 nanocatalysts which play important roles in the degradation activity of the catalysts.
International Nuclear Information System (INIS)
Lu Haitian; Crawford, Robert B.; Kaplan, Barbara L.F.; Kaminski, Norbert E.
2011-01-01
Suppression of the primary antibody response is particularly sensitive to suppression by 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD) in mice; however, surprisingly little is known concerning the effects of TCDD on humoral immunity or B cell function in humans. Results from a limited number of previous studies, primarily employing in vitro activation models, suggested that human B cell effector function is suppressed by TCDD. The present study sought to extend these findings by investigating, in primary human B cells, the effects of TCDD on several critical stages leading to antibody secretion including activation and plasmacytic differentiation using an in vitro CD40 ligand activation model. These studies revealed important differences in the response of human and mouse B cells to TCDD, the most striking being altered expression of plasmacytic differentiation regulators, B lymphocyte-induced maturation protein 1 and paired box protein 5, in mouse but not human B cells. The activation of human B cells was profoundly impaired by TCDD, as evidenced by decreased expression of activation markers CD80, CD86, and CD69. The impaired activation correlated with decreased cell viability, which prevented the progression of human B cells toward plasmacytic differentiation. TCDD treatment also attenuated the early activation of mitogen-activated protein kinases (MAPK) and Akt signaling in human B cells. Collectively, the present study provided experimental evidence for novel mechanisms by which TCDD impairs the effector function of primary human B cells. - Highlights: → In this study primary human and mouse B cell toxicity to TCDD was compared. → TCDD altered the expression of Blimp-1 and Pax5 in mouse but not human B cells. → TCDD markedly suppressed human B cell activation as characterized by CD80, CD86 and CD69 expression. → TCDD inhibited ERK, p38, and Akt phosphorylation in human B cells.
Relative phase asynchrony and long-range correlation of long-term solar magnetic activity
Deng, Linhua
2017-07-01
Statistical signal processing is one of the most important tasks in a large amount of areas of scientific studies, such as astrophysics, geophysics, and space physics. Phase recurrence analysis and long-range persistence are the two dynamical structures of the underlying processes for the given natural phenomenon. Linear and nonlinear time series analysis approaches (cross-correlation analysis, cross-recurrence plot, wavelet coherent transform, and Hurst analysis) are combined to investigate the relative phase interconnection and long-range correlation between solar activity and geomagnetic activity for the time interval from 1932 January to 2017 January. The following prominent results are found: (1) geomagnetic activity lags behind sunspot numbers with a phase shift of 21 months, and they have a high level of asynchronous behavior; (2) their relative phase interconnections are in phase for the periodic scales during 8-16 years, but have a mixing behavior for the periodic belts below 8 years; (3) both sunspot numbers and geomagnetic activity can not be regarded as a stochastic phenomenon because their dynamical behaviors display a long-term correlation and a fractal nature. We believe that the presented conclusions could provide further information on understanding the dynamical coupling of solar dynamo process with geomagnetic activity variation, and the crucial role of solar and geomagnetic activity in the long-term climate change.
Solar activity effects on cosmic ray intensity and geomagnetic field variation
International Nuclear Information System (INIS)
Shukla, A.K.; Shukla, J.P.; Sharma, S.M.; Singh, R.L.; Agrawal, S.P.
1978-01-01
An analysis has been performed to statistically correlate the date of solar flare occurrence and its importance with the short term cosmic ray intensity decreases (observed by the high latitude neutron monitors) as well as with the geomagnetic field fluctuation indices (Asub(p) and Dsub(st)), during the period 1973-1976. This period has the particular advantage of being close to a solar minimum to avoid the ambiguity due to closely spaced solar flares. It is found that the intensity decrease starts at least 2-3 days after the date of bright solar flares of Imp 1B, 2B or 3B and the amplitude of the decrease increases with the importance of the solar flare. (author)
Dynamics of ozone layer under Serbia and solar activity: Previous statement
Directory of Open Access Journals (Sweden)
Ducić Vladan
2008-01-01
Full Text Available The aim of this paper is to identify ozone layer dynamics under Serbian area, as well as possible relations of change in stratospheric ozone concentration with some parameters of solar activity. During the period 1979-2005, the statistical decrease of ozone concentration was noticed under Serbian territory cumulatively for 24.5 DU (7.2%, apropos 9.4 DU (2.8% by decade. These changes are consistent with the changes in surrounding countries. From absolute minimum 1993, flexible trend of ozone layer pentad values validate hypotheses of its recovery. Correspondence of ozone thickness extreme period with Wolf's number and with the greatest volcanic eruptions shows that interannual variations of stratospheric ozone concentration are still in the function of natural factors above all, as are solar and volcanic activities. Investigation of larger number solar activity parameters shows statistically important antiphase synchronous between the number of polar faculae on the Sun and stratospheric ozone dynamics under Serbia. Respecting that relation between these two features until now isn't depicted, some possible causal mechanisms are proposed.
Variability in equatorial B0 and B1
International Nuclear Information System (INIS)
Adeniyi, J.O.; Radicella, S.M.
2002-01-01
Variability of ionospheric profile parameters B0 and B1, below the F2 peak is investigated for an equatorial station at two levels of solar activities. The whole 24 hours of the day and the four seasons of the year are covered. Absolute and relative variability indices were utilized in the study. Some evidences of correlations of variability index and profiles parameters were observed. Daytime values of relative variability in B1 at solar minimum were found to be greater than those of solar maximum. (author)
DASL-Data and Activities for Solar Learning
Jones, Harrison P.; Henney, Carl; Hill, Frank; Gearen, Michael; Pompca, Stephen; Stagg, Travis; Stefaniak, Linda; Walker, Connie
2004-01-01
DASL-Data and Activities for Solar Learning Data and Activities for Solar Learning (DASL) provides a classroom learning environment based on a twenty-five year record of solar magnetograms from the National Solar Observatory (NSO) at Kitt Peak, AZ. The data, together with image processing software for Macs or PCs, can be used to learn basic facts about the Sun and astronomy at the middle school level. At the high school level, students can study properties of the Sun's magnetic cycle with classroom exercises emphasizing data and error analysis and can participate in a new scientific study, Research in Active Solar Longitudes (RASL), in collaboration with classrooms throughout the country and scientists at NSO and NASA. We present a half-day course to train teachers in the scientific content of the project and its classroom use. We will provide a compact disc with the data and software and will demonstrate software installation and use, classroom exercises, and participation in RASL with computer projection.
Synthesis of (±)-8-deisopropyladunctin B.
Nomura, Sayo; Arimitsu, Kenji; Yamaguchi, Satoshi; Kosuga, Yuya; Kakimoto, Yuko; Komai, Takanori; Hasegawa, Kazumasa; Nakanishi, Akira; Miyoshi, Tamami; Iwasaki, Hiroki; Ozeki, Minoru; Kawasaki, Ikuo; Kurume, Ai; Ohta, Shunsaku; Yamashita, Masayuki
2012-01-01
(±)-8-Deisopropyladunctin B, the deisopropyl form of adunctin B, which was isolated from the leaves of Piper aduncum (Piperaceae) collected in Papua New Guinea, was synthesized in 0.77% overall yield in 17 steps from 5,7-dimethoxycoumarin-3-carboxylate. The key step was our original stereoconvergent skeleton transformation from 1,2,2a,8b-tetrahydro-3H-benzo[b]cyclobuta[d]pyran-3-one to 1,2,4a,9b-tetrahydrodibenzofuran-4-ol with dimethylsulfoxonium methylide.
8-Amido-Bearing pseudomycin B (PSB) analogue: novel antifungal agents.
Zhang, Y Z; Sun, X; Zeckner, D J; Sachs, R K; Current, W L; Chen, S H
2001-01-22
During the course of a structure-activity relationship (SAR) study on novel depsinonapeptide pseudomycin B, we synthesized a total of 12 8-amidopseudomycin analogues via standard two-step sequence from either ZPSB 2 or AllocPSB 3. A number of these amides exhibited good in vitro antifungal activities.
Grifoni, D.; Carreras, G.; Zipoli, G.; Sabatini, F.; Dalla Marta, A.; Orlandini, S.
2008-11-01
Besides playing an essential role in plant photosynthesis, solar radiation is also involved in many other important biological processes. In particular, it has been demonstrated that ultraviolet (UV) solar radiation plays a relevant role in grapevines ( Vitis vinifera) in the production of certain important chemical compounds directly responsible for yield and wine quality. Moreover, the exposure to UV-B radiation (280-320 nm) can affect plant-disease interaction by influencing the behaviour of both pathogen and host. The main objective of this research was to characterise the solar radiative regime of a vineyard, in terms of photosynthetically active radiation (PAR) and UV components. In this analysis, solar spectral UV irradiance components, broadband UV (280-400 nm), spectral UV-B and UV-A (320-400 nm), the biological effective UVBE, as well as the PAR (400-700 nm) component, were all considered. The diurnal patterns of these quantities and the UV-B/PAR and UV-B/UV-A ratios were analysed to investigate the effect of row orientation of the vineyard in combination with solar azimuth and elevation angles. The distribution of PAR and UV irradiance at various heights of the vertical sides of the rows was also studied. The results showed that the highest portion of plants received higher levels of daily radiation, especially the UV-B component. Row orientation of the vines had a pronounced effect on the global PAR received by the two sides of the rows and, to a lesser extent, UV-A and UV-B. When only the diffused component was considered, this geometrical effect was greatly attenuated. UV-B/PAR and UV-A/PAR ratios were also affected, with potential consequences on physiological processes. Because of the high diffusive capacity of the UV-B radiation, the UV-B/PAR ratio was significantly lower on the plant portions exposed to full sunlight than on those in the shade.
International Nuclear Information System (INIS)
Kim, Young-Ho; Woo, Kyung Jin; Lim, Jun Hee; Kim, Shin; Lee, Tae Jin; Jung, Eun Mi; Lee, Jin-Man; Park, Jong-Wook; Kwon, Taeg Kyu
2005-01-01
In activated macrophage, large amounts of nitric oxide (NO) are generated by inducible nitric oxide synthase (iNOS), resulting in acute or chronic inflammatory disorders. In Raw 264.7 cells stimulated with lipopolysaccharide (LPS) to mimic inflammation, 8-hydroxyquinoline (8HQ) inhibited the LPS-induced expression of both iNOS protein and mRNA in a parallel dose-dependent manner. 8HQ did not enhance the degradation of iNOS mRNA. To investigate the mechanism by which 8HQ inhibits iNOS gene expression, we examined the activation of MAP kinases in Raw 264.7 cells. We did not observe any significant change in the phosphorylation of MAPKs between LPS alone and LPS plus 8HQ-treated cells. Moreover, 8HQ significantly inhibited the DNA-binding activity of nuclear factor-κB (NF-κB) and CCAAT/enhancer-binding protein β (C/EBPβ), but not activator protein-1 and cAMP response element-binding protein. Taken together, these results suggest that 8HQ acts to inhibit inflammation through inhibition of NO production and iNOS expression through blockade of C/EBPβ DNA-binding activity and NF-κB activation
Fonseca, Luis Vazquez; Doimo, Mara; Calderan, Cristina; Desbats, Maria Andrea; Acosta, Manuel J.; Cerqua, Cristina; Cassina, Matteo; Ashraf, Shazia; Hildebrandt, Friedhelm; Sartori, Geppo; Navas, Placido; Trevisson, Eva; Salviati, Leonardo
2018-01-01
Abstract Mutations in COQ8B cause steroid‐resistant nephrotic syndrome with variable neurological involvement. In yeast, COQ8 encodes a protein required for coenzyme Q (CoQ) biosynthesis, whose precise role is not clear. Humans harbor two paralog genes: COQ8A and COQ8B (previously termed ADCK3 and ADCK4). We have found that COQ8B is a mitochondrial matrix protein peripherally associated with the inner membrane. COQ8B can complement a ΔCOQ8 yeast strain when its mitochondrial targeting sequenc...
15 CFR 8b.4 - Discrimination prohibited.
2010-01-01
... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Discrimination prohibited. 8b.4 Section 8b.4 Commerce and Foreign Trade Office of the Secretary of Commerce PROHIBITION OF DISCRIMINATION... Provisions § 8b.4 Discrimination prohibited. (a) General. No qualified handicapped individual shall, on the...
15 CFR 8b.11 - Discrimination prohibited.
2010-01-01
... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Discrimination prohibited. 8b.11 Section 8b.11 Commerce and Foreign Trade Office of the Secretary of Commerce PROHIBITION OF DISCRIMINATION... Practices § 8b.11 Discrimination prohibited. (a) General. (1) No qualified handicapped individual shall, on...
15 CFR 8b.16 - Discrimination prohibited.
2010-01-01
... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Discrimination prohibited. 8b.16 Section 8b.16 Commerce and Foreign Trade Office of the Secretary of Commerce PROHIBITION OF DISCRIMINATION... Accessibility § 8b.16 Discrimination prohibited. No qualified handicapped individual shall, because a recipient...
Yang, Lifei; Yu, Xuegong; Hu, Weidan; Wu, Xiaolei; Zhao, Yan; Yang, Deren
2015-02-25
Graphene-silicon (Gr-Si) heterojunction solar cells have been recognized as one of the most low-cost candidates in photovoltaics due to its simple fabrication process. However, the high sheet resistance of chemical vapor deposited (CVD) Gr films is still the most important limiting factor for the improvement of the power conversion efficiency of Gr-Si solar cells, especially in the case of large device-active area. In this work, we have fabricated a novel transparent conductive film by hybriding a monolayer Gr film with silver nanowires (AgNWs) network soldered by the graphene oxide (GO) flakes. This Gr-AgNWs hybrid film exhibits low sheet resistance and larger direct-current to optical conductivity ratio, quite suitable for solar cell fabrication. An efficiency of 8.68% has been achieved for the Gr-AgNWs-Si solar cell, in which the AgNWs network acts as buried contacts. Meanwhile, the Gr-AgNWs-Si solar cells have much better stability than the chemically doped Gr-Si solar cells. These results show a new route for the fabrication of high efficient and stable Gr-Si solar cells.
Greenfield, Jamie A; Park, Philip S; Farahani, Ellie; Malik, Suneil; Vieth, Reinhold; McFarlane, Norman A; Shepherd, Theodore G; Knight, Julia A
2012-08-15
Exposure to solar ultraviolet-B (UV-B) radiation is a major source of vitamin D3. Chemistry climate models project decreases in ground-level solar erythemal UV over the current century. It is unclear what impact this will have on vitamin D status at the population level. The purpose of this study was to measure the association between ground-level solar UV-B and serum concentrations of 25-hydroxyvitamin D (25(OH)D) using a secondary analysis of the 2007 to 2009 Canadian Health Measures Survey (CHMS). Blood samples collected from individuals aged 12 to 79 years sampled across Canada were analyzed for 25(OH)D (n = 4,398). Solar UV-B irradiance was calculated for the 15 CHMS collection sites using the Tropospheric Ultraviolet and Visible Radiation Model. Multivariable linear regression was used to evaluate the association between 25(OH)D and solar UV-B adjusted for other predictors and to explore effect modification. Cumulative solar UV-B irradiance averaged over 91 days (91-day UV-B) prior to blood draw correlated significantly with 25(OH)D. Independent of other predictors, a 1 kJ/m² increase in 91-day UV-B was associated with a significant 0.5 nmol/L (95% CI 0.3-0.8) increase in mean 25(OH)D (P = 0.0001). The relationship was stronger among younger individuals and those spending more time outdoors. Based on current projections of decreases in ground-level solar UV-B, we predict less than a 1 nmol/L decrease in mean 25(OH)D for the population. In Canada, cumulative exposure to ambient solar UV-B has a small but significant association with 25(OH)D concentrations. Public health messages to improve vitamin D status should target safe sun exposure with sunscreen use, and also enhanced dietary and supplemental intake and maintenance of a healthy body weight.
Aging Converts Innate B1a Cells into Potent CD8+ T Cell Inducers.
Lee-Chang, Catalina; Bodogai, Monica; Moritoh, Kanako; Chen, Xin; Wersto, Robert; Sen, Ranjan; Young, Howard A; Croft, Michael; Ferrucci, Luigi; Biragyn, Arya
2016-04-15
B cell dysregulation in aging is thought to mostly occur in conventional B2 cells without affecting innate B1 cells. Elderly humans and mice also accumulate 4-1BBL(+)MHC class-I(Hi)CD86(Hi)B cells of unknown origin. In this article, we report that these cells, termed 4BL cells, are activated murine and possibly human B1a cells. The activation is mediated by aging human monocytes and murine peritoneal macrophages. They induce expression and activation of 4-1BBL and IFN-γR1 on B1a cells to subsequently upregulate membrane TNF-α and CD86. As a result, activated B1a/4BL cells induce expression of granzyme B in CD8(+)T cells by targeting TNFR2 via membrane TNF-α and providing costimulation with CD86. Thus, for the first time, to our knowledge, these results indicate that aging affects the function of B1a cells. Upon aging, these cells lose their tumor-supporting activity and become inducers of potentially antitumor and autoimmune CD8(+)T cells. Copyright © 2016 by The American Association of Immunologists, Inc.
Higher plant acclimation to solar ultraviolet-B radiation
International Nuclear Information System (INIS)
Robberecht, R.
1981-01-01
The objectives of this study were to determine: (1) the relationship between plant sensitivity and epidermal uv attenuation, (2) the effect of phenotypic changes in the leaf epidermis, resulting from uv-B exposure, on plant sensitivity to uv radiation, and (3) the platicity of these changes in the epidermis leading to plant acclimation to uv-B radiation. A mechanism of uv-B attenuation, possibly involving the biosynthesis of uv-absorbing flavonoid compounds in the epidermis and mesophyll under the stress of uv-B radiation, and a subsequent increase in the uv-B attenuation capacity of the epidermis, is suggested. The degree of plant sensitivity and acclimation to natural and intensified solar uv-B radiation may involve a dynamic balance between the capacity for uv-B attenuation and uv-radiation-repair mechanisms in the leaf
Search for outlying data points in multivariate solar activity data sets
International Nuclear Information System (INIS)
Bartkowiak, A.; Jakimiec, M.
1989-01-01
The aim of this paper is the investigation of outlying data points in the solar activity data sets. Two statistical methods for identifying of multivariate outliers are presented: the chi2-plot method based on the analysis of Mahalanobis distances and the method based on principal component analysis, i.e. on scatterdiagrams constructed from the first two or last two eigenvectors. We demonstrate the usefullness of these methods applying them to same data of solar activity. The methods allow to reveal quite precisely the data vectors containing some errors and also some untypical vectors, i.e. vectors with unusually large values or with values revealing untypical relations as compared with the common relations between the appropriate variables. 12 refs., 7 figs., 8 tabs. (author)
Active solar information dissemination activities
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-07-01
The principal objective of the project has been the development of an information dissemination strategy for the UK active solar heating industry. The project has also aimed to prepare the industry for the implementation of such a strategy and to produce initial information materials to support the early stages of the implementation process. (author)
Partial inhibition of in vitro pollen germination by simulated solar ultraviolet-B radiation
International Nuclear Information System (INIS)
Flint, S.D.; Caldwell, M.M.
1984-01-01
Pollen from four temperate-latitude taxa were treated with UV radiation in a portion of the UV-B (280-320 nm) waveband during in vitro germination. Inhibition of germination was noted in this pollen compared to samples treated identically except for the exclusion of the UV-B portion of the spectrum. Levels similar to maximum solar UV-B found in temperate-latitude areas failed to inhibit pollen germination significantly, while levels similar to maximum solar UV-B found in equatorial alpine locations caused partial inhibition of germination in three of the four taxa examined
Vazquez Fonseca, Luis; Doimo, Mara; Calderan, Cristina; Desbats, Maria Andrea; Acosta, Manuel J.; Cerqua, Cristina; Cassina, Matteo; Ashraf, Shazia; Hildebrandt, Friedhelm; Sartori, Geppo; Navas, Placido; Trevisson, Eva
2017-01-01
Abstract Mutations in COQ8B cause steroid‐resistant nephrotic syndrome with variable neurological involvement. In yeast, COQ8 encodes a protein required for coenzyme Q (CoQ) biosynthesis, whose precise role is not clear. Humans harbor two paralog genes: COQ8A and COQ8B (previously termed ADCK3 and ADCK4). We have found that COQ8B is a mitochondrial matrix protein peripherally associated with the inner membrane. COQ8B can complement a ΔCOQ8 yeast strain when its mitochondrial targeting sequence (MTS) is replaced by a yeast MTS. This model was employed to validate COQ8B mutations, and to establish genotype–phenotype correlations. All mutations affected respiratory growth, but there was no correlation between mutation type and the severity of the phenotype. In fact, contrary to the case of COQ2, where residual CoQ biosynthesis correlates with clinical severity, patients harboring hypomorphic COQ8B alleles did not display a different phenotype compared with those with null mutations. These data also suggest that the system is redundant, and that other proteins (probably COQ8A) may partially compensate for the absence of COQ8B. Finally, a COQ8B polymorphism, present in 50% of the European population (NM_024876.3:c.521A > G, p.His174Arg), affects stability of the protein and could represent a risk factor for secondary CoQ deficiencies or for other complex traits. PMID:29194833
Radar meteor rates and solar activity
International Nuclear Information System (INIS)
Prikryl, P.
1983-01-01
The short-term variation of diurnal radar meteor rates with solar activity represented by solar microwave flux Fsub(10.7), and sunspots relative number Rsub(z), is investigated. Applying the superposed-epoch analysis to the observational material of radar meteor rates from Christchurch (1960-61 and 1963-65), a decrease in the recorded radar rates is found during days of enhanced solar activity. No effect of geomagnetic activity similar to the one reported for the Swedish and Canadian radar meteor data was found by the author in the Christchurch data. A possible explanation of the absence of the geomagnetic effect on radar meteor rates from New Zealand due to a lower echo ceiling height of the Christchurch radar is suggested. The variation of the atmospheric parameters as a possible cause of the observed variation in radar meteor rates is also discussed. (author)
Solar activity simulation and forecast with a flux-transport dynamo
Macario-Rojas, Alejandro; Smith, Katharine L.; Roberts, Peter C. E.
2018-06-01
We present the assessment of a diffusion-dominated mean field axisymmetric dynamo model in reproducing historical solar activity and forecast for solar cycle 25. Previous studies point to the Sun's polar magnetic field as an important proxy for solar activity prediction. Extended research using this proxy has been impeded by reduced observational data record only available from 1976. However, there is a recognised need for a solar dynamo model with ample verification over various activity scenarios to improve theoretical standards. The present study aims to explore the use of helioseismology data and reconstructed solar polar magnetic field, to foster the development of robust solar activity forecasts. The research is based on observationally inferred differential rotation morphology, as well as observed and reconstructed polar field using artificial neural network methods via the hemispheric sunspot areas record. Results show consistent reproduction of historical solar activity trends with enhanced results by introducing a precursor rise time coefficient. A weak solar cycle 25, with slow rise time and maximum activity -14.4% (±19.5%) with respect to the current cycle 24 is predicted.
R. BHATTACHARYA; A. BHOUMICK
2012-01-01
Surface solar ultraviolet irradiance has been measured at Bakkhali (21.8ºN, 87.8ºE), a tropical rural station on the coast of Bay of Bengal, India in West Bengal. The measurements show a remarkable variation in UV-B load exists with a peak value at noon. The blockage of direct UV radiation in mangrove forest of costal site appears low when compared with UV load beneath the multiple trees of Mangifera indica in an inland site of Kalyani (22058' N, 88028' E), West Bengal. Mangrove forests have ...
Prediciting Solar Activity: Today, Tomorrow, Next Year
Pesnell, William Dean
2008-01-01
Fleets of satellites circle the Earth collecting science data, protecting astronauts, and relaying information. All of these satellites are sensitive at some level to space weather effects. Predictions of drag on LEO spacecraft are one of the most important. Launching a satellite with less fuel can mean a higher orbit, but unanticipated solar activity and increased drag can make that a Pyrrhic victory. Energetic events at the Sun can produce crippling radiation storms. Predicting those events that will affect our assets in space includes a solar prediction and how the radiation will propagate through the solar system. I will talk our need for solar activity predictions and anticipate how those predictions could be made more accurate in the future.
Energy Technology Data Exchange (ETDEWEB)
Xu Qingchi; Zhang Yan; He Ziming [Nanyang Technological University, School of Chemical and Biomedical Engineering (Singapore); Loo, Say Chye Joachim, E-mail: joachimloo@ntu.edu.sg [Nanyang Technological University, School of Materials Science and Engineering (Singapore); Tan, Timothy Thatt Yang, E-mail: tytan@ntu.edu.sg [Nanyang Technological University, School of Chemical and Biomedical Engineering (Singapore)
2012-08-15
This work reports an efficient visible and UV-light-activated boron and nitrogen codoped TiO{sub 2} porous film prepared via a 'green' and direct coating approach. Such photocatalyst is highly promising for solar depollution application due to its efficient photocatalytic activities in both visible and UV spectrum. The preparation method avoids the use of organic solvents, which are usually more expensive and hazardous compared with water. Using stearic acid as the model organic pollutant, the visible-light photocatalytic activity of optimized porous B-N-codoped TiO{sub 2} film (p-3B-N-TiO{sub 2}) is 3 times higher than that of porous N-doped TiO{sub 2} (p-N-TiO{sub 2}) film, while its UV photocatalytic activity is almost double that of p-N-TiO{sub 2} film and comparable to that of porous TiO{sub 2}. The enhancement in photocatalytic activity is attributed to higher surface area due to the porous structure, improved visible-light absorption attributed to interstitially substituted boron atoms, and coexistence of boron and nitrogen dopants which may reduce Ti{sup 3+} recombination centers.
Vazquez Fonseca, Luis; Doimo, Mara; Calderan, Cristina; Desbats, Maria Andrea; Acosta, Manuel J; Cerqua, Cristina; Cassina, Matteo; Ashraf, Shazia; Hildebrandt, Friedhelm; Sartori, Geppo; Navas, Placido; Trevisson, Eva; Salviati, Leonardo
2018-03-01
Mutations in COQ8B cause steroid-resistant nephrotic syndrome with variable neurological involvement. In yeast, COQ8 encodes a protein required for coenzyme Q (CoQ) biosynthesis, whose precise role is not clear. Humans harbor two paralog genes: COQ8A and COQ8B (previously termed ADCK3 and ADCK4). We have found that COQ8B is a mitochondrial matrix protein peripherally associated with the inner membrane. COQ8B can complement a ΔCOQ8 yeast strain when its mitochondrial targeting sequence (MTS) is replaced by a yeast MTS. This model was employed to validate COQ8B mutations, and to establish genotype-phenotype correlations. All mutations affected respiratory growth, but there was no correlation between mutation type and the severity of the phenotype. In fact, contrary to the case of COQ2, where residual CoQ biosynthesis correlates with clinical severity, patients harboring hypomorphic COQ8B alleles did not display a different phenotype compared with those with null mutations. These data also suggest that the system is redundant, and that other proteins (probably COQ8A) may partially compensate for the absence of COQ8B. Finally, a COQ8B polymorphism, present in 50% of the European population (NM_024876.3:c.521A > G, p.His174Arg), affects stability of the protein and could represent a risk factor for secondary CoQ deficiencies or for other complex traits. © 2017 The Authors. Human Mutation published by Wiley Periodicals, Inc.
WARM SPITZER OBSERVATIONS OF THREE HOT EXOPLANETS: XO-4b, HAT-P-6b, AND HAT-P-8b
Energy Technology Data Exchange (ETDEWEB)
Todorov, Kamen O. [Department of Astronomy and Astrophysics, The Pennsylvania State University, University Park, PA 16802 (United States); Deming, Drake [Planetary Systems Laboratory, NASA' s Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Knutson, Heather A. [Division of Geological and Planetary Sciences, California Institute of Technology, Pasadena, CA 91125 (United States); Burrows, Adam [Department of Astrophysical Sciences, Princeton University, Princeton, NJ 05844 (United States); Sada, Pedro V. [Department of Physics and Mathematics, University of Monterrey, Monterrey (Mexico); Cowan, Nicolas B. [Department of Physics and Astronomy, Northwestern University, Evanston, IL 60208 (United States); Agol, Eric [Department of Astronomy, University of Washington, Box 351580, Seattle, WA 98195 (United States); Desert, Jean-Michel; Charbonneau, David [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA 02138 (United States); Fortney, Jonathan J.; Laughlin, Gregory [Department of Astronomy and Astrophysics, University of California at Santa Cruz, Santa Cruz, CA 95064 (United States); Langton, Jonathan [Department of Physics, Principia College, Elsah, IL 62028 (United States); Showman, Adam P.; Lewis, Nikole K. [Lunar and Planetary Laboratory, University of Arizona, Tucson, AZ 85721 (United States)
2012-02-10
We analyze Warm Spitzer/Infrared Array Camera observations of the secondary eclipses of three planets, XO-4b, HAT-P-6b, and HAT-P-8b. We measure secondary eclipse amplitudes at 3.6 {mu}m and 4.5 {mu}m for each target. XO-4b exhibits a stronger eclipse depth at 4.5 {mu}m than at 3.6 {mu}m, which is consistent with the presence of a temperature inversion. HAT-P-8b shows a stronger eclipse amplitude at 3.6 {mu}m and is best described by models without a temperature inversion. The eclipse depths of HAT-P-6b can be fitted with models with a small or no temperature inversion. We consider our results in the context of a postulated relationship between stellar activity and temperature inversion and a relationship between irradiation level and planet dayside temperature, as discussed by Knutson et al. and Cowan and Agol, respectively. Our results are consistent with these hypotheses, but do not significantly strengthen them. To measure accurate secondary eclipse central phases, we require accurate ephemerides. We obtain primary transit observations and supplement them with publicly available observations to update the orbital ephemerides of the three planets. Based on the secondary eclipse timing, we set upper boundaries for ecos ({omega}) for HAT-P-6b, HAT-P-8b, and XO-4b and find that the values are consistent with circular orbits.
On the possible relations between solar activities and global seismicity in the solar cycle 20 to 23
Energy Technology Data Exchange (ETDEWEB)
Herdiwijaya, Dhani, E-mail: dhani@as.itb.ac.id [Astronomy Research Division and Bosscha Observatory, Faculty of Mathematics and Natural Sciences, Bandung Institute of Technology, Ganesha 10, Bandung, Indonesia 40132 (Indonesia); Arif, Johan [Geology Research Division, Faculty of Earth Sciences and Technology, Bandung Institute of Technology, Ganesha 10, Bandung, Indonesia 40132 (Indonesia); Nurzaman, Muhamad Zamzam; Astuti, Isna Kusuma Dewi [Astronomy Study Program, Faculty of Mathematics and Natural Sciences, Bandung Institute of Technology, Ganesha 10, Bandung, Indonesia 40132 (Indonesia)
2015-09-30
Solar activities consist of high energetic particle streams, electromagnetic radiation, magnetic and orbital gravitational forces. The well-know solar activity main indicator is the existence of sunspot which has mean variation in 11 years, named by solar cycle, allow for the above fluctuations. Solar activities are also related to the space weather affecting all planetary atmospheric variability, moreover to the Earth’s climate variability. Large extreme space and geophysical events (high magnitude earthquakes, explosive volcanic eruptions, magnetic storms, etc.) are hazards for humankind, infrastructure, economies, technology and the activities of civilization. With a growing world population, and with modern reliance on delicate technological systems, human society is becoming increasingly vulnerable to natural hazardous events. The big question arises to the relation between solar forcing energy to the Earth’s global seismic activities. Estimates are needed for the long term occurrence-rate probabilities of these extreme natural hazardous events. We studied connectivity from yearly seismic activities that refer to and sunspot number within the solar cycle 20 to 23 of year 1960 to 2013 (53 years). We found clear evidences that in general high magnitude earthquake events and their depth were related to the low solar activity.
On the possible relations between solar activities and global seismicity in the solar cycle 20 to 23
Herdiwijaya, Dhani; Arif, Johan; Nurzaman, Muhamad Zamzam; Astuti, Isna Kusuma Dewi
2015-09-01
Solar activities consist of high energetic particle streams, electromagnetic radiation, magnetic and orbital gravitational forces. The well-know solar activity main indicator is the existence of sunspot which has mean variation in 11 years, named by solar cycle, allow for the above fluctuations. Solar activities are also related to the space weather affecting all planetary atmospheric variability, moreover to the Earth's climate variability. Large extreme space and geophysical events (high magnitude earthquakes, explosive volcanic eruptions, magnetic storms, etc.) are hazards for humankind, infrastructure, economies, technology and the activities of civilization. With a growing world population, and with modern reliance on delicate technological systems, human society is becoming increasingly vulnerable to natural hazardous events. The big question arises to the relation between solar forcing energy to the Earth's global seismic activities. Estimates are needed for the long term occurrence-rate probabilities of these extreme natural hazardous events. We studied connectivity from yearly seismic activities that refer to and sunspot number within the solar cycle 20 to 23 of year 1960 to 2013 (53 years). We found clear evidences that in general high magnitude earthquake events and their depth were related to the low solar activity.
Fan, Lin; Wang, Fengyou; Liang, Junhui; Yao, Xin; Fang, Jia; Zhang, Dekun; Wei, Changchun; Zhao, Ying; Zhang, Xiaodan
2017-01-01
A rising candidate for upgrading the performance of an established narrow-bandgap solar technology without adding much cost is to construct the tandem solar cells from a crystalline silicon bottom cell and a high open-circuit voltage top cell. Here, we present a four-terminal tandem solar cell architecture consisting of a self-filtered planar architecture perovskite top cell and a silicon heterojunction bottom cell. A transparent ultrathin gold electrode has been used in perovskite solar cells to achieve a semi-transparent device. The transparent ultrathin gold contact could provide a better electrical conductivity and optical reflectance-scattering to maintain the performance of the top cell compared with the traditional metal oxide contact. The four-terminal tandem solar cell yields an efficiency of 14.8%, with contributions of the top (8.98%) and the bottom cell (5.82%), respectively. We also point out that in terms of optical losses, the intermediate contact of self-filtered tandem architecture is the uppermost problem, which has been addressed in this communication, and the results show that reducing the parasitic light absorption and improving the long wavelength range transmittance without scarifying the electrical properties of the intermediate hole contact layer are the key issues towards further improving the efficiency of this architecture device. Project supported by the International Cooperation Projects of the Ministry of Science and Technology (No. 2014DFE60170), the National Natural Science Foundation of China (Nos. 61474065, 61674084), the Tianjin Research Key Program of Application Foundation and Advanced Technology (No. 15JCZDJC31300), the Key Project in the Science & Technology Pillar Program of Jiangsu Province (No. BE2014147-3), and the 111 Project (No. B16027).
Solar Energy Education. Home economics: student activities. Field test edition
Energy Technology Data Exchange (ETDEWEB)
1981-03-01
A view of solar energy from the standpoint of home economics is taken in this book of activities. Students are provided information on solar energy resources while performing these classroom activities. Instructions for the construction of a solar food dryer and a solar cooker are provided. Topics for study include window treatments, clothing, the history of solar energy, vitamins from the sun, and how to choose the correct solar home. (BCS)
Study of an active wall solar heating system
International Nuclear Information System (INIS)
Kassem, Talal
2006-01-01
An active wall solar heating system was built and tested. In the same time a compatible computer program has been according to set the recommended dimensions for the solar collectors where (F-Chart) method used to set the ratio of monthly solar sharing average for the examined heating system. Some parameters, such as collectors' areas, its tilt angle and near earth reflecting were experimentally investigated, affecting the executed active solar heating system performance. The study explain the ability of using this system which is simple, Low coast and high performance in heating residential and public buildings and heating water with ratio of yearly solar sharing achieves the needed saving of using this system.(Author)
Ito, Daisuke; Nojima, Satoshi; Nishide, Masayuki; Okuno, Tatsusada; Takamatsu, Hyota; Kang, Sujin; Kimura, Tetsuya; Yoshida, Yuji; Morimoto, Keiko; Maeda, Yohei; Hosokawa, Takashi; Toyofuku, Toshihiko; Ohshima, Jun; Kamimura, Daisuke; Yamamoto, Masahiro; Murakami, Masaaki; Morii, Eiichi; Rakugi, Hiromi; Isaka, Yoshitaka; Kumanogoh, Atsushi
2015-08-01
Mammalian target of rapamycin (mTOR) plays crucial roles in activation and differentiation of diverse types of immune cells. Although several lines of evidence have demonstrated the importance of mTOR-mediated signals in CD4(+) T cell responses, the involvement of mTOR in CD8(+) T cell responses is not fully understood. In this study, we show that a class IV semaphorin, SEMA4A, regulates CD8(+) T cell activation and differentiation through activation of mTOR complex (mTORC) 1. SEMA4A(-/-) CD8(+) T cells exhibited impairments in production of IFN-γ and TNF-α and induction of the effector molecules granzyme B, perforin, and FAS-L. Upon infection with OVA-expressing Listeria monocytogenes, pathogen-specific effector CD8(+) T cell responses were significantly impaired in SEMA4A(-/-) mice. Furthermore, SEMA4A(-/-) CD8(+) T cells exhibited reduced mTORC1 activity and elevated mTORC2 activity, suggesting that SEMA4A is required for optimal activation of mTORC1 in CD8(+) T cells. IFN-γ production and mTORC1 activity in SEMA4A(-/-) CD8(+) T cells were restored by administration of recombinant Sema4A protein. In addition, we show that plexin B2 is a functional receptor of SEMA4A in CD8(+) T cells. Collectively, these results not only demonstrate the role of SEMA4A in CD8(+) T cells, but also reveal a novel link between a semaphorin and mTOR signaling. Copyright © 2015 by The American Association of Immunologists, Inc.
Spectral Analysis of Geomagnetic Activity Indices and Solar Wind Parameters
Directory of Open Access Journals (Sweden)
Jung-Hee Kim
2014-06-01
Full Text Available Solar variability is widely known to affect the interplanetary space and in turn the Earth’s electromagnetical environment on the basis of common periodicities in the solar and geomagnetic activity indices. The goal of this study is twofold. Firstly, we attempt to associate modes by comparing a temporal behavior of the power of geomagnetic activity parameters since it is barely sufficient searching for common peaks with a similar periodicity in order to causally correlate geomagnetic activity parameters. As a result of the wavelet transform analysis we are able to obtain information on the temporal behavior of the power in the velocity of the solar wind, the number density of protons in the solar wind, the AE index, the Dst index, the interplanetary magnetic field, B and its three components of the GSM coordinate system, BX, BY, BZ. Secondly, we also attempt to search for any signatures of influence on the space environment near the Earth by inner planets orbiting around the Sun. Our main findings are as follows: (1 Parameters we have investigated show periodicities of ~ 27 days, ~ 13.5 days, ~ 9 days. (2 The peaks in the power spectrum of BZ appear to be split due to an unknown agent. (3 For some modes powers are not present all the time and intervals showing high powers do not always coincide. (4 Noticeable peaks do not emerge at those frequencies corresponding to the synodic and/or sidereal periods of Mercury and Venus, which leads us to conclude that the Earth’s space environment is not subject to the shadow of the inner planets as suggested earlier.
Solar wind fluctuations at large scale - A comparison between low and high solar activity conditions
Bavassano, B.; Bruno, R.
1991-02-01
The influence of the sun's activity cycle on the solar wind fluctuations at time scales from 1 hour to 3 days in the inner heliosphere (0.3 to 1 AU) is investigated. Hourly averages of plasma and magnetic field data by Helios spacecraft are used. Since fluctuations behave quite differently with changing scale, the analysis is performed separately for two different ranges in time scale. Between 1 and 6 hours Alfvenic fluctuations and pressure-balanced structures are extensively observed. At low solar activity and close to 0.3 AU Alfvenic fluctuations are more frequent than pressure-balanced structures. This predominance, however, weakens for rising solar activity and radial distance, to the point that a role-exchange, in terms of occurrence rate, is found at the maximum of the cycle close to 1 AU. On the other hand, in all cases Alfvenic fluctuations have a larger amplitude than pressure-balanced structures. The Alfvenic contribution to the solar wind energy spectrum comes out to be dominant at all solar activity conditions. These findings support the conclusion that the solar cycle evolution of the large-scale velocity pattern is the factor governing the observed variations.
Directory of Open Access Journals (Sweden)
B. T. Tsurutani
2011-05-01
Full Text Available Minima in geomagnetic activity (MGA at Earth at the ends of SC23 and SC22 have been identified. The two MGAs (called MGA23 and MGA22, respectively were present in 2009 and 1997, delayed from the sunspot number minima in 2008 and 1996 by ~1/2–1 years. Part of the solar and interplanetary causes of the MGAs were exceptionally low solar (and thus low interplanetary magnetic fields. Another important factor in MGA23 was the disappearance of equatorial and low latitude coronal holes and the appearance of midlatitude coronal holes. The location of the holes relative to the ecliptic plane led to low solar wind speeds and low IMF (Bz variances (σBz2 and normalized variances (σBz2/B02 at Earth, with concomitant reduced solar wind-magnetospheric energy coupling. One result was the lowest ap indices in the history of ap recording. The results presented here are used to comment on the possible solar and interplanetary causes of the low geomagnetic activity that occurred during the Maunder Minimum.
Paulusma, Coen C.; Folmer, Dineke E.; Ho-Mok, Kam S.; de Waart, D. Rudi; Hilarius, Petra M.; Verhoeven, Arthur J.; Oude Elferink, Ronald P. J.
2008-01-01
Mutations in ATP8B1 cause progressive familial intrahepatic cholestasis type 1 and benign recurrent intrahepatic cholestasis type 1. Previously, we have shown in mice that Atp8b1 deficiency leads to enhanced biliary excretion of phosphatidylserine, and we hypothesized that ATP8B1 is a flippase for
Optimization of a PV/T (photovoltaic/thermal) active solar still
International Nuclear Information System (INIS)
Saeedi, F.; Sarhaddi, F.; Behzadmehr, A.
2015-01-01
In this paper, the optimization of a PV/T (photovoltaic/thermal) active solar still is carried out. Analytical expressions for glass cover temperature, basin temperature, brackish water temperature and fresh water productivity are obtained by writing energy balance for different components of PV/T active solar still. The output electrical power of PV/T active solar still is calculated by four-parameter I–V (current–voltage) model. Objective function in present study is the energy efficiency of PV/T active solar still. A computer simulation program has been developed in order to obtain thermal and electrical parameters, respectively. The simulation results of the present study are in fair agreement with the experimental data of previous literatures. Finally, the optimization of PV/T active solar still has been carried out and the optimized value of mass flow rate, number of PV/T collector and the objective function have been obtained. Furthermore, the effect of various operating parameters on energy efficiency have been investigated. - Highlights: • The comprehensive optimization of a PV/T active solar still is carried out. • Present study is based on numerical simulation. • A modified energy efficiency for PV/T active solar still is obtained. • The effect of design and operating parameters is investigated on energy efficiency
Solar-terrestrial disturbances of June-September 1982, 2
International Nuclear Information System (INIS)
Kumagai, Hiroshi; Ohbu, Kouji; Ouchi, Choshichi; Isobe, Takeshi; Hori, Toshihiro; Ouchi, Eiji
1985-01-01
The outline of the solar activity during the period from June to September 1982 is given. During this period, several extremely developed active regions appeared on the solar disk and produced severe solar-terrestrial disturbances which we had not experienced since August 1972. In June and July, significant solar activities were brought about by the active regions 3763, 3776, and 3804. These regions frequently produced large flares of the highest class of importances in both Hsub(a) and X-ray intensities. However, the geomagnetic disturbances scarcely developed in June. The 3B/X7 flare on July 12 occurred in the region 3804 and caused the largest proton event and geomagnetic storm in this solar cycle. In August and September, flare occurrences were fewer than before. The 2B/M6 and 3N/M4 flares occurred in the region 3886 on September 4, and 2B/C9 flare occurred in the region 3907 on September 19. They are considered to cause two major geomagnetic storms which started on September 5 and 21, respectively. It seems remarkable that significant flares which occurred during these periods were produced by the same active region maintaining activities for more than ten solar rotations; 3776, 3804, and 3886 belonged to the same region in different solar rotations. (author)
Solar-Type Activity in Main-Sequence Stars
Gershberg, Roald E
2005-01-01
Solar-type activity over the whole range of the electromagnetic spectrum is a phenomenon inherent in the majority of low- and moderate-mass main sequence stars. In this monograph observational results are summarized in a systematic and comprehensive fashion. The analysis of the various manifestations of such stellar activity leads to the identification of these phenomena with macroscopic non-linear processes in a magnetized plasma. Comparative study of flare stars and the Sun has become increasingly fruitful and is presently an active field of research involving stellar and solar physicists, experts in plasma physics and high-energy astrophysicists. This book will provide them with both an introduction and overview of observational results from the first optical photometry and spectroscopy, from the satellite telescopes International Ultraviolet Explorer to Hubble Space Telescope, XMM-Newton and Chandra, as well as with the present physical interpretation of solar-type activity in main sequence stars. Gershbe...
Guruprasad, Kadur; Kadur, Guruprasad; Bhattacharjee, Swapan; Swapan, Bhattacharjee; Kataria, Sunita; Sunita, Kataria; Yadav, Sanjeev; Sanjeev, Yadav; Tiwari, Arjun; Arjun, Tiwari; Baroniya, Sanjay; Sanjay, Baroniya; Rajiv, Abhinav; Abhinav, Rajiv; Mohanty, Prasanna
2007-01-01
Exclusion of UV (280-380 nm) radiation from the solar spectrum can be an important tool to assess the impact of ambient UV radiation on plant growth and performance of crop plants. The effect of exclusion of UV-B and UV-A from solar radiation on the growth and photosynthetic components in soybean (Glycine max) leaves were investigated. Exclusion of solar UV-B and UV-B/A radiation, enhanced the fresh weight, dry weight, leaf area as well as induced a dramatic increase in plant height, which reflected a net increase in biomass. Dry weight increase per unit leaf area was quite significant upon both UV-B and UV-B/A exclusion from the solar spectrum. However, no changes in chlorophyll a and b contents were observed by exclusion of solar UV radiation but the content of carotenoids was significantly (34-46%) lowered. Analysis of chlorophyll (Chl) fluorescence transient parameters of leaf segments suggested no change in the F v/F m value due to UV-B or UV-B/A exclusion. Only a small reduction in photo-oxidized signal I (P700+)/unit Chl was noted. Interestingly the total soluble protein content per unit leaf area increased by 18% in UV-B/A and 40% in UV-B excluded samples, suggesting a unique upregulation of biosynthesis and accumulation of biomass. Solar UV radiation thus seems to primarily affect the photomorphogenic regulatory system that leads to an enhanced growth of leaves and an enhanced rate of net photosynthesis in soybean, a crop plant of economic importance. The presence of ultra-violet components in sunlight seems to arrest carbon sequestration in plants.
Solar wind fluctuations at large scale: A comparison between low and high solar activity conditions
International Nuclear Information System (INIS)
Bavassano, B.; Bruno, R.
1991-01-01
The influence of the Sun's activity cycle on the solar wind fluctuations at time scales from 1 hour to 3 days in the inner heliosphere (0.3 to 1 AU) is investigated. Hourly averages of plasma and magnetic field data by Helios spacecraft are used. Since fluctuations behave quite differently with changing scale, the analysis is performed separately for two different ranges in time scale. Between 1 and 6 hours Alfvenic fluctuations and pressure-balanced structures are extensively observed. At low solar activity and close to 0.3 AU, Alfvenic fluctuations are more frequent than pressure-balanced structures. This predominance, however, weakens for rising solar activity and radial distance, to the point that a role exchange, in terms of occurrence rate, is found at the maximum of the cycle close to 1 AU. On the other hand, in all cases Alfvenic fluctuations have a larger amplitude than pressure-balanced structures. On the whole, the Alfvenic contribution to the solar wind energy spectrum comes out to be dominant at all solar activity conditions. At scales from 0.5 to 3 days the most important feature is the growth, as the solar wind expansion develops, of strong positive correlations between magnetic and thermal pressures. These structures are progressively built up by the interaction between different wind flows. This effect is more pronounced at low than at high activity. Our findings support the conclusion that the solar cycle evolution of the large-scale velocity pattern is the factor governing the observed variations
Danish participation in the IEA solar cell activities
International Nuclear Information System (INIS)
1994-05-01
In the 12-month period 01.05.93 - 30.04.94 the Danish activities in the IEA 'Solar Cell Agreement' consisted in: participation in the Executive Committee (ExCo) and participation in Task 1 'Exchange and Dissemination of Information on PV Power Systems'. ExCo has meetings every half-year and is a coordinating organ for the Agreement. Work on the Task 1 is organized in 4 subtasks: (1) mapping of solar cell activities in the OECD countries and preparation of an IEA handbook on solar cell technology; (2) publishing of a semiannual newsletter about the agreement; (3) an 'executive conference' on solar cell technology and its uses with participation of the decision-makers in respective power industries; (4) information dissemination whenever required. Demonstration projects, like a photovoltaic roof-integrated system connected to the grid. have been implemented. Three larger solar cell projects, subsidized by the EU means, comprehend 'real time monitoring' by a solar system, WHO project 'Solar Energy Applications for Primary Health Care Clinics for Remote Rural Areas' (SAPHIR) and a grid-connected photovoltaic system in a suburb residential settlement. (EG)
Study of non-domestic applications for active solar heating
Energy Technology Data Exchange (ETDEWEB)
Stammers, J.R.
1997-11-01
The UK Department of Trade and Industry (through ETSU) commissioned this study as part of its active solar programme. It was carried out from October 1996 to June 1997. The objective was to assess the potential for the use of active solar heating in non-domestic applications. The study was carried out by searching the literature, carrying out case studies and interviewing members of the solar industry and experts in other fields. There are currently about 45-50 active solar non-domestic schemes in operation in the UK, mostly for heating tap water in buildings of different types. The biggest potential for future non-domestic sales also lies in solar water heating for buildings. Most of the opportunities seem to be in the following building types: ablutions blocks in caravan and holiday camps, sheltered flats and hostels, nursing homes, office buildings, hotels and guest houses, and schools occupied during the summer. There are some other building types which might present niche markets for solar water heating. The market for active solar systems in space heating and cooling appears to be negligible. There is one other market for active solar heating in the non-domestic building sector. This is for warming water used to maintain stand-by generators at a temperature which allows them to kick in without delay in the event of a mains power failure. The main market is in buildings housing computers which control the provision of vital services, e.g. electricity, water and gas. (author)
15 CFR 8b.18 - New construction.
2010-01-01
... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false New construction. 8b.18 Section 8b.18... construction. (a) Design and construction. Each facility or part of a facility constructed by, on behalf of, or... construction was commenced after the effective date of this part. (b) Alteration. Each facility or part of a...
Magnetic activity effect on equatorial spread-F under high and low solar activity conditions
Energy Technology Data Exchange (ETDEWEB)
Subbarao, K S.V.; Somayajulu, V V; Krishna Murthy, B V
1986-08-01
The effect of magnetic activity on spread-F at two equatorial stations, Trivandrum and Huancayo, separated in longitude by about 150 deg, under high and low solar activity conditions has been investigated. Magnetic activity produces strong inhibition effect on spread-F at Huancayo compared to that at Trivandrum especially during high solar activity period. This results in a decrease of spread-F with solar activity at Huancayo in contrast to Trivandrum. These findings are explained in terms of F-region electrodynamics and Rayleigh-Taylor instability mechanism for spread-F.
Manifestation of solar activity in solar wind particle flux density
International Nuclear Information System (INIS)
Kovalenko, V.A.
1988-01-01
An analysis has been made of the origin of long-term variations in flux density of solar wind particles (nv) for different velocity regimes. The study revealed a relationship of these variations to the area of the polar coronal holes (CH). It is shown that within the framework of the model under development, the main longterm variations of nv are a result of the latitude redistribution of the solar wind mass flux in the heliosphere and are due to changes in the large-scale geometry of the solar plasma flow in the corona. A study has been made of the variations of nv for high speed solar wind streams. It is found that nv in high speed streams which are formed in CH, decreases from minimum to maximum solar activity. The analysis indicates that this decrease is attributable to the magnetic field strength increase in coronal holes. It has been found that periods of rapid global changes of background magnetic fields on the Sun are accompanied by a reconfiguration of coronal magnetic fields, rapid changes in the length of quiescent filaments, and by an increase in the density of the particle flux of a high speed solar wind. It has been established that these periods precede the formation of CH, corresponding to the increase in solar wind velocity near the Earth and to enhancement of the level of geomagnetic disturbance. (author)
71-Mbit/s ultraviolet-B LED communication link based on 8-QAM-OFDM modulation.
Sun, Xiaobin; Zhang, Zhenyu; Chaaban, Anas; Ng, Tien Khee; Shen, Chao; Chen, Rui; Yan, Jianchang; Sun, Haiding; Li, Xiaohang; Wang, Junxi; Li, Jinmin; Alouini, Mohamed-Slim; Ooi, Boon S
2017-09-18
A demonstration of ultraviolet-B (UVB) communication link is implemented utilizing quadrature amplitude modulation (QAM) orthogonal frequency-division multiplexing (OFDM). The demonstration is based on a 294-nm UVB-light-emitting-diode (UVB-LED) with a full-width at half-maximum (FWHM) of 9 nm and light output power of 190 μW, at 7 V, with a special silica gel lens on top of it. A -3-dB bandwidth of 29 MHz was measured and a high-speed near-solar-blind communication link with a data rate of 71 Mbit/s was achieved using 8-QAM-OFDM at perfect alignment. 23.6 Mbit/s using 2-QAM-OFDM when the angle subtended by the pointing directions of the UVB-LED and photodetector (PD) is 12 degrees, thus establishing a diffuse-line-of-sight (LOS) link. The measured bit-error rate (BER) of 2.8 ×10 -4 and 2.4 ×10 -4 , respectively, are well below the forward error correction (FEC) criterion of 3.8 ×10 -3 . The demonstrated high data-rate OFDM-based UVB communication link paves the way for realizing high-speed non-line-of-sight free-space optical communications.
Vitaly, Ishkov
A reliable series of the relative numbers of sunspots (14 solar cycles ‒ 165 years) it leads to the only scenario of solar activity cycles - to the alternation of epochs of “increased” (18 ‒ 22 cycles of solar activity) and “lowered” (12 ‒ 16 and 24 ‒ ...) solar activity with the periods of solar magnetic field reconstruction in solar zone of the sunspots formation (11, 12, 23) from one epoch to another. The regime of the produce of magnetic field significantly changes in these periods, providing to the subsequent 5 cycles the stable conditions of solar activity. Space solar research made it possible to sufficiently fully investigate characteristics and parameters of the solar cycles for the epoch of “increased” (20 ‒ 22 cycles) solar activity and period of the reconstruction (22 ‒ 23 cycles) to the epoch of “lowered” solar activity (24 ‒ ... cycles). In this scenario 24 solar cycle is the first solar cycle of the second epoch of “lowered” solar activity. Therefore his development and characteristics roughly must be described in the context of the low solar cycles development (12, 14, and 16). In the current solar cycle the sunspot-forming activity is lowered, the average areas of the sunspot groups correspond to values for epoch of “lowered “solar activity, average magnetic field in the umbra of sunspots was reduced approximately to 700 gauss, and for this time was observed only 4 very large sunspot groups (≥1500 mvh). Flare activity substantially was lowered: for the time of the current solar cycle development it was occurrence of M-class flares M - 368, class X - 32, from which only 2 solar flares of class X> 5. Solar proton events are observed predominantly small intensity; but only 5 from them were the intensity of ≥100 pfu (S2) and 4 - ≥1000 pfu (S3). The first five years of the 24 cycle evolution confirm this assumption and the possibility to give the qualitative forecast of his evolution and development of the
Solar Neutrino Observables Sensitive to Matter Effects
Directory of Open Access Journals (Sweden)
H. Minakata
2012-01-01
Full Text Available We discuss constraints on the coefficient AMSW which is introduced to simulate the effect of weaker or stronger matter potential for electron neutrinos with the current and future solar neutrino data. The currently available solar neutrino data leads to a bound AMSW=1.47+0.54−0.42(+1.88−0.82 at 1σ (3σ CL, which is consistent with the Standard Model prediction AMSW=1. For weaker matter potential (AMSW1, the bound is milder and is dominated by the day-night asymmetry of 8B neutrino flux recently observed by Super-Kamiokande. Among the list of observables of ongoing and future solar neutrino experiments, we find that (1 an improved precision of the day-night asymmetry of 8B neutrinos, (2 precision measurements of the low-energy quasi-monoenergetic neutrinos, and (3 the detection of the upturn of the 8B neutrino spectrum at low energies are the best choices to improve the bound on AMSW.
Heliophysics: Evolving Solar Activity and the Climates of Space and Earth
Schrijver, Carolus J.; Siscoe, George L.
2012-01-01
Preface; 1. Interconnectedness in heliophysics Carolus J. Schrijver and George L. Siscoe; 2. Long-term evolution of magnetic activity of Sun-like stars Carolus J. Schrijver; 3. Formation and early evolution of stars and proto-planetary disks Lee W. Hartmann; 4. Planetary habitability on astronomical time scales Donald E. Brownlee; 5. Solar internal flows and dynamo action Mark S. Miesch; 6. Modeling solar and stellar dynamos Paul Charbonneau; 7. Planetary fields and dynamos Ulrich R. Christensen; 8. The structure and evolution of the 3D solar wind John T. Gosling; 9. The heliosphere and cosmic rays J. Randy Jokipii; 10. Solar spectral irradiance: measurements and models Judith L. Lean and Thomas N. Woods; 11. Astrophysical influences on planetary climate systems Juerg Beer; 12. Evaluating the drivers of Earth's climate system Thomas J. Crowley; 13. Ionospheres of the terrestrial planets Stanley C. Solomon; 14. Long-term evolution of the geospace climate Jan J. Sojka; 15. Waves and transport processes in atmospheres and oceans Richard L. Walterscheid; 16. Solar variability, climate, and atmospheric photochemistry Guy P. Brasseur, Daniel Marsch and Hauke Schmidt; Appendix I. Authors and editors; List of illustrations; List of tables; Bibliography; Index.
International Nuclear Information System (INIS)
Patil, Ashokrao B.; Patil, Kashinath R.; Pardeshi, Satish K.
2011-01-01
B-doped ZnO and N-doped ZnO powders have been synthesized by mechanochemical method and characterized by TG–DTA, XRD, SEM–EDX, XPS, UV–visible and photoluminescence (PL) spectra. X-ray diffraction data suggests the hexagonal wurtzite structure for modified ZnO crystallites and the incorporation of nonmetal expands the lattice constants of ZnO. The room temperature PL spectra suggest more number of oxygen vacancies exist in nonmetal-doped ZnO than that of undoped zinc oxide. XPS analysis shows the substitution of some of the O atoms of ZnO by nonmetal atoms. Solar photocatalytic activity of B-doped ZnO, N-doped ZnO and undoped ZnO was compared by means of oxidative photocatalytic degradation (PCD) of Bisphenol A (BPA). B-doped ZnO showed better solar PCD efficiency as compare to N-doped ZnO and undoped ZnO. The PCD of BPA follows first order reaction kinetics. The detail mechanism of PCD of Bisphenol A was proposed with the identification of intermediates such as hydroquinone, benzene-1,2,4-triol and 4-(2-hydroxypropan-2-yl) phenol. - Graphical Abstract: B-doped ZnO and N-doped ZnO synthesized by mechanochemical method were characterized by various techniques. Solar photocatalytic degradation of Bisphenol-A is in the order of B-ZnO>N-ZnO>ZnO. Highlights: ► B-doped ZnO and N-doped ZnO powders have been synthesized by mechanochemical method. ► PL spectra suggest oxygen vacancies are in order of B-doped ZnO>N-doped ZnO>ZnO. ► Solar PCD efficiency is in order of B-doped ZnO>N-doped ZnO>ZnO for Bisphenol A.
The active thermal solar; Le solaire thermique actif
Energy Technology Data Exchange (ETDEWEB)
Bedel, St.; Salomon, Th.
2000-05-01
This information paper recalls the different types of solar cells and their operating. It presents the possible utilizations for the buildings heating (air and water systems) and for the water heating in the residential houses (also for the heating of swimming pools) and the collective buildings. The drying of agricultural products and the solar cooling are also discussed. (A.L.B.)
Martin, Elliot; Shreim, Amer; Paczuski, Maya
2010-01-01
We define an activity-dependent branching ratio that allows comparison of different time series X(t). The branching ratio b(x) is defined as b(x)=E[xi(x)/x]. The random variable xi(x) is the value of the next signal given that the previous one is equal to x, so xi(x)=[X(t+1) | X(t)=x]. If b(x)>1, the process is on average supercritical when the signal is equal to x, while if b(x)efficient market hypothesis." For stock volumes, solar x-ray flux intensities, and the Bak-Tang-Wiesenfeld (BTW) sandpile model, b(x) is supercritical for small values of activity and subcritical for the largest ones, indicating a tendency to return to a typical value. For stock volumes this tendency has an approximate power-law behavior. For solar x-ray flux and the BTW model, there is a broad regime of activity where b(x) approximately equal 1, which we interpret as an indicator of critical behavior. This is true despite different underlying probability distributions for X(t) and for xi(x). For the BTW model the distribution of xi(x) is Gaussian, for x sufficiently larger than 1, and its variance grows linearly with x. Hence, the activity in the BTW model obeys a central limit theorem when sampling over past histories. The broad region of activity where b(x) is close to one disappears once bulk dissipation is introduced in the BTW model-supporting our hypothesis that it is an indicator of criticality.
Nuclear Factor kappa B is required for the production of infectious human herpesvirus 8 virions
Directory of Open Access Journals (Sweden)
Negin N Blattman
2014-04-01
Full Text Available Human herpesvirus 8 (HHV8 infection leads to potent activation of nuclear factor kappa B (NFB in primary and transformed cells. We used recombinant HHV8 (rKSHV.219 expressing green fluorescent protein under the constitutive cellular promoter elongation factor 2 and red fluorescent protein under an early HHV8 lytic gene promoter T1.1, to monitor replication during infection of human foreskin fibroblasts (HF, noting changes in NFB activity. In primary HF, NFB levels do not affect HHV8 ability to establish infection or maintain latency. Furthermore, there was no effect on the percent of cells undergoing reactivation from latency, and there were similar numbers of released and cell associated HHV8 viral particles following reactivation in the presence of inhibitors. Reactivation of HHV8 in latently infected HF in the presence of NFB inhibitors resulted in production of viral particles that did not efficiently establish infection, due to deficiencies in binding and/or entry into normally permissive cells. Exogenous expression of glycoprotein M, an envelope protein involved in viral binding and entry was able to partially overcome the deficiency induced by NFB inhibitors. Our data indicate that in primary cells, NFB is not required for infection, establishment of latency, or entry into the lytic cycle, but is required for the expression of virion associated genes involved in the initial steps of virion infectivity. These studies suggest that strategies to inhibit NFB may prevent HHV8 spread and should be considered as a potential therapeutic target for preventing HHV8 associated diseases.
Predicting Solar Activity Using Machine-Learning Methods
Bobra, M.
2017-12-01
Of all the activity observed on the Sun, two of the most energetic events are flares and coronal mass ejections. However, we do not, as of yet, fully understand the physical mechanism that triggers solar eruptions. A machine-learning algorithm, which is favorable in cases where the amount of data is large, is one way to [1] empirically determine the signatures of this mechanism in solar image data and [2] use them to predict solar activity. In this talk, we discuss the application of various machine learning algorithms - specifically, a Support Vector Machine, a sparse linear regression (Lasso), and Convolutional Neural Network - to image data from the photosphere, chromosphere, transition region, and corona taken by instruments aboard the Solar Dynamics Observatory in order to predict solar activity on a variety of time scales. Such an approach may be useful since, at the present time, there are no physical models of flares available for real-time prediction. We discuss our results (Bobra and Couvidat, 2015; Bobra and Ilonidis, 2016; Jonas et al., 2017) as well as other attempts to predict flares using machine-learning (e.g. Ahmed et al., 2013; Nishizuka et al. 2017) and compare these results with the more traditional techniques used by the NOAA Space Weather Prediction Center (Crown, 2012). We also discuss some of the challenges in using machine-learning algorithms for space science applications.
Apparent Relations Between Solar Activity and Solar Tides Caused by the Planets
Hung, Ching-Cheh
2007-01-01
A solar storm is a storm of ions and electrons from the Sun. Large solar storms are usually preceded by solar flares, phenomena that can be characterized quantitatively from Earth. Twenty-five of the thirty-eight largest known solar flares were observed to start when one or more tide-producing planets (Mercury, Venus, Earth, and Jupiter) were either nearly above the event positions (less than 10 deg. longitude) or at the opposing side of the Sun. The probability for this to happen at random is 0.039 percent. This supports the hypothesis that the force or momentum balance (between the solar atmospheric pressure, the gravity field, and magnetic field) on plasma in the looping magnetic field lines in solar corona could be disturbed by tides, resulting in magnetic field reconnection, solar flares, and solar storms. Separately, from the daily position data of Venus, Earth, and Jupiter, an 11-year planet alignment cycle is observed to approximately match the sunspot cycle. This observation supports the hypothesis that the resonance and beat between the solar tide cycle and nontidal solar activity cycle influences the sunspot cycle and its varying magnitudes. The above relations between the unpredictable solar flares and the predictable solar tidal effects could be used and further developed to forecast the dangerous space weather and therefore reduce its destructive power against the humans in space and satellites controlling mobile phones and global positioning satellite (GPS) systems.
Huang, Yu-Hsuan; Tsai, Kevin; Tan, Sara Y; Kang, Sohyeong; Ford, Mandy L; Harder, Kenneth W; Priatel, John J
2017-01-01
Mutations in SH2D1A gene that encodes SAP (SLAM-associated protein) result in X-linked lymphoproliferative disease (XLP), a rare primary immunodeficiency disease defined by exquisite sensitivity to the B-lymphotropic Epstein-Barr virus (EBV) and B cell lymphomas. However, the precise mechanism of how the loss of SAP function contributes to extreme vulnerability to EBV and the development of B cell lymphomas remains unclear. Here, we investigate the hypothesis that SAP is critical for CD8 + T cell immune surveillance of antigen (Ag)-expressing B cells or B lymphoma cells under conditions of defined T cell receptor (TCR) signaling. Sh2d1a - / - CD8 + T cells exhibited greatly diminished proliferation relative to wild type when Ag-presenting-B cells or -B lymphoma cells served as the primary Ag-presenting cell (APC). By contrast, Sh2d1a - / - CD8 + T cells responded equivalently to wild-type CD8 + T cells when B cell-depleted splenocytes, melanoma cells or breast carcinoma cells performed Ag presentation. Through application of signaling lymphocyte activation molecule (SLAM) family receptor blocking antibodies or SLAM family receptor-deficient CD8 + T cells and APCs, we found that CD48 engagement on the B cell surface by 2B4 is crucial for initiating SAP-dependent signaling required for the Ag-driven CD8 + T cell proliferation and differentiation. Altogether, a pivotal role for SAP in promoting the expansion and differentiation of B cell-primed viral-specific naive CD8 + T cells may explain the selective immune deficiency of XLP patients to EBV and B cell lymphomas.
2017-01-01
ABSTRACT Mutations in SH2D1A gene that encodes SAP (SLAM-associated protein) result in X-linked lymphoproliferative disease (XLP), a rare primary immunodeficiency disease defined by exquisite sensitivity to the B-lymphotropic Epstein–Barr virus (EBV) and B cell lymphomas. However, the precise mechanism of how the loss of SAP function contributes to extreme vulnerability to EBV and the development of B cell lymphomas remains unclear. Here, we investigate the hypothesis that SAP is critical for CD8+ T cell immune surveillance of antigen (Ag)-expressing B cells or B lymphoma cells under conditions of defined T cell receptor (TCR) signaling. Sh2d1a−/− CD8+ T cells exhibited greatly diminished proliferation relative to wild type when Ag-presenting-B cells or -B lymphoma cells served as the primary Ag-presenting cell (APC). By contrast, Sh2d1a−/− CD8+ T cells responded equivalently to wild-type CD8+ T cells when B cell-depleted splenocytes, melanoma cells or breast carcinoma cells performed Ag presentation. Through application of signaling lymphocyte activation molecule (SLAM) family receptor blocking antibodies or SLAM family receptor-deficient CD8+ T cells and APCs, we found that CD48 engagement on the B cell surface by 2B4 is crucial for initiating SAP-dependent signaling required for the Ag-driven CD8+ T cell proliferation and differentiation. Altogether, a pivotal role for SAP in promoting the expansion and differentiation of B cell-primed viral-specific naive CD8+ T cells may explain the selective immune deficiency of XLP patients to EBV and B cell lymphomas. PMID:28344876
Singh, Yashi; Hussain, Ikhlaq; Singh, Bhim; Mishra, Sukumar
2018-03-01
In this paper, power quality features such as harmonics mitigation, power factor correction with active power filtering are addressed in a single-stage, single-phase solar photovoltaic (PV) grid tied system. The Power Balance Theory (PBT) with perturb and observe based maximum power point tracking algorithm is proposed for the mitigation of power quality problems in a solar PV grid tied system. The solar PV array is interfaced to a single phase AC grid through a Voltage Source Converter (VSC), which provides active power flow from a solar PV array to the grid as well as to the load and it performs harmonics mitigation using PBT based control. The solar PV array power varies with sunlight and due to this, the solar PV grid tied VSC works only 8-10 h per day. At night, when PV power is zero, the VSC works as an active power filter for power quality improvement, and the load active power is delivered by the grid to the load connected at the point of common coupling. This increases the effective utilization of a VSC. The system is modelled and simulated using MATLAB and simulated responses of the system at nonlinear loads and varying environmental conditions are also validated experimentally on a prototype developed in the laboratory.
Solar Cell Polymer Based Active Ingredients PPV and PCBM
Hardeli, H.; Sanjaya, H.; Resikarnila, R.; Nitami H, R.
2018-04-01
A polymer solar cell is a solar cell based on a polymer bulk heterojunction structure using the method of thin film, which can convert solar energy into electrical energy. Absorption of light is carried by active material layer PPV: PCBM. This study aims to make solar cells tandem and know the value of converting solar energy into electrical energy and increase the value of efficiency generated through morphological control, ie annealing temperature and the ratio of active layer mixture. The active layer is positioned above the PEDOT:PSS layer on ITO glass substrate. The characterization results show the surface morphology of the PPV:PCBM active layer is quite evenly at annealing temperature of 165 ° C. The result of conversion of electrical energy with a UV light source in annealing samples with temperature 165 ° C is 0.03 mA and voltage of 4.085 V with an efficiency of 2.61% and mixed ratio variation was obtained in comparison of P3HT: PCBM is 1: 3
Vanhaelewyn, Lucas; Schumacher, Paolo; Poelman, Dirk; Fankhauser, Christian; Van Der Straeten, Dominique; Vandenbussche, Filip
2016-11-01
Ultraviolet B (UV-B) light is a part of the solar radiation which has significant effects on plant morphology, even at low doses. In Arabidopsis, many of these morphological changes have been attributed to a specific UV-B receptor, UV resistance locus 8 (UVR8). Recent findings showed that next to phototropin regulated phototropism, UVR8 mediated signaling is able of inducing directional bending towards UV-B light in etiolated seedlings of Arabidopsis, in a phototropin independent manner. In this study, kinetic analysis of phototropic bending was used to evaluate the relative contribution of each of these pathways in UV-B mediated phototropism. Diminishing UV-B light intensity favors the importance of phototropins. Molecular and genetic analyses suggest that UV-B is capable of inducing phototropin signaling relying on phototropin kinase activity and regulation of NPH3. Moreover, enhanced UVR8 responses in the UV-B hypersensitive rup1rup2 mutants interferes with the fast phototropin mediated phototropism. Together the data suggest that phototropins are the most important receptors for UV-B induced phototropism in etiolated seedlings, and a RUP mediated negative feedback pathway prevents UVR8 signaling to interfere with the phototropin dependent response. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.
Initiation of non-tropical thunderstorms by solar activity
Energy Technology Data Exchange (ETDEWEB)
Herman, J R [Radio Sciences Co., Melbourne, Fla. (USA); Goldberg, R A
1978-02-01
Correlative evidence accumulating since 1926 suggests that there must be some physical coupling mechanism between solar activity and thunderstorm occurrence in middle to high latitudes. Such a link may be provided by alteration of atmospheric electric parameters through the influence of cosmic ray decreases and/or high-energy solar protons associated with active solar events. Galactic cosmic ray decreases tend to enhance the electric field at low heights. The protons produce excess ionization near and above 20 km, greatly increasing the atmospheric conductivity and possibly lowering the height of the electrosphere. Consequent effects near the solar proton cut-off latitude also lead to an enhancement of the atmospheric electric field near the surface. If appropriate meteorological conditions (warm moist air with updrafts) exist or develop during a solar event, the atmospheric electric field enhancement may be sufficient to trigger thunderstorm development. The suggested mechanism appears plausible enough to warrant a co-ordinated experimental effort involving satellite balloon and ground-based measurements of the possible forcing functions (solar protons and cosmic rays) and the responding atmospheric electrical and ionic species' characteristics.
International Nuclear Information System (INIS)
Bell, B.; Noci, G.
1976-01-01
The average solar wind velocity and the level of geomagnetic activity (Kp) following central meridian passage of coronal weak and bright features identified from Oso 7 isophotograms of Fe XV (284 A) are determined by the method of superposed epochs. Results are consistent with the concept that bright regions possess magnetic field of closed configurations, thereby reducing particle escape, while coronal holes possess open magnetic field lines favorable to particle escape or enhanced outflow of the solar wind. Coronal holes are identified with Bartels' M regions not only statistically but by linking specific long-lived holes with individual sequences of geomagnetic storms. In the study of bright region a subdivision by brightness temperature (T/sub b/) of associated 9.1-cm radiation was found to be significant, with the region s of higher T/sub b/ having a stronger inhibiting power on the outflow of the solar wind when they were located in the solar hemisphere on the same side of the solar equator as the earth. Regions of highest T/sub b/ most strongly depress the outflow of solar wind but are also the most likely to produce flare-associated great storms
THE RISE AND FALL OF OPEN SOLAR FLUX DURING THE CURRENT GRAND SOLAR MAXIMUM
International Nuclear Information System (INIS)
Lockwood, M.; Rouillard, A. P.; Finch, I. D.
2009-01-01
We use geomagnetic activity data to study the rise and fall over the past century of the solar wind flow speed V SW , the interplanetary magnetic field strength B, and the open solar flux F S . Our estimates include allowance for the kinematic effect of longitudinal structure in the solar wind flow speed. As well as solar cycle variations, all three parameters show a long-term rise during the first half of the 20th century followed by peaks around 1955 and 1986 and then a recent decline. Cosmogenic isotope data reveal that this constitutes a grand maximum of solar activity which began in 1920, using the definition that such grand maxima are when 25-year averages of the heliospheric modulation potential exceeds 600 MV. Extrapolating the linear declines seen in all three parameters since 1985, yields predictions that the grand maximum will end in the years 2013, 2014, or 2027 using V SW , F S , or B, respectively. These estimates are consistent with predictions based on the probability distribution of the durations of past grand solar maxima seen in cosmogenic isotope data. The data contradict any suggestions of a floor to the open solar flux: we show that the solar minimum open solar flux, kinematically corrected to allow for the excess flux effect, has halved over the past two solar cycles.
A comparison of solar wind streams and coronal structure near solar minimum
Nolte, J. T.; Davis, J. M.; Gerassimenko, M.; Lazarus, A. J.; Sullivan, J. D.
1977-01-01
Solar wind data from the MIT detectors on the IMP 7 and 8 satellites and the SOLRAD 11B satellite for the solar-minimum period September-December, 1976, were compared with X-ray images of the solar corona taken by rocket-borne telescopes on September 16 and November 17, 1976. There was no compelling evidence that a coronal hole was the source of any high speed stream. Thus it is possible that either coronal holes were not the sources of all recurrent high-speed solar wind streams during the declining phase of the solar cycle, as might be inferred from the Skylab period, or there was a change in the appearance of some magnetic field regions near the time of solar minimum.
Solar Thermal Energy; Energia Solar Termica
Energy Technology Data Exchange (ETDEWEB)
Perez-Martinez, M; Cuesta-Santianes, M J; Cabrera Jimenez, J A
2008-07-01
Approximately, 50 % of worldwide primary energy consumption is done in the form of heat in applications with a temperature lower than 250 degree centigree (low-medium temperature heat). These data clearly demonstrate the great potential of solar thermal energy to substitute conventional fossil fuels, which are becoming more expensive and are responsible for global warming. Low-medium temperature solar thermal energy is mainly used to obtain domestic hot water and provide space heating. Active solar thermal systems are those related to the use of solar thermal collectors. This study is dealing with low temperature solar thermal applications, mainly focusing on active solar thermal systems. This kind of systems has been extensively growing worldwide during the last years. At the end of 2006, the collector capacity in operation worldwide equalled 127.8 GWth. The technology is considered to be already developed and actions should be aimed at favouring a greater market penetration: diffusion, financial support, regulations establishment, etc. China and USA are the leading countries with a technology based on evacuated tube collectors and unglazed collectors, respectively. The rest of the world markets are dominated by the flat glazed collectors technology. (Author) 15 refs.
Can origin of the 2400-year cycle of solar activity be caused by solar inertial motion?
Directory of Open Access Journals (Sweden)
I. Charvátová
Full Text Available A solar activity cycle of about 2400 years has until now been of uncertain origin. Recent results indicate it is caused by solar inertial motion. First we describe the 178.7-year basic cycle of solar motion. The longer cycle, over an 8000 year interval, is found to average 2402.2 years. This corresponds to the Jupiter/Heliocentre/Barycentre alignments (9.8855 × 243. Within each cycle an exceptional segment of 370 years has been found characterized by a looping pattern by a trefoil or quasitrefoil geometry. Solar activity, evidenced by 14C tree-ring proxies, shows the same pattern. Solar motion is computable in advance, so this provides a basis for future predictive assessments. The next 370-year segment will occur between AD 2240 and 2610.
Key words: Solar physics (celestial mechanics
MAGNETIC NON-POTENTIALITY OF SOLAR ACTIVE REGIONS AND PEAK X-RAY FLUX OF THE ASSOCIATED FLARES
International Nuclear Information System (INIS)
Tiwari, Sanjiv Kumar; Venkatakrishnan, P.; Gosain, Sanjay
2010-01-01
Predicting the severity of solar eruptive phenomena such as flares and coronal mass ejections remains a great challenge despite concerted efforts to do so over the past several decades. However, the advent of high-quality vector magnetograms obtained from Hinode (SOT/SP) has increased the possibility of meeting this challenge. In particular, the spatially averaged signed shear angle (SASSA) seems to be a unique parameter for quantifying the non-potentiality of active regions. We demonstrate the usefulness of the SASSA for predicting flare severity. For this purpose, we present case studies of the evolution of magnetic non-potentiality using 115 vector magnetograms of four active regions, namely, ARs NOAA 10930, 10960, 10961, and 10963 during 2006 December 8-15, 2007 June 3-10, 2007 June 28-July 5, and 2007 July 10-17, respectively. The NOAA ARs 10930 and 10960 were very active and produced X and M class flares, respectively, along with many smaller X-ray flares. On the other hand, the NOAA ARs 10961 and 10963 were relatively less active and produced only very small (mostly A- and B-class) flares. For this study, we have used a large number of high-resolution vector magnetograms obtained from Hinode (SOT/SP). Our analysis shows that the peak X-ray flux of the most intense solar flare emanating from the active regions depends on the magnitude of the SASSA at the time of the flare. This finding of the existence of a lower limit of the SASSA for a given class of X-ray flares will be very useful for space weather forecasting. We have also studied another non-potentiality parameter called the mean weighted shear angle (MWSA) of the vector magnetograms along with the SASSA. We find that the MWSA does not show such distinction as the SASSA for upper limits of the GOES X-ray flux of solar flares; however, both the quantities show similar trends during the evolution of all active regions studied.
Mutacin H-29B is identical to mutacin II (J-T8
Directory of Open Access Journals (Sweden)
Lavoie Marc C
2006-04-01
Full Text Available Abstract Background Streptococcus mutans produces bacteriocins named mutacins. Studies of mutacins have always been hampered by the difficulties in obtaining active liquid preparations of these substances. Some of them were found to be lantibiotics, defined as bacterial ribosomally synthesised lanthionine-containing peptides with antimicrobial activity. The goal of this study was to produce and characterize a new mutacin from S. mutans strain 29B, as it shows a promising activity spectrum against current human pathogens. Results Mutacin H-29B, produced by S. mutans strain 29B, was purified by successive hydrophobic chromatography from a liquid preparation consisting of cheese whey permeate (6% w/v supplemented with yeast extract (2% and CaCO3 (1%. Edman degradation revealed 24 amino acids identical to those of mutacin II (also known as J-T8. The molecular mass of the purified peptide was evaluated at 3246.08 ± 0.1 Da by MALDI-TOF MS. Conclusion A simple procedure for production and purification of mutacins along with its characterization is presented. Our results show that the amino acid sequence of mutacin H-29B is identical to the already known mutacin II (J-T8 over the first 24 residues. S. mutans strains of widely different origins may thus produce very similar bacteriocins.
Asteroseismology of the Solar Analogs 16 Cyg A and B from Kepler Observations
DEFF Research Database (Denmark)
Metcalfe, T. S.; Chaplin, W. J.; Appourchaux, T.
2012-01-01
The evolved solar-type stars 16 Cyg A and B have long been studied as solar analogs, yielding a glimpse into the future of our own Sun. The orbital period of the binary system is too long to provide meaningful dynamical constraints on the stellar properties, but asteroseismology can help because...
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Interrogation. 343b.3 Section 343b.3 Aliens... NATURALIZATION FOR RECOGNITION BY A FOREIGN STATE § 343b.3 Interrogation. When Form N-565 presents a prima facie... issuance of the certificate. Interrogation of the applicant shall be conducted before the application is...
Energy Technology Data Exchange (ETDEWEB)
NONE
2007-07-01
The 8th forum on solar engineering in practice includes based upon a proven concept talks, impulse briefings and discussions in larger and smaller groups in many different ways about the subjects politics, market, finances, marketing and sales. In terms of contents the forum incorporates all subjects, which are of importance for the growth of solar engineering: New European Energy Law and Thermal Energy Law, supporting industry, mechanical engineering, training and finances. Latest subjects like Start-Up, finances, energy efficiency and market conditions and applications like solar cooling and solar thermal power plants are presented and discussed. In the frame of the forum on solar engineering in practice analyst conferences are held this year as well. Many companies, which are quoted at the stock exchange present their numbers to the analysts and financial groups. Furthermore companies in the field of the supporting industry present themselves to the fields of finance and solar engineering. (orig.)
UV-B Perceived by the UVR8 Photoreceptor Inhibits Plant Thermomorphogenesis.
Hayes, Scott; Sharma, Ashutosh; Fraser, Donald P; Trevisan, Martine; Cragg-Barber, C Kester; Tavridou, Eleni; Fankhauser, Christian; Jenkins, Gareth I; Franklin, Keara A
2017-01-09
Small increases in ambient temperature can elicit striking effects on plant architecture, collectively termed thermomorphogenesis [1]. In Arabidopsis thaliana, these include marked stem elongation and leaf elevation, responses that have been predicted to enhance leaf cooling [2-5]. Thermomorphogenesis requires increased auxin biosynthesis, mediated by the bHLH transcription factor PHYTOCHROME-INTERACTING FACTOR 4 (PIF4) [6-8], and enhanced stability of the auxin co-receptor TIR1, involving HEAT SHOCK PROTEIN 90 (HSP90) [9]. High-temperature-mediated hypocotyl elongation additionally involves localized changes in auxin metabolism, mediated by the indole-3-acetic acid (IAA)-amido synthetase Gretchen Hagen 3 (GH3).17 [10]. Here we show that ultraviolet-B light (UV-B) perceived by the photoreceptor UV RESISTANCE LOCUS 8 (UVR8) [11] strongly attenuates thermomorphogenesis via multiple mechanisms inhibiting PIF4 activity. Suppression of thermomorphogenesis involves UVR8 and CONSTITUTIVELY PHOTOMORPHOGENIC 1 (COP1)-mediated repression of PIF4 transcript accumulation, reducing PIF4 abundance. UV-B also stabilizes the bHLH protein LONG HYPOCOTYL IN FAR RED (HFR1), which can bind to and inhibit PIF4 function. Collectively, our results demonstrate complex crosstalk between UV-B and high-temperature signaling. As plants grown in sunlight would most likely experience concomitant elevations in UV-B and ambient temperature, elucidating how these pathways are integrated is of key importance to the understanding of plant development in natural environments. Copyright © 2017 The Authors. Published by Elsevier Ltd.. All rights reserved.
Columbia University OSO-8 instrument for stellar and solar X-ray spectroscopy and polarimetry
Energy Technology Data Exchange (ETDEWEB)
Wolff, R S [Columbia Univ., New York (USA). Columbia Astrophysics Lab.
1976-08-01
A spectrometer and a polarimeter consisting of large-area panels of mosaic crystals have been constructed and prepared for use in the OSO-8 satellite. The instrumentation is planned for study of stellar and solar X-ray spectra between 1.8-8 keV and stellar X-ray polarization at 2.6 keV. Aspects of the design which enable the instrument to make measurements of the diverse range of stellar and solar phenomena are described. Some of the unique features, such as high sensitivity, high temporal resolution, and spectral range, are discussed. The applicability of the spectrometer and polarimeter to various current problems in X-ray astronomy is considered.
International Nuclear Information System (INIS)
Hadorn, J.-C.; Renaud, P.
2003-01-01
In this report by the research, development and demonstration (RD+D) programme coordinators the objectives, activities and main results in the area of solar heating and heat storage in Switzerland are presented for 2003. In a stagnating market environment the strategy of the Swiss Federal Office of Energy mainly consists in improving the quality and durability of solar collectors and materials, optimizing combisystems for space heating and domestic hot water preparation, searching for storage systems with a higher energy storage density than in the case of sensible heat storage in water, developing coloured solar collectors for more architectonic freedom, and finalizing a seasonal heat storage project for 100 dwellings to demonstrate the feasibility of solar fractions larger than 50% in apartment houses. Support was granted to the Swiss Testing Facility SPF in Rapperswil as in previous years; SPF was the first European testing institute to perform solar collector labeling according to the new rules of the 'Solar Keymark', introduced in cooperation with the European Committee for Standardization CEN. Several 2003 projects were conducted within the framework of the Solar Heating and Cooling Programme of the International Energy Agency IEA. Computerized simulation tools were improved. With the aim of jointly producing high-temperature heat and electric power a solar installation including a concentrating collector and a thermodynamic machine based on a Rankine cycle is still being developed. Seasonal underground heat storage was studied in detail by means of a validated computer simulation programme. Design guidelines were obtained for such a storage used in the summer time for cooling and in the winter time for space heating via a heat pump: depending on the ratio 'summer cooling / winter heating', cooling requires a cooling machine, or direct cooling without such a machine is possible. The report ends up with the list of all supported RD+D projects
Directory of Open Access Journals (Sweden)
N. K. Sethi
2002-06-01
Full Text Available High resolution electron density profiles (Ne measured with the Arecibo (18.4 N, 66.7 W, Incoherent Scatter radar (I. S. are used to obtain the bottomside shape parameters B0, B1 for a solar maximum period (1989–90. Median values of these parameters are compared with those obtained from the IRI-2001 model. It is observed that during summer, the IRI values agree fairly well with the Arecibo values, though the numbers are somewhat larger during the daytime. Discrepancies occur during winter and equinox, when the IRI underestimates B0 for the local times from about 12:00 LT to about 20:00 LT. Furthermore, the IRI model tends to generally overestimate B1 at all local times. At Arecibo, B0 increases by about 50%, and B1 decreases by about 30% from solar minimum to solar maximum.Key words. Ionosphere (equational ionosphere; modeling and forecasting
71-Mbit/s ultraviolet-B LED communication link based on 8-QAM-OFDM modulation
Sun, Xiaobin
2017-09-14
A demonstration of ultraviolet-B (UVB) communication link is implemented utilizing quadrature amplitude modulation (QAM) orthogonal frequency-division multiplexing (OFDM). The demonstration is based on a 294-nm UVB-light-emitting-diode (UVB-LED) with a full-width at half-maximum (FWHM) of 9 nm and light output power of 190 μW, at 7 V, with a special silica gel lens on top of it. A −3-dB bandwidth of 29 MHz was measured and a high-speed near-solar-blind communication link with a data rate of 71 Mbit/s was achieved using 8-QAM-OFDM at perfect alignment. 23.6 Mbit/s using 2-QAM-OFDM when the angle subtended by the pointing directions of the UVB-LED and photodetector (PD) is 12 degrees, thus establishing a diffuse-line-of-sight (LOS) link. The measured bit-error rate (BER) of 2.8 × 10−4 and 2.4 × 10−4, respectively, are well below the forward error correction (FEC) criterion of 3.8 × 10−3. The demonstrated high data-rate OFDM-based UVB communication link paves the way for realizing high-speed non-line-of-sight free-space optical communications.
71-Mbit/s ultraviolet-B LED communication link based on 8-QAM-OFDM modulation
Sun, Xiaobin; Zhang, Zhenyu; Chaaban, Anas; Ng, Tien Khee; Shen, Chao; Chen, Rui; Yan, Jianchang; Sun, Haiding; Li, Xiaohang; Wang, Junxi; Li, Jinmin; Alouini, Mohamed-Slim; Ooi, Boon S.
2017-01-01
A demonstration of ultraviolet-B (UVB) communication link is implemented utilizing quadrature amplitude modulation (QAM) orthogonal frequency-division multiplexing (OFDM). The demonstration is based on a 294-nm UVB-light-emitting-diode (UVB-LED) with a full-width at half-maximum (FWHM) of 9 nm and light output power of 190 μW, at 7 V, with a special silica gel lens on top of it. A −3-dB bandwidth of 29 MHz was measured and a high-speed near-solar-blind communication link with a data rate of 71 Mbit/s was achieved using 8-QAM-OFDM at perfect alignment. 23.6 Mbit/s using 2-QAM-OFDM when the angle subtended by the pointing directions of the UVB-LED and photodetector (PD) is 12 degrees, thus establishing a diffuse-line-of-sight (LOS) link. The measured bit-error rate (BER) of 2.8 × 10−4 and 2.4 × 10−4, respectively, are well below the forward error correction (FEC) criterion of 3.8 × 10−3. The demonstrated high data-rate OFDM-based UVB communication link paves the way for realizing high-speed non-line-of-sight free-space optical communications.
Newkirk, G., Jr.
1975-01-01
Elemental abundances in the solar corona are studied. Abundances in the corona, solar wind and solar cosmic rays are compared to those in the photosphere. The variation in silicon and iron abundance in the solar wind as compared to helium is studied. The coronal small and large scale structure is investigated, emphasizing magnetic field activity and examining cosmic ray generation mechanisms. The corona is observed in the X-ray and EUV regions. The nature of coronal transients is discussed with emphasis on solar-wind modulation of galactic cosmic rays. A schematic plan view of the interplanetary magnetic field during sunspot minimum is given showing the presence of magnetic bubbles and their concentration in the region around 4-5 AU by a fast solar wind stream.
Yu, Xiaoyi; Liu, Qiuhong; Wang, Xiaochuan; Liu, Hong; Wang, Yan
2018-01-01
In diabetic retinopathy, prolonged high-level blood glucose induced significant impairments among various retinal tissues, including retinal pigment epithelial (RPE) cells. In an in vitro model of human RPE cells, we evaluated whether 7,8-Dihydroxyflavone (DHF) may effectively prevent high glucose-induced diabetic apoptosis among human RPE cells. ARPE-19 cells, a Human RPE cell line, were treated with d-glucose (50 mM) to induce apoptosis in vitro. Prior to glucose, ARPE-19 cells were pre-incubated with various concentrations of DHF. The effect of DHF on d-glucose-induced apoptosis was examined by TUNEL assay, in a concentration-dependent manner. The biological effects of DHF on Caspase-9 (Casp-9) and TrkB signaling pathways in d-glucose-injured ARPE-19 cells were evaluated by qRT-PCR and western blot (WB) assays. A TrkB antagonist, K252a, was also applied in DHF and d-glucose treated ARPE-19 cells. Possible effect of K252a blocking TrkB signaling pathway, thus reversing DHF-modulated apoptosis prevention was also examined by TUNEL and WB assays. DHF ameliorated d-glucose-induced diabetic apoptosis in ARPE-19 cells. Apoptotic factor Casp-9, at both mRNA and protein levels, were drastically inhibited by DHF in d-glucose-injured ARPE-19 cells. Also, DHF activated TrkB signaling pathway through phosphorylation. K252a dramatically reversed the preventive effect of DHF on d-glucose-induced apoptosis in ARPE-19 cells. Further investigation showed that K252a functioned through de-activating or de-phosphorylating TrkB signaling pathway. This work demonstrates that DHF, through activation of TrkB signaling pathway, has a preventive function in d-glucose-induced apoptosis in PRE cells in diabetic retinopathy. Copyright © 2017. Published by Elsevier Inc.
Solar ultraviolet-B exposure and cancer incidence and mortality in the United States, 1993–2002
International Nuclear Information System (INIS)
Boscoe, Francis P; Schymura, Maria J
2006-01-01
An inverse relationship between solar ultraviolet-B (UV-B) exposure and non-skin cancer mortality has long been reported. Vitamin D, acquired primarily through exposure to the sun via the skin, is believed to inhibit tumor development and growth and reduce mortality for certain cancers. We extend the analysis of this relationship to include cancer incidence as well as mortality, using higher quality and higher resolution data sets than have typically been available. Over three million incident cancer cases between 1998 and 2002 and three million cancer deaths between 1993 and 2002 in the continental United States were regressed against daily satellite-measured solar UV-B levels, adjusting for numerous confounders. Relative risks of reduced solar UV-B exposure were calculated for thirty-two different cancer sites. For non-Hispanic whites, an inverse relationship between solar UV-B exposure and cancer incidence and mortality was observed for ten sites: bladder, colon, Hodgkin lymphoma, myeloma, other biliary, prostate, rectum, stomach, uterus, and vulva. Weaker evidence of an inverse relationship was observed for six sites: breast, kidney, leukemia, non-Hodgkin lymphoma, pancreas, and small intestine. For three sites, inverse relationships were seen that varied markedly by sex: esophagus (stronger in males than females), gallbladder (stronger in females than males), and thyroid (only seen in females). No association was found for bone and joint, brain, larynx, liver, nasal cavity, ovary, soft tissue, male thyroid, and miscellaneous cancers. A positive association between solar UV-B exposure and cancer mortality and incidence was found for anus, cervix, oral cavity, melanoma, and other non-epithelial skin cancer. This paper adds to the mounting evidence for the influential role of solar UV-B exposure on cancer, particularly for some of the less-well studied digestive cancers. The relative risks for cancer incidence are similar to those for cancer mortality for most
Asteroseismology of the solar analogs 16 Cyg A and B from Kepler observations
Metcalfe, T.; Chaplin, W.J.; Appourchaux, T.; Garcia, R.A.; Basu, S.; Brandão, I.; Creevey, O.L.; Deheuvels, S.; Doğan, G.; Eggenberger, P.; Karoff, C.; Miglio, A.; Stello, D.; Yıldız, M.; Çelik, Z.; Antia, H.M.; Benomar, O.; Howe, R.; Régulo, C.; Salabert, D.; Stahn, T.; Bedding, T.R.; Davies, G.R.; Elsworth, Y.; Gizon, L.; Hekker, S.; Mathur, S.; Mosser, B.; Bryson, S.T.; Still, M.D.; Christensen-Dalsgaard, J.; Gilliland, R.L.; Kawaler, S.D.; Kjeldsen, H.; Ibrahim, K.A.; Klaus, T.C.; Li, J.
2012-01-01
The evolved solar-type stars 16 Cyg A and B have long been studied as solar analogs, yielding a glimpse into the future of our own Sun. The orbital period of the binary system is too long to provide meaningful dynamical constraints on the stellar properties, but asteroseismology can help because the
Survey of active solar thermal collectors, industry and markets in Canada : final report
International Nuclear Information System (INIS)
2005-08-01
the operating base of solar thermal systems in Canada only began to increase again in recent years. The estimated GHG emissions avoided from all active solar systems operating in Canada during 2004 were 23, 200 tonnes of CO 2 equivalent. It was anticipated that the expected avoidance of CO 2 emissions from solar collectors sold and installed in Canada during 2004 will total 122,600 tonnes over their 20-30 year life. 8 refs., 8 tabs., 12 figs
Enerplan, Professional association of solar energy - activity report 2006
International Nuclear Information System (INIS)
2007-01-01
Enerplan is the French union of solar energy professionals. Created in 1983, its social purpose is the study and defense of the rights and of the material and moral interests of its members. Enerplan structures its action through two poles representing members' activities: 'solar energy and building' where topics about heat and electricity generation in relation with buildings are treated, and 'photovoltaic energy' where topics specific to big solar power plants are considered. Thanks to the collaborative participation of its members, both poles allow Enerplan union to be source of proposals to develop solar energy in France. As an active interface between professionals and institutions, Enerplan includes in its membership: industrialists, plant makers, engineering consultants, installers, associations, energy suppliers etc, from small-medium size companies to big groups. This document presents Enerplan's activities in 2006 (public relations, lobbying, meetings and conferences, promotional activities, collaborations, projects..)
17 CFR 270.8b-2 - Definitions.
2010-04-01
... such document is filed with such exchange. (j) Share. The term “share” means a share of stock in a... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definitions. 270.8b-2 Section 270.8b-2 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) RULES AND...
Preliminary results from the Orbiting Solar Observatory 8 - Observations of optically thin lines
Shine, R. A.; Roussel-Dupre, D.; Bruner, E. C., Jr.; Chipman, E. G.; Lites, B. W.; Rottman, G. J.; Athay, R. G.; White, O. R.
1976-01-01
The University of Colorado spectrometer aboard OSO 8 has measured the high temperature C IV resonance lines (at 1548 and 1551 A) and the Si IV resonance lines (at 1393 and 1402 A) formed in the solar chromosphere-corona transition region. Preliminary results include studies of mean profiles, a comparison of cell and network profiles, and the behavior of the lines at the extreme solar limb.
Directory of Open Access Journals (Sweden)
Himsar Ambarita
2016-03-01
Full Text Available Typical adsorbent applied in solar-powered adsorption refrigeration cycle is activated carbon. It is known that activated alumina shows a higher adsorption capacity when it is tested in the laboratory using a constant radiation heat flux. In this study, solar-powered adsorption refrigeration cycle with generator filled by different adsorbents has been tested by exposing to solar radiation in Medan city of Indonesia. The generator is heated using a flat-plate type solar collector with a dimension of 0.5 m×0.5 m. Four cases experiments of solar-powered adsorption cycle were carried out, they are with generator filled by 100% activated alumina (named as 100AA, by a mixed of 75% activated alumina and 25% activated carbon (75AA, by a mixed of 25% activated alumina and 75% activated carbon (25AA, and filled by 100% activated carbon. Each case was tested for three days. The temperature and pressure history and the performance have been presented and analyzed. The results show that the average COP of 100AA, 75AA, 25AA, and 100AC is 0.054, 0.056, 0.06, and 0.074, respectively. The main conclusion can be drawn is that for Indonesian condition and flat-plate type solar collector the pair of activated carbon and methanol is the better than activated alumina.
EGFRvIII promotes glioma angiogenesis and growth through the NF-κB, interleukin-8 pathway.
Bonavia, R; Inda, M M; Vandenberg, S; Cheng, S-Y; Nagane, M; Hadwiger, P; Tan, P; Sah, D W Y; Cavenee, W K; Furnari, F B
2012-09-06
Sustaining a high growth rate requires tumors to exploit resources in their microenvironment. One example of this is the extensive angiogenesis that is a typical feature of high-grade gliomas. Here, we show that expression of the constitutively active mutant epidermal growth factor receptor, ΔEGFR (EGFRvIII, EGFR*, de2-7EGFR) is associated with significantly higher expression levels of the pro-angiogenic factor interleukin (IL)-8 in human glioma specimens and glioma stem cells. Furthermore, the ectopic expression of ΔEGFR in different glioma cell lines caused up to 60-fold increases in the secretion of IL-8. Xenografts of these cells exhibit increased neovascularization, which is not elicited by cells overexpressing wild-type (wt)EGFR or ΔEGFR with an additional kinase domain mutation. Analysis of the regulation of IL-8 by site-directed mutagenesis of its promoter showed that ΔEGFR regulates its expression through the transcription factors nuclear factor (NF)-κB, activator protein 1 (AP-1) and CCAAT/enhancer binding protein (C/EBP). Glioma cells overexpressing ΔEGFR showed constitutive activation and DNA binding of NF-κB, overexpression of c-Jun and activation of its upstream kinase c-Jun N-terminal kinase (JNK) and overexpression of C/EBPβ. Selective pharmacological or genetic targeting of the NF-κB or AP-1 pathways efficiently blocked promoter activity and secretion of IL-8. Moreover, RNA interference-mediated knock-down of either IL-8 or the NF-κB subunit p65, in ΔEGFR-expressing cells attenuated their ability to form tumors and to induce angiogenesis when injected subcutaneously into nude mice. On the contrary, the overexpression of IL-8 in glioma cells lacking ΔEGFR potently enhanced their tumorigenicity and produced highly vascularized tumors, suggesting the importance of this cytokine and its transcription regulators in promoting glioma angiogenesis and tumor growth.
International Nuclear Information System (INIS)
2008-01-01
Enerplan is the French union of solar energy professionals. Created in 1983, its social purpose is the study and defense of the rights and of the material and moral interests of its members. Enerplan structures its action through two poles representing members' activities: 'solar energy and building' where topics about heat and electricity generation in relation with buildings are treated, and 'photovoltaic energy' where topics specific to big solar power plants are considered. Thanks to the collaborative participation of its members, both poles allow Enerplan union to be source of proposals to develop solar energy in France. As an active interface between professionals and institutions, Enerplan includes in its membership: industrialists, plant makers, engineering consultants, installers, associations, energy suppliers etc, from small-medium size companies to big groups. This document presents Enerplan's activities in 2007 (public relations, lobbying, meetings and conferences, promotional activities, collaborations, projects..)
International Nuclear Information System (INIS)
2009-01-01
Enerplan is the French union of solar energy professionals. Created in 1983, its social purpose is the study and defense of the rights and of the material and moral interests of its members. Enerplan structures its action through two poles representing members' activities: 'solar energy and building' where topics about heat and electricity generation in relation with buildings are treated, and 'photovoltaic energy' where topics specific to big solar power plants are considered. Thanks to the collaborative participation of its members, both poles allow Enerplan union to be source of proposals to develop solar energy in France. As an active interface between professionals and institutions, Enerplan includes in its membership: industrialists, plant makers, engineering consultants, installers, associations, energy suppliers etc, from small-medium size companies to big groups. This document presents Enerplan's activities in 2008 (public relations, lobbying, meetings and conferences, promotional activities, collaborations, projects..)
Wind and IMP 8 Solar Wind, Magnetosheath and Shock Data
2004-01-01
The purpose of this project was to provide the community access to magnetosheath data near Earth. We provided 27 years of IMP 8 magnetosheath proton velocities, densities, and temperatures with our best (usually 1-min.) time resolution. IMP 8 crosses the magnetosheath twice each 125 day orbit, and we provided magnetosheath data for the roughly 27 years of data for which magnetometer data are also available (which are needed to reliably pick boundaries). We provided this 27 years of IMP 8 magnetosheath data to the NSSDC; this data is now integrated with the IMP 8 solar wind data with flags indicating whether each data point is in the solar wind, magnetosheath, or at the boundary between the two regions. The plasma speed, density, and temperature are provided for each magnetosheath point. These data are also available on the MIT web site ftp://space .mit.edu/pub/plasma/imp/www/imp.html. We provide ASCII time-ordered rows of data giving the observation time, the spacecraft position in GSE, the velocity is GSE, the density and temperature for protons. We also have analyzed and archived on our web site the Wind magnetosheath plasma parameters. These consist of ascii files of the proton and alpha densities, speeds, and thermal speeds. These data are available at ftp://space.mit.edu/pub/plasma/wind/sheath These are the two products promised in the work statement and they have been completed in full.
Protective mechanisms and acclimation to solar ultraviolet-B radiation in Oenothera stricta
Robberecht, R.; Caldwell, M. M.
1981-01-01
Plant adaptations ameliorating or repairing the damaging effects of ultraviolet-B (UV-B) radiation on plant tissue were investigated. The degree of phenotype plasticity in UV protective mechanisms and acclimation in relation to the natural solar UV-B radiation flux and in an enhanced UV-B irradiance environment was also examined. Mechanisms by which plants avoid radiation, adaptations altering the path of radiation incident on the leaf, and repair processes were considered. Attenuation of UV-B by tissues, UV-B irradiation into the leaf, and the effects of UV-B on photosynthesis were investigated.
Migration and Extension of Solar Active Longitudinal Zones
Gyenge, N.; Baranyi, T.; Ludmány, A.
2014-02-01
Solar active longitudes show a characteristic migration pattern in the Carrington coordinate system if they can be identified at all. By following this migration, the longitudinal activity distribution around the center of the band can be determined. The half-width of the distribution is found to be varying in Cycles 21 - 23, and in some time intervals it was as narrow as 20 - 30 degrees. It was more extended around a maximum but it was also narrow when the activity jumped to the opposite longitude. Flux emergence exhibited a quasi-periodic variation within the active zone with a period of about 1.3 years. The path of the active-longitude migration does not support the view that it might be associated with the 11-year solar cycle. These results were obtained for a limited time interval of a few solar cycles and, bearing in mind uncertainties of the migration-path definition, are only indicative. For the major fraction of the dataset no systematic active longitudes were found. Sporadic migration of active longitudes was identified only for Cycles 21 - 22 in the northern hemisphere and Cycle 23 in the southern hemisphere.
Solar-terrestrial disturbances in June-September 1982, 5
International Nuclear Information System (INIS)
Ondoh, Tadanori
1985-01-01
The x-ray detector on the SMS-GOES satellite observed 77 solar x-ray flares (1 - 8A) with flux above 10 -5 W/m 2 in June, 1982, and 33 SIDs with importance above 2 were observed in Hiraiso, Japan. However, the geomagnetic storm with Dst above 100 nT did not occur at that time since most solar flares occurred near the east rim of the sun. These solar active regions lasted for 5 solar rotations, then, the great geomagnetic storms with Dst above 100 nT occurred on July 13 - 15, September 5 - 7 and September 21 - 23, 1982. These geomagnetic storms were preceded by the solar flares of importance above 2B occurred in the central part of the solar disc. From September 26 to 27, 1982, a great geomagnetic storm which was not accompanied by solar flare occurred. This paper summarized the studies on solar-terrestrial events from June to September, 1982, made by the space physics and aeronomy groups of the Radio Research Laboratories, Japan. The solar flares occurred on July 12, September 4 and 19, 1982, the geomagnetic storms corresponding to them, the cosmic ray storms observed on July 13 - 19, September 6 - 9 and 21 - 26, 1982, global equivalent current system and others are reported. (Kako, I.)
Breathing of heliospheric structures triggered by the solar-cycle activity
Directory of Open Access Journals (Sweden)
K. Scherer
Full Text Available Solar wind ram pressure variations occuring within the solar activity cycle are communicated to the outer heliosphere as complicated time-variabilities, but repeating its typical form with the activity period of about 11 years. At outer heliospheric regions, the main surviving solar cycle feature is a periodic variation of the solar wind dynamical pressure or momentum flow, as clearly recognized by observations of the VOYAGER-1/2 space probes. This long-periodic variation of the solar wind dynamical pressure is modeled here through application of appropriately time-dependent inner boundary conditions within our multifluid code to describe the solar wind – interstellar medium interaction. As we can show, it takes several solar cycles until the heliospheric structures adapt to an average location about which they carry out a periodic breathing, however, lagged in phase with respect to the solar cycle. The dynamically active heliosphere behaves differently from a static heliosphere and especially shows a historic hysteresis in the sense that the shock structures move out to larger distances than explained by the average ram pressure. Obviously, additional energies are pumped into the heliosheath by means of density and pressure waves which are excited. These waves travel outwards through the interface from the termination shock towards the bow shock. Depending on longitude, the heliospheric sheath region memorizes 2–3 (upwind and up to 6–7 (downwind preceding solar activity cycles, i.e. the cycle-induced waves need corresponding travel times for the passage over the heliosheath. Within our multifluid code we also adequately describe the solar cycle variations in the energy distributions of anomalous and galactic cosmic rays, respectively. According to these results the distribution of these high energetic species cannot be correctly described on the basis of the actually prevailing solar wind conditions.
Key words. Interplanetary
BOREX: Solar neutrino experiment via weak neutral and charged currents in boron-11
International Nuclear Information System (INIS)
Kovacs, T.; Mitchell, J.W.; Raghavan, P.
1989-01-01
Borex, and experiment to observe solar neutrinos using boron loaded liquid scintillation techniques, is being developed for operation at the Gran Sasso underground laboratory. It aims to observe the spectrum of electron type 8 B solar neutrinos via charged current inverse β-decay of 11 B and the total flux solar neutrinos regardless of flavor by excitation of 11 B via the weak neutral current. 14 refs
Geophysical and solar activity indices
Bossy, L.; Lemaire, J.
1984-04-01
A large number of geophysicists try to correlate their observations with one or even a series of different geophysical or solar activity indices. Yet the right choice of the most appropriate index with which to correlate depends mainly on our understanding of the physical cause-effect relationship between the new set of observations and the index chosen. This best choice will therefore depend on our good understanding of the methods of measurement and derivation of the adopted index in such correlative studies. It relies also on our awareness of the range of applicability of the indices presently available as well as on our understanding of their limitations. It was to achieve these goals that a series of general lectures on geophysical and solar activity indices was organized by L. Bossy and J. Lemaire (Institut d'Aeronomie Spatiale de Belgique (IASB), Brussels), March 26-29, 1984 at Han-sur-Lesse, Belgium.
Temporal associations of life with solar and geophysical activity
Directory of Open Access Journals (Sweden)
T. K. Breus
Full Text Available In biology, circadian rhythms with a period of one cycle in 20–28 h are known to be ubiquitous and partly endogenous. Rhythms with a frequency lower than one cycle per day are called 'infradian rhythms'. Among them are components with one cycle in about 3.5, 7, 14 and 28 days, the multiseptans, which, like the circadians, must be regarded as a general characteristic of life: they characterize unicells as well as much more differentiated organisms. We hypothesize that heliogeophysical factors other than the solar visible light, held responsible for the evolution of circadian periodicity, underlie the infradian rhythms of biosystems. The periodicities in the solar wind and variations in the interplanetary magnetic field (IMF which are associated with the solar rotation are very similar in length to the biological periodicities. We investigate the temporal relations of variations in solar activity and in biological systems to test associations between events in the IMF, in geomagnetic disturbance, in myocardial infarction and in physiology. By cross-spectral analysis, we also find relations at certain frequencies between changes in human physiology on the one hand, and (1 the vertical component of the induction vector of the IMF, Bz, and (2 a global index of geomagnetic disturbance, Kp, on the other hand. We wish to stimulate interest in these periodicities of both biological systems and geophysical endpoints among physicists and biologists alike, so that problems relevant to clinicians and other biologists, including evolutionists, are eventually solved by their cooperation with the geophysical community.
The UVR8 UV-B Photoreceptor: Perception, Signaling and Response
Tilbrook, Kimberley; Arongaus, Adriana B.; Binkert, Melanie; Heijde, Marc; Yin, Ruohe; Ulm, Roman
2013-01-01
Ultraviolet-B radiation (UV-B) is an intrinsic part of sunlight that is accompanied by significant biological effects. Plants are able to perceive UV-B using the UV-B photoreceptor UVR8 which is linked to a specific molecular signaling pathway and leads to UV-B acclimation. Herein we review the biological process in plants from initial UV-B perception and signal transduction through to the known UV-B responses that promote survival in sunlight. The UVR8 UV-B photoreceptor exists as a homodimer that instantly monomerises upon UV-B absorption via specific intrinsic tryptophans which act as UV-B chromophores. The UVR8 monomer interacts with COP1, an E3 ubiquitin ligase, initiating a molecular signaling pathway that leads to gene expression changes. This signaling output leads to UVR8-dependent responses including UV-B-induced photomorphogenesis and the accumulation of UV-B-absorbing flavonols. Negative feedback regulation of the pathway is provided by the WD40-repeat proteins RUP1 and RUP2, which facilitate UVR8 redimerization, disrupting the UVR8-COP1 interaction. Despite rapid advancements in the field of recent years, further components of UVR8 UV-B signaling are constantly emerging, and the precise interplay of these and the established players UVR8, COP1, RUP1, RUP2 and HY5 needs to be defined. UVR8 UV-B signaling represents our further understanding of how plants are able to sense their light environment and adjust their growth accordingly. PMID:23864838
Solar rotational cycle in lightning activity in Japan during the 18-19th centuries
Miyahara, Hiroko; Kataoka, Ryuho; Mikami, Takehiko; Zaiki, Masumi; Hirano, Junpei; Yoshimura, Minoru; Aono, Yasuyuki; Iwahashi, Kiyomi
2018-04-01
Thunderstorm and cloud activities sometimes show a 27-day period, and this has long been studied to uncover a possible important link to solar rotation. Because the 27-day variations in the solar forcing parameters such as solar ultraviolet and galactic cosmic rays become more prominent when the solar activity is high, it is expected that the signal of the 27-day period in meteorological phenomena may wax and wane according to the changes in the solar activity level. In this study, we examine in detail the intensity variations in the signal of the 27-day solar rotational period in thunder and lightning activity from the 18th to the 19th centuries based on 150-year-long records found in old diaries kept in Japan and discuss their relation with the solar activity levels. Such long records enable us to examine the signals of solar rotation at both high and low solar activity levels. We found that the signal of the solar rotational period in the thunder and lightning activity increases as the solar activity increases. In this study, we also discuss the possibility of the impact of the long-term climatological conditions on the signals of the 27-day period in thunder/lightning activities.
32 CFR 806b.8 - Obtaining law enforcement records.
2010-07-01
... 32 National Defense 6 2010-07-01 2010-07-01 false Obtaining law enforcement records. 806b.8 Section 806b.8 National Defense Department of Defense (Continued) DEPARTMENT OF THE AIR FORCE ADMINISTRATION PRIVACY ACT PROGRAM Obtaining Law Enforcement Records and Confidentiality Promises § 806b.8 Obtaining law enforcement records. The Commander, Air...
Physics of the Solar Active Regions from Radio Observations
Gelfreikh, G. B.
1999-12-01
Localized increase of the magnetic field observed by routine methods on the photosphere result in the growth of a number of active processes in the solar atmosphere and the heliosphere. These localized regions of increased magnetic field are called active regions (AR). The main processes of transfer, accumulation and release of energy in an AR is, however, out of scope of photospheric observations being essentially a 3D-process and happening either under photosphere or up in the corona. So, to investigate these plasma structures and processes we are bound to use either extrapolation of optical observational methods or observations in EUV, X-rays and radio. In this review, we stress and illustrate the input to the problem gained from radio astronomical methods and discuss possible future development of their applicatications. Historically speaking each new step in developing radio technique of observations resulted in detecting some new physics of ARs. The most significant progress in the last few years in radio diagnostics of the plasma structures of magnetospheres of the solar ARs is connected with the developing of the 2D full disk analysis on regular basis made at Nobeyama and detailed multichannel spectral-polarization (but one-dimensional and one per day) solar observations at the RATAN-600. In this report the bulk of attention is paid to the new approach to the study of solar activity gained with the Nobeyama radioheliograph and analyzing the ways for future progress. The most important new features of the multicomponent radio sources of the ARs studied using Nobeyama radioheliograph are as follow: 1. The analysis of magnetic field structures in solar corona above sunspot with 2000 G. Their temporal evolution and fluctuations with the periods around 3 and 5 minutes, due to MHD-waves in sunspot magnetic tubes and surrounding plasma. These investigations are certainly based on an analysis of thermal cyclotron emission of lower corona and CCTR above sunspot
Solar activity and transformer failures in the Greek national electric grid
Directory of Open Access Journals (Sweden)
Zois Ioannis Panayiotis
2013-11-01
Full Text Available Aims: We study both the short term and long term effects of solar activity on the large transformers (150 kV and 400 kV of the Greek national electric grid. Methods: We use data analysis and various statistical methods and models. Results: Contrary to common belief in PPC Greece, we see that there are considerable both short term (immediate and long term effects of solar activity onto large transformers in a mid-latitude country like Greece. Our results can be summarised as follows: For the short term effects: During 1989–2010 there were 43 “stormy days” (namely days with for example Ap ≥ 100 and we had 19 failures occurring during a stormy day plus or minus 3 days and 51 failures occurring during a stormy day plus or minus 7 days. All these failures can be directly related to Geomagnetically Induced Currents (GICs. Explicit cases are briefly presented. For the long term effects, again for the same period 1989–2010, we have two main results: The annual number of transformer failures seems to follow the solar activity pattern. Yet the maximum number of transformer failures occurs about half a solar cycle after the maximum of solar activity. There is statistical correlation between solar activity expressed using various newly defined long term solar activity indices and the annual number of transformer failures. These new long term solar activity indices were defined using both local (from the geomagnetic station in Greece and global (planetary averages geomagnetic data. Applying both linear and non-linear statistical regression we compute the regression equations and the corresponding coefficients of determination.
Active solar heating industry development study
International Nuclear Information System (INIS)
1995-01-01
Despite the fact that solar water heating systems are technologically viable and commercially available, this Energy Technology Support Unit report shows that there is no established market in the United Kingdom. The Solar Trade Association (STA) has undertaken an Active Solar Heating Industry Development Study which is reported here. The data is derived from a questionnaire survey completed by companies, organizations and individuals operating within the industry. Information was also gathered from utility companies, and STAs elsewhere in Europe. Barriers which need to be overcome include lack of public awareness, especially in the construction industry, lack of capital investment and other financial disincentives, little or no government support, and lack of organization and quality monitoring and assurance within the industry itself. (UK)
Solar ultraviolet-B exposure and cancer incidence and mortality in the United States, 1993–2002
Directory of Open Access Journals (Sweden)
Boscoe Francis P
2006-11-01
Full Text Available Abstract Background An inverse relationship between solar ultraviolet-B (UV-B exposure and non-skin cancer mortality has long been reported. Vitamin D, acquired primarily through exposure to the sun via the skin, is believed to inhibit tumor development and growth and reduce mortality for certain cancers. Methods We extend the analysis of this relationship to include cancer incidence as well as mortality, using higher quality and higher resolution data sets than have typically been available. Over three million incident cancer cases between 1998 and 2002 and three million cancer deaths between 1993 and 2002 in the continental United States were regressed against daily satellite-measured solar UV-B levels, adjusting for numerous confounders. Relative risks of reduced solar UV-B exposure were calculated for thirty-two different cancer sites. Results For non-Hispanic whites, an inverse relationship between solar UV-B exposure and cancer incidence and mortality was observed for ten sites: bladder, colon, Hodgkin lymphoma, myeloma, other biliary, prostate, rectum, stomach, uterus, and vulva. Weaker evidence of an inverse relationship was observed for six sites: breast, kidney, leukemia, non-Hodgkin lymphoma, pancreas, and small intestine. For three sites, inverse relationships were seen that varied markedly by sex: esophagus (stronger in males than females, gallbladder (stronger in females than males, and thyroid (only seen in females. No association was found for bone and joint, brain, larynx, liver, nasal cavity, ovary, soft tissue, male thyroid, and miscellaneous cancers. A positive association between solar UV-B exposure and cancer mortality and incidence was found for anus, cervix, oral cavity, melanoma, and other non-epithelial skin cancer. Conclusion This paper adds to the mounting evidence for the influential role of solar UV-B exposure on cancer, particularly for some of the less-well studied digestive cancers. The relative risks for cancer
The relationship between plasmapause, solar wind and geomagnetic activity between 2007 and 2011
Energy Technology Data Exchange (ETDEWEB)
Verbanac, G. [Zagreb Univ. (Croatia). Dept. of Geophysics; Pierrard, V. [Belgian Institute for Space Aeronomy (Space Physics and STCE), Brussels (Belgium); Univ. Catholique de Louvain, Louvain-La-Neuve (Belgium). TECLIM, Earth and Life Inst.; Darrouzet, F. [Belgian Institute for Space Aeronomy (Space Physics and STCE), Brussels (Belgium); Rauch, J.L.; Decreau, P. [Laboratoire de Physique et Chimie de l' Environnement et de l' Espace (LPC2E), Orleans (France); Bandic, M.
2015-07-01
Taking advantage of the Cluster satellite mission and especially the observations made by the instrument WHISPER to deduce the electron number density along the orbit of the satellites, we studied the relationships between the plasmapause positions (L{sub PP}) and the following L{sub PP} indicators: (a) solar wind coupling functions B{sub z} (Z component of the interplanetary magnetic field vector, B, in GSM system), BV (related to the interplanetary electric field; B is the magnitude of the interplanetary magnetic field vector, V is solar wind velocity), and dΦ{sub mp}/dt (which combines different physical processes responsible for the magnetospheric activity) and (b) geomagnetic indices Dst, Ap and AE. The analysis is performed separately for three magnetic local time (MLT) sectors (Sector1 - night sector (01:00-07:00MLT); Sector2 - day sector (07:00-16:00MLT); Sector3 - evening sector (16:00-01:00MLT)) and for all MLTs taken together. All L{sub PP} indicators suggest the faster plasmapause response in the postmidnight sector. Delays in the plasmapause responses (hereafter time lags) are approximately 2-27 h, always increasing from Sector1 to Sector3. The obtained fits clearly resolve the MLT structures. The variability in the plasmapause is the largest for low values of L{sub PP} indicators, especially in Sector2. At low activity levels, L{sub PP} exhibits the largest values on the dayside (in Sector2) and the smallest on the postmidnight side (Sector1). Displacements towards larger values on the evening side (Sector3) and towards lower values on the dayside (Sector2) are identified for enhanced magnetic activity. Our results contribute to constraining the physical mechanisms involved in the plasmapause formation and to further study the still not well understood related issues.
The relationship between plasmapause, solar wind and geomagnetic activity between 2007 and 2011
International Nuclear Information System (INIS)
Verbanac, G.; Rauch, J.L.; Decreau, P.; Bandic, M.
2015-01-01
Taking advantage of the Cluster satellite mission and especially the observations made by the instrument WHISPER to deduce the electron number density along the orbit of the satellites, we studied the relationships between the plasmapause positions (L PP ) and the following L PP indicators: (a) solar wind coupling functions B z (Z component of the interplanetary magnetic field vector, B, in GSM system), BV (related to the interplanetary electric field; B is the magnitude of the interplanetary magnetic field vector, V is solar wind velocity), and dΦ mp /dt (which combines different physical processes responsible for the magnetospheric activity) and (b) geomagnetic indices Dst, Ap and AE. The analysis is performed separately for three magnetic local time (MLT) sectors (Sector1 - night sector (01:00-07:00MLT); Sector2 - day sector (07:00-16:00MLT); Sector3 - evening sector (16:00-01:00MLT)) and for all MLTs taken together. All L PP indicators suggest the faster plasmapause response in the postmidnight sector. Delays in the plasmapause responses (hereafter time lags) are approximately 2-27 h, always increasing from Sector1 to Sector3. The obtained fits clearly resolve the MLT structures. The variability in the plasmapause is the largest for low values of L PP indicators, especially in Sector2. At low activity levels, L PP exhibits the largest values on the dayside (in Sector2) and the smallest on the postmidnight side (Sector1). Displacements towards larger values on the evening side (Sector3) and towards lower values on the dayside (Sector2) are identified for enhanced magnetic activity. Our results contribute to constraining the physical mechanisms involved in the plasmapause formation and to further study the still not well understood related issues.
Near and sub-barrier reactions of 8B
Directory of Open Access Journals (Sweden)
Kolata J. J.
2017-01-01
Full Text Available Four classes of measurements that are important for achieving a complete understanding of the reactions of exotic nuclei are identified and classified according to their degree of difficulty. Previously reported data for near- and sub-barrier fusion of 8B+58Ni are critically reviewed. The influence of breakup protons on the evaporation proton measurements for this system is shown to be small at all energies except for the lowest one measured, and corrections are made for this process. Model dependencies in the deduced fusion cross sections are assessed using three different evaporation codes. Data sets for targets of 58Ni and 28Si are shown to be consistent with each other, and with fusion enhancement up to energies that are greater than the Coulomb barrier Vb (Ec.m. ≲ Vb + 1.5×ћω. An important difference with the behavior of neutron-halo systems is thereby confirmed. Possible fusion suppression beyond this energy is suggested by the 28Si data. A proposal to measure the 8B+40Ar fusion cross section using an active-target time projection chamber is discussed.
Homo-Tandem Polymer Solar Cells withVOC>1.8 V for Efficient PV-Driven Water Splitting
Gao, Yangqin
2016-03-06
Efficient homo-tandem and triple-junction polymer solar cells are constructed by stacking identical subcells composed of the wide-bandgap polymer PBDTTPD, achieving power conversion efficiencies >8% paralleled by open-circuit voltages >1.8 V. The high-voltage homo-tandem is used to demonstrate PV-driven electrochemical water splitting with an estimated solar-to-hydrogen conversion efficiency of ≈6%. © 2016 WILEY-VCH Verlag GmbH & Co.
International Nuclear Information System (INIS)
Tang, F.; Tsurutani, B.T.; Gonzalez, W.D.; Akasofu, S.I.; Smith, E.J.
1989-01-01
Tsurutani et al. [1988] analyzed the 10 intense interplanetary southward B/sub z/ events that led to major magnetic storms (Dst 3.0) are associated with prominence eruptions. For three of the five southward B/sub z/ events in which the driver gases are the causes of the intense southward field leading to magnetic storms, the photospheric fields of the solar sources have no dominant southward component, indicating the driver gas fields do not always result from a simple outward convection of solar magnetic fields. Finally we compare the solar events and their resulting interplanetary shocks and find that the standard solar parameters do not correlate with the strengths of the resulting shocks at 1 AU. The implications are discussed. copyright American Geophysical Union 1989
International Nuclear Information System (INIS)
Ballare, C.L.; Scopel, A.L.; Stapleton, A.E.
1996-01-01
To study functional relationships between the effects of solar ultraviolet-B radiation (UV0B) on different aspects of the physiology of a wild plant, we carried out exclusion experiments in the field with the summer annual Datura ferrox L. Solar UV-B incident over Buenos Aires reduced daytime seedling emergence, inhibited stem elongation and leaf expansion, and tended to reduce biomass accumulation during early growth. However, UV-B had no effect on calculated net assimilation rate. Using a monoclonal antibody specific to the cyclobutane-pyrimidine dimer (CPD), we found that plants receiving full sunlight had more CPDs per unit of DNA than plants shielded from solar UV-B, but the positive correlation between UV-B and CPD burden tended to level off at high (near solar) UV-B levels. At our field site, Datura plants were consumed by leaf beetles (Coleoptera), and the proportion of plants attacked by insects declined with the amount of UV-B received during growth. Field experiments showed that plant exposure to solar UV-B reduced the likelihood of leaf beetle attack by one-half. Our results highlight the complexities associated with scaling plant responses to solar UV-B, because they show: (a) a lack of correspondence between UV-B effects on net assimilation rate and whole-plant growth rate, (b) nonlinear UV-B dose-response curves, and (c) UV-B effects of plant attractiveness to natural herbivores. 56 refs., 7 figs
Broadband light absorption enhancement in moth’s eye nanostructured organic solar cells
Directory of Open Access Journals (Sweden)
Weixia Lan
2015-05-01
Full Text Available A comprehensive study on inverted organic solar cells (OSCs with a moth’s eye nanostructured (MEN active layer was carried out. Performance of the MEN-based OSCs and the corresponding control planar cells, fabricated with blend of poly[4,8-bis[(2-ethylhexyloxy]benzo[1,2-b:4,5-bA] dithiophene-2, 6-diyl][3-fluoro-2-[(2- ethylhexyl carbonyl]thieno[3,4-b]-thiophenediyl] (PTB7:[6,6]- phenyl-C70- butyric-acid-methyl-ester (PC70BM was analyzed. The efficiency of the MEN-based OSCs was optimized by adjusting the height of MEN pattern in the active layer. Our experimental and theoretical results reveal that the MEN pattern enhances light absorption in the PTB7:PC70BM active layer, especially over the long wavelength region. This leads to a 7.8% increase in short circuit current density and a 6.1% increase in power conversion efficiency over those of the control planar cell.
Survey of active solar thermal collectors, industry and markets in Canada : final report
Energy Technology Data Exchange (ETDEWEB)
NONE
2005-08-01
that the operating base of solar thermal systems in Canada only began to increase again in recent years. The estimated GHG emissions avoided from all active solar systems operating in Canada during 2004 were 23, 200 tonnes of CO{sub 2} equivalent. It was anticipated that the expected avoidance of CO{sub 2} emissions from solar collectors sold and installed in Canada during 2004 will total 122,600 tonnes over their 20-30 year life. 8 refs., 8 tabs., 12 figs.
Ionospheric F2-Layer Semi-Annual Variation in Middle Latitude by Solar Activity
Directory of Open Access Journals (Sweden)
Yoon-Kyung Park
2010-12-01
Full Text Available We examine the ionospheric F2-layer electron density variation by solar activity in middle latitude by using foF2 observed at the Kokubunji ionosonde station in Japan for the period from 1997 to 2008. The semi-annual variation of foF2 shows obviously in high solar activity (2000-2002 than low solar activity (2006-2008. It seems that variation of geomagnetic activity by solar activity influences on the semi-annual variation of the ionospheric F2-layer electron density. According to the Lomb-Scargle periodogram analysis of foF2 and Ap index, interplanetary magnetic field (IMF Bs (IMF Bz <0 component, solar wind speed, solar wind number density and flow pressure which influence the geomagnetic activity, we examine how the geomagnetic activity affects the ionospheric F2-layer electron density variation. We find that the semi-annual variation of daily foF2, Ap index and IMF Bs appear clearly during the high solar activity. It suggests that the semi-annual variation of geomagnetic activity, caused by Russell-McPherron effect, contributes greatly to the ionospheric F2-layer semi-annual electron density variation, except dynamical effects in the thermosphere.
Solar activity effects in the ionospheric D region
Directory of Open Access Journals (Sweden)
A. D. Danilov
1998-12-01
Full Text Available Variations in the D-region electron concentration within the solar activity cycle are considered. It is demonstrated that conclusions of various authors, who have analyzed various sets of experimental data on [e], differ significantly. The most reliable seem to be the conclusions based on analysis of the [e] measurements carried out by the Faraday rotation method and on the theoretical concepts on the D-region photochemistry. Possible QBO effects in the relation of [e] to solar activity are considered and an assumption is made that such effects may be the reason for the aforementioned disagreement in conclusions on the [e] relation to solar indices.Key words. Atmospheric composition and structure · Ion chemistry of the atmosphere · Middle atmosphere
Forecasting the peak of the present solar activity cycle 24
Hamid, R. H.; Marzouk, B. A.
2018-06-01
Solar forecasting of the level of sun Activity is very important subject for all space programs. Most predictions are based on the physical conditions prevailing at or before the solar cycle minimum preceding the maximum in question. Our aim is to predict the maximum peak of cycle 24 using precursor techniques in particular those using spotless event, geomagnetic aamin. index and solar flux F10.7. Also prediction of exact date of the maximum (Tr) is taken in consideration. A study of variation over previous spotless event for cycles 7-23 and that for even cycles (8-22) are carried out for the prediction. Linear correlation between maximum of solar cycles (RM) and spotless event around the preceding minimum gives R24t = 88.4 with rise time Tr = 4.6 years. For the even cycles R24E = 77.9 with rise time Tr = 4.5 y's. Based on the average aamin. index for cycles (12-23), we estimate the expected amplitude for cycle 24 to be Raamin = 99.4 and 98.1 with time rise of Traamin = 4.04 & 4.3 years for both the total and even cycles in consecutive. The application of the data of solar flux F10.7 which cover only cycles (19-23) was taken in consideration and gives predicted maximum amplitude R24 10.7 = 126 with rise time Tr107 = 3.7 years, which are over estimation. Our result indicating to somewhat weaker of cycle 24 as compared to cycles 21-23.
Gravity Probe B Completed With Solar Arrays
2004-01-01
In this photo, the Gravity Probe B (GP-B) space vehicle is completed during the solar array installation. The GP-B is the relativity experiment developed at Stanford University to test two extraordinary predictions of Albert Einstein's general theory of relativity. The experiment will measure, very precisely, the expected tiny changes in the direction of the spin axes of four gyroscopes contained in an Earth-orbiting satellite at a 400-mile altitude. So free are the gyroscopes from disturbance that they will provide an almost perfect space-time reference system. They will measure how space and time are very slightly warped by the presence of the Earth, and, more profoundly, how the Earth's rotation very slightly drags space-time around with it. These effects, though small for the Earth, have far-reaching implications for the nature of matter and the structure of the Universe. GP-B is among the most thoroughly researched programs ever undertaken by NASA. This is the story of a scientific quest in which physicists and engineers have collaborated closely over many years. Inspired by their quest, they have invented a whole range of technologies that are already enlivening other branches of science and engineering. GP-B is scheduled for launch in April 2004 and managed for NASA by the Marshall Space Flight Center. Development of the GP-B is the responsibility of Stanford University along with major subcontractor Lockheed Martin Corporation. (Image credit to Russ Underwood, Lockheed Martin Corporation).
Nonlinear techniques for forecasting solar activity directly from its time series
Ashrafi, S.; Roszman, L.; Cooley, J.
1993-01-01
This paper presents numerical techniques for constructing nonlinear predictive models to forecast solar flux directly from its time series. This approach makes it possible to extract dynamical in variants of our system without reference to any underlying solar physics. We consider the dynamical evolution of solar activity in a reconstructed phase space that captures the attractor (strange), give a procedure for constructing a predictor of future solar activity, and discuss extraction of dynamical invariants such as Lyapunov exponents and attractor dimension.
International Nuclear Information System (INIS)
Pourghasemi Ranjbar, M.; Alavi Naeini, N.; Mortezapour, H.
2016-01-01
Drying is a very sophisticated process which consumes a large amount of energy. Solar energy can be used as an alternative or supplementary energy source to fossil fuels. Solar dryers are common ways for saving fossil fuel consumption during agricultural products drying. In this study, the performance of an active solar dryer equipped with an energy recovery system was investigated at three levels of drying air temperature. The results showed that the energy recovery system was able to increase inlet air temperature by 16.8, 18.5 and 18.9 ° C at drying temperatures of 55, 65 and 75 ℃, respectively. Meanwhile 47.8, 42.9 and 40.9 percents of the dryer exhaust air energy were recovered respectively at these conditions which subsequently led to a reduction of 30.7, 19.2 and 14.7 percents in electrical heater energy consumption.
Hilbert-Huang transform analysis of long-term solar magnetic activity
Deng, Linhua
2018-04-01
Astronomical time series analysis is one of the hottest and most important problems, and becomes the suitable way to deal with the underlying dynamical behavior of the considered nonlinear systems. The quasi-periodic analysis of solar magnetic activity has been carried out by various authors during the past fifty years. In this work, the novel Hilbert-Huang transform approach is applied to investigate the yearly numbers of polar faculae in the time interval from 1705 to 1999. The detected periodicities can be allocated to three components: the first one is the short-term variations with periods smaller than 11 years, the second one is the mid- term variations with classical periods from 11 years to 50 years, and the last one is the long-term variations with periods larger than 50 years. The analysis results improve our knowledge on the quasi-periodic variations of solar magnetic activity and could be provided valuable constraints for solar dynamo theory. Furthermore, our analysis results could be useful for understanding the long-term variations of solar magnetic activity, providing crucial information to describe and forecast solar magnetic activity indicators.
Does solar activity affect human happiness?
Kristoufek, Ladislav
2018-03-01
We investigate the direct influence of solar activity (represented by sunspot numbers) on human happiness (represented by the Twitter-based Happiness Index). We construct four models controlling for various statistical and dynamic effects of the analyzed series. The final model gives promising results. First, there is a statistically significant negative influence of solar activity on happiness which holds even after controlling for the other factors. Second, the final model, which is still rather simple, explains around 75% of variance of the Happiness Index. Third, our control variables contribute significantly as well: happiness is higher in no sunspots days, happiness is strongly persistent, there are strong intra-week cycles and happiness peaks during holidays. Our results strongly contribute to the topical literature and they provide evidence of unique utility of the online data.
The ancient Egyptian civilization: maximum and minimum in coincidence with solar activity
Shaltout, M.
It is proved from the last 22 years observations of the total solar irradiance (TSI) from space by artificial satellites, that TSI shows negative correlation with the solar activity (sunspots, flares, and 10.7cm Radio emissions) from day to day, but shows positive correlations with the same activity from year to year (on the base of the annual average for each of them). Also, the solar constant, which estimated fromth ground stations for beam solar radiations observations during the 20 century indicate coincidence with the phases of the 11- year cycles. It is known from sunspot observations (250 years) , and from C14 analysis, that there are another long-term cycles for the solar activity larger than 11-year cycle. The variability of the total solar irradiance affecting on the climate, and the Nile flooding, where there is a periodicities in the Nile flooding similar to that of solar activity, from the analysis of about 1300 years of the Nile level observations atth Cairo. The secular variations of the Nile levels, regularly measured from the 7 toth 15 century A.D., clearly correlate with the solar variations, which suggests evidence for solar influence on the climatic changes in the East African tropics The civilization of the ancient Egyptian was highly correlated with the Nile flooding , where the river Nile was and still yet, the source of the life in the Valley and Delta inside high dry desert area. The study depends on long -time historical data for Carbon 14 (more than five thousands years), and chronical scanning for all the elements of the ancient Egyptian civilization starting from the firs t dynasty to the twenty six dynasty. The result shows coincidence between the ancient Egyptian civilization and solar activity. For example, the period of pyramids building, which is one of the Brilliant periods, is corresponding to maximum solar activity, where the periods of occupation of Egypt by Foreign Peoples corresponding to minimum solar activity. The decline
Super-Kamiokande Solar Neutrino Results and NSI Analysis
Weatherly, Pierce; Super-Kamiokande Collaboration
2017-09-01
Super-Kamiokande (SK) detects the Cerenkov light from elastic scattering of solar 8B neutrinos with electrons in its ultra-pure water. The directionality, energy, and timing of the recoil electrons determines the interaction rate, the flight path, as well as the energy dependence of the 8B neutrinos’ electron-flavor survival probability P ee . While the P ee below 1 MeV is equivalent to averaged vacuum neutrino flavor oscillations, the P ee above 7 MeV is suppressed by the Mikheyev-Smirnov-Wolfenstein (MSW) resonance resulting from the interaction of the solar neutrinos with solar matter. In the same way, Earth matter effects influence Pee, leading to an apparent Day/Night effect. Non-standard interactions (NSI) extend the MSW model to include interactions between the quarks in matter and neutrinos, thereby modifying P ee . We present the signatures of matter effects on solar neutrinos in Super-Kamiokande and present limits on NSI parameters, in particular couplings to the down quark.
Perna, L.; Venkatesh, K.; Pillat, V. G.; Pezzopane, M.; Fagundes, P. R.; Ezquer, R. G.; Cabrera, M. A.
2018-01-01
Bottom side electron density profiles for two stations at the southern crest of the Equatorial Ionization Anomaly (EIA), São José dos Campos (23.1°S, 314.5°E, dip latitude 19.8°S; Brazil) and Tucumán (26.9°S, 294.6°E, dip latitude 14.0°S; Argentina), located at similar latitude and separated by only 20° in longitude, have been compared during equinoctial, winter and summer months under low (year 2008, minimum of the solar cycle 23/24) and high solar activity (years 2013-2014, maximum of the solar cycle 24) conditions. An analysis of parameters describing the bottom side part of the electron density profile, namely the peak electron density NmF2, the height hmF2 at which it is reached, the thickness parameter B0 and the shape parameter B1, is carried out. Further, a comparison of bottom side profiles and F-layer parameters with the corresponding outputs of IRI-2012 and NeQuick2 models is also reported. The variations of NmF2 at both stations reveal the absence of semi-annual anomaly for low solar activity (LSA), evidencing the anomalous activity of the last solar minimum, while those related to hmF2 show an uplift of the ionosphere for high solar activity (HSA). As expected, the EIA is particularly visible at both stations during equinox for HSA, when its strength is at maximum in the South American sector. Despite the similar latitude of the two stations upon the southern crest of the EIA, the anomaly effect is more pronounced at Tucumán than at São José dos Campos. The differences encountered between these very close stations suggest that in this sector relevant longitudinal-dependent variations could occur, with the longitudinal gradient of the Equatorial Electrojet that plays a key role to explain such differences together with the 5.8° separation in dip latitude between the two ionosondes. Furthermore at Tucumán, the daily peak value of NmF2 around 21:00 LT during equinox for HSA is in temporal coincidence with an impulsive enhancement of hmF2
Effects of Solar Activity and Space Environment in 2003 Oct.
Directory of Open Access Journals (Sweden)
Kyung-Seok Cho
2004-12-01
Full Text Available In this paper, we present a good example of extreme solar and geomagnetic activities from October to November, 2003. These activities are characterized by very large sunspot groups, X-class solar flares, strong particle events, and huge geomagnetic storms. We discuss ground-based and space-based data in terms of space weather scales. Especially, we present several solar and geomagnetic disturbance data produced in Korea : sunspots, geo-magnetograms, aurora, Ionogram, and Total Electron Content (TEC map by GPS data. Finally, we introduce some examples of the satellite orbit and communication effects caused by these activities; e.g., the disturbances of the KOMPSAT-1 operational orbit and HF communication.
Activity associated with the solar origin of coronal mass ejections
Webb, D. F.; Hundhausen, A. J.
1987-01-01
Solar coronal mass ejections (CMEs) observed in 1980 with the HAO Coronagraph/Polarimeter on the Solar Maximum Mission (SMM) satellite are compared with other forms of solar activity that might be physically related to the ejections. The solar phenomena checked and the method of association used were intentionally patterned after those of Munro et al.'s (1979) analysis of mass ejections observed with the Skylab coronagraph to facilitate comparison of the two epochs. Comparison of the results reveals that the types and degree of CME associations are similar near solar activity minimum and at maximum. For both epochs, most CMEs with associations had associated eruptive prominences, and the proportions of association of all types of activity were similar. A high percentage of association between SMM CMEs and X-ray long duration events is also found, in agreement with Skylab results. It is concluded that most CMEs are the result of the destabilization and eruption of a prominence and its overlying coronal structure, or of a magnetic structure capable of supporting a prominence.
Solar Observations on Magneto-Convection
1989-05-31
Technical Library National Solar Observatory Sunspot, NM 88349 Karl - Schwarzschild -Strasse 1 8046 Garching bei Mundhen Solar Observations On Magneto...Schmidt, Hermann-Ulrich Schmidt, Hans-Christoph Thomas (eds.) Max-Planck-Institut fir Physik und Astrophysik Institut fiur Astrophysik Karl ... Schwarzschild -St-. 1 D-8046 Garching, FklG 14TIS CRiA.&l DTIC TA. U~Jar,iou8:ed B ......... ... Distribution I -- Availability COcý----- Avail and or Dist special
International Nuclear Information System (INIS)
Tuomela, Johanna; Solin, Olof; Minn, Heikki; Härkönen, Pirkko L; Grönroos, Tove J; Valta, Maija P; Sandholm, Jouko; Schrey, Aleksi; Seppänen, Jani; Marjamäki, Päivi; Forsback, Sarita; Kinnunen, Ilpo
2010-01-01
Prostate tumours are commonly poorly oxygenated which is associated with tumour progression and development of resistance to chemotherapeutic drugs and radiotherapy. Fibroblast growth factor 8b (FGF8b) is a mitogenic and angiogenic factor, which is expressed at an increased level in human prostate tumours and is associated with a poor prognosis. We studied the effect of FGF8b on tumour oxygenation and growth parameters in xenografts in comparison with vascular endothelial growth factor (VEGF)-expressing xenografts, representing another fast growing and angiogenic tumour model. Subcutaneous tumours of PC-3 cells transfected with FGF8b, VEGF or empty (mock) vectors were produced and studied for vascularity, cell proliferation, glucose metabolism and oxygenation. Tumours were evaluated by immunohistochemistry (IHC), flow cytometry, use of radiolabelled markers of energy metabolism ([ 18 F]FDG) and hypoxia ([ 18 F]EF5), and intratumoral polarographic measurements of pO 2 . Both FGF8b and VEGF tumours grew rapidly in nude mice and showed highly vascularised morphology. Perfusion studies, pO 2 measurements, [ 18 F]EF5 and [ 18 F]FDG uptake as well as IHC staining for glucose transport protein (GLUT1) and hypoxia inducible factor (HIF) 1 showed that VEGF xenografts were well-perfused and oxygenised, as expected, whereas FGF8b tumours were as hypoxic as mock tumours. These results suggest that FGF8b-induced tumour capillaries are defective. Nevertheless, the growth rate of hypoxic FGF8b tumours was highly increased, as that of well-oxygenised VEGF tumours, when compared with hypoxic mock tumour controls. FGF8b is able to induce fast growth in strongly hypoxic tumour microenvironment whereas VEGF-stimulated growth advantage is associated with improved perfusion and oxygenation of prostate tumour xenografts
International Nuclear Information System (INIS)
Gold, R.E.; Dodson-Prince, H.W.; Hedeman, E.R.; Roelof, E.C.
1982-01-01
We have studied solar and interplanetary data by identification of the heliographic longitudes of the coronal source regions of high speed solar wind streams and by mapping the velocities measured near earth back to the sun using the approximation of constant radial velocity. Interplay of active regions and solar wind were studied
Shinbori, A.; Koyama, Y.; Nose, M.; Hori, T.
2017-12-01
Characteristics of seasonal variation and solar activity dependence of the X- and Y-components of the geomagnetic solar quiet (Sq) daily variation at Memanbetsu in mid-latitudes and Guam near the equator have been investigated using long-term geomagnetic field data with 1-h time resolution from 1957 to 2016. In this analysis, we defined the quiet day when the maximum value of the Kp index is less than 3 for that day. In this analysis, we used the monthly average of the adjusted daily F10.7 corresponding to geomagnetically quiet days. For identification of the monthly mean Sq variation in the X and Y components (Sq-X and Sq-Y), we first determined the baseline of the X and Y components from the average value from 22 to 2 h (LT: local time) for each quiet day. Next, we calculated a deviation from the baseline of the X- and Y-components of the geomagnetic field for each quiet day, and computed the monthly mean value of the deviation for each local time. As a result, Sq-X and Sq-Y shows a clear seasonal variation and solar activity dependence. The amplitude of seasonal variation increases significantly during high solar activities, and is proportional to the solar F10.7 index. The pattern of the seasonal variation is quite different between Sq-X and Sq-Y. The result of the correlation analysis between the solar F10.7 index and Sq-X and Sq-Y shows almost the linear relationship, but the slope and intercept of the linear fitted line varies as function of local time and month. This implies that the sensitivity of Sq-X and Sq-Y to the solar activity is different for different local times and seasons. The local time dependence of the offset value of Sq-Y at Guam and its seasonal variation suggest a magnetic field produced by inter-hemispheric field-aligned currents (FACs). From the sign of the offset value of Sq-Y, it is infer that the inter-hemispheric FACs flow from the summer to winter hemispheres in the dawn and dusk sectors and from the winter to summer hemispheres in
NOMINAL VALUES FOR SELECTED SOLAR AND PLANETARY QUANTITIES: IAU 2015 RESOLUTION B3
Energy Technology Data Exchange (ETDEWEB)
Prša, Andrej [Villanova University, Department of Astrophysics and Planetary Science, 800 Lancaster Ave., Villanova, PA 19085 (United States); Harmanec, Petr [Astronomical Institute of the Charles University, Faculty of Mathematics and Physics, V Holešovičkách 2, CZ-180 00 Praha 8 (Czech Republic); Torres, Guillermo [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA 02138 (United States); Mamajek, Eric [Department of Physics and Astronomy, University of Rochester, Rochester, NY 14627-0171 (United States); Asplund, Martin [Research School of Astronomy and Astrophysics, Australian National University, Canberra, ACT 2611 (Australia); Capitaine, Nicole [SYRTE, Observatoire de Paris, PSL Research University, CNRS, Sorbonne Universités, UPMC, LNE, 61 avenue de lObservatoire, F-75014 Paris (France); Christensen-Dalsgaard, Jørgen [Stellar Astrophysics Centre, Department of Physics and Astronomy, Aarhus University, Ny Munkegade 120, DK-8000 Aarhus C (Denmark); Depagne, Éric [South African Astronomical Observatory, P.O. Box 9 Observatory, Cape Town (South Africa); Haberreiter, Margit [Physikalisch-Meteorologisches Observatorium Davos/World Radiation Center, Dorfstrasse 33, Davos (Switzerland); Hekker, Saskia [Max-Planck-Institut für Sonnensystemforschung, Justus-von-Liebig-Weg 3, D-37077 Göttingen (Germany); Hilton, James [US Naval Observatory, 3450 Massachusetts Ave. NW, Washington, DC 20392-5420 (United States); Kopp, Greg [Laboratory for Atmospheric and Space Physics, 1234 Innovation Drive, Boulder, CO 80303-7814 (United States); and others
2016-08-01
In this brief communication we provide the rationale for and the outcome of the International Astronomical Union (IAU) resolution vote at the XXIXth General Assembly in Honolulu, Hawaii, in 2015, on recommended nominal conversion constants for selected solar and planetary properties. The problem addressed by the resolution is a lack of established conversion constants between solar and planetary values and SI units: a missing standard has caused a proliferation of solar values (e.g., solar radius, solar irradiance, solar luminosity, solar effective temperature, and solar mass parameter) in the literature, with cited solar values typically based on best estimates at the time of paper writing. As precision of observations increases, a set of consistent values becomes increasingly important. To address this, an IAU Working Group on Nominal Units for Stellar and Planetary Astronomy formed in 2011, uniting experts from the solar, stellar, planetary, exoplanetary, and fundamental astronomy, as well as from general standards fields to converge on optimal values for nominal conversion constants. The effort resulted in the IAU 2015 Resolution B3, passed at the IAU General Assembly by a large majority. The resolution recommends the use of nominal solar and planetary values, which are by definition exact and are expressed in SI units. These nominal values should be understood as conversion factors only, not as the true solar/planetary properties or current best estimates. Authors and journal editors are urged to join in using the standard values set forth by this resolution in future work and publications to help minimize further confusion.
NOMINAL VALUES FOR SELECTED SOLAR AND PLANETARY QUANTITIES: IAU 2015 RESOLUTION B3
International Nuclear Information System (INIS)
Prša, Andrej; Harmanec, Petr; Torres, Guillermo; Mamajek, Eric; Asplund, Martin; Capitaine, Nicole; Christensen-Dalsgaard, Jørgen; Depagne, Éric; Haberreiter, Margit; Hekker, Saskia; Hilton, James; Kopp, Greg
2016-01-01
In this brief communication we provide the rationale for and the outcome of the International Astronomical Union (IAU) resolution vote at the XXIXth General Assembly in Honolulu, Hawaii, in 2015, on recommended nominal conversion constants for selected solar and planetary properties. The problem addressed by the resolution is a lack of established conversion constants between solar and planetary values and SI units: a missing standard has caused a proliferation of solar values (e.g., solar radius, solar irradiance, solar luminosity, solar effective temperature, and solar mass parameter) in the literature, with cited solar values typically based on best estimates at the time of paper writing. As precision of observations increases, a set of consistent values becomes increasingly important. To address this, an IAU Working Group on Nominal Units for Stellar and Planetary Astronomy formed in 2011, uniting experts from the solar, stellar, planetary, exoplanetary, and fundamental astronomy, as well as from general standards fields to converge on optimal values for nominal conversion constants. The effort resulted in the IAU 2015 Resolution B3, passed at the IAU General Assembly by a large majority. The resolution recommends the use of nominal solar and planetary values, which are by definition exact and are expressed in SI units. These nominal values should be understood as conversion factors only, not as the true solar/planetary properties or current best estimates. Authors and journal editors are urged to join in using the standard values set forth by this resolution in future work and publications to help minimize further confusion.
Design, fabrication and performance of a hybrid photovoltaic/thermal (PV/T) active solar still
International Nuclear Information System (INIS)
Kumar, Shiv; Tiwari, Arvind
2010-01-01
Two solar stills (single slope passive and single slope photovoltaic/thermal (PV/T) active solar still) were fabricated and tested at solar energy park, IIT New Delhi (India) for composite climate. Photovoltaic operated DC water pump was used between solar still and photovoltaic (PV) integrated flat plate collector to re-circulate the water through the collectors and transfer it to the solar still. The newly designed hybrid (PV/T) active solar still is self-sustainable and can be used in remote areas, need to transport distilled water from a distance and not connected to grid, but blessed with ample solar energy. Experiments were performed for 0.05, 0.10, and 0.15 m water depth, round the year 2006-2007 for both the stills. It has been observed that maximum daily yield of 2.26 kg and 7.22 kg were obtained from passive and hybrid active solar still, respectively at 0.05 m water depth. The daily yield from hybrid active solar still is around 3.2 and 5.5 times higher than the passive solar still in summer and winter month, respectively. The study has shown that this design of the hybrid active solar still also provides higher electrical and overall thermal efficiency, which is about 20% higher than the passive solar still.
International Nuclear Information System (INIS)
Kianifar, Ali; Zeinali Heris, Saeed; Mahian, Omid
2012-01-01
An exergy analysis has been conducted to show the effect of a small fan on the exergy efficiency in a pyramid-shaped solar still. The tests were carried out in Mashhad (36° 36′ N), for two solar still systems. One of them was equipped with a small fan (active system), to enhance the evaporation rate while the other one was tested in passive condition (no fan). To examine the effects of radiation and water depth on exergy efficiency, experiments in two seasons and two different depths of water in the solar still basin were performed. The results show that during summer, active unit has higher exergy efficiency than passive one while in winter there is no considerable difference between the exergy efficiency of the units. Results also reveal that the exergy efficiency is higher when the water depth in the basin is lower. Finally, the economic analysis shows a considerable reduction in production cost of the water (8–9%) when the active system is used. -- Highlights: ► Using a small fan in the solar still; reduces the productive cost of fresh water up to 9%. ► Effects of the fan and basin depth on the exergy efficiency during summer and winter were examined. ► Utilizing an active system will increase the daily productivity of fresh water by 20%.
Gold, R. E.; Dodson-Prince, H. W.; Hedeman, E. R.; Roelof, E. C.
1982-01-01
Solar and interplanetary data are examined, taking into account the identification of the heliographic longitudes of the coronal source regions of high speed solar wind (SW) streams by Nolte and Roelof (1973). Nolte and Roelof have 'mapped' the velocities measured near earth back to the sun using the approximation of constant radial velocity. The 'Carrington carpet' for rotations 1597-1616 is shown in a graph. Coronal sources of high speed streams appear in the form of solid black areas. The contours of the stream sources are laid on 'evolutionary charts' of solar active region histories for the Southern and Northern Hemispheres. Questions regarding the interplay of active regions and solar wind are investigated, giving attention to developments during the years 1973, 1974, and 1975.
Electrically active defects in solar grade multicrystalline silicon
DEFF Research Database (Denmark)
Dahl, Espen
2013-01-01
Shortage in high purity silicon feedstock, as a result of the formidable increased demand for solar cell devices during the last two decades, can be mitigated by the introduction of cheaper feedstock of solar grade (So-G) quality. Silicon produced through the metallurgical process route has shown...... the potential to be such a feedstock. However, this feedstock has only few years of active commercial history and the detailed understanding of the nature of structural defects in this material still has fundamental shortcomings. In this thesis the electrical activity of structural defects, commonly associated...
A metal-based inhibitor of NEDD8-activating enzyme.
Directory of Open Access Journals (Sweden)
Hai-Jing Zhong
Full Text Available A cyclometallated rhodium(III complex [Rh(ppy(2(dppz](+ (1 (where ppy=2-phenylpyridine and dppz=dipyrido[3,2-a:2',3'-c]phenazine dipyridophenazine has been prepared and identified as an inhibitor of NEDD8-activating enzyme (NAE. The complex inhibited NAE activity in cell-free and cell-based assays, and suppressed the CRL-regulated substrate degradation and NF-κB activation in human cancer cells with potency comparable to known NAE inhibitor MLN4924. Molecular modeling analysis suggested that the overall binding mode of 1 within the binding pocket of the APPBP1/UBA3 heterodimer resembled that for MLN4924. Complex 1 is the first metal complex reported to suppress the NEDDylation pathway via inhibition of the NEDD8-activating enzyme.
Active solar heating and cooling information user study
Energy Technology Data Exchange (ETDEWEB)
Belew, W.W.; Wood, B.L.; Marle, T.L.; Reinhardt, C.L.
1981-01-01
The results of a series of telephone interviews with groups of users of information on active solar heating and cooling (SHAC). An earlier study identified the information user groups in the solar community and the priority (to accelerate solar energy commercialization) of getting information to each group. In the current study only high-priority groups were examined. Results from 19 SHAC groups respondents are analyzed in this report: DOE-Funded Researchers, Non-DOE-Funded Researchers, Representatives of Manufacturers (4 groups), Distributors, Installers, Architects, Builders, Planners, Engineers (2 groups), Representatives of Utilities, Educators, Cooperative Extension Service County Agents, Building Owners/Managers, and Homeowners (2 groups). The data will be used as input to the determination of information products and services the Solar Energy Research Institute, the Solar Energy Information Data Bank Network, and the entire information outreach community should be preparing and disseminating.
DEFF Research Database (Denmark)
Ravnbak, Mette H; Philipsen, Peter A; Wulf, Hans Christian
2010-01-01
To investigate the relation between pre-exposure skin pigmentation and the minimal melanogenesis dose (MMD)/minimal erythema dose (MED) ratio after a single narrowband ultraviolet B (nUVB) and solar simulator (Solar) exposure.......To investigate the relation between pre-exposure skin pigmentation and the minimal melanogenesis dose (MMD)/minimal erythema dose (MED) ratio after a single narrowband ultraviolet B (nUVB) and solar simulator (Solar) exposure....
Height of the E layer as a function of solar activity
International Nuclear Information System (INIS)
Antonova, L.A.; Ivanov-Kholodnyj, G.S.; Zhivolup, T.G.
1992-01-01
Variations of h m E height of E layer maximum with solar activity are investigated using data of from rocket measurements. These data are contradictory ones and requires more exact definition. h m E decrease with growth of solar activity is predicted theoretically: small monotone decrease during solar cycle on the one hand, and/or jump-like decrease of h m E at a certain intermediate value of F 10.7 - on the other hand. New rather reliable results are obtained due to data from incoherent dissipation station. On the basis of these measurements it is obtained that at low and even at rather high solar activity there is a small monotone decrease of h m E, while at intermediate activity, when F 10.7 =140-180 there occurs more abrupt variation of h m E
The UV-B Photoreceptor UVR8: From Structure to Physiology
Jenkins, Gareth I.
2014-01-01
Low doses of UV-B light (280 to 315 nm) elicit photomorphogenic responses in plants that modify biochemical composition, photosynthetic competence, morphogenesis, and defense. UV RESISTANCE LOCUS8 (UVR8) mediates photomorphogenic responses to UV-B by regulating transcription of a set of target genes. UVR8 differs from other known photoreceptors in that it uses specific Trp amino acids instead of a prosthetic chromophore for light absorption during UV-B photoreception. Absorption of UV-B dissociates the UVR8 dimer into monomers, initiating signal transduction through interaction with CONSTITUTIVELY PHOTOMORPHOGENIC1. However, much remains to be learned about the physiological role of UVR8 and its interaction with other signaling pathways, the molecular mechanism of UVR8 photoreception, how the UVR8 protein initiates signaling, how it is regulated, and how UVR8 regulates transcription of its target genes. PMID:24481075
Indexes and parameters of activity in solar-terrestrial physics
International Nuclear Information System (INIS)
Minasyants, G.S.; Minasyants, T.M.
2005-01-01
The daily variation of different indexes and parameters of the solar-terrestrial physics at the 23 cycle were considered to find the most important from them for the forecast of geomagnetic activity. The validity of application of the Wolf numbers in quality of the characteristic of solar activity at sunspots is confirmed. The best geo-effective parameter in the arrival of the interplanetary shock from coronal mass ejection to an orbit of the Earth. (author)
On proton events of different solar activity cycles
International Nuclear Information System (INIS)
Sattarov, I.; Sherdanov, Ch.; Sattarov, B.
1997-01-01
In solar activity cycle N21 and N22 the latitude distribution of the proton large flares and sunspot groups is being studied. It was found that higher proton activity of cycle N22 is connected with its higher latitude sunspot activity (author)
The Heliosphere through the Solar Activity Cycle
Balogh, André; Suess, Steven T
2008-01-01
Understanding how the Sun changes though its 11-year sunspot cycle and how these changes affect the vast space around the Sun – the heliosphere – has been one of the principal objectives of space research since the advent of the space age. This book presents the evolution of the heliosphere through an entire solar activity cycle. The last solar cycle (cycle 23) has been the best observed from both the Earth and from a fleet of spacecraft. Of these, the joint ESA-NASA Ulysses probe has provided continuous observations of the state of the heliosphere since 1990 from a unique vantage point, that of a nearly polar orbit around the Sun. Ulysses’ results affect our understanding of the heliosphere from the interior of the Sun to the interstellar medium - beyond the outer boundary of the heliosphere. Written by scientists closely associated with the Ulysses mission, the book describes and explains the many different aspects of changes in the heliosphere in response to solar activity. In particular, the authors...
FARIMA MODELING OF SOLAR FLARE ACTIVITY FROM EMPIRICAL TIME SERIES OF SOFT X-RAY SOLAR EMISSION
International Nuclear Information System (INIS)
Stanislavsky, A. A.; Burnecki, K.; Magdziarz, M.; Weron, A.; Weron, K.
2009-01-01
A time series of soft X-ray emission observed by the Geostationary Operational Environment Satellites from 1974 to 2007 is analyzed. We show that in the solar-maximum periods the energy distribution of soft X-ray solar flares for C, M, and X classes is well described by a fractional autoregressive integrated moving average model with Pareto noise. The model incorporates two effects detected in our empirical studies. One effect is a long-term dependence (long-term memory), and another corresponds to heavy-tailed distributions. The parameters of the model: self-similarity exponent H, tail index α, and memory parameter d are statistically stable enough during the periods 1977-1981, 1988-1992, 1999-2003. However, when the solar activity tends to minimum, the parameters vary. We discuss the possible causes of this evolution and suggest a statistically justified model for predicting the solar flare activity.
The solar activity cycle physical causes and consequences
Hudson, Hugh; Petrovay, Kristóf; Steiger, Rudolf
2015-01-01
A collection of papers edited by four experts in the field, this book sets out to describe the way solar activity is manifested in observations of the solar interior, the photosphere, the chromosphere, the corona and the heliosphere. The 11-year solar activity cycle, more generally known as the sunspot cycle, is a fundamental property of the Sun. This phenomenon is the generation and evolution of magnetic fields in the Sun’s convection zone, the photosphere. It is only by the careful enumeration and description of the phenomena and their variations that one can clarify their interdependences. The sunspot cycle has been tracked back about four centuries, and it has been recognized that to make this data set a really useful tool in understanding how the activity cycle works and how it can be predicted, a very careful and detailed effort is needed to generate sunspot numbers. This book deals with this topic, together with several others that present related phenomena that all indicate the physical pr...
Transient flows of the solar wind associated with small-scale solar activity in solar minimum
Slemzin, Vladimir; Veselovsky, Igor; Kuzin, Sergey; Gburek, Szymon; Ulyanov, Artyom; Kirichenko, Alexey; Shugay, Yulia; Goryaev, Farid
The data obtained by the modern high sensitive EUV-XUV telescopes and photometers such as CORONAS-Photon/TESIS and SPHINX, STEREO/EUVI, PROBA2/SWAP, SDO/AIA provide good possibilities for studying small-scale solar activity (SSA), which is supposed to play an important role in heating of the corona and producing transient flows of the solar wind. During the recent unusually weak solar minimum, a large number of SSA events, such as week solar flares, small CMEs and CME-like flows were observed and recorded in the databases of flares (STEREO, SWAP, SPHINX) and CMEs (LASCO, CACTUS). On the other hand, the solar wind data obtained in this period by ACE, Wind, STEREO contain signatures of transient ICME-like structures which have shorter duration (<10h), weaker magnetic field strength (<10 nT) and lower proton temperature than usual ICMEs. To verify the assumption that ICME-like transients may be associated with the SSA events we investigated the number of weak flares of C-class and lower detected by SPHINX in 2009 and STEREO/EUVI in 2010. The flares were classified on temperature and emission measure using the diagnostic means of SPHINX and Hinode/EIS and were confronted with the parameters of the solar wind (velocity, density, ion composition and temperature, magnetic field, pitch angle distribution of the suprathermal electrons). The outflows of plasma associated with the flares were identified by their coronal signatures - CMEs (only in few cases) and dimmings. It was found that the mean parameters of the solar wind projected to the source surface for the times of the studied flares were typical for the ICME-like transients. The results support the suggestion that weak flares can be indicators of sources of transient plasma flows contributing to the slow solar wind at solar minimum, although these flows may be too weak to be considered as separate CMEs and ICMEs. The research leading to these results has received funding from the European Union’s Seventh Programme
Modelling and experimental validation of thin layer indirect solar drying of mango slices
Energy Technology Data Exchange (ETDEWEB)
Dissa, A.O.; Bathiebo, J.; Kam, S.; Koulidiati, J. [Laboratoire de Physique et de Chimie de l' Environnement (LPCE), Unite de Formation et de Recherche en Sciences Exactes et Appliquee (UFR/SEA), Universite de Ouagadougou, Avenue Charles de Gaulle, BP 7021 Kadiogo (Burkina Faso); Savadogo, P.W. [Laboratoire Sol Eau Plante, Institut de l' Environnement et de Recherches Agricoles, 01 BP 476, Ouagadougou (Burkina Faso); Desmorieux, H. [Laboratoire d' Automatisme et de Genie des Procedes (LAGEP), UCBL1-CNRS UMR 5007-CPE Lyon, Bat.308G, 43 bd du 11 Nov. 1918 Villeurbanne, Universite Claude Bernard Lyon1, Lyon (France)
2009-04-15
The thin layer solar drying of mango slices of 8 mm thick was simulated and experimented using a solar dryer designed and constructed in laboratory. Under meteorological conditions of harvest period of mangoes, the results showed that 3 'typical days' of drying were necessary to reach the range of preservation water contents. During these 3 days of solar drying, 50%, 40% and 5% of unbound water were eliminated, respectively, at the first, second and the third day. The final water content obtained was about 16 {+-} 1.33% d.b. (13.79% w.b.). This final water content and the corresponding water activity (0.6 {+-} 0.02) were in accordance with previous work. The drying rates with correction for shrinkage and the critical water content were experimentally determined. The critical water content was close to 70% of the initial water content and the drying rates were reduced almost at 6% of their maximum value at night. The thin layer drying model made it possible to simulate suitably the solar drying kinetics of mango slices with a correlation coefficient of r{sup 2} = 0.990. This study thus contributed to the setting of solar drying time of mango and to the establishment of solar drying rates' curves of this fruit. (author)
Solar wind plasma periodicities observed at 1 AU by IMP 8
Paularena, K. I.; Szabo, A.; Lazarus, A. J.
1995-01-01
The IMP 8 spacecraft has been in Earth orbit since 1973, gathering plasma data over one complete 22-year solar cycle. These data are being examined to look for periodicities at time scales ranging from several hours to the entire span of the data set. A 1.3-year periodicity in the radial speed observed by IMP 8 and Voyager 2 has already been reported for the years from 1987 to 1993. The periodogram method, useful for unevenly sampled data such as the IMP 8 plasma data, has been used to search for other periods. It is interesting to note that the 13-year period is not present in the out-of-the-ecliptic component of the velocity (Vz), although a 1-year period is very obvious both visually and on the periodogram. Both components show a very strong peak associated with the 11-year solar cycle variation. This work will be extended to the thermal speed (a measure of the wind's temperature) and density, although the frequent correlations between these parameters and the velocity are expected to cause similar results. Additionally, the fine resolution data will be examined for shorter time periods than are visible using the hourly average data which are appropriate for longer periods. A comparison with periods observed at other spacecraft may also be made.
The relationship between plasmapause, solar wind and geomagnetic activity between 2007 and 2011
Directory of Open Access Journals (Sweden)
G. Verbanac
2015-10-01
Full Text Available Taking advantage of the Cluster satellite mission and especially the observations made by the instrument WHISPER to deduce the electron number density along the orbit of the satellites, we studied the relationships between the plasmapause positions (LPP and the following LPP indicators: (a solar wind coupling functions Bz (Z component of the interplanetary magnetic field vector, B, in GSM system, BV (related to the interplanetary electric field; B is the magnitude of the interplanetary magnetic field vector, V is solar wind velocity, and dΦmp/dt (which combines different physical processes responsible for the magnetospheric activity and (b geomagnetic indices Dst, Ap and AE. The analysis is performed separately for three magnetic local time (MLT sectors (Sector1 – night sector (01:00–07:00 MLT; Sector2 – day sector (07:00–16:00 MLT; Sector3 – evening sector (16:00–01:00 MLT and for all MLTs taken together. All LPP indicators suggest the faster plasmapause response in the postmidnight sector. Delays in the plasmapause responses (hereafter time lags are approximately 2–27 h, always increasing from Sector1 to Sector3. The obtained fits clearly resolve the MLT structures. The variability in the plasmapause is the largest for low values of LPP indicators, especially in Sector2. At low activity levels,LPP exhibits the largest values on the dayside (in Sector2 and the smallest on the postmidnight side (Sector1. Displacements towards larger values on the evening side (Sector3 and towards lower values on the dayside (Sector2 are identified for enhanced magnetic activity. Our results contribute to constraining the physical mechanisms involved in the plasmapause formation and to further study the still not well understood related issues.
Exclusion of UV-B radiation from normal solar spectrum on the growth of mung bean and maize
International Nuclear Information System (INIS)
Pal, M.; Sharma, A.; Abrol, Y.P.; Sengupta, U.K.
1997-01-01
The increase in UV-B radiation due to depletion of the ozone layer has potentially harmful effects on plant growth and performance. The bulk of these studies conducted in growth chambers, greenhouses or in the field use different types of exposure systems which may be responsible for differences in the sensitivity of a crop to UV-B radiation. A field study using selective filters to remove the UV-B portion of the solar spectrum was conducted with mung bean (a dicotyledonous C 3 plant) and maize (a monocotyledonous C 4 plant) to determine the sensitivity of these crop plants to ambient UV-B levels without disturbing the microenvironment. Mung bean was found to be sensitive to ambient UV-B levels in terms of leaf area development, plant height attained and net photosynthesis, while maize was found to be unaffected by ambient UV-B levels (22.8 |GmW cm −2 nm −1 ) found in Delhi, India (28°38′N, 77°13′E). The level of ambient UV-B radiation thus appears to be inhibitory for optimal growth of plants, especially dicotyledonous mung bean. (author)
International Nuclear Information System (INIS)
Tomova, Dimitrinka; Velinov, Peter; Tassev, Yordan; Tomova, Dimitrinka
2018-01-01
Some of the most powerful Earth’s directed coronal mass ejections (CMEs) from the current 24 solar cycle have been investigated. These are CMEs on March 15, 2015 and on September 4 and 6, 2017. As a result of these impacts of Sun on Earth, the highest intensity of the geomagnetic storms for the 24th solar cycle is observed. These G4 – Severe geomagnetic storms are in the periods March 17÷19, 2015 and September 7÷10, 2017. We use the solar wind parameters (velocity V, density or concentration N , temperature T p and intensity of the magnetic field B) from measurements by WIND, ACE and SOHO space crafts in the Lagrange equilibrium point L1 between Sun and Earth. We make calculations for the kinetic (dynamic) energy density E k , thermal energy density E t and magnetic energy density E m during the investigated periods May 10÷24, 2015 and September 2÷16, 2017. Both the energy densities for the individual events and the cumulative energy for each of them are evaluated. The quantitative analysis shows that not always the size of the geomagnetic reaction is commensurate with the density of the energy flux reaching the magnetosphere. In both studied periods, the energy densities have different behaviour over time. But for both periods, we can talk about the prognostic effect – with varying degrees of increase of the dynamic and thermal energies. Such an effect is not observed in the density of magnetic energy. An inverse relationship between the magnitude of the density of energies and the effect of Forbush decrease of the galactic cosmic rays is established. Key words: solar activity, flares, coronal mass ejection (CME), G4 –Severe geomagnetic storms, energy density of the solar wind, space weather
Resonance of about-weekly human heart rate rhythm with solar activity change.
Cornelissen, G; Halberg, F; Wendt, H W; Bingham, C; Sothern, R B; Haus, E; Kleitman, E; Kleitman, N; Revilla, M A; Revilla, M; Breus, T K; Pimenov, K; Grigoriev, A E; Mitish, M D; Yatsyk, G V; Syutkina, E V
1996-12-01
In several human adults, certain solar activity rhythms may influence an about 7-day rhythm in heart rate. When no about-weekly feature was found in the rate of change in sunspot area, a measure of solar activity, the double amplitude of a circadian heart rate rhythm, approximated by the fit of a 7-day cosine curve, was lower, as was heart rate corresponds to about-weekly features in solar activity and/or relates to a sunspot cycle.
Solar Light Responsive Photocatalytic Activity of Reduced Graphene Oxide-Zinc Selenide Nanocomposite
Chakraborty, Koushik; Ibrahim, Sk; Das, Poulomi; Ghosh, Surajit; Pal, Tanusri
2017-10-01
Solution processable reduced graphene oxide-zinc selenide (RGO-ZnSe) nanocomposite has been successfully synthesized by an easy one-pot single-step solvothermal reaction. The RGO-ZnSe composite was characterized structurally and morphologically by the study of XRD analysis, SEM and TEM imaging. Reduction in graphene oxide was confirmed by FTIR spectroscopy analysis. Photocatalytic efficiency of RGO-ZnSe composite was investigated toward the degradation of Rhodamine B under solar light irradiation. Our study indicates that the RGO-ZnSe composite is catalytically more active compared to the controlled-ZnSe under the solar light illumination. Here, RGO plays an important role for photoinduced charge separation and subsequently hinders the electron-hole recombination probability that consequently enhances photocatalytic degradation efficiency. We expect that this type of RGO-based optoelectronics materials opens up a new avenue in the field of photocatalytic degradation of different organic water pollutants.
Silva, H G; Lopes, I
Heliospheric modulation of galactic cosmic rays links solar cycle activity with neutron monitor count rate on earth. A less direct relation holds between neutron monitor count rate and atmospheric electric field because different atmospheric processes, including fluctuations in the ionosphere, are involved. Although a full quantitative model is still lacking, this link is supported by solid statistical evidence. Thus, a connection between the solar cycle activity and atmospheric electric field is expected. To gain a deeper insight into these relations, sunspot area (NOAA, USA), neutron monitor count rate (Climax, Colorado, USA), and atmospheric electric field (Lisbon, Portugal) are presented here in a phase space representation. The period considered covers two solar cycles (21, 22) and extends from 1978 to 1990. Two solar maxima were observed in this dataset, one in 1979 and another in 1989, as well as one solar minimum in 1986. Two main observations of the present study were: (1) similar short-term topological features of the phase space representations of the three variables, (2) a long-term phase space radius synchronization between the solar cycle activity, neutron monitor count rate, and potential gradient (confirmed by absolute correlation values above ~0.8). Finally, the methodology proposed here can be used for obtaining the relations between other atmospheric parameters (e.g., solar radiation) and solar cycle activity.
International Nuclear Information System (INIS)
Adhikari, Rajesh; Gyawali, Gobinda; Sekino, Tohru; Wohn Lee, Soo
2013-01-01
Simulated solar light responsive Ag/AgCl/WO 3 composite photocatalyst was synthesized by microwave assisted hydrothermal process. The synthesized powders were characterized by X-Ray Diffraction (XRD) spectroscopy, X-Ray Photoelectron Spectroscopy (XPS), Transmission Electron Microscopy (TEM), Diffuse Reflectance Spectroscopy (UV–Vis DRS), and BET surface area analyzer to investigate the crystal structure, morphology, chemical composition, optical properties and surface area of the composite photocatalyst. This photocatalyst exhibited higher photocatalytic activity for the degradation of rhodamine B under simulated solar light irradiation. Dye degradation efficiency of composite photocatalyst was found to be increased significantly as compared to that of the commercial WO 3 nanopowder. Increase in photocatalytic activity of the photocatalyst was explained on the basis of surface plasmon resonance (SPR) effect caused by the silver nanoparticles present in the composite photocatalyst. Highlights: ► Successful synthesis of Ag/AgCl/WO 3 nanocomposite. ► Photocatalytic experiment was performed under simulated solar light. ► Nanocomposite photocatalyst was very active as compared to WO 3 commercial powder. ► SPR effect due to Ag nanoparticles enhanced the photocatalytic activity.
Close Binary Star Speckle Interferometry on the McMath-Pierce 0.8-Meter Solar Telescope
Wiley, Edward; Harshaw, Richard; Jones, Gregory; Branston, Detrick; Boyce, Patrick; Rowe, David; Ridgely, John; Estrada, Reed; Genet, Russell
2015-09-01
Observations were made in April 2014 to assess the utility of the 0.8-meter solar telescope at the McMath-Pierce Solar Observatory at Kitt Peak National Observatory for performing speckle interferometry observations of close binary stars. Several configurations using science cameras, acquisition cameras, eyepieces, and flip mirrors were evaluated. Speckle images were obtained and recommendations for further improvement of the acquisition system are presented.
Cosmic rays, solar activity and the climate
International Nuclear Information System (INIS)
Sloan, T; Wolfendale, A W
2013-01-01
Although it is generally believed that the increase in the mean global surface temperature since industrialization is caused by the increase in green house gases in the atmosphere, some people cite solar activity, either directly or through its effect on cosmic rays, as an underestimated contributor to such global warming. In this letter a simplified version of the standard picture of the role of greenhouse gases in causing the global warming since industrialization is described. The conditions necessary for this picture to be wholly or partially wrong are then introduced. Evidence is presented from which the contributions of either cosmic rays or solar activity to this warming is deduced. The contribution is shown to be less than 10% of the warming seen in the twentieth century. (letter)
Directory of Open Access Journals (Sweden)
Silvia Della Bella
Full Text Available BACKGROUND: Human herpesvirus-8 (HHV-8 is the etiological agent of Kaposi's sarcoma (KS and of some lymphoproliferative disorders of B cells. Most malignancies develop after long-lasting viral dormancy, and a preventing role for both humoral and cellular immune control is suggested by the high frequency of these pathologies in immunosuppressed patients. B cells, macrophages and dendritic cells of peripheral lymphoid organs and blood represent the major reservoir of HHV-8. Due to the dual role of B cells in HHV-8 infection, both as virus reservoir and as agents of humoral immune control, we analyzed the subset distribution and the functional state of peripheral blood B cells in HHV-8-infected individuals with and without cKS. METHODOLOGY/PRINCIPAL FINDINGS: Circulating B cells and their subsets were analyzed by 6-color flow cytometry in the following groups: 1- patients HHV-8 positive with classic KS (cKS (n = 47; 2- subjects HHV-8 positive and cKS negative (HSP (n = 10; 3- healthy controls, HHV-8 negative and cKS negative (HC (n = 43. The number of B cells belonging to the preimmune/natural effector compartment, including transitional, pre-naïve, naïve and MZ-like subsets, was significantly higher among HHV-8 positive subjects, with or without cKS, while was comparable to healthy controls in the antigen-experienced T-cell dependent compartment. The increased number of preimmune/natural effector B cells was associated with increased resistance to spontaneous apoptosis, while it did not correlate with HHV-8 viral load. CONCLUSIONS/SIGNIFICANCE: Our results indicate that long-lasting HHV-8 infection promotes an imbalance in peripheral B cell subsets, perturbing the equilibrium between earlier and later steps of maturation and activation processes. This observation may broaden our understanding of the complex interplay between viral and immune factors leading HHV-8-infected individuals to develop HHV-8-associated malignancies.
Directory of Open Access Journals (Sweden)
Sebastian Horn
2017-04-01
Full Text Available Formation of the death-inducing signaling complex (DISC initiates extrinsic apoptosis. Caspase-8 and its regulator cFLIP control death signaling by binding to death-receptor-bound FADD. By elucidating the function of the caspase-8 homolog, caspase-10, we discover that caspase-10 negatively regulates caspase-8-mediated cell death. Significantly, we reveal that caspase-10 reduces DISC association and activation of caspase-8. Furthermore, we extend our co-operative/hierarchical binding model of caspase-8/cFLIP and show that caspase-10 does not compete with caspase-8 for binding to FADD. Utilizing caspase-8-knockout cells, we demonstrate that caspase-8 is required upstream of both cFLIP and caspase-10 and that DISC formation critically depends on the scaffold function of caspase-8. We establish that caspase-10 rewires DISC signaling to NF-κB activation/cell survival and demonstrate that the catalytic activity of caspase-10, and caspase-8, is redundant in gene induction. Thus, our data are consistent with a model in which both caspase-10 and cFLIP coordinately regulate CD95L-mediated signaling for death or survival.
MAGNETIC ENERGY SPECTRA IN SOLAR ACTIVE REGIONS
International Nuclear Information System (INIS)
Abramenko, Valentyna; Yurchyshyn, Vasyl
2010-01-01
Line-of-sight magnetograms for 217 active regions (ARs) with different flare rates observed at the solar disk center from 1997 January until 2006 December are utilized to study the turbulence regime and its relationship to flare productivity. Data from the SOHO/MDI instrument recorded in the high-resolution mode and data from the BBSO magnetograph were used. The turbulence regime was probed via magnetic energy spectra and magnetic dissipation spectra. We found steeper energy spectra for ARs with higher flare productivity. We also report that both the power index, α, of the energy spectrum, E(k) ∼ k -α , and the total spectral energy, W = ∫E(k)dk, are comparably correlated with the flare index, A, of an AR. The correlations are found to be stronger than those found between the flare index and the total unsigned flux. The flare index for an AR can be estimated based on measurements of α and W as A = 10 b (αW) c , with b = -7.92 ± 0.58 and c = 1.85 ± 0.13. We found that the regime of the fully developed turbulence occurs in decaying ARs and in emerging ARs (at the very early stage of emergence). Well-developed ARs display underdeveloped turbulence with strong magnetic dissipation at all scales.
Solar optics-based active panel for solar energy storage and disinfection of greywater.
Lee, W; Song, J; Son, J H; Gutierrez, M P; Kang, T; Kim, D; Lee, L P
2016-09-01
Smart city and innovative building strategies are becoming increasingly more necessary because advancing a sustainable building system is regarded as a promising solution to overcome the depleting water and energy. However, current sustainable building systems mainly focus on energy saving and miss a holistic integration of water regeneration and energy generation. Here, we present a theoretical study of a solar optics-based active panel (SOAP) that enables both solar energy storage and photothermal disinfection of greywater simultaneously. Solar collector efficiency of energy storage and disinfection rate of greywater have been investigated. Due to the light focusing by microlens, the solar collector efficiency is enhanced from 25% to 65%, compared to that without the microlens. The simulation of greywater sterilization shows that 100% disinfection can be accomplished by our SOAP for different types of bacteria including Escherichia coli . Numerical simulation reveals that our SOAP as a lab-on-a-wall system can resolve the water and energy problem in future sustainable building systems.
Zhang, Le; Li, Ban-Ban; Li, Hao-Ze; Meng, Xiao; Lin, Xin; Jiang, Yi-Yu; Ahn, Jong-Seog; Cui, Long
2017-09-01
Four new compounds, erythro-7'E-4-hydroxy-3,3'-dimethoxy-8,5'-oxyneoligna-7'-ene-7,9-diol-9'-al (1), (7S,8S)-4-hydroxy-3,1',3'-trimethoxy-4',7-epoxy-8,5'-neolign-9-ol (5), (7S,8S,7'E)-5-hydroxy-3,3'-dimethoxy-4',7-epoxy-8,5'-neolign-7'-ene-9,9'-diol (6) and (7S,8S,7'E)-5-hydroxy-3,3',9'-trimethoxy-4'-7-epoxy-8,5'-neolign-7'-ene-9-ol (7). Along with four known compounds (2-4, 8) were isolated from the EtOAc-soluble extract of Eleutherococcus senticosus. Their structures were elucidated on the basis of spectroscopic and physicochemical analyses. All the compounds were evaluated for in vitro inhibitory activity against PTP1B, VHR and PP1. Among them, compounds 1-4 and 6-8 were found to exhibit selective inhibitory activity on PTP1B with IC 50 values ranging from 17.2±1.6 to 32.7±1.2μM. Copyright © 2017 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Zhijian Liu
2017-10-01
Full Text Available Passive and active solar heating systems have drawn much attention and are widely used in residence buildings in the Qinghai-Tibetan plateau due to its high radiation intensity. In fact, there is still lack of quantitative evaluation of the passive and active heating effect, especially for residential building in the Qinghai-Tibetan plateau areas. In this study, three kinds of heating strategies, including reference condition, passive solar heating condition and active solar heating condition, were tested in one demonstration residential building. The hourly air temperatures of each room under different conditions were obtained and analyzed. The results show the indoor air temperature in the living room and bedrooms (core zones was much higher than that of other rooms under both passive and active solar heating conditions. In addition, the heating effect with different strategies for core zones of the building was evaluated by the ratio of indoor and outdoor degree hour, which indicates that solar heating could effectively reduce the traditional energy consumption and improve the indoor thermal environment. The passive solar heating could undertake 49.8% degree hours for heating under an evaluation criterion of 14 °C and the active solar heating could undertake 75% degree hours for heating under evaluation criterion of 18 °C, which indicated that solar heating could effectively reduce the traditional energy consumption and improve the indoor thermal environment in this area. These findings could provide reference for the design and application of solar heating in similar climate areas.
Enerplan, activity report 2009. Acting for solar energy promotion and development
International Nuclear Information System (INIS)
2010-01-01
Enerplan is the French union of solar energy professionals. Created in 1983, its social purpose is the study and defense of the rights and of the material and moral interests of its members. Enerplan structures its action through two poles representing members' activities: 'solar energy and building' where topics about heat and electricity generation in relation with buildings are treated, and 'photovoltaic energy' where topics specific to big solar power plants are considered. Thanks to the collaborative participation of its members, both poles allow Enerplan union to be source of proposals to develop solar energy in France. As an active interface between professionals and institutions, Enerplan includes in its membership: industrialists, plant makers, engineering consultants, installers, associations, energy suppliers etc, from small-medium size companies to big groups. This document presents Enerplan's activities in 2009 (public relations, lobbying, meetings and conferences, promotional activities, collaborations, projects..)
The Solar System Ballet: A Kinesthetic Spatial Astronomy Activity
Heyer, Inge; Slater, T. F.; Slater, S. J.; Astronomy, Center; Education ResearchCAPER, Physics
2011-05-01
The Solar System Ballet was developed in order for students of all ages to learn about the planets, their motions, their distances, and their individual characteristics. To teach people about the structure of our Solar System can be revealing and rewarding, for students and teachers. Little ones (and some bigger ones, too) often cannot yet grasp theoretical and spatial ideas purely with their minds. Showing a video is better, but being able to learn with their bodies, essentially being what they learn about, will help them understand and remember difficult concepts much more easily. There are three segments to this activity, which can be done together or separately, depending on time limits and age of the students. Part one involves a short introductory discussion about what students know about the planets. Then students will act out the orbital motions of the planets (and also moons for the older ones) while holding a physical model. During the second phase we look at the structure of the Solar System as well as the relative distances of the planets from the Sun, first by sketching it on paper, then by recreating a scaled version in the class room. Again the students act out the parts of the Solar System bodies with their models. The third segment concentrates on recreating historical measurements of Earth-Moon-Sun system. The Solar System Ballet activity is suitable for grades K-12+ as well as general public informal learning activities.
Concentrating Solar Power Projects - Khi Solar One | Concentrating Solar
Power | NREL Khi Solar One This page provides information on Khi Solar One, a concentrating solar power (CSP) project, with data organized by background, parcipants and power plant configuration . Status Date: February 8, 2016 Project Overview Project Name: Khi Solar One Country: South Africa Location
Blade-coated sol-gel indium-gallium-zinc-oxide for inverted polymer solar cell
Directory of Open Access Journals (Sweden)
Yan-Huei Lee
2016-11-01
Full Text Available The inverted organic solar cell was fabricated by using sol-gel indium-gallium-zinc-oxide (IGZO as the electron-transport layer. The IGZO precursor solution was deposited by blade coating with simultaneous substrate heating at 120 °C from the bottom and hot wind from above. Uniform IGZO film of around 30 nm was formed after annealing at 400 °C. Using the blend of low band-gap polymer poly[(4,8-bis-(2-ethylhexyloxy-benzo(1,2-b:4,5-b’dithiophene-2,6-diyl-alt- (4-(2-ethylhexanoyl-thieno [3,4-b]thiophene--2-6-diyl] (PBDTTT-C-T and [6,6]-Phenyl C71 butyric acid methyl ester ([70]PCBM as the active layer for the inverted organic solar cell, an efficiency of 6.2% was achieved with a blade speed of 180 mm/s for the IGZO. The efficiency of the inverted organic solar cells was found to depend on the coating speed of the IGZO films, which was attributed to the change in the concentration of surface OH groups. Compared to organic solar cells of conventional structure using PBDTTT-C-T: [70]PCBM as active layer, the inverted organic solar cells showed significant improvement in thermal stability. In addition, the chemical composition, as well as the work function of the IGZO film at the surface and inside can be tuned by the blade speed, which may find applications in other areas like thin-film transistors.
International Nuclear Information System (INIS)
Robberecht, R.; Caldwell, M.M.
1981-12-01
Plant adaptations ameliorating or repairing the damaging effects of ultraviolet-B (UV-B) radiation on plant tissue were investigated. The degree of phenotype plasticity in UV protective mechanisms and acclimation in relation to the natural solar UV-B radiation flux and in an enhanced UV-B irradiance environment was also examined. Mechanisms by which plants avoid radiation, adaptations altering the path of radiation incident on the leaf, and repair processes were considered. Attenuation of UV-B by tissues, UV-B irradiation into the leaf, and the effects of UV-B on photosynthesis were investigated
Homo-Tandem Polymer Solar Cells withVOC>1.8 V for Efficient PV-Driven Water Splitting
Gao, Yangqin; Le Corre, Vincent M.; Gaï tis, Alexandre; Neophytou, Marios; Hamid, Mahmoud Abdul; Takanabe, Kazuhiro; Beaujuge, Pierre
2016-01-01
Efficient homo-tandem and triple-junction polymer solar cells are constructed by stacking identical subcells composed of the wide-bandgap polymer PBDTTPD, achieving power conversion efficiencies >8% paralleled by open-circuit voltages >1.8 V
Identification of the key structural motifs involved in HspB8/HspB6-Bag3 interaction
Fuchs, Margit; Poirier, Dominic J.; Seguin, Samuel J.; Lambert, Herman; Carra, Serena; Charette, Steve J.; Landry, Jacques
2010-01-01
The molecular chaperone HspB8 [Hsp (heat-shock protein) B8] is member of the B-group of Hsps. These proteins bind to unfolded or misfolded proteins and protect them from aggregation. HspB8 has been reported to form a stable molecular complex with the chaperone cohort protein Bag3 (Bcl-2-associated
Energy Technology Data Exchange (ETDEWEB)
Podewils, Christoph
2010-05-15
This is the first detail analysis ever of the German solar market, based on the solar power plant register published by the Bundesnetzagentur shortly after Easter. The result was surprising: Solar power plants with a total power of nearly 1.5 GW were commissioned in December 2009. In all, the German solar market approached the 4 GW mark in 2009. So far, there has been no public debate, and even the BSW-Solar association issued only scarce comments. (orig.)
Lites, B. W.; Hansen, E. R.; Shine, R. A.
1980-01-01
The University of Colorado ultraviolet spectrometer aboard the Orbiting Solar Observatory 8(OSO 8) has measured self-reversed profiles of the resonance line of C IV lamda 1548.2 at the limb passage of an active region. The degree of the self-reversal together with the absolute intensity of the line profile determine the electron density in the active region at 10 to the 10th/cu cm at temperatures where the C IV line is formed. The nonthermal component of the broadening velocity is no more than 14km/s, and the physical thickness of an equivalent plane-parallel slab in hydrostatic equilibrium that would give rise to the observed line profiles is about 430 km.
Solar activity: nowcasting and forecasting at the SIDC
Directory of Open Access Journals (Sweden)
D. Berghmans
2005-11-01
Full Text Available The Solar Influences Data analysis Center (SIDC is the World Data Center for the production and the distribution of the International Sunspot Index, coordinating a network of about 80 stations worldwide. From this core activity, the SIDC has grown in recent years to a European center for nowcasting and forecasting of solar activity on all timescales. This paper reviews the services (data, forecasts, alerts, software that the SIDC currently offers to the scientific community. The SIDC operates instruments both on the ground and in space. The USET telescope in Brussels produces daily white light and Hα images. Several members of the SIDC are co-investigators of the EIT instrument onboard SOHO and are involved in the development of the next generation of Europe's solar weather monitoring capabilities. While the SIDC is staffed only during day-time (7 days/week, the monitoring service is a 24 h activity thanks to the implementation of autonomous software for data handling and analysis and the sending of automated alerts. We will give an overview of recently developed techniques for visualization and automated analysis of solar images and detection of events significant for space weather (e.g. CMEs or EIT waves. As part of the involvement of the SIDC in the ESA Pilot Project for Space Weather Applications we have developed services dedicated to the users of the Global Positioning System (GPS. As a Regional Warning Center (RWC of the International Space Environment Service (ISES, the SIDC produces daily forecasts of flaring probability, geomagnetic activity and 10.7 cm radio flux. The accuracy of these forecasts will be investigated through an in-depth quality analysis.
LEO resistant PI-B-PDMS block copolymer films for solar array applications
Lonkhuyzen, H. van; Bongers, E.; Fischer, H.R.; Dingemans, T.J.; Semprimoschnig, C.
2013-01-01
Due to their low atomic oxygen erosion yields PI-b-PDMS block copolymer films have considerable potential for application onto space exposed surfaces of satellites in low earth orbit. On solar arrays these materials might be used as electrical electrical insulation film, flexprint outer layer,
He, Hongcai; Jiang, Zhuolin; He, Zhaoling; Liu, Tao; Li, Enzhu; Li, Bao-Wen
2018-01-01
An excellent ternary composite photocatalyst consisting of silver orthophosphate (Ag3PO4), attapulgite (ATP), and TiO2 was synthesized, in which heterojunction was formed between dissimilar semiconductors to promote the separation of photo-generated charges. The ATP/TiO2/Ag3PO4 composite was characterized by SEM, XRD, and UV-vis diffuse reflectance spectroscopy. The co-deposition of Ag3PO4 and TiO2 nanoparticles onto the surface of ATP forms a lath-particle structure. Compared with composite photocatalysts consisting of two phases, ATP/TiO2/Ag3PO4 ternary composite exhibits greatly improved photocatalytic activity for degradation of rhodamine B under simulated solar irradiation. Such ternary composite not only improves the stability of Ag3PO4, but also lowers the cost by reducing application amount of Ag3PO4, which provides guidance for the design of Ag3PO4- and Ag-based composites for photocatalytic applications.
Salabert, D.; Régulo, C.; Pérez Hernández, F.; García, R. A.
2018-04-01
The variations of the frequencies of the low-degree acoustic oscillations in the Sun induced by magnetic activity show a dependence on radial order. The frequency shifts are observed to increase towards higher-order modes to reach a maximum of about 0.8 μHz over the 11-yr solar cycle. A comparable frequency dependence is also measured in two other main sequence solar-like stars, the F-star HD 49933, and the young 1 Gyr-old solar analog KIC 10644253, although with different amplitudes of the shifts of about 2 μHz and 0.5 μHz, respectively. Our objective here is to extend this analysis to stars with different masses, metallicities, and evolutionary stages. From an initial set of 87 Kepler solar-like oscillating stars with known individual p-mode frequencies, we identify five stars showing frequency shifts that can be considered reliable using selection criteria based on Monte Carlo simulations and on the photospheric magnetic activity proxy Sph. The frequency dependence of the frequency shifts of four of these stars could be measured for the l = 0 and l = 1 modes individually. Given the quality of the data, the results could indicate that a physical source of perturbation different from that in the Sun is dominating in this sample of solar-like stars.
Wolf, Jannic Sebastian; Babics, Maxime; Wang, Kai; Saleem, Qasim; Liang, Ru-Ze; Hansen, Michael Ryan; Beaujuge, Pierre
2016-01-01
We report on the synthesis, material properties and BHJ solar cell characteristics of a set of π-conjugated small-molecule (SM) donors composed of benzo[1,2-b:4,5-b′]dithiophene (BDT) and pyrido[3,4-b]pyrazine (PP) units – examining the perspectives of alkyl-substituted PP acceptor motifs in SM designs. In these systems (SM1-4), both the type of side chains derived from the PP motifs and the presence of ring-substituents on BDT critically impact (i) molecular packing, and (ii) thin-film morphologies and charge transport in BHJ solar cells. With the appropriate side-chain pattern, the ring-substituted analogue SM4 stands out: achieving efficiencies of ca. 6.5% with PC71BM, and fine-scale morphologies comparable to those obtained with some of the best-performing polymer donors in BHJ solar cells. 1H-1H DQ-SQ NMR analyses are used to examine the distinct self-assembly pattern of SM4, expected to factor into the development of the BHJ morphology.
Wolf, Jannic Sebastian
2016-01-22
We report on the synthesis, material properties and BHJ solar cell characteristics of a set of π-conjugated small-molecule (SM) donors composed of benzo[1,2-b:4,5-b′]dithiophene (BDT) and pyrido[3,4-b]pyrazine (PP) units – examining the perspectives of alkyl-substituted PP acceptor motifs in SM designs. In these systems (SM1-4), both the type of side chains derived from the PP motifs and the presence of ring-substituents on BDT critically impact (i) molecular packing, and (ii) thin-film morphologies and charge transport in BHJ solar cells. With the appropriate side-chain pattern, the ring-substituted analogue SM4 stands out: achieving efficiencies of ca. 6.5% with PC71BM, and fine-scale morphologies comparable to those obtained with some of the best-performing polymer donors in BHJ solar cells. 1H-1H DQ-SQ NMR analyses are used to examine the distinct self-assembly pattern of SM4, expected to factor into the development of the BHJ morphology.
Loss of Cyp8b1 Improves Glucose Homeostasis by Increasing GLP-1
Kaur, Achint; Patankar, Jay V.; de Haan, Willeke; Ruddle, Piers; Wijesekara, Nadeeja; Groen, Albert K.; Verchere, C. Bruce; Singaraja, Roshni R.; Hayden, Michael R.
Besides their role in facilitating lipid absorption, bile acids are increasingly being recognized as signaling molecules that activate cell-signaling receptors. Targeted disruption of the sterol 12-hydroxylase gene (Cyp8b1) results in complete absence of cholic acid (CA) and its derivatives. Here we
Cabrera, Sebastián; Benavente, David; Alvo, Miriam; de Pablo, Paola; Ferro, Charles J
2014-11-01
Vitamin B12 and folic acid deficiency are common in the older and are associated with several conditions including anaemia, cardiovascular disease, cognitive impairment and cancer. Evidence from in vitro studies suggests that solar radiation can degrade both vitamins in the skin. Chile is the longest country in the world running perfectly North-South making it an ideal place to study potential associations of latitude and solar radiation on vitamin B12 and folic acid deficiency. The objective was to examine the association between vitamin B12 and folic acid deficiencies and latitude. Plasma samples were collected from Chileans aged 65+ years (n=1013) living across the whole country and assayed for vitamin B12 and folic acid concentrations as part of the Chilean Health Survey 2009-2010, which is a national representative sample study. Overall, the prevalence of vitamin B12 deficiency was 11.3%, with the prevalence in the North of the country being significantly greater than in the Central and South zones (19.1%,10.5%, and 5.7%, respectively; Psolar radiation (OR 1.203 [95% confidence intervals 1.119-1.294], Psolar radiation. Although degradation by solar radiation might explain this observation, further work is required to establish the potential mechanisms. In countries that routinely fortify food with folic acid, efforts to identify vitamin B12 deficiency might be more cost-efficiently targeted in areas closest to the Equator. Copyright © 2014 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Wang, Wenhui; Chen, Xilei; Li, Tao; Li, Yanmei; Wang, Ruixue; He, Dan; Luo, Wu; Li, Xiaokun; Wu, Xiaoping
2013-01-01
Fibroblast growth factor 8b (FGF8b) is the major isoform of FGF8 expressed in prostate cancer and it correlates with the stage and grade of the disease. FGF8b has been considered as a potential target for prostate cancer therapy. Here we isolated 12 specific FGF8b-binding phage clones by screening a phage display heptapeptide library with FGF8b. The peptide (HSQAAVP, named as P12) corresponding to one of these clones showed high homology to the immunoglobulin-like (Ig-like) domain II(D2) of high-affinity FGF8b receptor (FGFR3c), contained 3 identical amino acids (AVP) to the authentic FGFR3 D2 sequence aa 163–169 (LLAVPAA) directly participating in ligand binding, carried the same charges as its corresponding motif (aa163–169) in FGFR3c, suggesting that P12 may have a greater potential to interrupt FGF8b binding to its receptors than other identified heptapeptides do. Functional analysis indicated that synthetic P12 peptides mediate significant inhibition of FGF8b-induced cell proliferation, arrest cell cycle at the G0/G1 phase via suppression of Cyclin D1 and PCNA, and blockade of the activations of Erk1/2 and Akt cascades in both prostate cancer cells and vascular endothelial cells. The results demonstrated that the P12 peptide acting as an FGF8b antagonist may have therapeutic potential in prostate cancer. - Highlights: ► A novel FGF8b-binding peptide P12 was isolated from a phage display library. ► The mechanisms for P12 peptide inhibiting cell proliferation were proposed. ► P12 caused cell cycle arrest at G0/G1 phase via suppression of Cyclin D1 and PCNA. ► P12 suppressed FGF8b-induced activations of Akt and MAP kinases. ► P12 acting as an FGF8b antagonist may have therapeutic potential in prostate cancer
Energy Technology Data Exchange (ETDEWEB)
Wang, Wenhui; Chen, Xilei; Li, Tao; Li, Yanmei; Wang, Ruixue; He, Dan; Luo, Wu [Institute of Tissue Transplantation and Immunology, Jinan University, Guangzhou 510632 (China); Li, Xiaokun [Institute of Tissue Transplantation and Immunology, Jinan University, Guangzhou 510632 (China); School of Pharmaceutical Science, Wenzhou Medical College, Wenzhou 325035 (China); Wu, Xiaoping, E-mail: twxp@jnu.edu.cn [Institute of Tissue Transplantation and Immunology, Jinan University, Guangzhou 510632 (China); School of Pharmaceutical Science, Wenzhou Medical College, Wenzhou 325035 (China)
2013-05-01
Fibroblast growth factor 8b (FGF8b) is the major isoform of FGF8 expressed in prostate cancer and it correlates with the stage and grade of the disease. FGF8b has been considered as a potential target for prostate cancer therapy. Here we isolated 12 specific FGF8b-binding phage clones by screening a phage display heptapeptide library with FGF8b. The peptide (HSQAAVP, named as P12) corresponding to one of these clones showed high homology to the immunoglobulin-like (Ig-like) domain II(D2) of high-affinity FGF8b receptor (FGFR3c), contained 3 identical amino acids (AVP) to the authentic FGFR3 D2 sequence aa 163–169 (LLAVPAA) directly participating in ligand binding, carried the same charges as its corresponding motif (aa163–169) in FGFR3c, suggesting that P12 may have a greater potential to interrupt FGF8b binding to its receptors than other identified heptapeptides do. Functional analysis indicated that synthetic P12 peptides mediate significant inhibition of FGF8b-induced cell proliferation, arrest cell cycle at the G0/G1 phase via suppression of Cyclin D1 and PCNA, and blockade of the activations of Erk1/2 and Akt cascades in both prostate cancer cells and vascular endothelial cells. The results demonstrated that the P12 peptide acting as an FGF8b antagonist may have therapeutic potential in prostate cancer. - Highlights: ► A novel FGF8b-binding peptide P12 was isolated from a phage display library. ► The mechanisms for P12 peptide inhibiting cell proliferation were proposed. ► P12 caused cell cycle arrest at G0/G1 phase via suppression of Cyclin D1 and PCNA. ► P12 suppressed FGF8b-induced activations of Akt and MAP kinases. ► P12 acting as an FGF8b antagonist may have therapeutic potential in prostate cancer.
Overview of the Solar-B Mission
Davis, John M.
2006-01-01
The Solar-B mission is a collaboration between the Japan Aerospace Exploration Agency, Institute of Space and Astronautical Science, the National Aeronautics and Space Administration (NASA) and the Particle Physics and Astronomy Research Council (PPARC) of the United Kingdom and the European Space Agency. The principal scientific goals of the mission are to understand the processes of magnetic field generation, transport and ultimate dissipation of solar magnetic fields and how the release of magnetic energy is responsible for the heating and structuring of the chromosphere and corona. The scientific payload consists of three instruments: the Solar Optical Telescope that consists of the Optical Telescope Assembly and the Focal Plane Package (FPP), the X-ray Telescope and the EUV Imaging Spectrometer Each instrument is a result of the combined talents of all the members of the international team and their design and performance is described in separate papers in this session. The instruments are designed to work together as an 'observatory' simultaneously studying the target, at which the spacecraft is pointed, at different levels in the atmosphere. The spacecraft is scheduled for launch in September 2006 from the Uchinoura Space Center into a 600 km circular, sun-synchronous, polar orbit with a nominal elevation of 97.9 degrees. The orbit provides at least two morning and two evening contacts in Japan. Morning contacts are used for recovering quick look science data and the evening contacts for uploading commands. In addition ESA will provide 15 contacts per day from the Norwegian high latitude (78deg 14' N) ground station at Svalbard. The data downloads are transmitted to the ISAS Sirius database. They will be reformatted into FITS files and archived as Level 0 data on the ISAS DARTS system and made available to the scientific community. Scientific operations will be conducted from the IS AS facility located in Sagamihara, Japan. They are separated into planning
Directory of Open Access Journals (Sweden)
P. Wintoft
2005-11-01
Full Text Available The 7-10 November 2004 period contains two events for which the local ground magnetic field was severely disturbed and simultaneously, the solar wind displayed several shocks and negative Bz periods. Using empirical models the 10-min RMS and at Brorfelde (BFE, 11.67° E, 55.63° N, Denmark, are predicted. The models are recurrent neural networks with 10-min solar wind plasma and magnetic field data as inputs. The predictions show a good agreement during 7 November, up until around noon on 8 November, after which the predictions become significantly poorer. The correlations between observed and predicted log RMS is 0.77 during 7-8 November but drops to 0.38 during 9-10 November. For RMS the correlations for the two periods are 0.71 and 0.41, respectively. Studying the solar wind data for other L1-spacecraft (WIND and SOHO it seems that the ACE data have a better agreement to the near-Earth solar wind during the first two days as compared to the last two days. Thus, the accuracy of the predictions depends on the location of the spacecraft and the solar wind flow direction. Another finding, for the events studied here, is that the and models showed a very different dependence on Bz. The model is almost independent of the solar wind magnetic field Bz, except at times when Bz is exceptionally large or when the overall activity is low. On the contrary, the model shows a strong dependence on Bz at all times.
The NF-κB p65 and p50 homodimer cooperate with IRF8 to activate iNOS transcription
International Nuclear Information System (INIS)
Simon, Priscilla S.; Sharman, Sarah K.; Lu, Chunwan; Yang, Dafeng; Paschall, Amy V.; Tulachan, Sidhartha S.; Liu, Kebin
2015-01-01
Inducible nitric oxide synthase (iNOS) metabolizes L-arginine to produce nitric oxide (NO) which was originally identified in myeloid cells as a host defense mechanism against pathogens. Recent studies, however, have revealed that iNOS is often induced in tumor cells and myeloid cells in the tumor microenvironment. Compelling experimental data have shown that iNOS promotes tumor development in certain cellular context and suppresses tumor development in other cellular conditions. The molecular mechanisms underlying these contrasting functions of iNOS is unknown. Because iNOS is often induced by inflammatory signals, it is therefore likely that these contrasting functions of iNOS could be controlled by the inflammatory signaling pathways, which remains to be determined. iNOS is expressed in colon carcinoma and myeloid cells in the tumor microenvironment. Colon carcinoma and myeloid cell lines were used to elucidate the molecular mechanisms underlying iNOS expression. Chromatin immunoprecipitation and electrophoretic mobility shift assay were used to determine the IFNγ-activated pSTAT1 and NF-κB association with the chromatin DNA of the nos2 promoter. We show here that iNOS is dramatically up-regulated in inflammed human colon tissues and in human colon carcinoma as compared to normal colon tissue. iNOS is expressed in either the colon carcinoma cells or immune cells within the tumor microenvironment. On the molecular level, the proinflammatory IFNγ and NF-κB signals induce iNOS expression in human colon cancer cells. We further demonstrate that NF-κB directly binds to the NOS2 promoter to regulate iNOS expression. Although neither the IFNγ signaling pathway nor the NF-κB signaling pathway alone is sufficient to induce iNOS expression in myeloid cells, IFNγ and NF-κB synergistically induce iNOS expression in myeloid cells. Furthermore, we determine that IFNγ up-regulates IRF8 expression to augment NF-κB induction of iNOS expression. More interestingly, we
The Effect of "Rogue" Active Regions on the Solar Cycle
Nagy, Melinda; Lemerle, Alexandre; Labonville, François; Petrovay, Kristóf; Charbonneau, Paul
2017-11-01
The origin of cycle-to-cycle variations in solar activity is currently the focus of much interest. It has recently been pointed out that large individual active regions with atypical properties can have a significant impact on the long-term behavior of solar activity. We investigate this possibility in more detail using a recently developed 2×2D dynamo model of the solar magnetic cycle. We find that even a single "rogue" bipolar magnetic region (BMR) in the simulations can have a major effect on the further development of solar activity cycles, boosting or suppressing the amplitude of subsequent cycles. In extreme cases, an individual BMR can completely halt the dynamo, triggering a grand minimum. Rogue BMRs also have the potential to induce significant hemispheric asymmetries in the solar cycle. To study the effect of rogue BMRs in a more systematic manner, a series of dynamo simulations were conducted, in which a large test BMR was manually introduced in the model at various phases of cycles of different amplitudes. BMRs emerging in the rising phase of a cycle can modify the amplitude of the ongoing cycle, while BMRs emerging in later phases will only affect subsequent cycles. In this model, the strongest effect on the subsequent cycle occurs when the rogue BMR emerges around cycle maximum at low latitudes, but the BMR does not need to be strictly cross-equatorial. Active regions emerging as far as 20° from the equator can still have a significant effect. We demonstrate that the combined effect of the magnetic flux, tilt angle, and polarity separation of the BMR on the dynamo is via their contribution to the dipole moment, δ D_{BMR}. Our results indicate that prediction of the amplitude, starting epoch, and duration of a cycle requires an accurate accounting of a broad range of active regions emerging in the previous cycle.
Polycrystalline ZnO: B grown by LPCVD as TCO for thin film silicon solar cells
International Nuclear Information System (INIS)
Fay, Sylvie; Steinhauser, Jerome; Nicolay, Sylvain; Ballif, Christophe
2010-01-01
Conductive zinc oxide (ZnO) grown by low pressure chemical vapor deposition (LPCVD) technique possesses a rough surface that induces an efficient light scattering in thin film silicon (TF Si) solar cells, which makes this TCO an ideal candidate for contacting such devices. IMT-EPFL has developed an in-house LPCVD process for the deposition of nanotextured boron doped ZnO films used as rough TCO for TF Si solar cells. This paper is a general review and synthesis of the study of the electrical, optical and structural properties of the ZnO:B that has been performed at IMT-EPFL. The influence of the free carrier absorption and the grain size on the electrical and optical properties of LPCVD ZnO:B is discussed. Transport mechanisms at grain boundaries are studied. It is seen that high doping of the ZnO grains facilitates the tunnelling of the electrons through potential barriers that are located at the grain boundaries. Therefore, even if these potential barriers increase after an exposition of the film to a humid atmosphere, the heavily doped LPCVD ZnO:B layers show a remarkable stable conductivity. However, the introduction of diborane in the CVD reaction induces also a degradation of the intra-grain mobility and increases over-proportionally the optical absorption of the ZnO:B films. Hence, the necessity to finely tune the doping level of LPCVD ZnO:B films is highlighted. Finally, the next challenges to push further the optimization of LPCVD ZnO:B films for thin film silicon solar cells are discussed, as well as some remarkable record cell results achieved with LPCVD ZnO:B as front electrode.
Salmon trypsin stimulates the expression of interleukin-8 via protease-activated receptor-2
International Nuclear Information System (INIS)
Larsen, Anett K.; Seternes, Ole-Morten; Larsen, Merethe; Aasmoe, Lisbeth; Bang, Berit
2008-01-01
In this study, we focus on salmon trypsin as an activator of inflammatory responses in airway cells in vitro. The rationale behind the investigation is that salmon industry workers are exposed to aerosols containing enzymes, which are generated during industrial processing of the fish. Knowing that serine proteases such as trypsin are highly active mediators with diverse biological activities, the stimulation of nuclear factor-kappa B (NF-κB) and interleukin (IL)-8 and the role of protease-activated receptors (PAR) in inflammatory signal mediation were investigated. Protease-activated receptors are considered important under pathological situations in the human airways, and a thorough understanding of PAR-induced cellular events and their consequences in airway inflammation is necessary. Human airway epithelial cells (A549) were exposed to trypsin isolated from fish (Salmo salar), and we observed that purified salmon trypsin could generate secretion of IL-8 in a concentration-dependent manner. Furthermore, we demonstrate that PAR-2 activation by salmon trypsin is coupled to an induction of NF-κB-mediated transcription using a PAR-2 transfected HeLa cell model. Finally, we show that the release of IL-8 from A549 following stimulation with purified salmon trypsin is mediated through activation of PAR-2 using specific small interfering RNAs (siRNAs). The results presented suggest that salmon trypsin, via activation of PAR-2, might influence inflammation processes in the airways if inhaled in sufficient amounts
Contributions to the understanding of the 8B proton halo question
International Nuclear Information System (INIS)
Negoita, F.; Borcea, C.; Carstoiu, F.; Lewitowicz, M.; Saint-Laurent, M.G.; Anne, R.; Bazin, D.; Borrel, V.; Corre, J.M.; Roussel-Chomaz, P.; and others.
1996-01-01
The reaction cross section for 8 B and 7 Be and the break-up cross section for 8 B on silicon have been measured. Secondary 8 B and 7 Be beams were obtained by use of the LISE spectrometer at GANIL. The separate contributions of diffraction dissociation and absorption to the breakup have been determined for the first time. The parallel momentum distribution of 7 Be resulting from the break-up of 8 B has also been determined. The data are compared to theoretical calculations. (author)
Energy Technology Data Exchange (ETDEWEB)
Wang, Ke [Key Laboratory of Nuclear Medicine, Ministry of Health, Jiangsu Key Laboratory of Molecular Nuclear Medicine, Jiangsu Institute of Nuclear Medicine, Wuxi, Jiangsu Province (China); Pei, Hao [Wuxi Hospital of Infectious Disease, Wuxi, Jiangsu Province (China); Huang, Biao; Yang, Run-Lin [Key Laboratory of Nuclear Medicine, Ministry of Health, Jiangsu Key Laboratory of Molecular Nuclear Medicine, Jiangsu Institute of Nuclear Medicine, Wuxi, Jiangsu Province (China); Wu, Hang-Yuan [Wuxi Hospital of Infectious Disease, Wuxi, Jiangsu Province (China); Zhu, Xue; Zhu, Lan [Key Laboratory of Nuclear Medicine, Ministry of Health, Jiangsu Key Laboratory of Molecular Nuclear Medicine, Jiangsu Institute of Nuclear Medicine, Wuxi, Jiangsu Province (China)
2012-08-17
The role of B cells in the pathogenesis of hepatitis B virus (HBV) infection has not been explored in depth. In the present study, the activation status of B cells from peripheral blood of healthy controls (N = 20) and patients with acute hepatitis B (AHB, N = 15) or chronic hepatitis B (CHB, N = 30) was evaluated by measuring the expression levels of B-cell activation markers CD69 and CD86, using quantitative real-time PCR and flow cytometry. Moreover, the potential mechanism underlying B-cell activation during HBV infection was further investigated by analyzing the expression profile of FCRL1, an intrinsic activation molecule of B cells. An elevation in the levels of B-cell activation markers including CD69 and CD86 was observed in the AHB patients (44.31 ± 9.27, 27.64 ± 9.26%) compared to CHB patients (30.35 ± 11.27, 18.41 ± 6.56%, P < 0.05), which was still higher than healthy controls (12.23 ± 7.84, 8.22 ± 3.43%, P < 0.05). Furthermore, the expression of FCRL1 was found to be similar to B-cell activation markers, which was highest in AHB patients (70.15 ± 17.11%), lowest in healthy donors (36.32 ± 9.98%, P < 0.05) and half-way between these levels in patients with CHB (55.17 ± 12.03%, P < 0.05). The results were positively associated with aberrant B-cell activation. These data suggest that B cells can play a role in HBV infection, and therefore more effort should be devoted to exploring their functions.
Influence of solar activity on the state of the wheat market in medieval England
Pustil'Nik, Lev A.; Din, Gregory Yom
2004-09-01
The database of professor Rogers (1887), which includes wheat prices in England in the Middle Ages, was used to search for a possible influence of solar activity on the wheat market. Our approach was based on the following: (1) Existence of the correlation between cosmic ray flux entering the terrestrial atmosphere and cloudiness of the atmosphere. (2) Cosmic ray intensity in the solar system changes with solar activity, (3) Wheat production depends on weather conditions as a nonlinear function with threshold transitions. (4) A wheat market with a limited supply (as it was in medieval England) has a highly nonlinear sensitivity to variations in wheat production with boundary states, where small changes in wheat supply could lead to bursts of prices or to prices falling. We present a conceptual model of possible modes for sensitivity of wheat prices to weather conditions, caused by solar cycle variations, and compare expected price fluctuations with price variations recorded in medieval England. We compared statistical properties of the intervals between wheat price bursts during the years 1249-1703 with statistical properties of the intervals between the minima of solar cycles during the years 1700-2000. We show that statistical properties of these two samples are similar, both for characteristics of the distributions and for histograms of the distributions. We analyze a direct link between wheat prices and solar activity in the 17th century, for which wheat prices and solar activity data (derived from 10Be isotope) are available. We show that for all 10 time moments of the solar activity minima the observed prices were higher than prices for the corresponding time moments of maximal solar activity (100% sign correlation, on a significance level < 0.2%). We consider these results a direct evidence of the causal connection between wheat prices bursts and solar activity.
CORONAL DYNAMIC ACTIVITIES IN THE DECLINING PHASE OF A SOLAR CYCLE
Energy Technology Data Exchange (ETDEWEB)
Jang, Minhwan; Choe, G. S. [Department of Astronomy and Space Science, Kyung Hee University, Yongin 17104 (Korea, Republic of); Woods, T. N. [Laboratory for Atmospheric and Space Physics, University of Colorado, Boulder, CO 80303 (United States); Hong, Sunhak, E-mail: gchoe@khu.ac.kr [School of Space Research, Kyung Hee University, Yongin 17104 (Korea, Republic of)
2016-12-10
It has been known that some solar activity indicators show a double-peak feature in their evolution through a solar cycle, which is not conspicuous in sunspot number. In this Letter, we investigate the high solar dynamic activity in the declining phase of the sunspot cycle by examining the evolution of polar and low-latitude coronal hole (CH) areas, splitting and merging events of CHs, and coronal mass ejections (CMEs) detected by SOHO /LASCO C3 in solar cycle 23. Although the total CH area is at its maximum near the sunspot minimum, in which polar CHs prevail, it shows a comparable second maximum in the declining phase of the cycle, in which low-latitude CHs are dominant. The events of CH splitting or merging, which are attributed to surface motions of magnetic fluxes, are also mostly populated in the declining phase of the cycle. The far-reaching C3 CMEs are also overpopulated in the declining phase of the cycle. From these results we suggest that solar dynamic activities due to the horizontal surface motions of magnetic fluxes extend far in the declining phase of the sunspot cycle.
CORONAL DYNAMIC ACTIVITIES IN THE DECLINING PHASE OF A SOLAR CYCLE
International Nuclear Information System (INIS)
Jang, Minhwan; Choe, G. S.; Woods, T. N.; Hong, Sunhak
2016-01-01
It has been known that some solar activity indicators show a double-peak feature in their evolution through a solar cycle, which is not conspicuous in sunspot number. In this Letter, we investigate the high solar dynamic activity in the declining phase of the sunspot cycle by examining the evolution of polar and low-latitude coronal hole (CH) areas, splitting and merging events of CHs, and coronal mass ejections (CMEs) detected by SOHO /LASCO C3 in solar cycle 23. Although the total CH area is at its maximum near the sunspot minimum, in which polar CHs prevail, it shows a comparable second maximum in the declining phase of the cycle, in which low-latitude CHs are dominant. The events of CH splitting or merging, which are attributed to surface motions of magnetic fluxes, are also mostly populated in the declining phase of the cycle. The far-reaching C3 CMEs are also overpopulated in the declining phase of the cycle. From these results we suggest that solar dynamic activities due to the horizontal surface motions of magnetic fluxes extend far in the declining phase of the sunspot cycle.
Immunodiagnostic Value of Echinococcus Granulosus Recombinant B8/1 Subunit of Antigen B.
Savardashtaki, Amir; Sarkari, Bahador; Arianfar, Farzane; Mostafavi-Pour, Zohreh
2017-06-01
Cystic echinococcosis (CE), as a chronic parasitic disease, is a major health problem in many countries. The performance of the currently available serodiagnostic tests for the diagnosis of CE is unsatisfactory. The current study aimed at sub-cloning a gene, encoding the B8/1 subunit of antigen B (AgB) from Echinococcus granulosus, using gene optimization for the immunodiagnosis of human CE. The coding sequence for AgB8/1 subunit of Echinococcus granulosus was selected from GenBank and was gene-optimized. The sequence was synthesized and inserted into pGEX-4T-1 vector. Purification was performed with GST tag affinity column. Diagnostic performance of the produced recombinant antigen, native antigen B and a commercial ELISA kit were further evaluated in an ELISA system, using a panel of sera from CE patients and controls. SDS-PAGE demonstrated that the protein of interest had a high expression level and purity after GST tag affinity purification. Western blotting verified the immunoreactivity of the produced recombinant antigen with the sera of CE patients. In an ELISA system, the sensitivity and specificity (for human CE diagnosis) of the recombinant antigen, native antigen B and commercial kit were respectively 93% and 92%, 87% and 90% and 97% and 95%. The produced recombinant antigen showed a high diagnostic value which can be recommended for serodiagnosis of CE in Iran and other CE-endemic areas. Utilizing the combination of other subunits of AgB8 would improve the performance value of the introduced ELISA system.
Solar Activity Across the Scales: From Small-Scale Quiet-Sun Dynamics to Magnetic Activity Cycles
Kitiashvili, Irina N.; Collins, Nancy N.; Kosovichev, Alexander G.; Mansour, Nagi N.; Wray, Alan A.
2017-01-01
Observations as well as numerical and theoretical models show that solar dynamics is characterized by complicated interactions and energy exchanges among different temporal and spatial scales. It reveals magnetic self-organization processes from the smallest scale magnetized vortex tubes to the global activity variation known as the solar cycle. To understand these multiscale processes and their relationships, we use a two-fold approach: 1) realistic 3D radiative MHD simulations of local dynamics together with high resolution observations by IRIS, Hinode, and SDO; and 2) modeling of solar activity cycles by using simplified MHD dynamo models and mathematical data assimilation techniques. We present recent results of this approach, including the interpretation of observational results from NASA heliophysics missions and predictive capabilities. In particular, we discuss the links between small-scale dynamo processes in the convection zone and atmospheric dynamics, as well as an early prediction of Solar Cycle 25.
Latitude dependence of long-term geomagnetic activity and its solar wind drivers
Energy Technology Data Exchange (ETDEWEB)
Myllys, M. [Helsinki Univ. (Finland). Dept. of Physics; Partamies, N. [Finnish Meteorological Institute, Helsinki (Finland); University Centre in Svalbard, Longyearbyen (Norway). Dept. of Arctic Geophysics; Juusola, L. [Finnish Meteorological Institute, Helsinki (Finland)
2015-09-01
To validate the usage of global indices in studies of geomagnetic activity, we have examined the latitude dependence of geomagnetic variations in Fennoscandia and Svalbard from 1994 to 2010. Daily standard deviation (SD) values of the horizontal magnetic field have been used as a measure of the ground magnetic disturbance level.We found that the timing of the geomagnetic minimum depends on the latitude region: corresponding to the minimum of sunspot cycle 22 (in 1996), the geomagnetic minimum occurred between the geomagnetic latitudes 57-61 in 1996 and at the latitudes 64-67 in 1997, which are the average auroral oval latitudes. During sunspot cycle 23, all latitude regions experienced the minimum in 2009, a year after the sunspot minimum. These timing differences are due to the latitude dependence of the 10 s daily SD on the different solar wind drivers. In the latitude region of 64-67 , the impact of the high-speed solar wind streams (HSSs) on the geomagnetic activity is the most pronounced compared to the other latitude groups, while in the latitude region of 57-61 , the importance of the coronal mass ejections (CMEs) dominates. The geomagnetic activity maxima during ascending solar cycle phases are typically caused by CME activity and occur especially in the oval and sub-auroral regions. The strongest geomagnetic activity occurs during the descending solar cycle phases due to a mixture of CME and HSS activity. Closer to the solar minimum, less severe geomagnetic activity is driven by HSSs and mainly visible in the poleward part of the auroral region. According to our study, however, the timing of the geomagnetic activity minima (and maxima) in different latitude bands is different, due to the relative importance of different solar wind drivers at different latitudes.
Latitude dependence of long-term geomagnetic activity and its solar wind drivers
International Nuclear Information System (INIS)
Myllys, M.
2015-01-01
To validate the usage of global indices in studies of geomagnetic activity, we have examined the latitude dependence of geomagnetic variations in Fennoscandia and Svalbard from 1994 to 2010. Daily standard deviation (SD) values of the horizontal magnetic field have been used as a measure of the ground magnetic disturbance level.We found that the timing of the geomagnetic minimum depends on the latitude region: corresponding to the minimum of sunspot cycle 22 (in 1996), the geomagnetic minimum occurred between the geomagnetic latitudes 57-61 in 1996 and at the latitudes 64-67 in 1997, which are the average auroral oval latitudes. During sunspot cycle 23, all latitude regions experienced the minimum in 2009, a year after the sunspot minimum. These timing differences are due to the latitude dependence of the 10 s daily SD on the different solar wind drivers. In the latitude region of 64-67 , the impact of the high-speed solar wind streams (HSSs) on the geomagnetic activity is the most pronounced compared to the other latitude groups, while in the latitude region of 57-61 , the importance of the coronal mass ejections (CMEs) dominates. The geomagnetic activity maxima during ascending solar cycle phases are typically caused by CME activity and occur especially in the oval and sub-auroral regions. The strongest geomagnetic activity occurs during the descending solar cycle phases due to a mixture of CME and HSS activity. Closer to the solar minimum, less severe geomagnetic activity is driven by HSSs and mainly visible in the poleward part of the auroral region. According to our study, however, the timing of the geomagnetic activity minima (and maxima) in different latitude bands is different, due to the relative importance of different solar wind drivers at different latitudes.
The Young Solar Analogs Project
Gray, Richard O.; Saken, J. M.; Corbally, C. J.; Seeds, M. F.; Morrison, S. S.
2012-01-01
We are carrying out a long-term project of measuring chromospheric activity and brightness variations in 31 young solar analogs (YSAs) using the Dark Sky Observatory (DSO -- Appalachian State University) 32-inch telescope and the G/M spectrograph. These YSAs are solar-type (spectral types F8 - K2) stars with ages ranging from 0.3 - 1.5 Gyr. The goal of this project is to gain better understanding of the magnetic activity of the early Sun, and especially how that activity may have impacted the development of life on the Earth. This project will also yield insights into the space environments experienced by young Earth analogs. We are currently in our 5th year of obtaining Ca II K & H chromospheric flux measurements, and are beginning to see signs of long-term activity cycles in a number of our stars. In addition, rotational modulation of the chromospheric fluxes is detectable in our data, and we have determined rotational periods for many of our stars. Short timescale increases in the K & H fluxes have been observed in a number of our stars; these events may be related to stellar flares. VATTSpec, a new moderate-resolution spectrograph on the 1.8-m Vatican Telescope in Arizona, has recently become involved with the project. This spectrograph will increase our ability to detect short-term changes in stellar activity on timescales of hours to minutes. We have been monitoring the program stars for one year in a multi-band photometric system consisting of Stromgren-v, and Johnson B, V, and R filters. We will soon add a narrow-band H-alpha filter to the system. Photometry is being carried out with a small piggy-back telescope on the 32-inch, but a robotic photometric telescope is currently being installed at DSO for this purpose. This project is supported by the National Science Foundation.
Li, Y.; Li, S. G.; Wang, J.; Li, Y.; Ma, C. H.; Zhang, L.
2014-12-01
Three TiO2 loaded composites, TiO2/kaolin, TiO2/diatomite, and TiO2/zeolite, were prepared in order to improve the solar-light photocatalytic activity of TiO2. The results showed that the photocatalytic activity could obviously be enhanced by loading appropriate amount of inorganic mineral materials. Meanwhile, TiO2 content, heat-treatment temperature and heat-treatment time on the photocatalytic activity were reviewed. Otherwise, the effect of solar light irradiation time and dye concentration on the photocatalytic degradation of Acid Red B was investigated. Furthermore, the degradation mechanism and adsorption process were also discussed.
Measurement of solar ultraviolet radiation intensity type A and B in Qazvin (2013-14
Directory of Open Access Journals (Sweden)
SAR. Babaee
2016-08-01
Full Text Available Background: Solar ultraviolet radiation (UVR is considered one of the most important biological risk factors in the world. Most health damages from solar ultraviolet radiation at ground level are mainly caused by UVA and UVB spectrums. Objective: The aim of this study was to Measure the solar ultraviolet radiation intensity type A and B in Qazvin city. Methods: In this cross-sectional study, the intensity of solar ultraviolet radiation type A and B was measured in Qazvin on years of 2013-14 (during one year every monthly at three times, in the morning, afternoon and evening by using a UV Radiometer. Data were analyzed using descriptive statistics. Findings: The maximum average intensity of UVA and UVB rays during the one year with 28.36±1.88 W/m2 and 0.156±0.035 W/m2 respectively was in Tir month (June 22–July 22 and the minimum average intensity of UVA and UVB rays with 10.36±0.83 W/m2 and 0.041±0.010 W/m2 respectively was in Dai month (December 22–January 20. Conclusion: With regards to the results, it is recommended that individuals were less exposed to exposure time with direct sunshine and use appropriate protective measures such as; wear appropriate clothing, sunglasses, and sunscreen.
REGULARITY OF THE NORTH–SOUTH ASYMMETRY OF SOLAR ACTIVITY: REVISITED
International Nuclear Information System (INIS)
Zhang, J.; Feng, W.
2015-01-01
Extended time series of Solar Activity Indices (ESAI) extended the Greenwich series of sunspot area from the year 1874 back to 1821. The ESAI's yearly sunspot area in the northern and southern hemispheres from 1821 to 2013 is utilized to investigate characteristics of the north–south hemispherical asymmetry of sunspot activity. Periodical behavior of about 12 solar cycles is also confirmed from the ESAI data set to exist in dominant hemispheres, linear regression lines of yearly asymmetry values, and cumulative counts of yearly sunspot areas in the hemispheres for solar cycles. The period is also inferred to appear in both the cumulative difference in the yearly sunspot areas in the hemispheres over the entire time interval and in its statistical Student's t-test. The hemispherical bias of sunspot activity should be regarded as an impossible stochastic phenomenon over a long time period
Solar activity influence on air temperature regimes in caves
Stoeva, Penka; Mikhalev, Alexander; Stoev, Alexey
Cave atmospheres are generally included in the processes that happen in the external atmosphere as circulation of the cave air is connected with the most general circulation of the air in the earth’s atmosphere. Such isolated volumes as the air of caves are also influenced by the variations of solar activity. We discuss cave air temperature response to climate and solar and geomagnetic activity for four show caves in Bulgaria studied for a period of 46 years (1968 - 2013). Everyday noon measurements in Ledenika, Saeva dupka, Snezhanka and Uhlovitsa cave have been used. Temperatures of the air in the zone of constant temperatures (ZCT) are compared with surface temperatures recorded at meteorological stations situated near about the caves - in the towns of Vratsa, Lovech, Peshtera and Smolyan, respectively. For comparison, The Hansen cave, Middle cave and Timpanogos cave from the Timpanogos Cave National Monument, Utah, USA situated nearly at the same latitude have also been examined. Our study shows that the correlation between cave air temperature time series and sunspot number is better than that between the cave air temperature and Apmax indices; that t°ZCT is rather connected with the first peak in geomagnetic activity, which is associated with transient solar activity (CMEs) than with the second one, which is higher and connected with the recurrent high speed streams from coronal holes. Air temperatures of all examined show caves, except the Ledenika cave, which is ice cave show decreasing trends. On the contrary, measurements at the meteorological stations show increasing trends in the surface air temperatures. The trend is decreasing for the Timpanogos cave system, USA. The conclusion is that surface temperature trends depend on the climatic zone, in which the cave is situated, and there is no apparent relation between temperatures inside and outside the caves. We consider possible mechanism of solar cosmic rays influence on the air temperatures in caves
Enerplan - union of solar energy professionals, activity report second half of 2012
International Nuclear Information System (INIS)
2013-01-01
Enerplan is the French union of solar energy professionals. Created in 1983, its social purpose is the study and defense of the rights and of the material and moral interests of its members. Enerplan structures its action through two poles representing members' activities: 'solar energy and building' where topics about heat and electricity generation in relation with buildings are treated, and 'photovoltaic energy' where topics specific to big solar power plants are considered. Thanks to the collaborative participation of its members, both poles allow Enerplan union to be source of proposals to develop solar energy in France. As an active interface between professionals and institutions, Enerplan includes in its membership: industrialists, plant makers, engineering consultants, installers, associations, energy suppliers etc, from small-medium size companies to big groups. This document presents Enerplan's activities during the second half of 2012 (public relations, meetings and conferences, promotional activities, projects..)
Enerplan - union of solar energy professionals, activity report first half of 2013
International Nuclear Information System (INIS)
2013-01-01
Enerplan is the French union of solar energy professionals. Created in 1983, its social purpose is the study and defense of the rights and of the material and moral interests of its members. Enerplan structures its action through two poles representing members' activities: 'solar energy and building' where topics about heat and electricity generation in relation with buildings are treated, and 'photovoltaic energy' where topics specific to big solar power plants are considered. Thanks to the collaborative participation of its members, both poles allow Enerplan union to be source of proposals to develop solar energy in France. As an active interface between professionals and institutions, Enerplan includes in its membership: industrialists, plant makers, engineering consultants, installers, associations, energy suppliers etc, from small-medium size companies to big groups. This document presents Enerplan's activities during the first half of 2013 (public relations, meetings and conferences, promotional activities, projects..)
Hu, Shan
other planar supercapacitors in literature by more than one order of magnitude. All-solution fabrication processes were developed for both generations to achieve economical and scalable production. In addition to carbon nanotubes, nickel/nickel oxide core-shell nanowires were also studied as electrode materials for supercapacitors, for which high specific capacitance but low working voltage were obtained. Semi-transparent solar cells with carbon nanotube counter electrodes are developed to power the active noise cancellation system. They can be directly mounted on the glass panes and become part of the home window. The 2.67% efficiency achieved is higher than the 1.8% efficiency required for harvesting adequate energy to cancel noise of 70dB Day-Night-Level, which impacts on a north-facing window. In summary, this project develops several fundamental technologies that together can contribute to a solar-powered active noise cancellation system for a building window. At the same time, since the component technologies being developed are fundamental, it is also likely that they will have wider applications in other domains beyond building windows.
An increase in circulating B cell-activating factor in childhood-onset ocular myasthenia gravis.
Motobayashi, Mitsuo; Inaba, Yuji; Nishimura, Takafumi; Kobayashi, Norimoto; Nakazawa, Yozo; Koike, Kenichi
2015-04-01
Myasthenia gravis is a B cell-mediated autoimmune disorder. The pathophysiology of childhood-onset ocular myasthenia gravis remains unclear. We investigated serum B cell-activating factor levels and other immunological parameters in child patients with ocular myasthenia gravis. Blood samples were obtained from 9 children with ocular myasthenia gravis and 20 age-matched controls. We assayed serum concentrations of B cell-activating factor, anti-acetylcholine receptor antibody titers, 7 types of cytokines (interleukins-2, -4, -6, -10, and -17A; interferon-γ; tumor necrosis factor-α) as well as the percentages of peripheral blood CD4+, CD8+, and CD19+ cells. Serum B cell-activating factor levels were significantly higher before immunosuppressive therapy in patients with childhood-onset ocular myasthenia gravis than in controls and decreased after immunosuppressive therapy. A significant positive correlation was observed between serum B cell-activating factor levels and anti-acetylcholine receptor antibody titers in patients with myasthenia gravis. Serum B cell-activating factor concentrations did not correlate with the percentages of CD4+, CD8+, and CD19+ cells or the CD4+/CD8+ ratio. No significant differences were observed in the levels of the 7 different types of cytokines examined, including interleukin-17A, between preimmunosuppressive therapy myasthenia gravis patients and controls. Circulating B cell-activating factor may play a key role in the pathophysiology of childhood-onset ocular myasthenia gravis. Copyright © 2015 Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Vial, Jean-Claude
1981-01-01
Notably by reprinting various documents and articles, this research reports works undertaken from the design of an experiment performed with the LPSP instrument aboard the OSO-8 satellite, to its data processing and interpretation. This experiment aimed at the study of the chromosphere fine structure by means of simultaneous high resolution observations of the L α, L β, Mg II, Ca II, H and K lines. The first part presents the on-board LPSP instrument. The second part reports observations of active and quiescent solar prominences. The third part reports the transfer calculation for five resonance lines (H Lα, Mg II H and K, Ca II H and K), and the comparison with observations performed on OSO-8
Czech Academy of Sciences Publication Activity Database
Truhlík, Vladimír; Bilitza, D.; Třísková, Ludmila
2015-01-01
Roč. 55, č. 8 (2015), s. 2099-2105 ISSN 0273-1177 R&D Projects: GA MŠk(CZ) LH11123 Institutional support: RVO:68378289 Keywords : ion composition * topside ionosphere * solar activity * empirical model * International Reference Ionosphere Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.409, year: 2015 http://www.sciencedirect.com/science/article/pii/S027311771400489X
Solar UV exposure among outdoor workers in Denmark measured with personal UV-B dosimeters
DEFF Research Database (Denmark)
Grandahl, Kasper; Mortensen, Ole Steen; Sherman, David Zim
2017-01-01
radiation exposure are needed to help resolve this problem. This can be done using personal ultraviolet radiation dosimeters. Methods: We consider technical and practical feasibility of measuring individual solar ultraviolet exposure at work and leisure in professions with different á priori temporal high......-level outdoor worktime, using aluminium gallium nitride (AlGaN) photodiode detector based personal UV-B dosimeters. Essential technical specifications including the spectral and angular responsivity of the dosimeters are described and pre-campaign dosimeter calibration applicability is verified. The scale...... with our specialist knowledge as occupational physicians. Conclusions: Large-scale use of personal UV-B dosimeters for measurement of solar ultraviolet radiation exposure at work and leisure in Denmark is indeed feasible from a technical and practical viewpoint. Samples of exposure data shown support...
EUV and Magnetic Activities Associated with Type-I Solar Radio Bursts
Li, C. Y.; Chen, Y.; Wang, B.; Ruan, G. P.; Feng, S. W.; Du, G. H.; Kong, X. L.
2017-06-01
Type-I bursts ( i.e. noise storms) are the earliest-known type of solar radio emission at the meter wavelength. They are believed to be excited by non-thermal energetic electrons accelerated in the corona. The underlying dynamic process and exact emission mechanism still remain unresolved. Here, with a combined analysis of extreme ultraviolet (EUV), radio and photospheric magnetic field data of unprecedented quality recorded during a type-I storm on 30 July 2011, we identify a good correlation between the radio bursts and the co-spatial EUV and magnetic activities. The EUV activities manifest themselves as three major brightening stripes above a region adjacent to a compact sunspot, while the magnetic field there presents multiple moving magnetic features (MMFs) with persistent coalescence or cancelation and a morphologically similar three-part distribution. We find that the type-I intensities are correlated with those of the EUV emissions at various wavelengths with a correlation coefficient of 0.7 - 0.8. In addition, in the region between the brightening EUV stripes and the radio sources there appear consistent dynamic motions with a series of bi-directional flows, suggesting ongoing small-scale reconnection there. Mainly based on the induced connection between the magnetic motion at the photosphere and the EUV and radio activities in the corona, we suggest that the observed type-I noise storms and the EUV brightening activities are the consequence of small-scale magnetic reconnection driven by MMFs. This is in support of the original proposal made by Bentley et al. ( Solar Phys. 193, 227, 2000).
Progress in passive solar energy systems. Volume 8. Part 1
Energy Technology Data Exchange (ETDEWEB)
Hayes, J.; Andrejko, D.A.
1983-01-01
This book presents the papers given at a conference sponsored by the US DOE, the Solar Energy Research Institute, SolarVision, Inc., and the Southern California Solar Energy Society. The topics considered at the conference included sizing solar energy systems for agricultural applications, a farm scale ethanol production plant, the EEC wind energy RandD program, the passive solar performance assessment of an earth-sheltered house, the ARCO 1 MW photovoltaic power plant, the performance of a dendritic web photovoltaic module, second generation point focused concentrators, linear fresnel lens concentrating photovoltaic collectors, photovoltaic conversion efficiency, amorphous silicon thin film solar cells, a photovoltaic system for a shopping center, photovoltaic power generation for the utility industry, spectral solar radiation, and the analysis of insolation data.
Frontier of solar observation. Solar activity observed by 'HINODE' mission
International Nuclear Information System (INIS)
Watanabe, Tetsuya
2008-01-01
After launched in September 2006, solar observation satellite 'HINODE' has been a solar observatory on orbit with the scientific instruments well operated and its continuous observation was conducted steadily on almost all solar atmospheres from photosphere to corona. 'HINODE' was equipped with the solar optical telescope, extreme-ultraviolet imaging spectrometer and x-ray telescope and aimed at clarifying the mystery of solar physics related with coronal heating and magnetic reconnection. Present state of 'HINODE' was described from observations made in initial observation results, which have made several discoveries, such as Alfven waves in the corona, unexpected dynamics in the chromosphere and photosphere, continuous outflowing plasma as a possible source of solar wind, and fine structures of magnetic field in sunspots and solar surface. (T. Tanaka)
The effects of changing solar activity on climate: contributions from palaeoclimatological studies
Directory of Open Access Journals (Sweden)
Engels Stefan
2012-07-01
Full Text Available Natural climate change currently acts in concert with human-induced changes in the climate system. To disentangle the natural variability in the climate system and the human-induced effects on the global climate, a critical analysis of climate change in the past may offer a better understanding of the processes that drive the global climate system. In this review paper, we present palaeoclimatological evidence for the past influence of solar variability on Earth’s climate, highlighting the effects of solar forcing on a range of timescales. On a decadal timescale, instrumental measurements as well as historical records show the effects of the 11-year Schwabe cycle on climate. The variation in total solar irradiance that is associated with a Schwabe cycle is only ~1 W m−2 between a solar minimum and a maximum, but winter and spring temperatures on the Northern Hemisphere show a response even to this small-scale variability. There is a large body of evidence from palaeoclimatic reconstructions that shows the influence of solar activity on a centennial to millennial timescale. We highlight a period of low solar activity starting at 2800 years before present when Europe experienced a shift to colder and wetter climate conditions. The spatial pattern of climate change that can be recognized in the palaeoclimatological data is in line with the suggested pattern of climate change as simulated by climate models. Millennial-scale climate oscillations can be recognized in sediment records from the Atlantic Ocean as well as in records of lake-level fluctuations in southeastern France. These oscillations coincide with variation in 14C production as recognized in the atmospheric 14C record (which is a proxy-record for solar activity, suggesting that Earth’s climate is sensitive to changes in solar activity on a millennial timescale as well.
Solar Magnetic Atmospheric Effects on Global Helioseismic ...
Indian Academy of Sciences (India)
provide priceless diagnostic tools in the search for hidden aspects of the solar interior ... The overall structure of the helioseismic frequency spectrum, see Figure 1, has not .... 10.7 cm radio flux were used as a proxy of the solar surface activity. All the ..... According to their predictions, at least B = 5 × 105 G field strength is.
Solar activity and terrestrial climate: an analysis of some purported correlations
DEFF Research Database (Denmark)
Laut, Peter
2003-01-01
claimed to support solar hypotheses. My analyses show that the apparent strong correlations displayed on these graphs have been obtained by an incorrect handling of the physical data. Since the graphs are still widely referred to in the literature and their misleading character has not yet been generally......The last decade has seen a revival of various hypotheses claiming a strong correlation between solar activity and a number of terrestrial climate parameters: Links between cosmic rays and cloud cover, first total cloud cover and then only low clouds, and between solar cycle lengths and Northern...... the existence of important links between solar activity and terrestrial climate. Such links have over the years been demonstrated by many authors. The sole objective of the present analysis is to draw attention to the fact that some of the widely publicized, apparent correlations do not properly reflect...
Multi-wavelength Observations of Solar Acoustic Waves Near Active Regions
Monsue, Teresa; Pesnell, Dean; Hill, Frank
2018-01-01
Active region areas on the Sun are abundant with a variety of waves that are both acoustically helioseismic and magnetohydrodynamic in nature. The occurrence of a solar flare can disrupt these waves, through MHD mode-mixing or scattering by the excitation of these waves. We take a multi-wavelength observational approach to understand the source of theses waves by studying active regions where flaring activity occurs. Our approach is to search for signals within a time series of images using a Fast Fourier Transform (FFT) algorithm, by producing multi-frequency power map movies. We study active regions both spatially and temporally and correlate this method over multiple wavelengths using data from NASA’s Solar Dynamics Observatory. By surveying the active regions on multiple wavelengths we are able to observe the behavior of these waves within the Solar atmosphere, from the photosphere up through the corona. We are able to detect enhancements of power around active regions, which could be acoustic power halos and of an MHD-wave propagating outward by the flaring event. We are in the initial stages of this study understanding the behaviors of these waves and could one day contribute to understanding the mechanism responsible for their formation; that has not yet been explained.
International Nuclear Information System (INIS)
Brines, R.D.; Sia, D.Y.; Lehner, T.
1987-01-01
The authors isolated a T8 + T3 + Ia + clone of cells from the peripheral blood mononuclear cells of a healthy subject. The clone was expanded and maintained with autologous feed cells, interleukin 2, and a streptococcal antigen. The T8 + clone of cells responded specifically to the streptococcal antigen, in the absence of accessory cells,and released a soluble factor. Both the cloned cells and the corresponding soluble factor expressed augmenting helper but not suppressor activity. The augmenting helper activity for B cell antibody synthesis was demonstrable only in the presence of autologous T 4 cells. Radioimmunoassay was used to measure antibodies. Although stimulation of the T8 + cloned cells was antigen-specific, the resulting soluble factor elicited nonspecific antibody synthesis in the presence of T4 and B cells. The T8 + cloned cell-derived factor was adsorbed by B cells but not by T4 cells. Preliminary studies suggest that the factor has the properties of a B cell growth factor. They suggest that the T8 + population consists of functionally heterogeneous cell subsets, some that have suppressor function and others that augment the T4 + helper-inducer activity in B cell antibody synthesis
Commercially Available Activated Carbon Fiber Felt Enables Efficient Solar Steam Generation.
Li, Haoran; He, Yurong; Hu, Yanwei; Wang, Xinzhi
2018-03-21
Sun-driven steam generation is now possible and has the potential to help meet future energy needs. Current technologies often use solar condensers to increase solar irradiance. More recently, a technology for solar steam generation that uses heated surface water and low optical concentration is reported. In this work, a commercially available activated carbon fiber felt is used to generate steam efficiently under one sun illumination. The evaporation rate and solar conversion efficiency reach 1.22 kg m -2 h -1 and 79.4%, respectively. The local temperature of the evaporator with a floating activated carbon fiber felt reaches 48 °C. Apart from the high absorptivity (about 94%) of the material, the evaporation performance is enhanced thanks to the well-developed pores for improved water supply and steam escape and the low thermal conductivity, which enables reduced bulk water temperature increase. This study helps to find a promising material for solar steam generation using a water evaporator that can be produced economically (∼6 $/m 2 ) with long-term stability.
The Influence of Solar Activity on the Rainfall over India: Cycle-to ...
Indian Academy of Sciences (India)
The Influence of Solar Activity on the Rainfall over India: Cycle-to-Cycle Variations. K. M. Hiremath. Indian Institute of Astrophysics, Bangalore 560 034, India. e-mail: hiremath@iiap.res.in. Abstract. We use 130 years data for studying correlative effects due to solar cycle and activity phenomena on the occurrence of rainfall ...
Data of evolutionary structure change: 1BT8B-1EN5B [Confc[Archive
Lifescience Database Archive (English)
Full Text Available e>KGLKK----GTTLQ >H ---- > ATOM ...bChain>B 1BT8B KNMAPKGSAPERPT cture>H ...DChain> LVLKG--DKLAV >EEEE -- EEEE...ence>LVWDPLGKRINT >EEEE EEEEe> AT...re> ATOM 2237 CA LYS B 80 12.251 15.102 18.409 1.00 11.94 C
Korolev, G. A.; Dobrovolsky, A. V.; Inglessi, A. G.; Alkhazov, G. D.; Egelhof, P.; Estradé, A.; Dillmann, I.; Farinon, F.; Geissel, H.; Ilieva, S.; Ke, Y.; Khanzadeev, A. V.; Kiselev, O. A.; Kurcewicz, J.; Le, X. C.; Litvinov, Yu. A.; Petrov, G. E.; Prochazka, A.; Scheidenberger, C.; Sergeev, L. O.; Simon, H.; Takechi, M.; Tang, S.; Volkov, V.; Vorobyov, A. A.; Weick, H.; Yatsoura, V. I.
2018-05-01
The absolute differential cross section for small-angle proton elastic scattering on the proton-rich 8B nucleus has been measured in inverse kinematics for the first time. The experiment was performed using a secondary radioactive beam with an energy of 0.7 GeV/u at GSI, Darmstadt. The active target, namely hydrogen-filled time projection ionization chamber IKAR, was used to measure the energy, angle and vertex point of the recoil protons. The scattering angle of the projectiles was simultaneously determined by the tracking detectors. The measured differential cross section is analyzed on the basis of the Glauber multiple scattering theory using phenomenological nuclear-density distributions with two free parameters. The radial density distribution deduced for 8B exhibits a halo structure with the root-mean-square (rms) matter radius Rm = 2.58 (6) fm and the rms halo radius Rh = 4.24 (25) fm. The results on 8B are compared to those on the mirror nucleus 8Li investigated earlier by the same method. A comparison is also made with previous experimental results and theoretical predictions for both nuclei.
Li, Penghui; Chen, Beibei; Zhang, Gaoyang; Chen, Longxiang; Dong, Qiang; Wen, Jiangqi; Mysore, Kirankumar S; Zhao, Jian
2016-05-01
The MYB- basic helix-loop-helix (bHLH)-WD40 complexes regulating anthocyanin and proanthocyanidin (PA) biosynthesis in plants are not fully understood. Here Medicago truncatula bHLH MtTT8 was characterized as a central component of these ternary complexes that control anthocyanin and PA biosynthesis. Mttt8 mutant seeds have a transparent testa phenotype with reduced PAs and anthocyanins. MtTT8 restores PA and anthocyanin productions in Arabidopsis tt8 mutant. Ectopic expression of MtTT8 restores anthocyanins and PAs in mttt8 plant and hairy roots and further enhances both productions in wild-type hairy roots. Transcriptomic analyses and metabolite profiling of mttt8 mutant seeds and M. truncatula hairy roots (mttt8 mutant, mttt8 mutant complemented with MtTT8, or MtTT8 overexpression lines) indicate that MtTT8 regulates a subset of genes involved in PA and anthocyanin biosynthesis. MtTT8 is genetically regulated by MtLAP1, MtPAR and MtWD40-1. Combinations of MtPAR, MtLAP1, MtTT8 and MtWD40-1 activate MtTT8 promoter in yeast assay. MtTT8 interacts with these transcription factors to form regulatory complexes. MtTT8, MtWD40-1 and an MYB factor, MtPAR or MtLAP1, interacted and activated promoters of anthocyanidin reductase and anthocyanidin synthase to regulate PA and anthocyanin biosynthesis, respectively. Our results provide new insights into the complex regulation of PA and anthocyanin biosynthesis in M. truncatula. © 2016 The Authors. New Phytologist © 2016 New Phytologist Trust.
Warnan, Julien; Cabanetos, Clement; El Labban, Abdulrahman; Hansen, Michael Ryan; Tassone, Christopher J.; Toney, Michael F.; Beaujuge, Pierre
2014-01-01
Benzo[1,2-b:4,5-b']difuran-thieno[3,4-c]pyrrole-4,6-dione (PBDFTPD) polymers prepared by microwave-assisted synthesis can achieve power conversion efficiencies (PCEs) >7% in bulk-heterojunction solar cells with phenyl-C61/71-butyric acid methyl
A road map to solar neutrino fluxe, neutrino oscillation parameters, and tests for new physics
Bahcall, J N; Bahcall, John N.; Peña-Garay, Carlos
2003-01-01
We analyze all available solar and related reactor neutrino experiments, as well as simulated future ^7Be, p-p, pep, and ^8B solar neutrino experiments. We treat all solar neutrino fluxes as free parameters subject to the condition that the total luminosity represented by the neutrinos equals the observed solar luminosity (the `luminosity constraint'). Existing experiments show that the p-p solar neutrino flux is 1.01 + - 0.02 (1 sigma) times the flux predicted by the BP00 standard solar model; the ^7Be neutrino flux is 0.97^{+0.28}_{-0.54} the predicted flux; and the ^8B flux is 1.01 + - 0.06 the predicted flux. The oscillation parameters are: Delta m^2 = 7.3^{+0.4}_{-0.6} 10^{-5} eV^2 and tan^2 theta_{12} = 0.42^{+0.08}_{-0.06}. We evaluate how accurate future experiments must be to determine more precisely neutrino oscillation parameters and solar neutrino fluxes, and to elucidate the transition from vacuum-dominated to matter-dominated oscillations. A future ^7Be nu-e scattering experiment accurate to + -...
Activity associated with coronal mass ejections at solar minimum - SMM observations from 1984-1986
St. Cyr, O. C.; Webb, D. F.
1991-01-01
Seventy-three coronal mass ejections (CMEs) observed by the coronagraph aboard SMM between 1984 and 1986 were examined in order to determine the distribution of various forms of solar activity that were spatially and temporally associated with mass ejections during solar minimum phase. For each coronal mass ejection a speed was measured, and the departure time of the transient from the lower corona estimated. Other forms of solar activity that appeared within 45 deg longitude and 30 deg latitude of the mass ejection and within +/-90 min of its extrapolated departure time were explored. The statistical results of the analysis of these 73 CMEs are presented, and it is found that slightly less than half of them were infrequently associated with other forms of solar activity. It is suggested that the distribution of the various forms of activity related to CMEs does not change at different phases of the solar cycle. For those CMEs with associations, it is found that eruptive prominences and soft X-rays were the most likely forms of activity to accompany the appearance of mass ejections.
International Nuclear Information System (INIS)
Coffey, H.E.
1988-05-01
Contents include: detailed index for 1987 and 1988; data for November 1987 -- (Meudon carte synoptique, solar flares, solar radio bursts at fixed frequencies, solar x-ray radiation from GOES satellite, mass ejections from the sun, active prominences and filaments); miscellaneous data -- interplanetary solar particles and plasma -- (IMP 8 solar wind -- October 1987 - January 1988, IMP 8 solar particles -- September 1985 - May 1986)
Li, Zhen; Gao, Yilong; Wu, Jianxiang; Zhang, Wei; Tan, Yueyue; Tang, Bohejin
2016-09-01
Ni-B/Zeolitic Imidazolate Frameworks-8 (Ni-B/ZIF-8) is synthesized via a series of solvothermal, incipient wetness impregnation and chemical reduction methods. The ZIF-8 serves as the host for the growth of Ni-B forming a Ni-B/ZIF-8 composite. Characterization by X-ray diffraction and Transmission electron microscope reveals the dispersion of Ni-B in ZIF-8. As electrode materials for supercapacitors, ZIF-8, Ni-B and Ni-B/ZIF-8 electrodes exhibit specific capacitances of 147, 563 and 866 F g-1, respectively at a scan rate of 5 mV s-1 and good stability over 500 cycles. In particular, Ni-B/ZIF-8 is a promising material for supercapacitors.
Okazaki, Y.; Seto, K.; Sakai, T.; Ooki, A.; yamada, K.; Dettman, D. L.
2011-12-01
Evidence shows that solar activity influences climate on a global scale. In the mid-latitude region, climate change is expected to change precipitation patterns. Concurrently, variation in solar activity may influence phytoplankton productivity. It seems that these changes should be recorded in sediment and organic matter deposits in coastal lagoons. In this study, we discuss the relationship between climate change and solar activity in the mid-Holocene in the northern hemisphere mid-latitude region based on grain size analysis, total organic carbon (TOC) content and organic carbon accumulation rates (Corg A.R.) in coastal lagoon sediment core samples. The INB core was drilled to produce a high resolution record of Holocene paleoenvironmental change in the San'in District, western Japan. The core is 19.17m in total length and is divided into Unit I~VII by lithofacies. Holocene sediment, primarily organic silt, forms Unit III and above in this core. Unit III was deposited from 8.4 to 5.4 ka, when sea level rose during the Jomon transgression; its depositional environment is a coastal lagoon. Progradation of the river mouth during the sea level rise lead to an increase in the C/N ratio of organic matter. Unit IV contains the volcanic Shigaku pyroclastic flow (the sixth stage of volcanic activity of the Sanbe volcano), and Unit V reflects deposition in a freshwater lake or swamp. Above this aggredational sediments were deposited by small rivers. This study focused on the coastal lagoon sediments of Unit III (8.4 to 5.4 ka); we carried out CNS elemental analysis and grain size analysis with a resolution of approximately five years. TOC content is variable and increases from 0.5 to 5%. Variation in TOC content is relatively well correlated with atmospheric radiocarbon 14C (Delta 14C) and therefore with solar activity, although the relationship is unclear in the upper portion of Unit III. The trend in Corg A.R. is different than TOC contents, about 40g/m/yr at ~8ka and
Energy Technology Data Exchange (ETDEWEB)
Joshi, Bhuwan; Kushwaha, Upendra [Udaipur Solar Observatory, Physical Research Laboratory, Udaipur 313001 (India); Veronig, Astrid M. [Kanzelhöhe Observatory/Institute of Physics, University of Graz, Universitätsplatz 5, A-8010 Graz (Austria); Cho, K.-S., E-mail: bhuwan@prl.res.in [Korea Astronomy and Space Science Institute, Daejeon 305-348 (Korea, Republic of)
2016-12-01
We investigate the triggering, activation, and ejection of a solar eruptive prominence that occurred in a multi-polar flux system of active region NOAA 11548 on 2012 August 18 by analyzing data from the Atmospheric Imaging Assembly on board the Solar Dynamics Observatory , the Reuven Ramaty High Energy Solar Spectroscopic Imager , and the Extreme Ultraviolet Imager/Sun Earth Connection Coronal and Heliospheric Investigation on board the Solar Terrestrial Relation Observatory . Prior to the prominence activation, we observed striking coronal activities in the form of a blowout jet, which is associated with the rapid eruption of a cool flux rope. Furthermore, the jet-associated flux rope eruption underwent splitting and rotation during its outward expansion. These coronal activities are followed by the prominence activation during which it slowly rises with a speed of ∼12 km s{sup −1} while the region below the prominence emits gradually varying EUV and thermal X-ray emissions. From these observations, we propose that the prominence eruption is a complex, multi-step phenomenon in which a combination of internal (tether-cutting reconnection) and external (i.e., pre-eruption coronal activities) processes are involved. The prominence underwent catastrophic loss of equilibrium with the onset of the impulsive phase of an M1.8 flare, suggesting large-scale energy release by coronal magnetic reconnection. We obtained signatures of particle acceleration in the form of power-law spectra with hard electron spectral index ( δ ∼ 3) and strong HXR footpoint sources. During the impulsive phase, a hot EUV plasmoid was observed below the apex of the erupting prominence that ejected in the direction of the prominence with a speed of ∼177 km s{sup −1}. The temporal, spatial, and kinematic correlations between the erupting prominence and the plasmoid imply that the magnetic reconnection supported the fast ejection of prominence in the lower corona.
A Solar Station for Education and Research on Solar Activity at a National University in Peru
Ishitsuka, J. K.
2006-11-01
pepe@geo.igp.gob.pe Beginning in 1937, the Carnegie Institution of Washington made active regional observations with a spectro-helioscope at the Huancayo Observatory. In 1957, during the celebration of the International Geophysical Year Mutsumi Ishitsuka arrived at the Geophysical Institute of Peru and restarted solar observations from the Huancayo Observatory. Almost 69 years have passed and many contributions for the geophysical and solar sciences have been made. Now the Instituto Geofisico del Peru (IGP), in cooperation with the Faculty of Sciences of the Universidad Nacional San Luis Gonzaga de Ica (UNICA), and with the support of the National Astronomical Observatory of Japan, are planning to construct a solar station refurbishing a coelostat that worked for many years at the Huancayo Observatory. A 15 cm refractor telescope is already installed at the university, for the observation of sunspots. A solar Flare Monitor Telescope (FMT) from Hida Observatory of Kyoto University could be sent to Peru and installed at the solar station at UNICA. As the refurbished coelostat, FMT will become a good tool to improve education and research in sciences.
Baby, L.T.; Goldring, G.; Hass, M.; Weissman, L.; Fedoseyev, V.N.; Koester, U.; Nir-El, Y.; Haquin, G.; Gaggeler, H.W.; Weinreich, R.
2003-01-01
The $^{7}$Be(p, $\\gamma$) $\\,^{8}$B reaction plays a central role in the evaluation of solar neutrino fluxes. We report on a new precision measurement of the cross section of this reaction, following our previous experiment with an implanted $^{7}$Be target, a raster- scanned beam, and the elimination of the backscattering loss. The new measurement incorporates a more abundant $^{7}$Be target and a number of improvements in design and procedure. The point at E$_{lab}$ = 991 keV was measured several times under varying experimental conditions, yielding a value of S$_{17}$(E$_{c.m.}$ = 850 keV) = 24.0 $\\pm$ 0.5 eV b. Measurements were carried out at lower energies as well. Because of the precise knowledge of the implanted $^{7}$Be density profile, it was possible to reconstitute both the off- and on-resonance parts of the cross section and to obtain from the entire set of measurements an extrapolated value of S$_{17}$(0)=21.2 $\\pm$ 0.7 eV b.
Early evolution of an X-ray emitting solar active region
International Nuclear Information System (INIS)
Wolfson, C.J.; Acton, L.W.; Leibacher, J.W.; Roethig, D.T.
1977-01-01
The birth and early evolution of a solar active region has been investigated using X-ray observations from the Lockheed Mapping X-Ray Heliometer on board the OSO-8 spacecraft. X-ray emission is observed within three hours of the first detection of Hα plage. At that time, a plasma temperature of 4 x 10 6 K in a region having a density of the order of 10 10 cm -3 is inferred. During the fifty hours following birth almost continuous flares or flare-like X-ray bursts are superimposed on a monotonically increasing base level of X-ray emission produced by plasma with a temperature of the order 3 x 10 6 K. If it is assumed that the X-rays result from heating due to dissipation of current systems or magnetic field reconnection, it can be concluded that flare-like X-ray emission soon after active region birth implies that the magnetic field probably emerges in a stressed or complex configuration. (Auth.)
North–South Asymmetry of the Rotation of the Solar Magnetic Field
Xie, Jinglan; Shi, Xiangjun; Qu, Zhining
2018-03-01
Using the rotation rates of the solar magnetic field during solar cycles 21 to 23 obtained by Chu et al. by analyzing the synoptic magnetic maps produced by the NSO/Kitt Peak and SOHO/MDI during the years 1975 to 2008, the temporal variation of the equatorial rotation rate (A) and the latitude gradient of rotation (B) in the northern and southern hemispheres are studied separately. The results indicate that the rotation is more differential (about 4.3%) in the southern hemisphere in the considered time frame. It is found that the north–south asymmetry of A and the asymmetry of B show increasing trends in the considered time frame, while the north–south asymmetry of the solar activity shows a decreasing trend. There exists a significant negative correlation (at 95% confidence level) between the asymmetry of B and the asymmetry of the solar activity, and this may be due to stronger magnetic activity in a certain hemisphere that may suppress the differential rotation to some extent. The periodicities in the variation of A and B are also studied, and periods of about 5.0 and 10.5 yr (5.5 and 10.4 yr) can be found for the variation of the northern (southern) hemisphere B. Moreover, the north–south asymmetry of A and the asymmetry of B have similar periods of about 2.6–2.7 and 5.2–5.3 yr. Further, cross-correlation analysis indicates that there exists a phase difference (about eight months) between the northern and southern hemisphere B, and this means that the northern hemisphere B generally leads by about eight months.
iNKT cells suppress the CD8+ T cell response to a murine Burkitt's-like B cell lymphoma.
Directory of Open Access Journals (Sweden)
Ryan L Bjordahl
Full Text Available The T cell response to B cell lymphomas differs from the majority of solid tumors in that the malignant cells themselves are derived from B lymphocytes, key players in immune response. B cell lymphomas are therefore well situated to manipulate their surrounding microenvironment to enhance tumor growth and minimize anti-tumor T cell responses. We analyzed the effect of T cells on the growth of a transplantable B cell lymphoma and found that iNKT cells suppressed the anti-tumor CD8(+ T cell response. Lymphoma cells transplanted into syngeneic wild type (WT mice or Jalpha18(-/- mice that specifically lack iNKT cells grew initially at the same rate, but only the mice lacking iNKT cells were able to reject the lymphoma. This effect was due to the enhanced activity of tumor-specific CD8(+ T cells in the absence of iNKT cells, and could be partially reversed by reconstitution of iNKT cells in Jalpha 18(-/- mice. Treatment of tumor-bearing WT mice with alpha -galactosyl ceramide, an activating ligand for iNKT cells, reduced the number of tumor-specific CD8(+ T cells. In contrast, lymphoma growth in CD1d1(-/- mice that lack both iNKT and type II NKT cells was similar to that in WT mice, suggesting that type II NKT cells are required for full activation of the anti-tumor immune response. This study reveals a tumor-promoting role for iNKT cells and suggests their capacity to inhibit the CD8(+ T cell response to B cell lymphoma by opposing the effects of type II NKT cells.
Energy Technology Data Exchange (ETDEWEB)
None,
1981-09-01
Ninety-three project summaries are presented which discuss the following aspects of active solar heating and cooling: Rankine solar cooling systems; absorption solar cooling systems; desiccant solar cooling systems; solar heat pump systems; solar hot water systems; special projects (such as the National Solar Data Network, hybrid solar thermal/photovoltaic applications, and heat transfer and water migration in soils); administrative/management support; and solar collector, storage, controls, analysis, and materials technology. (LEW)
Auxiliary VHF transmitter to aid recovery of solar Argos/GPS PTTs
Christopher P. Hansen; Mark A. Rumble; R. Scott Gamo; Joshua J. Millspaugh
2014-01-01
While conducting greater sage-grouse (Centrocercus urophasianus) research, we found that solar-powered global positioning systems platform transmitter terminals (GPS PTTs) can be lost if the solar panel does not receive adequate sunlight. Thus, we developed 5-g (mortality sensor included; Prototype A) and 9.8-g (no mortality sensor; Prototype B) auxiliary very high...
15 CFR 8b.22 - Academic adjustments.
2010-01-01
... actions. Recipients need not provide attendants, individually prescribed devices, readers for personal use... Secondary Education § 8b.22 Academic adjustments. (a) Academic requirements. A recipient to which this..., against a qualified handicapped applicant or student. Academic requirements that the recipient can...
Bischoff, David S; Zhu, Jian-Hua; Makhijani, Nalini S; Yamaguchi, Dean T
2008-07-01
Blood vessel injury results in limited oxygen tension and diffusion leading to hypoxia, increased anaerobic metabolism, and elevated production of acidic metabolites that cannot be easily removed due to the reduced blood flow. Therefore, an acidic extracellular pH occurs in the local microenvironment of disrupted bone. The potential role of acidic pH and glu-leu-arg (ELR(+)) CXC chemokines in early events in bone repair was studied in human mesenchymal stem cells (hMSCs) treated with medium of decreasing pH (7.4, 7.0, 6.7, and 6.4). The cells showed a reciprocal increase in CXCL8 (interleukin-8, IL-8) mRNA levels as extracellular pH decreased. At pH 6.4, CXCL8 mRNA was induced >60x in comparison to levels at pH 7.4. hMSCs treated with osteogenic medium (OGM) also showed an increase in CXCL8 mRNA with decreasing pH; although, at a lower level than that seen in cells grown in non-OGM. CXCL8 protein was secreted into the medium at all pHs with maximal induction at pH 6.7. Inhibition of the G-protein-coupled receptor alpha, G(alphai), suppressed CXCL8 levels in response to acidic pH; whereas phospholipase C inhibition had no effect on CXCL8. The use of specific mitogen-activated protein kinase (MAPK) signal transduction inhibitors indicated that the pH-dependent increase in CXCL8 mRNA is due to activation of ERK and p38 pathways. The JNK pathway was not involved. NF-kappaB inhibition resulted in a decrease in CXCL8 levels in hMSCs grown in non-OGM. However, OGM-differentiated hMSCs showed an increase in CXCL8 levels when treated with the NF-kappaB inhibitor PDTC, a pyrrolidine derivative of dithiocarbamate. 2008 Wiley-Liss, Inc.
Crystal structure of PrRh4.8B2
International Nuclear Information System (INIS)
Higashi, Iwami; Shishido, Toetsu; Takei, Humihiko; Kobayashi, Takaaki
1988-01-01
The crystal structure of a new rare earth ternary boride PrRh 4.8 B 2 was investigated, by single-crystal X-ray diffractometry. PrRh 4.8 B 2 crystallizes in the orthorhombic space group Immm with a = 9.697(4), b = 5.577(2), c = 25.64(3) A, Z=12. The intensity data were collected on a four-circle diffractometer with graphite-monochromatized Mo Kα radiation. The structure was solved by the Patterson method and refined with a full-matrix least-squares program to an R value (equal to Σvertical strokeΔFvertical stroke/Σvertical strokeF 0 vertical stroke) of 0.055 for 1176 reflections. (orig.)
INTERNAL-CYCLE VARIATION OF SOLAR DIFFERENTIAL ROTATION
International Nuclear Information System (INIS)
Li, K. J.; Xie, J. L.; Shi, X. J.
2013-01-01
The latitudinal distributions of the yearly mean rotation rates measured by Suzuki in 1998 and 2012 and Pulkkinen and Tuominen in 1998 are utilized to investigate internal-cycle variation of solar differential rotation. The rotation rate at the solar equator seems to have decreased since cycle 10 onward. The coefficient B of solar differential rotation, which represents the latitudinal gradient of rotation, is found to be smaller in the several years after the minimum of a solar cycle than in the several years after the maximum time of the cycle, and it peaks several years after the maximum time of the solar cycle. The internal-cycle variation of the solar rotation rates looks similar in profile to that of the coefficient B. A new explanation is proposed to address such a solar-cycle-related variation of the solar rotation rates. Weak magnetic fields may more effectively reflect differentiation at low latitudes with high rotation rates than at high latitudes with low rotation rates, and strong magnetic fields may more effectively repress differentiation at relatively low latitudes than at high latitudes. The internal-cycle variation is inferred as the result of both the latitudinal migration of the surface torsional pattern and the repression of strong magnetic activity in differentiation.
T helper-independent activation of human CD8+ cells: the role of CD28 costimulation.
Van Gool, S W; Zhang, Y; Kasran, A; de Boer, M; Ceuppens, J L
1996-07-01
The concept that activation of MHC class I-restricted CD8+ cells entirely depends on help from MHC class II-restricted CD4+ T cells has recently been supplemented with an alternative model in which CD8+ cells can directly be activated by MHC class I-expressing professional antigen-presenting cells (APC), which are able to deliver an accessory signal. The authors analysed the role of CD28-mediated costimulation for T helper cell-independent activation of purified human CD8+ T cells in two different in vitro models. Freshly isolated CD8+ cells could be activated (proliferation, IL-2 production and cytotoxic activity) by anti-CD3-presenting Fc gamma R+ mouse cells transfected with the human CD28 ligand, CD80, as the only accessory signal. On the other hand, activation of CD8+ cells by allogeneic MHC class I on EBV-transformed B cells, which express two different CD28 ligands, CD80 and CD86, also proceeded very efficiently (proliferation, cytotoxic activity and CD25 expression), but was either not, or only partially, blocked by anti-CD80 and anti-CD86 MoAb or CTLA-4Ig. This indicates that other costimulatory signals are also effective, and that CD28 triggering is not absolutely required for initial T-cell activation. CsA and CD80/CD86-blocking agents were synergistic in completely inhibiting activation of CD8+ cells in the MLR with allogeneic B-cell lines. This combination also induced non-responsiveness of CD8+ cells upon restimulation in the absence of blocking agents. Therefore, although professional APC can apparently provide multiple costimulatory signals for direct activation of CD8+ T cells, the signal derived from CD80/CD86 is unique in providing CsA-resistance.
Rotation of the Earth, solar activity and cosmic ray intensity
Energy Technology Data Exchange (ETDEWEB)
Barlyaeva, T.; Bard, E. [Aix-Marseille Univ., CNRS, IRD, Aix-en-Provence (France). CEREGE, College de France; Abarca-del-Rio, R. [Universidad de Concepcion (UDEC) (Chile). Dept. de Geofisica (DGEO)
2014-10-01
We analyse phase lags between the 11-year variations of three records: the semi-annual oscillation of the length of day (LOD), the solar activity (SA) and the cosmic ray intensity (CRI). The analysis was done for solar cycles 20-23. Observed relationships between LOD, CRI and SA are discussed separately for even and odd solar cycles. Phase lags were calculated using different methods (comparison of maximal points of cycles, maximal correlation coefficient, line of synchronization of cross-recurrence plots). We have found different phase lags between SA and CRI for even and odd solar cycles, confirming previous studies. The evolution of phase lags between SA and LOD as well as between CRI and LOD shows a positive trend with additional variations of phase lag values. For solar cycle 20, phase lags between SA and CRI, between SA and LOD, and between CRI and LOD were found to be negative. Overall, our study suggests that, if anything, the length of day could be influenced by solar irradiance rather than by cosmic rays.
Rotation of the Earth, solar activity and cosmic ray intensity
International Nuclear Information System (INIS)
Barlyaeva, T.; Bard, E.
2014-01-01
We analyse phase lags between the 11-year variations of three records: the semi-annual oscillation of the length of day (LOD), the solar activity (SA) and the cosmic ray intensity (CRI). The analysis was done for solar cycles 20-23. Observed relationships between LOD, CRI and SA are discussed separately for even and odd solar cycles. Phase lags were calculated using different methods (comparison of maximal points of cycles, maximal correlation coefficient, line of synchronization of cross-recurrence plots). We have found different phase lags between SA and CRI for even and odd solar cycles, confirming previous studies. The evolution of phase lags between SA and LOD as well as between CRI and LOD shows a positive trend with additional variations of phase lag values. For solar cycle 20, phase lags between SA and CRI, between SA and LOD, and between CRI and LOD were found to be negative. Overall, our study suggests that, if anything, the length of day could be influenced by solar irradiance rather than by cosmic rays.
Contributions to the understanding of the {sup 8}B proton halo question
Energy Technology Data Exchange (ETDEWEB)
Negoita, F.; Borcea, C.; Carstoiu, F. [Institute of Atomic Physics, Bucharest (Romania); Lewitowicz, M.; Saint-Laurent, M.G.; Anne, R.; Bazin, D.; Borrel, V.; Corre, J.M.; Roussel-Chomaz, P. [Grand Accelerateur National d`Ions Lourds (GANIL), 14 - Caen (France); and others
1996-12-31
The reaction cross section for {sup 8}B and {sup 7}Be and the break-up cross section for {sup 8}B on silicon have been measured. Secondary {sup 8}B and {sup 7}Be beams were obtained by use of the LISE spectrometer at GANIL. The separate contributions of diffraction dissociation and absorption to the breakup have been determined for the first time. The parallel momentum distribution of {sup 7}Be resulting from the break-up of {sup 8}B has also been determined. The data are compared to theoretical calculations. (author). 27 refs. Submitted to Physical Review, C (US).
Foothills Parkway Section 8B Final Environmental Report, Volume 2, Appendices A-C
Energy Technology Data Exchange (ETDEWEB)
Blasing, T.J.; Cada, G.F.; Carer, M.; Chin, S.M.; Dickerman, J.A.; Etnier, D.A.; Gibson, R.; Harvey, M.; Hatcher, B.; Lietzske, D.; Mann, L.K.; Mulholland, P.J.; Petrich, C.H.; Pounds, L.; Ranney, J.; Reed, R.M.; Ryan, P.F.; Schweitzer, M.; Smith, D.; Thomason, P.; Wade, M.C.
1999-07-01
In 1994, Oak Ridge National Laboratory (ORNL) was tasked by the National Park Service (NPS) to prepare an Environmental Report (ER) for Section 8B of the Foothills Parkway in the Great Smoky Mountains National Park (GSMNP). Section 8B represents 27.7 km (14.2 miles) of a total of 115 km (72 miles) of the planned Foothills Parkway and would connect the Cosby community on the east to the incorporated town of Pittman Center to the west. The major deliverables for the project are listed. From August 1995 through October 1996, NW, GSMNP, and ORNL staff interacted with Federal Highway Administration staff to develop a conceptual design plan for Section 8B with the intent of protecting critical resources identified during the ER process to the extent possible. In addition, ORNL arranged for bioengineering experts to discuss techniques that might be employed on Section 8B with NPS, GSMNP, and ORNL staff during September 1996. For the purposes of this EN there are two basic alternatives under consideration: (1) a build alternative and (2) a no-build alternative. Within the build alternative are a number of options including constructing Section 8B with no interchanges, constricting Section 8B with an interchange at SR 416 or U.S. 321, constructing Section 8B with a spur road on Webb Mountain, and considering operation of Section 8B both before and after the operation of Section 8C. The no-build alternative is considered the no-action alternative and is not to construct Section 8B. This volume of the ER, which consists of Appendices A, B, and C, assesses the potential geologic impacts of the proposed Section 8B construction, presents the results of the Section 8B soil survey, and describes the water quality studies and analyses performed for the ER. The following summary sections provide information for geology, soils, and water quality.
Medición y predicción de la radiación solar global UV-B bajo cielos claros y sin nubes
Directory of Open Access Journals (Sweden)
Jaime Wright Gilmore
2016-03-01
Full Text Available Se presentan mediciones experimentales de la radiación solar ultravioleta en el rango B del espectro solar (UV-B y la radiación ultravioleta en el rango total RUV (UV-A+UV-B en días claros y sin nubes en Heredia, Costa Rica. Se utilizó una radiómetro UV-B, que mide la radiación solar en el rango espectral 280-315 nm, y un radiómetro RUV, que mide la radiación solar en el rango espectral 280-385 nm. La dependencia entre entre UV-B y RUV también fue investigada, y se encontró un excelente grado de asociación entre ambas. Además se detalló que UV-B representa solamente un 5,4% de RUV, a pesar de que UV-B es mil veces más potente que UV-A. Los valores de UV-B medidos in situ fueron comparados con los valores predichos por un modelo atmosférico espectral, el cual utiliza como datos de entrada: la hora del día, la latitud, la altitud, el albedo superficial, la distancia Tierra-Sol, la turbiedad atmosférica y el ozono atmosférico. La comparación entre los valores medidos y predichos dio resultados satisfactorios.
Directory of Open Access Journals (Sweden)
Lorenza Tulli
2018-03-01
Full Text Available Toll-like receptors (TLRs play a key role in the activation of innate immune cells, in which their engagement leads to production of cytokines and co-stimulatory molecules. TLRs signaling requires recruitment of toll/IL-1R (TIR domain-containing adaptors, such as MyD88 and/or TRIF, and leads to activation of several transcription factors, such as NF-κB, the AP1 complex, and various members of the interferon regulatory factor (IRF family, which in turn results in triggering of several cellular functions associated with these receptors. A role for Src family kinases (SFKs in this signaling pathway has also been established. Our work and that of others have shown that this type of kinases is activated following engagement of several TLRs, and that this event is essential for the initiation of specific downstream cellular response. In particular, we have previously demonstrated that activation of SFKs is required for balanced production of pro-inflammatory cytokines by monocyte-derived dendritic cells after stimulation with R848, an agonist of human TLRs 7/8. We also showed that TLR7/8 triggering leads to an increase in interferon regulatory factor 1 (IRF-1 protein levels and that this effect is abolished by inhibition of SFKs, suggesting a critical role of these kinases in IRF-1 regulation. In this study, we first confirmed the key role of SFKs in TLR7/8 signaling for cytokine production and accumulation of IRF-1 protein in monocytes and in B lymphocytes, two other type of antigen-presenting cells. Then, we demonstrate that TLR7 triggering leads to an increase of K63-linked ubiquitination of IRF-1, which is prevented by SFKs inhibition, suggesting a key role of these kinases in posttranslational regulation of IRF-1 in the immune cells. In order to understand the mechanism that links SFKs activation to IRF-1 K63-linked ubiquitination, we examined SFKs and IRF-1 possible interactors and proved that activation of SFKs is necessary for their
Directory of Open Access Journals (Sweden)
Chibueze Chioma Ezinne
Full Text Available CD8+ T cell response is important in the response to viral infections; this response though is regulated by inhibitory receptors. Expression of inhibitory receptors has been positively correlated with CD8+ T cell exhaustion; the consequent effect of simultaneous blockade of these inhibitory receptors on CD8+ T cell response in viral infections have been studied, however, the role of individual blockade of receptor-ligand pair is unclear. 2B4/CD48 interaction is involved in CD8+T cell regulation, its signal transducer SAP (signaling lymphocyte activation molecule (SLAM-associated protein is required for stimulatory function of 2B4/CD244 on lymphocytes hence, we analyzed 2B4/CD244 (natural killer cell receptor and SAP (signaling lymphocyte activation molecule(SLAM-associated protein on total CD8+ and HTLV-1 specific CD8+T cells in HTLV-1 infection and the effect of blockade of interaction with ligand CD48 on HTLV-1 specific CD8+ T cell function. We observed a high expression of 2B4/CD244 on CD8+ T cells relative to uninfected and further upregulation on HTLV-1 specific CD8+ T cells. 2B4+ CD8+ T cells exhibited more of an effector and terminally differentiated memory phenotype. Blockade of 2B4/CD48 interaction resulted in improvement in function via perforin expression and degranulation as measured by CD107a surface mobilization on HTLV-1 specific CD8+ T cells. In the light of these findings, we thus propose an inhibitory role for 2B4/CD48 interaction on CD8+T cell function.
Pc3 activity at low geomagnetic latitudes - A comparison with solar wind observations
Villante, U.; Lepidi, S.; Vellante, M.; Lazarus, A. J.; Lepping, R. P.
1992-01-01
On an hourly time-scale the different roles of the solar wind and interplanetary magnetic field (IMF) parameters on ground micropulsation activity can be better investigated than at longer time-scales. A long-term comparison between ground measurements made at L'Aquila and IMP 8 observations confirms the solar wind speed as the key parameter for the onset of pulsations even at low latitudes, although additional control of the energy transfer from the interplanetary medium to the earth's magnetosphere is clearly exerted by the cone angle. Above about 20 mHz the frequency of pulsations is confirmed to be closely related to the IMF magnitude while, in agreement with model predictions, the IMF magnitude is related to the amplitude of the local fundamental resonant mode. We provide an interesting example in which high resolution measurements simultaneously obtained in the foreshock region and on the ground show that external transversal fluctuations do not penetrate deep into the low latitude magnetosphere.
International Nuclear Information System (INIS)
Hedeman, E.R.; Dodson, H.W.; Roelof, E.C.
1981-08-01
The richness and diversity of data relating to solar activity present a challenge from the point of view of organization and evaluation. For phenomena such as plages and centers of activity that tend to last for more than one solar rotation, a sequence of evolutionary charts based on heliographic longitude for successive solar rotations are discussed. Such a diagrammatic representation of calcium plages as a function of longitude and time, coupled with considerations of heliographic latitude, permits relatively easy and confident recognition of successively returning centers of activity
International Nuclear Information System (INIS)
Lee, Hwa-Jeong; Lee, Jun; Lee, Sun-Kyung; Lee, Suk-Keun; Kim, Eun-Cheol
2007-01-01
Interleukin-8 (IL-8) is a cytokine that plays an important role in tumor progression in a variety of cancer types; however, its regulation is not well understood in oral cancer cells. In the present study, we examined the expression and mechanism of IL-8 in which it is involved by treating immortalized (IHOK) and malignant human oral keratinocytes (HN12) cells with deferoxamine (DFO). IL-8 production was measured by an enzyme-linked immunoabsorbent assay and reverse transcriptase-polymerase chain reaction (RT-PCR) analysis. Electrophoretic mobility shift assays was used to determine NF-κB binding activity. Phosphorylation and degradation of the I-κB were analyized by Western blot. IHOK cells incubated with DFO showed increased expression of IL-8 mRNA, as well as higher release of the IL-8 protein. The up-regulation of DFO-induced IL-8 expression was higher in IHOK cells than in HN12 cells and was concentration-dependent. DFO acted additively with IL-1β to strongly up-regulate IL-8 in IHOK cells but not in HN12 cells. Accordingly, selective p38 and ERK1/2 inhibitors for both kinases abolished DFO-induced IL-8 expression in both IHOK and HN12 cells. Furthermore, DFO induced the degradation and phosphorylation of IκB, and activation of NF-κB. The IL-8 inducing effects of DFO were mediated by a nitric oxide donor (S-nitrosoglutathione), and by pyrrolidine dithiocarbamate, an inhibitor of NF-κB, as well as by wortmannin, which inhibits the phosphatidylinositol 3-kinase-dependent activation of NAD(P)H oxidase. This results demonstrate that DFO-induced IL-8 acts via multiple signaling pathways in immortalized and malignant oral keratinocytes, and that the control of IL-8 may be an important target for immunotheraphy against human oral premalignant lesions
Geometry of solar corona expansion and solar wind parameters
International Nuclear Information System (INIS)
Krajnev, M.B.
1980-01-01
The character of the parameter chanqe of solar wind plasma in the region of the Earth orbit is studied. The main regularities in the parametep behaviour of solar wind (plasma velocity and density) are qualitatively explained in the framework of a model according to which solar corona expansion stronqly differs from radial expansion, that is: the solar wind current lines are focused towards helioequator during the period of low solar activity with gradual transfer to radial expansion during the years of high solar activity. It is shown that the geometry of the solar wind current tubes and its change with the solar activity cycle can not serve an explanation of the observed change of the solar wind parameters
Tsurutani, Bruce T.; Echer, Ezequiel; Guarnieri, Fernando L.; Kozyra, J. U.
2008-01-01
The complex interplanetary structures during 7 to 8 Nov 2004 are analyzed to identify their properties as well as resultant geomagnetic effects and the solar origins. Three fast forward shocks, three directional discontinuities and two reverse waves were detected and analyzed in detail. The three fast forward shocks 'pump' up the interplanetary magnetic field from a value of approx.4 nT to 44 nT. However, the fields after the shocks were northward, and magnetic storms did not result. The three ram pressure increases were associated with major sudden impulses (SI + s) at Earth. A magnetic cloud followed the third forward shock and the southward Bz associated with the latter was responsible for the superstorm. Two reverse waves were detected, one at the edge and one near the center of the magnetic cloud (MC). It is suspected that these 'waves' were once reverse shocks which were becoming evanescent when they propagated into the low plasma beta MC. The second reverse wave caused a decrease in the southward component of the IMF and initiated the storm recovery phase. It is determined that flares located at large longitudinal distances from the subsolar point were the most likely causes of the first two shocks without associated magnetic clouds. It is thus unlikely that the shocks were 'blast waves' or that magnetic reconnection eroded away the two associated MCs. This interplanetary/solar event is an example of the extremely complex magnetic storms which can occur in the post-solar maximum phase.
Responses of Solar Irradiance and the Ionosphere to an Intense Activity Region
Chen, Yiding; Liu, Libo; Le, Huijun; Wan, Weixing
2018-03-01
Solar rotation (SR) variation dominates solar extremely ultraviolet (EUV) changes on the timescale of days. The F10.7 index is usually used as an indicator for solar EUV. The SR variation of F10.7 significantly enhanced during the 2008th-2009th Carrington rotations (CRs) owing to an intense active region; F10.7 increased about 180 units during that SR period. That was the most prominent SR variation of F10.7 during solar cycle 23. In this paper, global electron content (GEC) is used to investigate ionospheric response to that strong variation of solar irradiance indicated by F10.7. The variation of GEC with F10.7 was anomalous (GEC-F10.7 slope significantly decreased) during the 2008th-2009th CRs; however, GEC versus EUV variation during that period was consistent with that during adjacent time intervals when using Solar Heliospheric Observatory/Solar EUV Monitor 26-34 nm EUV measurements. The reason is that F10.7 response to that intense active region was much stronger than EUV response; thus, the EUV-F10.7 slope decreased. We confirmed decreased EUV-F10.7 slope during the 2008th-2009th CRs for different wavelengths within 27-120 nm using Thermosphere, Ionosphere, Mesosphere Energetics and Dynamics/Solar EUV Experiment high spectral resolution EUV measurements. And on the basis of Solar Heliospheric Observatory/Solar EUV Monitor EUV measurements during solar cycle 23, we further presented that EUV-F10.7 slope statistically tends to decrease when the SR variation of F10.7 significantly enhances. Moreover, we found that ionospheric time lag effect to EUV is exaggerated when using F10.7, owing to the time lag effect of EUV to F10.7.
Effects of sublethal gamma radiation on T and B cell activity in the antibody response of mice
International Nuclear Information System (INIS)
Carlson, D.E.; Lubet, R.A.
1976-01-01
The relative radiosensitivity of T and B cells was followed in sublethally irradiated mice reconstituted with bone marrow cells, thymus cells, or both, and simultaneously challenged with sheep erythrocytes. Numbers of antibody-forming cells in recipient spleens were determined on days 4 to 8. In this assay the response of mice given bone marrow cells was limited by the amount of residual T cell activity, while the response of mice given thymus cells was limited by the residual B cell activity. Although residual activity of both T and B cells was suppressed in mice given 300 to 700 rad at 80 rad/min, residual B cell activity was consistently lower in these animals. When antibody responses were initiated at intervals after irradiation, B cell activity was clearly limiting by 48 hr after 500 or 600 rad. The activity of both T and B cells was sensitive to differences in dose rate between 8 and 80 rad/min. The 4 to 7 fold dose-rate sensitivity of T cells paralleled that of differentially irradiated nonreconstituted mice. In contrast, dose-rate dependence of B cell activity varied from 10- to 20-fold between 8 and 80 rad/min. These results suggest that radiation suppression of antibody responses in mice is highly dependent upon B cell sensitivity, and that dose-rate dependence of the antibody response may be explained in large part by differential sensitivity of B cells
Solar collector wall with active curtain system; Lasikatteinen massiivienen aurinkokeraeaejaeseinae
Energy Technology Data Exchange (ETDEWEB)
Ojanen, T.; Heimonen, I. [VTT Building Technology, Espoo (Finland). Building Physics, Building Services and Fire Technology
1998-12-01
Integration of solar collector into the building envelope structure brings many advantages. The disadvantage of a passive solar collector wall is that its thermal performance can not be controlled, which may cause temporary overheating and low thermal efficiency of the collector. The thermal performance of the collector wall can be improved by using controllable, active collector systems. In this paper a solar collector wall with a controllable curtain between the transparent and absorption layers is investigated. The curtain is made of several low-emissivity foil layers, which ensures low radiation heat transfer through the curtain. The curtain decreases the heat losses out from the collector wall and it improves the U-value of the wall. The curtain is used when the solar radiation intensity to the wall is not high enough or when the wall needs protection against overheating during warm weather conditions. The materials and building components used in the collector wall, except those of the curtain, are ordinary in buildings. The transparent layer can be made by using normal glazing technology and the thermal storage layer can be made out of brick or similar material. The solar energy gains through the glazing can be utilised better than in passive systems, because the curtain provides the wall with high thermal resistance outside the solar radiation periods. The thermal performance of the collector wall was studied experimentally using a Hot-Box apparatus equipped with a solar lamp. Numerical simulations were carried out to study the yearly performance of the collector wall under real climate conditions. The objectives were to determine the thermal performance of the collector wall and to study how to optimise the use of solar radiation in this system. When the curtain with high thermal resistance is used actively, the temperature level of the thermal storage layer in the wall is relatively high also during dark periods and the heat losses out from the storage
Kepa, Anna; Gburek, Szymon; Siarkowski, Marek; Sylwester, Barbara; Sylwester, Janusz; Kowalinski, Miroslaw
SphinX is a high-sensitivity soft X-ray spectrophotometer which measures soft X-ray spectra in the energy range between 0.8 keV and 15 keV. From February to November 2009 the instrument has observed unusually quiet solar coronal emission as well as a number of weak solar flares. Based on SphinX spectra it is possible to study the differential emission measure distributions (DEM) in the temperature range roughly between 1 MK and 10 MK. The aim of the present study is to unveil DEM plasma distributions for selected activity conditions and analyze their variability.
Foothills Parkway Section 8B Final Environmental Report, Volume 6, Appendix N
Energy Technology Data Exchange (ETDEWEB)
Blasing, T.J.; Cada, G.F.; Carer, M.; Chin, S.M.; Dickerman, J.A.; Etnier, D.A.; Gibson, R.; Harvey, M.; Hatcher, B.; Lietzske, D.; Mann, L.K.; Mulholland, P.J.; Petrich, C.H.; Pounds, L.; Ranney, J.; Reed, R.M.; Ryan, P.F.; Schweitzer, M.; Smith, D.; Thomason, P.; Wade, M.C.
1999-07-01
In 1994, Oak Ridge National Laboratory (ORNL) was tasked by the National Park Service (NPS) to prepare an Environmental Report (ER) for Section 8B of the Foothills Parkway in the Great Smoky Mountains National Park (GSMNP). Section 8B represents 27.7 km (14.2 miles) of a total of 115 km (72 miles) of the planned Foothills Parkway and would connect the Cosby community on the east to the incorporated town of Pittman Center to the west. The major deliverables for the project are listed. From August 1995 through October 1996, NPS, GSMNP, and ORNL staff interacted with Federal Highway Administration staff to develop a conceptual design plan for Section 8B with the intent of protecting critical resources identified during the ER process to the extent possible. In addition, ORNL arranged for bioengineering experts to discuss techniques that might be employed on Section 8B with NPS, GSMNP, and ORNL staff during September 1996. For the purposes of this ER, there are two basic alternatives under consideration: (1) a build alternative and (2) a no-build alternative. Within the build alternative are a number of options including constructing Section 8B with no interchanges, constructing Section 8B with an interchange at SR 416 or U.S. 321, constructing Section 8B with a spur road on Webb Mountain, and considering operation of Section 8B both before and after the operation of Section 8C. The no-build alternative is considered the no-action alternative and is not to construct Section 8B. This volume of the ER documents the results of the architectural, historical, and cultural resources assessment for the entire Section 8B ROW that was completed in May 1995 to document the architectural, historical, and cultural resources located within the project area. The assessment included evaluation of the potential for cultural (i.e., rural historic) landscapes in the area of the ROW. The assessment showed that one National Register-listed property is located 0.3 mile south of the ROW
Complex active regions as the main source of extreme and large solar proton events
Ishkov, V. N.
2013-12-01
A study of solar proton sources indicated that solar flare events responsible for ≥2000 pfu proton fluxes mostly occur in complex active regions (CARs), i.e., in transition structures between active regions and activity complexes. Different classes of similar structures and their relation to solar proton events (SPEs) and evolution, depending on the origination conditions, are considered. Arguments in favor of the fact that sunspot groups with extreme dimensions are CARs are presented. An analysis of the flare activity in a CAR resulted in the detection of "physical" boundaries, which separate magnetic structures of the same polarity and are responsible for the independent development of each structure.
Energy Technology Data Exchange (ETDEWEB)
Awasthi, Arun Kumar [Astronomical Institute, University of Wroclaw, Wroclaw (Poland); Sylwester, Barbara; Sylwester, Janusz [Solar Physics Division, Space Research Centre, Polish Academy of Sciences, Wroclaw (Poland); Jain, Rajmal, E-mail: arun.awasthi.87@gmail.com, E-mail: awasthi@astro.uni.wroc.pl [Kadi Sarva Vishwavidyalaya, Gandhinagar, Gujarat (India)
2016-06-01
We investigate the evolution of the differential emission measure distribution (DEM[ T ]) in various phases of a B8.3 flare which occurred on 2009 July 04. We analyze the soft X-ray (SXR) emission in the 1.6–8.0 keV range, recorded collectively by the Solar Photometer in X-rays (SphinX; Polish) and the Solar X-ray Spectrometer (Indian) instruments. We conduct a comparative investigation of the best-fit DEM[ T ] distributions derived by employing various inversion schemes, namely, single Gaussian, power-law functions and a Withbroe–Sylwester (W–S) maximum likelihood algorithm. In addition, the SXR spectrum in three different energy bands, that is, 1.6–5.0 keV (low), 5.0–8.0 keV (high), and 1.6–8.0 keV (combined), is analyzed to determine the dependence of the best-fit DEM[ T ] distribution on the selection of the energy interval. The evolution of the DEM[ T ] distribution, derived using a W–S algorithm, reveals multi-thermal plasma during the rise to the maximum phase of the flare, and isothermal plasma in the post-maximum phase of the flare. The thermal energy content is estimated by considering the flare plasma to be (1) isothermal and (2) multi-thermal in nature. We find that the energy content during the flare, estimated using the multi-thermal approach, is in good agreement with that derived using the isothermal assumption, except during the flare maximum. Furthermore, the (multi-) thermal energy estimated while employing the low-energy band of the SXR spectrum results in higher values than that derived from the combined energy band. On the contrary, the analysis of the high-energy band of the SXR spectrum leads to lower thermal energy than that estimated from the combined energy band.
Solar and terrestrial physics. [effects of solar activities on earth environment
1975-01-01
The effects of solar radiation on the near space and biomental earth, the upper atmosphere, and the magnetosphere are discussed. Data obtained from the OSO satellites pertaining to the solar cycle variation of extreme ultraviolet (EUV) radiation are analyzed. The effects of solar cycle variation of the characteristics of the solar wind are examined. The fluid mechanics of shock waves and the specific relationship to the characteristics of solar shock waves are investigated. The solar and corpuscular heating of the upper atmosphere is reported based on the findings of the AEROS and NATE experiments. Seasonal variations of the upper atmosphere composition are plotted based on OGO-6 mass spectrometer data.
Solar India - 82: national solar energy convention
Energy Technology Data Exchange (ETDEWEB)
1982-01-01
This document is the proceedings of the Solar India - 82 conference, which was held 17-19 December 1982. The papers are organized into functional groupings which include: (1) solar radiation, (2) flat plate solar collectors and solar water heaters, (3) solar concentrators, (4) solar air heaters and dryers, (5) solar ponds and energy storage, (6) solar cookers, (7) solar stills, (8) selective coatings, (9) photovoltaics, (10) space heating and cooling, (11) bio-energy, and (12) miscellaneous papers. The vast majority of the papers describe work carried out in India, the vast majority of the papers also contain relatively readable abstracts.
Hands-on Activities for Exploring the Solar System in K-14 Formal and Informal Education Settings
Allen, J. S.; Tobola, K. W.
2004-12-01
Introduction: Activities developed by NASA scientists and teachers focus on integrating Planetary Science activities with existing Earth science, math, and language arts curriculum. Educators may choose activities that fit a particular concept or theme within their curriculum from activities that highlight missions and research pertaining to exploring the solar system. Most of the activities use simple, inexpensive techniques that help students understand the how and why of what scientists are learning about comets, asteroids, meteorites, moons and planets. The web sites for the activities contain current information so students experience recent mission information such as data from Mars rovers or the status of Stardust sample return. The Johnson Space Center Astromaterials Research and Exploration Science education team has compiled a variety of NASA solar system activities to produce an annotated thematic syllabus useful to classroom educators and informal educators as they teach space science. An important aspect of the syllabus is that it highlights appropriate science content information and key science and math concepts so educators can easily identify activities that will enhance curriculum development. The outline contains URLs for the activities and NASA educator guides as well as links to NASA mission science and technology. In the informal setting, educators can use solar system exploration activities to reinforce learning in association with thematic displays, planetarium programs, youth group gatherings, or community events. In both the informal and the primary education levels the activities are appropriately designed to excite interest, arouse curiosity and easily take the participants from pre-awareness to the awareness stage. Middle school educators will find activities that enhance thematic science and encourage students to think about the scientific process of investigation. Some of the activities offered may easily be adapted for the upper
DEFF Research Database (Denmark)
Vejen, Niels Kristian
1999-01-01
A solar heating system for space heating and domestic hot water supply from "Sol&Træ A.m.b.a." was tested in a laboratory test facility.......A solar heating system for space heating and domestic hot water supply from "Sol&Træ A.m.b.a." was tested in a laboratory test facility....
Solar Energy Education. Humanities: activities and teacher's guide. Field test edition
Energy Technology Data Exchange (ETDEWEB)
1982-01-01
Activities are outlined to introduce students to information on solar energy while performing ordinary classroom work. In this teaching manual solar energy is integrated with the humanities. The activities include such things as stories, newspapers, writing assignments, and art and musical presentations all filled with energy related terms. An energy glossary is provided. (BCS)
Multi-parametric Effect of Solar Activity on Cosmic Rays V. K. Mishra ...
Indian Academy of Sciences (India)
Key words. Sun—solar parameters—cosmic ray modulation—running ... Neutron monitors are most sensitive to cosmic rays in the energy range. 0.5–20 GeV ... been considered as a primary indicator to define the level of solar activity, which.
Foothills Parkway Section 8B Final Environmental Report, Volume 3, Appendix D
Energy Technology Data Exchange (ETDEWEB)
Blasing, T.J.; Cada, G.F.; Carer, M.; Chin, S.M.; Dickerman, J.A.; Etnier, D.A.; Gibson, R.; Harvey, M.; Hatcher, B.; Lietzske, D.; Mann, L.K.; Mulholland, P.J.; Petrich, C.H.; Pounds, L.; Ranney, J.; Reed, R.M.; Ryan, P.F.; Schweitzer, M.; Smith, D.; Thomason, P.; Wade, M.C.
1999-07-01
In 1994, Oak Ridge National Laboratory (ORNL) was tasked by the National Park Service (NPS) to prepare an Environmental Report (ER) for Section 8B of the Foothills Parkway in the Great Smoky Mountains National Park (GSMNP). Section 8B represents 27.7 km (14.2 miles) of a total of 115 km (72 miles) of the planned Foothills Parkway and would connect the Cosby community on the east to the incorporated town of Pittman Center to the west. The major deliverables for the project are listed. From August 1995 through October 1996, NPS, GSMNP, and ORNL staff interacted with Federal Highway Administration staff to develop a conceptual design plan for Section 8B with the intent of protecting critical resources identified during the ER process to the extent possible. In addition, ORNL arranged for bioengineering experts to discuss techniques that might be employed on Section 8B with NPS, GSMNP, and ORNL staff during September 1996. For the purposes of this ER, there are two basic alternatives under consideration: (1) a build alternative and (2) a no-build alternative. Within the build alternative are a number of options including constructing Section 8B with no interchanges, constructing Section 8B with an interchange at SR416 or U.S. 321, constructing Section 8B with a spur road on Webb Mountain, and considering operation of Section 8B both before and after the operation of Section 8C. The no-build alternative is considered the no-action alternative and is not to construct Section 8B. This volume of the ER inventories the fishes and benthic macroinvertebrates inhabiting the aquatic ecosystems potentially affected by the proposed construction of Section 8B. Stream biological surveys were completed at 31 stream sites during the Fall of 1994. The sampling strategy for both invertebrates and fish was to survey the different taxa from all available habitats. For benthic invertebrates, a standardized qualitative manual collection technique was employed for all 31 stations. For fish
International Nuclear Information System (INIS)
Tylka, Allan J.; Dietrich, William F.
1999-01-01
In more than 25 years of almost continuous observations, the University of Chicago's Cosmic Ray Telescope (CRT) on IMP-8 has amassed a unique database on high-energy solar heavy ions of potential relevance to manned spaceflight. In the very largest particle events, IMP-8/CRT has even observed solar Fe ions above the Galactic cosmic ray background up to ∼800 MeV/nucleon, an energy sufficiently high to penetrate nearly 25 g/cm 2 of shielding. IMP-8/CRT observations show that high-energy heavy-ion spectra are often surprisingly hard power laws, without the exponential roll-offs suggested by stochastic acceleration fits to lower energy measurements alone. Also, in many solar particle events the Fe/O ratio grows with increasing energy, contrary to the notion that ions with higher mass-to-charge ratios should be less abundant at higher energies. Previous studies of radiation hazards for manned spaceflight have often assumed heavy-ion composition and steeply-falling energy spectra inconsistent with these observations. Conclusions based on such studies should therefore be re-assessed. The significant event-to-event variability observed in the high-energy solar heavy ions also has important implications for strategies in building probabilistic models of solar particle radiation hazards
Suematsu, Y.; Katsukawa, Y.; Shimizu, T.; Ichimoto, K.; Horiuchi, T.; Matsumoto, Y.; Takeyama, N.
2017-11-01
order of magnitude more photons than SOT, relatively shorter telescope length of 2.8 m to accommodate a launcher's nosecone size for possible dual-satellite-launch configuration, and much wider observing wavelength from UV (down to 250 nm) through near IR (up to 1100 nm). The large aperture is essentially important to attain scientific goals of the plan-B, especially for accurate diagnostics of the dynamic solar chromosphere as revealed by Hinode, although this make it difficult to design the telescope because of ten times more solar heat load introduced into the telescope. The SUVIT consists of two optically separable components; the telescope assembly (TA) and an accompanying focal plane package equipped with filtergraphs and spectrographs. Opto-mechanical and -thermal performance of the TA is crucial to attain high-quality solar observations and here we present a status of feasible study in its optical and thermal designing for diffraction-limited performance at visible wavelength in a reasonably wide field of view.
IUE observations of the chromospheric activity-age relation in young solar-type stars
International Nuclear Information System (INIS)
Simon, T.; Boesgaard, A.M.
1983-01-01
Except for the synoptic observations of the chromospheric Ca II H-K lines by Wilson (1978), in which he sought evidence for magnetic activity cycles, there is still scant data on stellar activity, especially at UV and X-ray wavelengths where 10 5 K TRs and 10 6 - 10 7 K coronae are expected to radiate. This paper presents new UV data, obtained with the IUE spacecraft, for a dozen solar-type stars in the field. The stars are of spectral type F6 V - G1 V; on the basis of their high Li content, they range in age from 0.1 to 2.8 Gyr. The purpose is to study the evolution of TR and chromospheric emission with stellar age, and also the surface distribution of magnetically active regions as revealed by rotational modulation of UV emission line fluxes. (Auth.)
Activated graphene nanoplatelets as a counter electrode for dye-sensitized solar cells
Energy Technology Data Exchange (ETDEWEB)
Gong, Jiawei [Center for Advanced Photovoltaics, Department of Electrical Engineering, South Dakota State University, Brookings, South Dakota 57007 (United States); Department of Mechanical Engineering, North Dakota State University, Fargo, North Dakota 58102 (United States); Zhou, Zhengping; Qiao, Qiquan, E-mail: qiquan.qiao@sdstate.edu [Center for Advanced Photovoltaics, Department of Electrical Engineering, South Dakota State University, Brookings, South Dakota 57007 (United States); Sumathy, K. [Department of Mechanical Engineering, North Dakota State University, Fargo, North Dakota 58102 (United States); Yang, Huojun [Department of Construction Management and Engineering, North Dakota State University, Fargo, North Dakota 58102 (United States)
2016-04-07
Activated graphene nanoplatelets (aGNPs) prepared by a hydrothermal method using KOH as activating agent were used as counter electrode for high efficiency dye-sensitized solar cells (DSSCs). After the KOH activation, the scanning electron microscopy image shows that aGNPs demonstrate a more curled, rough, and porous morphology which could contain both micro- and mesopores. The KOH activation changed the stacked layers of GNPs to a more crumpled and curved morphology. The microstructure of large pores significantly increased the electrode surface area and roughness, leading to the high electrocatalytic activity for triiodide reduction at the counter electrode. The DSSCs fabricated using aGNP as counter electrodes were tested under standard AM 1.5 illumination with an intensity of 91.5 mW/cm{sup 2}. The device achieved an overall power conversion efficiency of 7.7%, which is comparable to the conventional platinum counter electrode (8%). Therefore, the low cost and high performance aGNP based counter electrode is a promising alternative to conventional Pt counter electrode in DSSCs.
Solar activity and its evolution across the corona: recent advances
Directory of Open Access Journals (Sweden)
Rodriguez Luciano
2013-04-01
Full Text Available Solar magnetism is responsible for the several active phenomena that occur in the solar atmosphere. The consequences of these phenomena on the solar-terrestrial environment and on Space Weather are nowadays clearly recognized, even if not yet fully understood. In order to shed light on the mechanisms that are at the basis of the Space Weather, it is necessary to investigate the sequence of phenomena starting in the solar atmosphere and developing across the outer layers of the Sun and along the path from the Sun to the Earth. This goal can be reached by a combined multi-disciplinary, multi-instrument, multi-wavelength study of these phenomena, starting with the very first manifestation of solar active region formation and evolution, followed by explosive phenomena (i.e., flares, erupting prominences, coronal mass ejections, and ending with the interaction of plasma magnetized clouds expelled from the Sun with the interplanetary magnetic field and medium. This wide field of research constitutes one of the main aims of COST Action ES0803: Developing Space Weather products and services in Europe. In particular, one of the tasks of this COST Action was to investigate the Progress in Scientific Understanding of Space Weather. In this paper we review the state of the art of our comprehension of some phenomena that, in the scenario outlined above, might have a role on Space Weather, focusing on the researches, thematic reviews, and main results obtained during the COST Action ES0803.
Kazemifard, Sholeh; Naji, Leila; Afshar Taromi, Faramarz
2018-04-01
Ternary blend (TB) strategy has been considered as an effective method to enhance the photovoltaic performance of bulk heterojunction (BHJ) polymer solar cells (PSCs). Here, we report on TB-based PSCs containing two donor materials; poly-3-hexylthiophene (P3HT) and Rhodamine B (RhB) laser organic dye, and [6,6]-phenyl C 61 butyric acid methyl ester (PC 61 BM) as an acceptor. The influence of RhB weight percentage and injection volume was extensively studied. To gain insight into the influences of RhB on the photovoltaic performance of PSCs, physicochemical and optical properties of TBs were compared with those of BHJ binary blend as a standard. RhB broadened the light absorption properties of the active layer and played a bridging role between P3HT and PC 61 BM. The PCE and short-circuit current density (Jsc) of the optimized TB-based PSCs comprising of 0.5 wt% RhB reached 5% and 12.12 mA/cm 2 , respectively. Compared to BHJ standard cell, the PCE and the generated current was improved by two orders of magnitude due to higher photon harvest of the active layer, cascade energy level structure of TB components and a considerable decrease in the charge carrier recombination. The results suggest that RhB can be considered as an effective material for application in PSCs to attain high photovoltaic performance. Copyright © 2018 Elsevier Inc. All rights reserved.
Multi-station investigation of spread F over Europe during low to high solar activity
Czech Academy of Sciences Publication Activity Database
Paul, K.S.; Haralambous, H.; Oikonomou, Ch.; Paul, A.; Belehaki, A.; Tsagouri, I.; Kouba, Daniel; Burešová, Dalia
2018-01-01
Roč. 8, A27 (2018), č. článku A27. ISSN 2115-7251 R&D Projects: GA ČR(CZ) GC15-07281J Institutional support: RVO:68378289 Keywords : nighttime midlatitude ionosphere over Europe * effects of solar activity over spread F occurrence * longitudinal and latitudinal dependence of spread F occurrence Subject RIV: BL - Plasma and Gas Discharge Physics OBOR OECD: Fluids and plasma physics (including surface physics) Impact factor: 2.446, year: 2016 https://www.swsc-journal.org/articles/swsc/full_html/2018/01/swsc170091/swsc170091.html
Radiocarbon evidence for low frequency solar oscillations
International Nuclear Information System (INIS)
Damon, P.E.; Jirikowic, I.
1992-01-01
From the spectrum of Δ 14 C variations attributed to solar activity modulation of cosmogenic isotope production, a long-period variation (the Hallstattzeit) of 2120±20 years was deduced with 93% statistical confidence. Although most Hallstattzeit harmonic overtones may be shape-related, two also behave as fundamentals: that of 212 years (Suess) and of 88 years (Gleissberg). These exceptional harmonic overtones modulate the 11-year Schwabe solar cycle determined from indices of sunspots. The Hallstattzeit period may be associated with dramatic secular changes in solar behavior. Sun-like stars exhibit quiet and active states consistent with such long-period secular variations. The climate impact of solar output changes may partially explain periods of rapid climate change such as the Little Ice Age associated with 14 C anomalies. (author) 9 tabs., 8 figs., 23 refs
Krause, G Heinrich; Jahns, Peter; Virgo, Aurelio; García, Milton; Aranda, Jorge; Wellmann, Eckard; Winter, Klaus
2007-10-01
Seedlings of two late-successional tropical rainforest tree species, Tetragastris panamensis (Engler) O. Kuntze and Calophyllum longifolium (Willd.), were field grown for 3-4 months at an open site near Panama City (9 degrees N), Panama, under plastic films that either transmitted or excluded most solar UV-B radiation. Experiments were designed to test whether leaves developing under bright sunlight with strongly reduced UV-B are capable of acclimating to near-ambient UV-B conditions. Leaves of T. panamensis that developed under near-ambient UV-B contained higher amounts of UV-absorbing substances than leaves of seedlings grown under reduced UV-B. Photosynthetic pigment composition, content of alpha-tocopherol, CO(2) assimilation, potential photosystem II (PSII) efficiency (evaluated by F(v)/F(m) ratios) and growth of T. panamensis and C. longifolium did not differ between seedlings developed under near-ambient and reduced solar UV-B. When seedlings were transferred from the reduced UV-B treatment to the near-ambient UV-B treatment, a pronounced inhibition of photosynthetic capacity was observed initially in both species. UV-B-mediated inhibition of photosynthetic capacity nearly fully recovered within 1 week of the transfer in C. longifolium, whereas in T. panamensis an about 35% reduced capacity of CO(2) uptake was maintained. A marked increase in UV-absorbing substances was observed in foliage of transferred T. panamensis seedlings. Both species exhibited enhanced mid-day photoinhibition of PSII immediately after being transferred from the reduced UV-B to the near-ambient UV-B treatment. This effect was fully reversible within 1d in T. panamensis and within a few days in C. longifolium. The data show that leaves of these tropical tree seedlings, when developing in full-spectrum sunlight, are effectively protected against high solar UV-B radiation. In contrast, leaves developing under conditions of low UV-B lacked sufficient UV protection. They experienced a
Life cycle cost analysis of single slope hybrid (PV/T) active solar still
International Nuclear Information System (INIS)
Kumar, Shiv; Tiwari, G.N.
2009-01-01
This paper presents the life cycle cost analysis of the single slope passive and hybrid photovoltaic (PV/T) active solar stills, based on the annual performance at 0.05 m water depth. Effects of various parameters, namely interest rate, life of the system and the maintenance cost have been taken into account. The comparative cost of distilled water produced from passive solar still (Rs. 0.70/kg) is found to be less than hybrid (PV/T) active solar still (Rs. 1.93/kg) for 30 years life time of the systems. The payback periods of the passive and hybrid (PV/T) active solar still are estimated to be in the range of 1.1-6.2 years and 3.3-23.9 years, respectively, based on selling price of distilled water in the range of Rs. 10/kg to Rs. 2/kg. The energy payback time (EPBT) has been estimated as 2.9 and 4.7 years, respectively. (author)
Endocytosis-independent function of clathrin heavy chain in the control of basal NF-κB activation.
Directory of Open Access Journals (Sweden)
Man Lyang Kim
Full Text Available BACKGROUND: Nuclear factor-κB (NF-κB is a transcription factor that regulates the transcription of genes involved in a variety of biological processes, including innate and adaptive immunity, stress responses and cell proliferation. Constitutive or excessive NF-κB activity has been associated with inflammatory disorders and higher risk of cancer. In contrast to the mechanisms controlling inducible activation, the regulation of basal NF-κB activation is not well understood. Here we test whether clathrin heavy chain (CHC contributes to the regulation of basal NF-κB activity in epithelial cells. METHODOLOGY: Using RNA interference to reduce endogenous CHC expression, we found that CHC is required to prevent constitutive activation of NF-κB and gene expression. Immunofluorescence staining showed constitutive nuclear localization of the NF-κB subunit p65 in absence of stimulation after CHC knockdown. Elevated basal p65 nuclear localization is caused by constitutive phosphorylation and degradation of inhibitor of NF-κB alpha (IκBα through an IκB kinase α (IKKα-dependent mechanism. The role of CHC in NF-κB signaling is functionally relevant as constitutive expression of the proinflammatory chemokine interleukin-8 (IL-8, whose expression is regulated by NF-κB, was found after CHC knockdown. Disruption of clathrin-mediated endocytosis by chemical inhibition or depletion of the μ2-subunit of the endocytosis adaptor protein AP-2, and knockdown of clathrin light chain a (CHLa, failed to induce constitutive NF-κB activation and IL-8 expression, showing that CHC acts on NF-κB independently of endocytosis and CLCa. CONCLUSIONS: We conclude that CHC functions as a built-in molecular brake that ensures a tight control of basal NF-κB activation and gene expression in unstimulated cells. Furthermore, our data suggest a potential link between a defect in CHC expression and chronic inflammation disorder and cancer.
The solarPACES strategy for the solar thermal breakthrough
International Nuclear Information System (INIS)
Burch, G.D.; Grasse, W.
1997-01-01
IEA(International Energy Agency)/SolarPACES(Solar Power and Chemical Energy systems)represents a world wide coalition for information sharing and collaboration on applications of concentrated solar energy. The current SolarPACES community has built up solar thermal system know-how over 15 years, is operating the three main solar test centres in the world. Its main activities are in the following four fields: solar thermal electric power systems, solar chemistry, solar technology and advanced applications and non-technical activities. The article presents the talk on the strategy of solarPACES given at the International Workshop on applied solar energy held in Tashkent(Uzbekistan) in June 1997. (A.A.D.)
Great red spot dependence on solar activity
International Nuclear Information System (INIS)
Schatten, K.H.
1979-01-01
A new inquiry has been made into the question of whether Jupiter's Great Red Spot shows a solar activity dependence. From 1892 to 1947 a clear correlation was present. A dearth of sightings in the seventeenth century, along with the Maunder Minimum, further supports the relation. An anticorrelation, however, from l948 to l967 removed support for such an effect. The old observations have reexamined and recent observations have also been studied. The author reexamines this difficult question and suggests a possible physical mechanism for a Sun-Jovian weather relation. Prinn and Lewis' conversion reaction of Phosphine gas to triclinic red phosphorous crystals is a reaction dependent upon solar radiation. It may explain the dependence found, as well as the striking appearance of the Great Red Spot in the UV
Global Analysis of Solar Neutrino Oscillations Including SNO CC Measurement
Bahcall, J N; Peña-Garay, C; Bahcall, John N; Peña-Garay, Carlos
2001-01-01
For active and sterile neutrinos, we present the globally allowed solutions for two neutrino oscillations. We include the SNO CC measurement and all other relevant solar neutrino and reactor data. Five active neutrino oscillation solutions (LMA, LOW, SMA, VAC, and Just So2) are currently allowed at 3 sigma; three sterile neutrino solutions (Just So2, SMA, and VAC) are allowed at 3 sigma. The goodness of fit is satisfactory for all eight solutions. We also investigate the robustness of the allowed solutions by carrying out global analyses with and without: 1) imposing solar model constraints on the 8B neutrino flux, 2) including the Super-Kamiokande spectral energy distribution and day-night data, 3) using an enhanced CC cross section for deuterium (due to radiative corrections), and 4) a optimistic, hypothetical reduction by a factor of three of the error of the SNO CC rate. For every analysis strategy used in this paper, the most favored solutions all involve large mixing angles: LMA, LOW, or VAC. The favore...
Different parameter and technique affecting the rate of evaporation on active solar still -a review
A, Muthu Manokar; D, Prince Winston; A. E, Kabeel; Sathyamurthy, Ravishankar; T, Arunkumar
2018-03-01
Water is one of the essential sources for the endurance of human on the earth. As earth having only a small amount of water resources for consumption purpose people in rural and urban areas are getting affected by consuming dirty water that leads to water-borne diseases. Even though ground water is available in small quantity, it has to be treated properly before its use for internal consumption. Brackish water contains dissolve and undissolved contents, and hence it is not suitable for the household purpose. Nowadays, distillation process is done by using passive and active solar stills. The major problem in using passive solar still is meeting higher demand for fresh water. The fresh water production from passive solar still is critically low to meet the demand. To improve the productivity of conventional solar still, input feed water is preheated by integrating the solar still to different collector panels. In this review article, the different parameters that affect the rate of evaporation in an active solar still and the different methods incorporated has been presented. In addition to active distillation system, forced convection technique can be incorporated to increase the yield of fresh water by decreasing the temperature of cover. Furthermore, it is identified that the yield of fresh water from the active desalination system can be improved by sensible and latent heat energy storage. This review will motivate the researchers to decide appropriate active solar still technology for promoting development.
International Nuclear Information System (INIS)
Chang, Huawei; Liu, Yuting; Shen, Jinqiu; Xiang, Can; He, Sinian; Wan, Zhongmin; Jiang, Meng; Duan, Chen; Shu, Shuiming
2015-01-01
Highlights: • Active and passive solar house technology is integrated in the solar house. • Solar thermal system and solar photoelectric system are measured and analyzed. • Energy balance and energy consumption are analyzed with valuable experimental data. • “Zero energy consumption” is truly achieved with the solar supply rate of 1.19 in winter. - Abstract: An integrated solar house with numerous advanced envelops is designed and constructed to investigate the comprehensive utilization of solar energy, energy efficiency and energy balance, which combines active solar house technology with passive solar house technology including solar photovoltaic system, solar water heating system, direct-gain door and windows. Solar radiation intensity, performance of the photovoltaic system, water temperature, and indoor and outdoor temperature are measured, results of the experiments indicate that solar glass window on the south wall can maintain the average indoor temperature at 21.4 °C in the case of average outdoor temperature at 11.2 °C without any external heat supply. The output current of the solar photovoltaic system shows the same trend as solar radiation intensity. When the intensity is 619.7 W/m"2, the instantaneous generation power could reach a value of 781.9 W, cumulative capacity throughout the day achieves 4.56 kW h and photovoltaic conversion efficiency 9.8%. When the average intensity throughout a day is 358 W/m"2, the solar water heating system could help to raise the temperature of 450 L water by 30 °C with its heat collecting efficiency being 37.4%. Through the analysis of the overall energy system in the solar house, it can be derived that this solar house could achieve “zero energy consumption” in winter with the solar supply rate at 1.19.
2010-04-01
... TAXES Pension, Profit-Sharing, Stock Bonus Plans, Etc. § 1.403(b)-8 Funding. (a) Investments. Section... the account cannot be used for, or diverted to, purposes other than for the exclusive benefit of plan participants or their beneficiaries (for which purpose, assets are treated as diverted to the employer if the...
Energy Technology Data Exchange (ETDEWEB)
Glaetzle, Matthias; Hoerder, Gregor J.; Huppertz, Hubert [Innsbruck Univ. (Austria). Inst. fuer Allgemeine, Anorganische und Theoretische Chemie
2016-08-01
The rare earth borates RE{sub 2}B{sub 8}O{sub 15} (RE = La, Pr, Nd) were synthesized in a Walker-type multianvil apparatus under conditions of 5.5 GPa and 1100 C. Starting from the corresponding rare earth oxides and boron oxide, the syntheses yielded crystalline products of all new compounds that allowed crystal structure analyses based on single-crystal X-ray diffraction data for La{sub 2}B{sub 8}O{sub 15} and Nd{sub 2}B{sub 8}O{sub 15}. The compound Pr{sub 2}B{sub 8}O{sub 15} could be characterized via X-ray powder diffractometry. The results show that the new compounds crystallize isotypically to Ce{sub 2}B{sub 8}O{sub 15} in the monoclinic space group P2/c. The infrared spectra of RE{sub 2}B{sub 8}O{sub 15} (RE = La, Pr, Nd) have also been studied.
Oxygen Non-Stoichiometry and Electrical Conductivity of LA0.2Sr0.8Fe0.8B0.2O3-d, B = Fe, Ti, Ta
Lohne, O.F.; Phung, T.N.; Grande, T.; Bouwmeester, Henricus J.M.; Hendriksen, P.V.; Sogaard, M.; Wiik, K.
2014-01-01
The oxygen non-stoichiometry was determined by coulometric titration for the perovskite oxides La0.2Sr0.8FeO3−δ and La0.2Sr0.8Fe0.8B0.2O3−δ (B = Ti4+ and Ta5+) in the temperature range 600 ◦C ≤ T ≤ 900 ◦C and the oxygen partial pressure range: 1 · 10−15 ≤ pO2 ≤ 0.209 atm. The non-stoichiometry (δ)
Kim, Yu Jin; Cheon, Ye Rim; Back, Jang Yeol; Kim, Yun-Hi; Chung, Dae Sung; Park, Chan Eon
2014-11-10
Organic bulk heterojunction photovoltaic devices based on a series of three naphtho[2,1-b:3,4-b']dithiophene (NDT) derivatives blended with phenyl-C71-butyric acid methyl ester were studied. These three derivatives, which have NDT units with various thiophene-chain lengths, were employed as the donor polymers. The influence of their molecular structures on the correlation between their solar-cell performances and their degree of crystallization was assessed. The grazing-incidence angle X-ray diffraction and atomic force microscopy results showed that the three derivatives exhibit three distinct nanoscale morphologies. We correlated these morphologies with the device physics by determining the J-V characteristics and the hole and electron mobilities of the devices. On the basis of our results, we propose new rules for the design of future generations of NDT-based polymers for use in bulk heterojunction solar cells. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Fu, Jie; Wen, Teng; Wang, Qing; Zhang, Xue-Wei; Zeng, Qing-Fu; An, Shu-Qing; Zhu, Hai-Liang
2010-06-01
Degradation of Active Brilliant Red X-3B (X-3B) in aqueous solution by a microwave discharge electrodeless lamp (MDEL) in the presence of activated carbon was investigated. The preliminary results proved this method could effectively degrade X-3B in aqueous solution. The removal percentages of colour and chemical oxygen demand were up to approximately 99% and 66%, respectively, at the conditions of 0.8 g/L dye concentration, 20 g/L activated carbon, pH 7.0 and 8 min microwave irradiation time. The degradation basically belonged to first-order reaction kinetics and its rate constant was 0.42 min(-1). No aromatic organics were detected in the final treated solution, indicating that the mineralization was relatively complete. By studying the change in solution properties, it could be concluded that MDEL-assisted oxidation was the dominant reaction mechanism. In addition, the influence of operational parameters and reuse of activated carbon were also discussed.
Prediction of solar cycle 24 using fourier series analysis
International Nuclear Information System (INIS)
Khalid, M.; Sultana, M.; Zaidi, F.
2014-01-01
Predicting the behavior of solar activity has become very significant. It is due to its influence on Earth and the surrounding environment. Apt predictions of the amplitude and timing of the next solar cycle will aid in the estimation of the several results of Space Weather. In the past, many prediction procedures have been used and have been successful to various degrees in the field of solar activity forecast. In this study, Solar cycle 24 is forecasted by the Fourier series method. Comparative analysis has been made by auto regressive integrated moving averages method. From sources, January 2008 was the minimum preceding solar cycle 24, the amplitude and shape of solar cycle 24 is approximate on monthly number of sunspots. This forecast framework approximates a mean solar cycle 24, with the maximum appearing during May 2014 (+- 8 months), with most sunspot of 98 +- 10. Solar cycle 24 will be ending in June 2020 (+- 7 months). The difference between two consecutive peak values of solar cycles (i.e. solar cycle 23 and 24 ) is 165 months(+- 6 months). (author)
van der Woude, D.A.A.; Pijnenborg, J.M.A.; de Vries, J.; van Wijk, E.M.
2018-01-01
Introduction Total vitamin B12 levels decrease significantly during pregnancy and recover to normal values within 8-week postpartum. Holotranscobalamin (holoTC) reflects the active part of vitamin B12 and has been shown to remain constant during pregnancy and postpartum. A mechanism of
Energy Technology Data Exchange (ETDEWEB)
Qu, Shiwei; Wang, Huan; Mo, Daize; Chao, Pengjie; Yang, Zhen; Li, Longji; Tian, Leilei; Chen, Wei [Materials; Institute; He, Feng
2017-06-22
A new family of thieno[3,4-b]thiophene benzodithiophene terpolymers (PBTClx) have been designed and synthesized, in which the chlorine/fluorine content has been adjusted and optimized. As the content of chlorine is increased in polymers, the twist angle between the donor and acceptor is increased, which leads to a diminishment in the planarity and conjugation. As a result, the UV vis absorption is continuous blue-shifted, and the band gap increases from 1.57 to 2.04 eV when the chlorinated moieties increased from 0 to 100%. The highest occupied molecular orbital (HOMO) levels of those polymers are decreased by increasing the content of chlorinated moiety, which opens a window to constantly modify the V-oc values and eventually meets a balance point for optimized solar energy conversion. The highest power conversion efficiency of 8.31% is obtained by using PBTCl25 as the donor and PC71BM as the acceptor in polymer solar cells (PSCs), in which the Voc increased from 0.79 to 0.82 V after 25% chlorinated monomer involved in copolymerization. Herein, the chlorine replacement could be a good method to further pump the solar conversion by increasing the open circuit voltage without reducing other factors of the polymer solar cells.
Precise Determination of the Unperturbed 8B Neutrino Spectrum
DEFF Research Database (Denmark)
Roger, T.; Büscher, J.; Bastin, B.
2012-01-01
A measurement of the final state distribution of the 8B β decay, obtained by implanting a 8B beam in a double-sided silicon strip detector, is reported here. The present spectrum is consistent with a recent independent precise measurement performed by our collaboration at the IGISOL facility, Jyv...
Twist of Magnetic Fields in Solar Active Regions Hongqi Zhang ...
Indian Academy of Sciences (India)
tribpo
in active regions also shows the butterfly pattern through the solar cycle. And, less than 30% of the active regions do not follow the general trend (Zhang & Bao 1998). The longitudinal distribution of current helicity parameter h|| of active regions in both the hemispheres in the last decade was presented by Zhang & Bao ...
International Nuclear Information System (INIS)
Bagheri, Narjes; Aghaei, Alireza; Ghotbi, Mohammad Yeganeh; Marzbanrad, Ehsan; Vlachopoulos, Nick; Häggman, Leif; Wang, Michael; Boschloo, Gerrit; Hagfeldt, Anders; Skunik-Nuckowska, Magdalena; Kulesza, Pawel J.
2014-01-01
Highlights: • Dye Solar Cell and supercapacitor are integrated into a single device capable of generation and storage of energy. • The solar cell part of the device utilizes the Co-based electrolyte and nickel/PEDOT counter electrode. • A cobalt-doped nickel oxide together with activated carbon is used in the capacitor part of the device. • The integrated photocapacitor is characterized by the capacitance of 32 F g −1 and the total efficiency of 0.6%. - Abstract: A dye-sensitized solar cell (DSC) based on the metal-free organic sensitizer and the cobalt (II, III) polypyridyl electrolyte was integrated here within an asymmetric supercapacitor utilizing cobalt-doped nickel oxide and activated carbon as positive and negative electrodes, respectively. A low cost nickel foil served as intermediate (auxiliary) bifunctional electrode separating two parts of the device and permitting the DSC electrolyte regeneration at one side and charge storage within cobalt-doped nickel oxide at the other. The main purpose of the research was to develop an integrated photocapacitor system capable of both energy generation and its further storage. Following irradiation at the 100 mW cm −2 level, the solar cell generated an open-circuit voltage of 0.8 V and short-circuit current of 8 mA cm −2 which corresponds to energy conversion efficiency of 4.9%. It was further shown that upon integration with asymmetric supercapacitor, the photogenerated energy was directly injected into porous charge storage electrodes thus resulting in specific capacitance of 32 F g −1 and energy density of 2.3 Wh kg −1 . The coulumbic and total (energy conversion and charge storage) efficiency of photocapacitor were equal to 54% and 0.6%, respectively
Reidenbach, Andrew G; Kemmerer, Zachary A; Aydin, Deniz; Jochem, Adam; McDevitt, Molly T; Hutchins, Paul D; Stark, Jaime L; Stefely, Jonathan A; Reddy, Thiru; Hebert, Alex S; Wilkerson, Emily M; Johnson, Isabel E; Bingman, Craig A; Markley, John L; Coon, Joshua J; Dal Peraro, Matteo; Pagliarini, David J
2018-02-15
Human COQ8A (ADCK3) and Saccharomyces cerevisiae Coq8p (collectively COQ8) are UbiB family proteins essential for mitochondrial coenzyme Q (CoQ) biosynthesis. However, the biochemical activity of COQ8 and its direct role in CoQ production remain unclear, in part due to lack of known endogenous regulators of COQ8 function and of effective small molecules for probing its activity in vivo. Here, we demonstrate that COQ8 possesses evolutionarily conserved ATPase activity that is activated by binding to membranes containing cardiolipin and by phenolic compounds that resemble CoQ pathway intermediates. We further create an analog-sensitive version of Coq8p and reveal that acute chemical inhibition of its endogenous activity in yeast is sufficient to cause respiratory deficiency concomitant with CoQ depletion. Collectively, this work defines lipid and small-molecule modulators of an ancient family of atypical kinase-like proteins and establishes a chemical genetic system for further exploring the mechanistic role of COQ8 in CoQ biosynthesis. Copyright © 2017 Elsevier Ltd. All rights reserved.
Method of separation of celestial gamma-ray bursts from solar flares
International Nuclear Information System (INIS)
Chuang, K.W.; White, R.S.; Klebesadel, R.W.; Laros, J.G.
1991-01-01
We recently discovered 217 ''new'' celestial gamma-ray burst candidates from the ''new'' burst search of the PVO real time data base. 1 The burst search covered the time period from September 1978 to July 1988. Sixty were confirmed by at lest on other spacecraft, e.g., ISEE-3, V-11, V-12, etc. None triggered the PVO high time resolution memory. In this paper we describe a new algorithm based ont eh relationship between time width T w and hardness ratio HR, to distinguish cosmic gamma-ray bursts from solar flares without knowing the directions of the events. The criteria for identification as a gamma-ray burst candidate are: If T ww ≤a then HR≥bT w , or T w >a then HR>c. Otherwise, the event is a solar flare candidate. Here, a, b, and c are parameter which differ for different gamma-ray burst detectors. For PVO, a=18.8 s, b=(1.38/18.8) s -1 , and c=1.38. This algorithm was tested with 83 triggered and 60 nontriggered confirmed gamma-ray burst and 30 confirmed solar flares from PVO
Influence of solar activity and environment on 10Be in recent natural archives
International Nuclear Information System (INIS)
Berggren, Ann-Marie
2009-01-01
Understanding the link between the Sun and climate is vital in the current incidence of global climate change, and 10 Be in natural archives constitutes an excellent tracer for this purpose. As cosmic rays enter the atmosphere, cosmogenic isotopes like 10 Be and 14 C are formed. Variations in solar activity modulate the amount of incoming cosmic rays, and thereby cosmogenic isotope production. Atmospherically produced 10 Be enters natural archives such as sediments and glaciers by wet and dry deposition within about a year of production. 10 Be from natural archives therefore provides information on past solar activity, and because these archives also contain climate information, solar activity and climate can be linked. One remaining question is to what degree 10 Be in natural archives reflects production, and to what extent the local and regional environment overprints the production signal. To explore this, 10 Be was measured at annual resolution over the last 600 years in a Greenland ice core. Measurement potentials for these samples benefited from the development of a new laboratory method of co-precipitating 10 Be with niobium. To diversify geographic location and archive media type, a pioneer study of measuring 10 Be with annual resolution in varved lake sediments from Finland was conducted, with samples from the entire 20th century. Pathways of 10 Be into lake sediments are more complex than into glacial ice, inferring that contemporary atmospheric conditions may not be recorded. Here, it is shown for the first time that tracing the 11-year solar cycle through lake sediment 10 Be variations is possible. Results also show that on an annual basis, 10 Be deposition in ice and sediment archives is affected by local environmental conditions. On a slightly longer timescale, however, diverse 10 Be records exhibit similar trends and a negative correlation with solar activity. Cyclic variability of 10 Be deposition persisted throughout past grand solar minima, when
Solar-like Oscillations in KIC 11395018 and KIC 11234888 from 8 Months of Kepler Data
DEFF Research Database (Denmark)
Mathur, S.; Handberg, Rasmus; Campante, Tiago. L.
2011-01-01
We analyze the photometric short-cadence data obtained with the Kepler mission during the first 8 months of observations of two solar-type stars of spectral types G and F: KIC 11395018 and KIC 11234888, respectively, the latter having a lower signal-to-noise ratio (S/N) compared with the former. ...
International Nuclear Information System (INIS)
Biswas, M.
1975-01-01
In this review, some of the important aspects of energetic solar particles and their relation to solar physics are discussed. The major aspects of solar cosmic ray studies currently under investigation are identified and attention is focussed on the problems of the physical processes in the sun which may be responsible for these phenomena. The studies of the composition and energy spectra of solar cosmic ray nuclei are related to the basic problem of particle acceleration process in sun and to the composition of elements in solar atmosphere. The composition of higher energy (>20 MeV/amu) multiply charged nuclei of He, C, N, O, Ne, Mg, Si and Fe give information on the abundance of elements in the solar atmosphere. At lower energies (approximately 1-10 MeV/amu), the abundances of these elements show enhancements relative to solar abundances and these enhancements are believed to be due to particle acceleration mechanisms operative in the sun which are not fully understood at present. Studies of the relative abundances of H 2 , H 3 and He 3 isotopes and Li, Be, B nuclei in the solar cosmic rays can also be studied. The question of the relationship of the accelerated particles in the sun to the optical flare phenomena is discussed. Further studies of different aspects of these phenomena may give important clues to a wide ranging phenomena in the active sun. The observational methods employed for these studies are mentioned. (A.K.)
Solar Drivers of 11-yr and Long-Term Cosmic Ray Modulation
Cliver, E. W.; Richardson, I. G.; Ling, A. G.
2011-01-01
In the current paradigm for the modulation of galactic cosmic rays (GCRs), diffusion is taken to be the dominant process during solar maxima while drift dominates at minima. Observations during the recent solar minimum challenge the pre-eminence of drift: at such times. In 2009, the approx.2 GV GCR intensity measured by the Newark neutron monitor increased by approx.5% relative to its maximum value two cycles earlier even though the average tilt angle in 2009 was slightly larger than that in 1986 (approx.20deg vs. approx.14deg), while solar wind B was significantly lower (approx.3.9 nT vs. approx.5.4 nT). A decomposition of the solar wind into high-speed streams, slow solar wind, and coronal mass ejections (CMEs; including postshock flows) reveals that the Sun transmits its message of changing magnetic field (diffusion coefficient) to the heliosphere primarily through CMEs at solar maximum and high-speed streams at solar minimum. Long-term reconstructions of solar wind B are in general agreement for the approx. 1900-present interval and can be used to reliably estimate GCR intensity over this period. For earlier epochs, however, a recent Be-10-based reconstruction covering the past approx. 10(exp 4) years shows nine abrupt and relatively short-lived drops of B to value of approx.2.8 nT. A floor in solar wind B implies a ceiling in the GCR intensity (a permanent modulation of the local interstellar spectrum) at a given energy/rigidity. The 30-40% increase in the intensity of 2.5 GV electrons observed by Ulysses during the recent solar minimum raises an interesting paradox that will need to be resolved.
Sunspot variation and selected associated phenomena: a look at solar cycle 21 and beyond
International Nuclear Information System (INIS)
Wilson, R.M.
1982-02-01
Solar sunspot cycles 8 through 21 are reviewed. Mean time intervals are calculated for maximum to maximum, minimum to minimum, minimum to maximum, and maximum to minimum phases for cycles 8 through 20 and 8 through 21. Simple cosine functions with a period of 132 years are compared to, and found to be representative of, the variation of smoothed sunspot numbers at solar maximum and minimum. A comparison of cycles 20 and 21 is given, leading to a projection for activity levels during the Spacelab 2 era (tentatively, November 1984). A prediction is made for cycle 22. Major flares are observed to peak several months subsequent to the solar maximum during cycle 21 and to be at minimum level several months after the solar minimum. Additional remarks are given for flares, gradual rise and fall radio events and 2800 MHz radio emission. Certain solar activity parameters, especially as they relate to the near term Spacelab 2 time frame are estimated
Foothills Parkway Section 8B Final Environmental Report, Volume 1
Energy Technology Data Exchange (ETDEWEB)
Blasing, T.J.; Cada, G.F.; Carer, M.; Chin, S.M.; Dickerman, J.A.; Etnier, D.A.; Gibson, R.; Harvey, M.; Hatcher, B.; Lietzske, D.; Mann, L.K.; Mulholland, P.J.; Petrich, C.H.; Pounds, L.; Ranney, J.; Reed, R.M.; Ryan, P.F.; Schweitzer, M.; Smith, D.; Thomason, P.; Wade, M.C.
1999-07-01
In 1994, Oak Ridge National Laboratory (ORNL) was tasked by the National Park Service (NPS) to prepare an Environmental Report (ER) for Section 8B of the Foothills Parkway in the Great Smoky Mountains National Park (GSMNP). Section 8B represents 27.7 km (14.2 miles) of a total of 115 km (72 miles) of the planned Foothills Parkway and would connect the Cosby community on the east to the incorporated town of Pittman Center to the west.
Steinberg, J. L.; Caroubalos, C.
1976-01-01
The mechanism causing solar radio bursts (1 and 111) is examined. It is proposed that a nonthermal energy source is responsible for the bursts; nonthermal energy is converted into electromagnetic energy. The advantages are examined for an out-of-the-ecliptic solar probe mission, which is proposed as a means of stereoscopically viewing solar radio bursts, solar magnetic fields, coronal structure, and the solar wind.
Intestinal bile salt absorption in Atp8b1 deficient mice
Groen, Annemiek; Kunne, Cindy; Paulusma, Coen C.; Kramer, Werner; Agellon, Luis B.; Bull, Laura N.; Elferink, Ronald P. J. Oude
2007-01-01
BACKGROUND/AIMS: Mutations in the ATP8B1 gene can cause Progressive Familial Intrahepatic Cholestasis type 1. We have previously reported that Atp8b1(G308V/G308V) mice, a model for PFIC1, have slightly, but significantly, higher baseline serum bile salt (BS) concentrations compared to wt mice. Upon
Molecular Cloning and Functional Analysis of UV RESISTANCE LOCUS 8 (PeUVR8 from Populus euphratica.
Directory of Open Access Journals (Sweden)
Ke Mao
Full Text Available Ultraviolet-B (UV-B; 280-315 nm light, which is an integral part of the solar radiation reaching the surface of the Earth, induces a broad range of physiological responses in plants. The UV RESISTANCE LOCUS 8 (UVR8 protein is the first and only light photoreceptor characterized to date that is specific for UV-B light and it regulates various aspects of plant growth and development in response to UV-B light. Despite its involvement in the control of important plant traits, most studies on UV-B photoreceptors have focused on Arabidopsis and no data on UVR8 function are available for forest trees. In this study, we isolated a homologue of the UV receptor UVR8 of Arabidopsis, PeUVR8, from Populus euphratica (Euphrates poplar and analyzed its structure and function in detail. The deduced PeUVR8 amino acid sequence contained nine well-conserved regulator of chromosome condensation 1 (RCC1 repeats and the region 27 amino acids from the C terminus (C27 that interact with COP1 (CONSTITUTIVELY PHOTOMORPHOGENIC1. Secondary and tertiary structure analysis showed that PeUVR8 shares high similarity with the AtUVR8 protein from Arabidopsis thaliana. Using heterologous expression in Arabidopsis, we showed that PeUVR8 overexpression rescued the uvr8 mutant phenotype. In addition, PeUVR8 overexpression in wild-type background seedlings grown under UV-B light inhibited hypocotyl elongation and enhanced anthocyanin accumulation. Furthermore, we examined the interaction between PeUVR8 and AtCOP1 using a bimolecular fluorescence complementation (BiFC assay. Our data provide evidence that PeUVR8 plays important roles in the control of photomorphogenesis in planta.
International Nuclear Information System (INIS)
Jun, Do Youn; Kim, Jun Seok; Park, Hae Sun; Song, Woo Sun; Bae, Young Seuk; Kim, Young Ho
2007-01-01
To understand the mechanism underlying T-cell toxicity of diacetoxyscirpenol (DAS) from Fusarium sambucinum, its apoptogenic as well as growth retardation activity was investigated in human Jurkat T cells. Exposure to DAS (0.01-0.15 μM) caused apoptotic DNA fragmentation along with caspase-8 activation, Bid cleavage, mitochondrial cytochrome c release, activation of caspase-9 and caspase-3, and PARP degradation, without any alteration in the levels of Fas or FasL. Under these conditions, necrosis was not accompanied. The cytotoxicity of DAS was not blocked by the anti-Fas neutralizing antibody ZB-4. Although the DAS-induced apoptotic events were completely prevented by overexpression of Bcl-xL, the cells overexpressing Bcl-xL were unable to divide in the presence of DAS, resulting from the failure of cell cycle progression possibly due to down-regulation in the protein levels of cdk4 and cyclin B1. The DAS-mediated apoptosis and activation of caspase-8, -9, and -3 were abrogated by either pan-caspase inhibitor (z-VAD-fmk) or caspase-8 inhibitor (z-IETD-fmk). While the DAS-mediated apoptosis and activation of caspase-9 and caspase-3 were slightly suppressed by the mitochondrial permeability transition pore inhibitor (CsA), both caspase-8 activation and Bid cleavage were not affected by CsA. The activated normal peripheral T cells possessed a similar susceptibility to the cytotoxicity of DAS. These results demonstrate that the T-cell toxicity of DAS is attributable to not only apoptosis initiated by caspase-8 activation and subsequent mitochondrion-dependent or -independent activation of caspase cascades, which can be regulated by Bcl-xL, but also interruption of cell cycle progression caused by down-regulation of cdk4 and cyclin B1 proteins
Rate of production of cosmogenic isotopes in the past and solar activity
International Nuclear Information System (INIS)
Kocharov, G.E.; Dergachev, V.A.; Gordeichik, N.I.; Ioffe, A.F.
1975-01-01
The available experimental data on abundances of 14 C, 10 Be and 26 Al in materials with known ages are analyzed with the aim of determining of solar activity in the past. Based on the authors results on the abundances of 14 C in the tree rings it is shown that concentration of radiocarbon in atmosphere is changed with the period of approximately 60 years, amplitude approcimately 1% and phase shift relatively to solar activity of approximately 10 years. (orig./WBU) [de
Welling, D. T.; Manchester, W.; Savani, N.; Sokolov, I.; van der Holst, B.; Jin, M.; Toth, G.; Liemohn, M. W.; Gombosi, T. I.
2017-12-01
The future of space weather prediction depends on the community's ability to predict L1 values from observations of the solar atmosphere, which can yield hours of lead time. While both empirical and physics-based L1 forecast methods exist, it is not yet known if this nascent capability can translate to skilled dB/dt forecasts at the Earth's surface. This paper shows results for the first forecast-quality, solar-atmosphere-to-Earth's-surface dB/dt predictions. Two methods are used to predict solar wind and IMF conditions at L1 for several real-world coronal mass ejection events. The first method is an empirical and observationally based system to estimate the plasma characteristics. The magnetic field predictions are based on the Bz4Cast system which assumes that the CME has a cylindrical flux rope geometry locally around Earth's trajectory. The remaining plasma parameters of density, temperature and velocity are estimated from white-light coronagraphs via a variety of triangulation methods and forward based modelling. The second is a first-principles-based approach that combines the Eruptive Event Generator using Gibson-Low configuration (EEGGL) model with the Alfven Wave Solar Model (AWSoM). EEGGL specifies parameters for the Gibson-Low flux rope such that it erupts, driving a CME in the coronal model that reproduces coronagraph observations and propagates to 1AU. The resulting solar wind predictions are used to drive the operational Space Weather Modeling Framework (SWMF) for geospace. Following the configuration used by NOAA's Space Weather Prediction Center, this setup couples the BATS-R-US global magnetohydromagnetic model to the Rice Convection Model (RCM) ring current model and a height-integrated ionosphere electrodynamics model. The long lead time predictions of dB/dt are compared to model results that are driven by L1 solar wind observations. Both are compared to real-world observations from surface magnetometers at a variety of geomagnetic latitudes
Cosmogenic radionuclide 7Be in atmospheric fallouts, weather factors and solar activity
International Nuclear Information System (INIS)
Kungurov, F.R.
2011-11-01
Key words: 7 Be activity, atmospheric fallouts, solar activity, gamma spectroscopy. Subjects of research: cosmogenic radionuclide 7 Be in atmospheric fallouts and surrounding objects of environment, its migrational distribution connected to solar activity and weather meteorologic parameters of the region studied. Purpose of work: Defining correlation between atmospheric humidity and solar activity with concentration and distribution of cosmogenic radionuclide 7 Be. Methods of research: gamma-spectrometry method of activity measurements. The results obtained and their novelty: Cycle of research works on definition of concentration and migrational distribution of CRN 7 Be in Samarkand region during 2002-2005 was carried out for the first time. Volumetric activity of 7 Be in squat air layer of Samarkand was determined. Average density of 7 Be fallouts for the four years of studies was determined. Qualitative correlation bet ween 7 Be fallouts density variations and solar activity, expressed through Wolf number has been found. Qualitative correlation between 7 Be fallouts density variations and amount of precipitations has been found. Regularity in 7 Be concentration decrease towards north latitudes has been detected. Practical value: Developed scintillation method of 7 Be activity detection in atmospheric fallouts was used in works performed in the framework of republican grants 2F-No 1.2.3, CNT RUz PFNI 2F-No 2.1.39 and ITD-7-024. Methodology was used for the estimation of the velocity of erosion processes in the soils of different regions of Uzbekistan. Methodology is used in the works on 7 Be radioactivity measurements. Degree of embed and economic effectivity: Gained results replenish database on 7 Be isotope distribution on Earth regions and its role in formation of some processes, connected with meteorology, agronomy and radioecology of Samarkand region. Field of application: meteorology, agronomy and radioecology. (author)
Porcine arterivirus activates the NF-κB pathway through IκB degradation
International Nuclear Information System (INIS)
Lee, Sang-Myeong; Kleiboeker, Steven B.
2005-01-01
Nuclear factor-kappaB (NF-κB) is a critical regulator of innate and adaptive immune function as well as cell proliferation and survival. The present study demonstrated for the first time that a virus belonging to the Arteriviridae family activates NF-κB in MARC-145 cells and alveolar macrophages. In porcine reproductive and respiratory syndrome virus (PRRSV)-infected cells, NF-κB activation was characterized by translocation of NF-κB from the cytoplasm to the nucleus, increased DNA binding activity, and NF-κB-regulated gene expression. NF-κB activation was increased as PRRSV infection progressed and in a viral dose-dependent manner. UV-inactivation of PRRSV significantly reduced the level of NF-κB activation. Degradation of IκB protein was detected late in PRRSV infection, and overexpression of the dominant negative form of IκBα (IκBαDN) significantly suppressed NF-κB activation induced by PRRSV. However, IκBαDN did not affect viral replication and viral cytopathic effect. PRRSV infection induced oxidative stress in cells by generating reactive oxygen species (ROS), and antioxidants inhibited NF-κB DNA binding activity in PRRSV-infected cells, suggesting ROS as a mechanism by which NF-κB was activated by PRRSV infection. Moreover, NF-κB-dependent expression of matrix metalloproteinase (MMP)-2 and MMP-9 was observed in PRRSV-infected cells, an observation which implies that NF-κB activation is a biologically significant aspect of PRRSV pathogenesis. The results presented here provide a basis for understanding molecular pathways of pathology and immune evasion associated with disease caused by PRRSV
LENUS (Irish Health Repository)
Aherne, Carol M
2009-10-01
Expression of the orphan nuclear receptor NR4A2 is controlled by pro-inflammatory mediators, suggesting that NR4A2 may contribute to pathological processes in the inflammatory lesion. This study identifies the chemoattractant protein, interleukin 8 (IL-8\\/CXCL8), as a molecular target of NR4A2 in human inflammatory arthritis and examines the mechanism through which NR4A2 modulates IL-8 expression. In TNF-alpha-activated human synoviocyte cells, enhanced expression of IL-8 mRNA and protein correspond to temporal changes in NR4A2 transcription and nuclear distribution. Ectopic expression of NR4A2 leads to robust changes in endogenous IL-8 mRNA levels and co-treatment with TNF-alpha results in significant (p<0.001) secretion of IL-8 protein. Transcriptional effects of NR4A2 on the human IL-8 promoter are enhanced in the presence of TNF-alpha, suggesting molecular crosstalk between TNF-alpha signalling and NR4A2. A dominant negative IkappaB kinase antagonizes the combined effects of NR4A2 and TNF-alpha on IL-8 promoter activity. Co-expression of NR4A2 and the p65 subunit of NF-kappaB enhances IL-8 transcription and functional studies indicate that transactivation occurs independently of NR4A2 binding to DNA or heterodimerization with additional nuclear receptors. The IL-8 minimal promoter region is sufficient to support NR4A2 and NF-kappaB\\/p65 co-operative activity and NR4A2 can interact with NF-kappaB\\/p65 on a 39bp sequence within this region. In patients treated with methotrexate for active inflammatory arthritis, a reduction in NR4A2 synovial tissue levels correlate significantly (n=10, r=0.73, p=0.002) with changes in IL-8 expression. Collectively, these data delineate an important role for NR4A2 in modulating IL-8 expression and reveal novel transcriptional responses to TNF-alpha in human inflammatory joint disease.
Solar cycle effect on geomagnetic storms caused by interplanetary magnetic clouds
Directory of Open Access Journals (Sweden)
C.-C. Wu
2006-12-01
Full Text Available We investigated geomagnetic activity which was induced by interplanetary magnetic clouds during the past four solar cycles, 1965–1998. We have found that the intensity of such geomagnetic storms is more severe in solar maximum than in solar minimum. In addition, we affirm that the average solar wind speed of magnetic clouds is faster in solar maximum than in solar minimum. In this study, we find that solar activity level plays a major role on the intensity of geomagnetic storms. In particular, some new statistical results are found and listed as follows. (1 The intensity of a geomagnetic storm in a solar active period is stronger than in a solar quiet period. (2 The magnitude of negative Bzmin is larger in a solar active period than in a quiet period. (3 Solar wind speed in an active period is faster than in a quiet period. (4 VBsmax in an active period is much larger than in a quiet period. (5 Solar wind parameters, Bzmin, Vmax and VBsmax are correlated well with geomagnetic storm intensity, Dstmin during a solar active period. (6 Solar wind parameters, Bzmin, and VBsmax are not correlated well (very poorly for Vmax with geomagnetic storm intensity during a solar quiet period. (7 The speed of the solar wind plays a key role in the correlation of solar wind parameters vs. the intensity of a geomagnetic storm. (8 More severe storms with Dstmin≤−100 nT caused by MCs occurred in the solar active period than in the solar quiet period.
International Nuclear Information System (INIS)
Kalinin, Yu.D.; Kiselev, V.M.
1980-01-01
A possibility of the presence of statistic relation between the changes of the Earth rotation regime and the mean velocity of solar wind is discussed. The ratio between the solar wind velocity observed and planetary index of geomagnetic activity am is used to determine the annual average values of solar wind velocity beyond the twentieth cycle of solar activity. The restored changes of solar wind velocity are compared with solar conditioned variations of the Earth day duration and it is shown that the correspondence takes place only at frequencies lower the frequency of 11-year cycle [ru
DEFF Research Database (Denmark)
Mursula, K.; Zieger, B.
2001-01-01
A significant and very similar annual variation in solar wind speed and in geomagnetic activity was recently found around all the four solar cycle minima covered by direct SW observations since mid-1960's. We have shown that the phase of this annual variation reverses with the Sun's polarity...... reversal, depicting a new form of 22-year periodicity. The annual variation results from a small north-south asymmetry in SW speed distribution where the minimum speed region is shifted toward the northern magnetic hemisphere. Here we study the very long-term evolution of the annual variation using early...... registrations of geomagnetic activity. We find a significant annual variation during the high-activity solar cycles in mid-19th century and since 1930's. Most interestingly, the SW speed asymmetry in mid-19th century was opposite to the present asymmetry, i.e., the minimum speed region was then shifted toward...
Pc3 activity at low geomagnetic latitudes: a comparison with solar wind observations
Energy Technology Data Exchange (ETDEWEB)
Villante, U.; Lepidi, S.; Vellante, M. (L' Aquila Univ. (Italy). Dip. di Fisica); Lazarus, A.J. (Massachusetts Inst. of Tech., Cambridge, MA (United States). Center for Space Research Massachusetts Inst. of Tech., Cambridge, MA (United States). Dept. of Physics); Lepping, R.P. (National Aeronautics and Space Administration, Greenbelt, MD (United States). Goddard Space Flight Center)
1992-10-01
On an hourly time-scale the different roles of the solar wind and interplanetary magnetic field (IMF) parameters on ground micropulsation activity can be better investigated than at longer time-scales. A long-term comparison between ground measurements made at L'Aquila (L [approx equal] 1.6) and IMP 8 observations confirms the solar wind speed as the key parameter for the onset of pulsations even at low latitudes, although additional control of the energy transfer from the interplanetary medium to the Earth's magnetosphere is clearly exerted by the cone angle. Above [approx equal] 20 mHz the frequency of pulsations is confirmed to be closely related to the IMF magnitude while, in agreement with model predictions, the IMF magnitude is related to the amplitude of the local fundamental resonant mode. We provide an interesting example in which high resolution measurements simultaneously obtained in the foreshock region and on the ground show that external transversal fluctuations do not penetrate deep into the low latitude magnetosphere. (Author).
Variations of Solar Non-axisymmetric Activity
Gyenge, N.; Baranyi, T.; Ludmány, A.
The temporal behaviour of solar active longitudes has been examined by using two sunspot catalogues, the Greenwich Photoheliographic Results (GPR) and the Debrecen Photoheliographic Data (DPD). The time-longitude diagrams of the activity distribution reveal the preferred longitudinal zones and their migration with respect to the Carrington frame. The migration paths outline a set of patterns in which the activity zone has alternating prograde/retrograde angular velocities with respect to the Carrington rotation rate. The time profiles of these variations can be described by a set of successive parabolae. Two similar migration paths have been selected from these datasets, one northern path during cycles 21 - 22 and one southern path during cycles 13 - 14, for closer examination and comparison of their dynamical behaviours. The rates of sunspot emergence exhibited in both migration paths similar periodicities, close to 1.3 years. This behaviour may imply that the active longitude is connected to the bottom of convection zone.
Models of the quiet and active solar atmosphere from Harvard OSO data.
Noyes, R. W.
1971-01-01
Review of some Harvard Observatory programs aimed at defining the physical conditions in quiet and active solar regions on the basis of data obtained from the OSO-IV and OSO-VI spacecraft. The spectral range covered is from 300 A to 1400 A. This spectral range consists of emission lines and continua from abundant elements such as hydrogen, helium, carbon, nitrogen, oxygen, silicon, magnesium, aluminum, neon, iron, and calcium in various ionization states ranging from neutral to 15 times ionized. The structure is discussed of the quiet solar atmosphere as deduced from center-to-limb behavior of spectral lines and continua formed in the chromosphere and corona. In reviewing investigations of solar active regions, it is shown that the structure of these regions varies in a complicated manner from point to point. The local structure is influenced by factors such as the magnetic field configuration within the active region and the age or evolutionary state of the region.
2013-09-04
... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [B-43-2013] Subzone 8I, Authorization of Production Activity, Whirlpool Corporation (Washing Machines); Clyde and Green Springs, Ohio On May 1, 2013, Whirlpool Corporation (Whirlpool) submitted a notification of proposed production activity to the Foreign...
Madhav Haridas, M. K.; Manju, G.; Arunamani, T.
2018-05-01
A comprehensive analysis using nearly two decades of ionosonde data is carried out on the seasonal and solar cycle variations of Equatorial Spread F (ESF) irregularities over magnetic equatorial location Trivandrum (8.5°N, 77°E). The corresponding Rayleigh Taylor (RT) instability growth rates (γ) are also estimated. A seasonal pattern of ESF occurrence and the corresponding γ is established for low solar (LSA), medium solar (MSA) and high solar (HSA) activity periods. For LSA, it is seen that the γ maximizes during post sunset time with comparable magnitudes for autumnal equinox (AE), vernal equinox (VE) and winter solstice (WS), while for summer solstice (SS) it maximizes in the post-midnight period. Concurrent responses are seen in the ESF occurrence pattern. For MSA, γ maximizes during post-sunset for VE followed by WS and AE while SS maximises during post-midnight period. The ESF occurrence for MSA is highest for VE (80%), followed by AE (70%), WS (60%) and SS (50%). In case of HSA, maximum γ occurs for VE followed by AE, WS and SS. The concurrent ESF occurrence maximizes for VE and AE (90%), WS and SS at 70%. The solar cycle variation of γ is examined. γ shows a linear variation with F10.7 cm flux. Further, ESF percentage occurrence and duration show an exponential and linear variation respectively with γ. An empirical model on the solar activity dependence of ESF occurrence and sustenance time over Indian longitudes is arrived at using the database spanning two solar cycles for the first time.
National Oceanic and Atmospheric Administration, Department of Commerce — Collection includes a variety of indices related to solar activity contributed by a number of national and private solar observatories located worldwide. This...
Solar Indices - Solar Ultraviolet
National Oceanic and Atmospheric Administration, Department of Commerce — Collection includes a variety of indices related to solar activity contributed by a number of national and private solar observatories located worldwide. This...
National Oceanic and Atmospheric Administration, Department of Commerce — Collection includes a variety of indices related to solar activity contributed by a number of national and private solar observatories located worldwide. This...
Solar Indices - Solar Irradiance
National Oceanic and Atmospheric Administration, Department of Commerce — Collection includes a variety of indices related to solar activity contributed by a number of national and private solar observatories located worldwide. This...
DATA ASSIMILATION APPROACH FOR FORECAST OF SOLAR ACTIVITY CYCLES
Energy Technology Data Exchange (ETDEWEB)
Kitiashvili, Irina N., E-mail: irina.n.kitiashvili@nasa.gov [NASA Ames Research Center, Moffett Field, Mountain View, CA 94035 (United States)
2016-11-01
Numerous attempts to predict future solar cycles are mostly based on empirical relations derived from observations of previous cycles, and they yield a wide range of predicted strengths and durations of the cycles. Results obtained with current dynamo models also deviate strongly from each other, thus raising questions about criteria to quantify the reliability of such predictions. The primary difficulties in modeling future solar activity are shortcomings of both the dynamo models and observations that do not allow us to determine the current and past states of the global solar magnetic structure and its dynamics. Data assimilation is a relatively new approach to develop physics-based predictions and estimate their uncertainties in situations where the physical properties of a system are not well-known. This paper presents an application of the ensemble Kalman filter method for modeling and prediction of solar cycles through use of a low-order nonlinear dynamo model that includes the essential physics and can describe general properties of the sunspot cycles. Despite the simplicity of this model, the data assimilation approach provides reasonable estimates for the strengths of future solar cycles. In particular, the prediction of Cycle 24 calculated and published in 2008 is so far holding up quite well. In this paper, I will present my first attempt to predict Cycle 25 using the data assimilation approach, and discuss the uncertainties of that prediction.
ON THE NON-KOLMOGOROV NATURE OF FLARE-PRODUCTIVE SOLAR ACTIVE REGIONS
Energy Technology Data Exchange (ETDEWEB)
Mandage, Revati S. [Physics and Astronomy Department, Rice University, 6100 Main MS-61, Houston, TX 77005-1827 (United States); McAteer, R. T. James, E-mail: mcateer@nmsu.edu [Department of Astronomy, New Mexico State University, MSC 4500, Las Cruces, NM 88001 (United States)
2016-12-20
A magnetic power spectral analysis is performed on 53 solar active regions, observed from 2011 August to 2012 July. Magnetic field data obtained from the Helioseismic and Magnetic Imager, inverted as Active Region Patches, are used to study the evolution of the magnetic power index as each region rotates across the solar disk. Active regions are classified based on the numbers and sizes of solar flares they produce in order to study the relationship between flare productivity and the magnetic power index. The choice of window size and inertial range plays a key role in determining the correct magnetic power index. The overall distribution of magnetic power indices has a range of 1.0–2.5. Flare-quiet regions peak at a value of 1.6. However, flare-productive regions peak at a value of 2.2. Overall, the histogram of the distribution of power indices of flare-productive active regions is well separated from flare-quiet active regions. Only 12% of flare-quiet regions exhibit an index greater than 2, whereas 90% of flare-productive regions exhibit an index greater than 2. Flare-quiet regions exhibit a high temporal variance (i.e., the index fluctuates between high and low values), whereas flare-productive regions maintain an index greater than 2 for several days. This shows the importance of including the temporal evolution of active regions in flare prediction studies, and highlights the potential of a 2–3 day prediction window for space weather applications.
Kumar Biswas, Bishyajit; Malpani, Yashwardhan R; Ha, Neul; Kwon, Do-Hyun; Soo Shin, Jin; Kim, Hae-Soo; Kim, Chonsaeng; Bong Han, Soo; Lee, Chong-Kyo; Jung, Young-Sik
2017-08-01
Members of a series of 4-aryl-6,7,8,9-tetrahydrobenzo[4,5]thieno[3,2-e][1,2,4]triazolo[4,3-a]pyrimidin-5(4H)-ones (1, Fig. 2) were prepared and tested against representative enteroviruses including Human Coxsackievirus B1 (Cox B1), Human Coxsackievirus B3 (Cox B3), human Poliovirus 3 (PV3), human Rhinovirus 14 (HRV14), human Rhinovirus 21 (HRV 21) and human Rhinovirus 71 (HRV 71). The C-8-tert-butyl group on the tetrahydrobenzene ring in these substances was found to be crucial for their enterovirus activity. One member of this group, 1e, showed single digit micromolar activities (1.6-8.85μM) against a spectrum of viruses screened, and the highest selectivity index (SI) values for Cox B1 (>11.2), for Cox B3 (>11.5), and for PV3 (>51.2), respectively. In contrast, 1p, was the most active analog against the selected HRVs (1.8-2.6μM), and showed the highest selectivity indices among the group of compounds tested. The SI values for 1p were 11.5 for HRV14, 8.4 for HRV21, and 12.1 for HRV71, respectively. Copyright © 2017 Elsevier Ltd. All rights reserved.
Morphology of equatorial plasma bubbles during low and high solar activity years over Indian sector
Kumar, Sanjay
2017-05-01
In the present study, slant total electron content (STEC) data computed from ground based GPS measurements over Hyderabad (Geog. Lat. 17.41° N, geog. long. 78.55° E, mag. lat. 08.81° N) and two close stations at Bangalore (Geog. Lat. 13.02°/13.03° N, geog. long. 77.57°/77.51° E, mag. lat. 04.53°/04.55° N) in Indian region during 2007-2012, have been used to study the occurrences and characteristics of equatorial plasma bubbles (EPBs). The analysis found maximum EPB occurrences during the equinoctial months and minimum during the December solstice throughout 2007-2012 except during the solar minimum years in 2007-2009. During 2007-2009, the maximum EPB occurrences were observed in June solstice which could not be predicted by the model proposed by Tsunoda (J. Geophys. Res., 90:447-456, 1985). The equinox maximum in EPB occurrences for high solar activity years could be caused by the vertical F-layer drift due to pre-reversal electric field (PRE), and expected to be maximum when day-night terminator aligns with the magnetic meridian i.e. during the equinox months whereas maximum occurrences during the solstice months of solar minimum could be caused by the seed perturbation in plasma density induced by gravity waves from tropospheric origins. Generally EPB occurrences are found to be more prominent during nighttime hours (2000-2400 hours) than the daytime hours. Peak in EPB occurrences is in early night for high solar activity years whereas same is late night for low solar activity. The day and nighttime EPB occurrences have been analyzed and found to vary in accordance with solar activity with an annual correlation coefficient (R) of ˜0.99 with F_{10.7} cm solar Flux. Additionally, solar activity influence on EPB occurrences is seasonal dependent with a maximum influence during the equinox season (R=0.88) and a minimum during winter season (R =0.73). The solar activity influences on EPB occurrences are found in agreement with the previous works reported in
International Nuclear Information System (INIS)
Meliss, M.
1996-01-01
In North-Rhine Westphalia, the Ministry for Science and Research and the Ministry for Economic Affairs, Medium-Sized Companies and Technology (MWF) in 1991 decided to jointly establish a research and technology association called AG Solar NRW, intended to function as a central body for promotion and coordination of existing but dispersed projects and activities in North-Rhine Westphalia for research into and development of solar technology and energy systems, and for promotion of demonstration projects and training programmes supporting enhanced use of solar energy. The total budget made available for activities of the AG Solar in phase 1 (1991 - 1995) was approx. DM 60 million. The article in hand summarizes the main activities and results achieved in this first phase which was committed to decentralized energy systems, performance testing and qualification. (orig.) [de
Estimate of the upper limit of amplitude of Solar Cycle No. 23
Energy Technology Data Exchange (ETDEWEB)
Silbergleit, V. M; Larocca, P. A [Departamento de Fisica, UBA (Argentina)
2001-07-01
AA* indices of values greater than 60 10{sup -9} Tesla are considered in order to characterize geomagnetic storms since the available series of these indices comprise the years from 1868 to 1998 (The longest existing interval of geomagnetic activity). By applying the precursor technique we have performed an analysis of the storm periods and the solar activity, obtaining a good correlation between the number of storms ({alpha})(characterized by the AA* indices) and the amplitudes of each solar cycle ({zeta}) and those of the next ({mu}). Using the multiple regression method applied to {alpha}=A+B{zeta} +C{mu}, the constants are calculated and the values found are: A=-33 {+-}18, B= 0.74{+-}0.13 y C= 0.56{+-}0.13. The present statistical method indicates that the current solar cycle (number 23) would have an upper limit of 202{+-}57 monthy mean sunspots. This value indicates that the solar activity would be high causing important effects on the Earth's environment. [Spanish] Se consideran los valores de los indices AA* de valor mayor que 60 10{sup -9} Tesla para caracterizar tormentas geomagneticas ya que las series disponibles de estos indices van desde 1868 hasta 1998 (el mas largo intervalo de la actividad geomagnetica existente). Aplicando la tecnica del precursor hemos realizado un analisis de los periodos de tormentas y la actividad solar obteniendo una buena correlacion entre el numero de tormentas ({alpha}) (caracterizado por los indices AA*) y las amplitudes de los ciclos solares corriente ({zeta}) y el proximo ({mu}). Usando el metodo de regresion multiple aplicado a {alpha}=A+B{zeta} +C{mu}, las consonantes resultaron: A=-33 {+-}18, B= 0.74{+-}0.13 y C= 0.56{+-}0.13. El metodo estadistico presentado indica que el ciclo actual (numero 23) tendria un pico de 202{+-} 57 manchas mensuales promedio. Este valor indica que la actividad solar seria alta produciendo importantes efectos en el medio ambiente terrestre.
Periodic analysis of solar activity and its link with the Arctic oscillation phenomenon
Energy Technology Data Exchange (ETDEWEB)
Qu, Weizheng; Li, Chun; Du, Ling; Huang, Fei [Ocean University of China, 14-1' -601, 2117 Jinshui Road, Qingdao 266100 (China); Li, Yanfang, E-mail: quweizhe@ouc.edu.cn [Yantai Institute of Coastal Zone Research Chinese Academy of Sciences (China)
2014-12-01
Based on spectrum analysis, we provide the arithmetic expressions of the quasi 11 yr cycle, 110 yr century cycle of relative sunspot numbers, and quasi 22 yr cycle of solar magnetic field polarity. Based on a comparative analysis of the monthly average geopotential height, geopotential height anomaly, and temperature anomaly of the northern hemisphere at locations with an air pressure of 500 HPa during the positive and negative phases of AO (Arctic Oscillation), one can see that the abnormal warming period in the Arctic region corresponds to the negative phase of AO, while the anomalous cold period corresponds to its positive phase. This shows that the abnormal change in the Arctic region is an important factor in determining the anomalies of AO. In accordance with the analysis performed using the successive filtering method, one can see that the AO phenomenon occurring in January shows a clear quasi 88 yr century cycle and quasi 22 yr decadal cycle, which are closely related to solar activities. The results of our comparative analysis show that there is a close inverse relationship between the solar activities (especially the solar magnetic field index changes) and the changes in the 22 yr cycle of the AO occurring in January, and that the two trends are basically opposite of each other. That is to say, in most cases after the solar magnetic index MI rises from the lowest value, the solar magnetic field turns from north to south, and the high-energy particle flow entering the Earth's magnetosphere increases to heat the polar atmosphere, thus causing the AO to drop from the highest value; after the solar magnetic index MI drops from the highest value, the solar magnetic field turns from south to north, and the solar high-energy particle flow passes through the top of the Earth's magnetosphere rather than entering it to heat the polar atmosphere. Thus the polar temperature drops, causing the AO to rise from the lowest value. In summary, the variance
Solar Energy Education. Social studies: activities and teacher's guide. Field test edition
Energy Technology Data Exchange (ETDEWEB)
1982-01-01
Solar energy information is made available to students through classroom instruction by way of the Solar Energy Education teaching manuals. In this manual solar energy, as well as other energy sources like wind power, is introduced by performing school activities in the area of social studies. A glossary of energy related terms is included. (BCS)
González, Juan A; Rosa, Mariana; Parrado, María F; Hilal, Mirna; Prado, Fernando E
2009-08-03
Morphological and physiological responses of seedlings to different solar UV-B irradiances were evaluated in two varieties of quinoa (Chenopodium quinoa Willd.), a crop species from Andean region of South America. Cristalina and Chucapaca varieties were grown at 1965m a.s.l in a glasshouse under natural light conditions for 18 days, and then transferred to outdoors under near-ambient (+UV-B) and strongly reduced (-UV-B) solar UV-B radiation. Exposition to -UV-B increased cotyledon area and seedling height in Cristalina variety whereas leaf number decreased compared to +UV-B. By contrast Chucapaca variety was not affected by UV-B treatments. Seedling fresh weight (FW), root length and leaf thickness did not show significant differences between +UV-B and -UV-B treatments. Mesophyll tissue was slightly affected by solar UV-B reduction. Chlorophyll content was differentially affected by UV-B treatments. Under +UV-B the highest value was observed in Cristalina variety, while in Chucapaca it was observed under -UV-B treatment. Chlorophyll content was slightly higher in leaves than in cotyledons, but there was no difference in the distribution pattern. Chlorophyll a/b ratio and carotenoid content did not show significant differences between UV-B treatments. Leaf UVB-absorbing compounds showed significant differences between UV-B treatments in Chucapaca only, while there were no significant differences in Cristalina variety. UVB-absorbing compounds of cotyledons did not show significant differences between +UV-B and -UV-B treatments. Sucrose, glucose and fructose showed different distribution patterns in cotyledons and leaves of the two varieties under near-ambient and strongly reduced UV-B. Results demonstrated that varieties of quinoa exhibit different morphological and physiological responses to changes in solar UV-B irradiance, but these responses cannot be used to predict the sensitivity to solar UV-B during a short-term exposition. Also, this study can be useful to
Coulomb dissociation of 8B at 254 MeV/u
International Nuclear Information System (INIS)
Surowka, G.; Iwasa, N.; Boue, F.
1999-01-01
As an alternative method to determine the cross section of 7 Be (p, γ) 8 B, the Coulomb dissociation reaction 8 B → 7 Be + p at E inc = 254 MeV/u was measured. Our preliminary results show the dominant role of the dipole excitation in the Coulomb break-up process. The extracted astrophysical S 17 factor is consistent with the lower-value results both of the direct-capture studies, and the RIKEN Coulomb-dissociation experiment at ∼ 50 MeV/u. (author)
Inhibitory effects of ambient levels of solar UV-A and UV-B radiation on growth of cucumber
International Nuclear Information System (INIS)
Krizek, D.T.; Mirecki, R.M.; Britz, S.J.
1997-01-01
The influence of solar UV-A and UV-B radiation at Beltsville, Maryland, on growth and flavonoid content in four cultivars of Cucumis sativus L. (Ashley, Poinsett, Marketmore, and Salad Bush cucumber) was examined during the summers of 1994 and 1995. Plants were grown from seed in UV exclusion chambers consisting of UV-transmitting Plexiglas, lined with Llumar to exclude UV-A and UV-B, polyester to exclude UV-B, or cellulose acetate to transmit UV-A and UV-B. Despite previously determined differences in sensitivity to supplemental UV-B radiation, all four cultivars responded similarly to UV-B exclusion treatment. After 19–21 days, the four cultivars grown in the absence of solar UV-B (polyester) had an average of 34, 55, and 40% greater biomass of leaves, stems, and roots, respectively, 27% greater stem height, and 35% greater leaf area than those grown under ambient UV-B (cellulose acetate). Plants protected from UV-A radiation as well (Llumar) showed an additional 14 and 22% average increase, respectively, in biomass of leaves and stems, and a 22 and 19% average increase, respectively, in stem elongation and leaf area over those grown under polyester. These findings demonstrate the extreme sensitivity of cucumber not only to present levels of UV-B but also to UV-A and suggest that even small changes in ozone depletion may have important biological consequences for certain plant species. (author)
Directory of Open Access Journals (Sweden)
Kai Bischof
2003-09-01
Full Text Available The generation of reactive oxygen species (ROS and scavenging of the superoxide radical by superoxide dismutase (SOD was studied in mat-like canopies of the green macroalga Ulva rotundata Bliding in a tidal brine pond system in southern Spain. Artificial canopies were covered with different cut-off filters, generating different radiation conditions. ROS and SOD were assessed after three days of exposure. ROS induced lipid peroxidation depended on the position of individual thalli within the canopy and on radiation conditions. Samples exposed to the full solar spectrum were most affected, whereas samples either exposed to photosynthetically active radiation (PAR alone or UV radiation without PAR exhibited fewer peroxidation products. The activity of SOD appeared to be controlled by the impinging UV-A and UV-B radiation and also increased in response to oxidative stress. The results provide evidence for additive effects of high PAR and UV-B under field conditions and support the previously proposed hypothesis that UV-B effects are mediated by an inhibition of the xanthophyll cycle, which increases ROS production and, consequently, causes oxidative damage to components of the photosynthetic machinery, such as proteins and pigments.
Hernández, Klaudia L; Yannicelli, Beatriz; Olsen, Lasse M; Dorador, Cristina; Menschel, Eduardo J; Molina, Verónica; Remonsellez, Francisco; Hengst, Martha B; Jeffrey, Wade H
2016-01-01
In high altitude environments, extreme levels of solar radiation and important differences of ionic concentrations over narrow spatial scales may modulate microbial activity. In Salar de Huasco, a high-altitude wetland in the Andean mountains, the high diversity of microbial communities has been characterized and associated with strong environmental variability. Communities that differed in light history and environmental conditions, such as nutrient concentrations and salinity from different spatial locations, were assessed for bacterial secondary production (BSP, 3 H-leucine incorporation) response from short-term exposures to solar radiation. We sampled during austral spring seven stations categorized as: (a) source stations, with recently emerged groundwater (no-previous solar exposure); (b) stream running water stations; (c) stations connected to source waters but far downstream from source points; and (d) isolated ponds disconnected from ground sources or streams with a longer isolation and solar exposure history. Very high values of 0.25 μE m -2 s -1 , 72 W m -2 and 12 W m -2 were measured for PAR, UVA, and UVB incident solar radiation, respectively. The environmental factors measured formed two groups of stations reflected by principal component analyses (near to groundwater sources and isolated systems) where isolated ponds had the highest BSP and microbial abundance (35 microalgae taxa, picoeukaryotes, nanoflagellates, and bacteria) plus higher salinities and PO 4 3- concentrations. BSP short-term response (4 h) to solar radiation was measured by 3 H-leucine incorporation under four different solar conditions: full sun, no UVB, PAR, and dark. Microbial communities established in waters with the longest surface exposure (e.g., isolated ponds) had the lowest BSP response to solar radiation treatments, and thus were likely best adapted to solar radiation exposure contrary to ground source waters. These results support our light history (solar exposure
Research on ZnO/Si heterojunction solar cells
Chen, Li; Chen, Xinliang; Liu, Yiming; Zhao, Ying; Zhang, Xiaodan
2017-06-01
We put forward an n-ZnO/p-Si heterojunction solar cell model based on AFORS-HET simulations and provide experimental support in this article. ZnO:B (B-doped ZnO) thin films deposited by metal-organic chemical vapor deposition (MOCVD) are planned to act as electrical emitter layer on p-type c-Si substrate for photovoltaic applications. We investigate the effects of thickness, buffer layer, ZnO:B affinity and work function of electrodes on performances of solar cells through computer simulations using AFORS-HET software package. The energy conversion efficiency of the ZnO:B(n)/ZnO/c-Si(p) solar cell can achieve 17.16% ({V}{oc}: 675.8 mV, {J}{sc}: 30.24 mA/cm2, FF: 83.96%) via simulation. On a basis of optimized conditions in simulation, we carry out some experiments, which testify that the ZnO buffer layer of 20 nm contributes to improving performances of solar cells. The influences of growth temperature, thickness and diborane (B2H6) flow rates are also discussed. We achieve an appropriate condition for the fabrication of the solar cells using the MOCVD technique. The obtained conversion efficiency reaches 2.82% ({V}{oc}: 294.4 mV, {J}{sc}: 26.108 mA/cm2, FF: 36.66%). Project supported by the State Key Development Program for Basic Research of China (Nos. 2011CBA00706, 2011CBA00707), the Tianjin Applied Basic Research Project and Cutting-Edge Technology Research Plan (No. 13JCZDJC26900), the Tianjin Major Science and Technology Support Project (No. 11TXSYGX22100), the National High Technology Research and Development Program of China (No. 2013AA050302), and the Fundamental Research Funds for the Central Universities (No. 65010341).
Expression and biological activity of the cystine knot bioinsecticide PA1b (Pea Albumin 1 Subunit b.
Directory of Open Access Journals (Sweden)
Vanessa Eyraud
Full Text Available The PA1b (Pea Albumin 1, subunit b peptide is an entomotoxin extract from Legume seeds with lethal activity on several insect pests, such as mosquitoes, some aphids and cereal weevils. This 37 amino-acid cysteine-rich peptide has been, until now, obtained by biochemical purification or chemical synthesis. In this paper, we present our results for the transient production of the peptide in Nicotiana benthamiana by agro-infiltration, with a yield of about 35 µg/g of fresh leaves and maximum production 8 days after infiltration. PA1b is part of the PA1 gene which, after post-translational modifications, encodes two peptides (PA1b and PA1a. We show that transforming tobacco with the PA1b cDNA alone does not result in production of the toxin and, in fact, the entire cDNA is necessary, raising the question of the role of PA1a. We constructed a PA1-cassette, allowing for the quick "cut/paste" of different PA1b mutants within a conserved PA1 cDNA. This cassette enabled us to produce the six isoforms of PA1b which exist in pea seeds. Biological tests revealed that all the isoforms display similar activity, with the exception of one which is inactive. The lack of activity in this isoform led us to conclude that the amphiphilic nature of the peptide is necessary for activity. The possible applications of this expression system for other cysteine-rich biomolecules are discussed.
Martucci, M.; Munini, R.; Boezio, M.; Di Felice, V.; Adriani, O.; Barbarino, G. C.; Bazilevskaya, G. A.; Bellotti, R.; Bongi, M.; Bonvicini, V.; Bottai, S.; Bruno, A.; Cafagna, F.; Campana, D.; Carlson, P.; Casolino, M.; Castellini, G.; De Santis, C.; Galper, A. M.; Karelin, A. V.; Koldashov, S. V.; Koldobskiy, S.; Krutkov, S. Y.; Kvashnin, A. N.; Leonov, A.; Malakhov, V.; Marcelli, L.; Marcelli, N.; Mayorov, A. G.; Menn, W.; Mergè, M.; Mikhailov, V. V.; Mocchiutti, E.; Monaco, A.; Mori, N.; Osteria, G.; Panico, B.; Papini, P.; Pearce, M.; Picozza, P.; Ricci, M.; Ricciarini, S. B.; Simon, M.; Sparvoli, R.; Spillantini, P.; Stozhkov, Y. I.; Vacchi, A.; Vannuccini, E.; Vasilyev, G.; Voronov, S. A.; Yurkin, Y. T.; Zampa, G.; Zampa, N.; Potgieter, M. S.; Raath, J. L.
2018-02-01
Precise measurements of the time-dependent intensity of the low-energy (solar activity periods, i.e., from minimum to maximum, are needed to achieve comprehensive understanding of such physical phenomena. The minimum phase between solar cycles 23 and 24 was peculiarly long, extending up to the beginning of 2010 and followed by the maximum phase, reached during early 2014. In this Letter, we present proton differential spectra measured from 2010 January to 2014 February by the PAMELA experiment. For the first time the GCR proton intensity was studied over a wide energy range (0.08–50 GeV) by a single apparatus from a minimum to a maximum period of solar activity. The large statistics allowed the time variation to be investigated on a nearly monthly basis. Data were compared and interpreted in the context of a state-of-the-art three-dimensional model describing the GCRs propagation through the heliosphere.
Didkovsky, Leonid; Wieman, Seth; Woods, Thomas
2016-10-01
The Extreme ultraviolet Spectrophotometer (ESP), one of the channels of SDO's Extreme ultraviolet Variability Experiment (EVE), measures solar irradiance in several EUV and soft x-ray (SXR) bands isolated using thin-film filters and a transmission diffraction grating, and includes a quad-diode detector positioned at the grating zeroth-order to observe in a wavelength band from about 0.1 to 7.0 nm. The quad diode signal also includes some contribution from shorter wavelength in the grating's first-order and the ratio of zeroth-order to first-order signal depends on both source geometry, and spectral distribution. For example, radiometric calibration of the ESP zeroth-order at the NIST SURF BL-2 with a near-parallel beam provides a different zeroth-to-first-order ratio than modeled for solar observations. The relative influence of "uncalibrated" first-order irradiance during solar observations is a function of the solar spectral irradiance and the locations of large Active Regions or solar flares. We discuss how the "uncalibrated" first-order "solar" component and the use of variable solar reference spectra affect determination of absolute SXR irradiance which currently may be significantly overestimated during high solar activity.
Energy Storage and Release through the Solar Activity Cycle Models Meet Radio Observations
Nindos, Alexander
2012-01-01
For nearly sixty years, radio observations have provided a unique insight into the physics of the active and quiescent solar atmosphere. Thanks to the variety of emission mechanisms and to the large altitude range available to observations, fundamental plasma parameters have been measured from the low chromosphere to the upper corona and interplanetary medium. This book presents current research in solar radio astronomy and shows how well it fits in the exceptional scientific context brought by the current space solar observatories. It essentially contains contributed research and review papers presented during the 2010 Community of European Solar Radio Astronomers (CESRA) meeting, which took place in Belgium in June 2010. This book is aimed at graduate students and researchers working in solar physics and space science. Previously published in Solar Physics journal, Vol. 273/2, 2011.
Energy Technology Data Exchange (ETDEWEB)
Raphaldini, Breno; Raupp, Carlos F. M., E-mail: brenorfs@gmail.com, E-mail: carlos.raupp@iag.usp.br [Instituto de Astronomia, Geofísica e Ciências Atmosféricas, Departamento de Geofísica, Rua do Matão, 1226-Cidade Universitária São Paulo-SP 05508-090 (Brazil)
2015-01-20
The solar dynamo is known to be associated with several periodicities, with the nearly 11/22 yr cycle being the most pronounced one. Even though these quasiperiodic variations of solar activity have been attributed to the underlying dynamo action in the Sun's interior, a fundamental theoretical description of these cycles is still elusive. Here, we present a new possible direction in understanding the Sun's cycles based on resonant nonlinear interactions among magnetohydrodynamic (MHD) Rossby waves. The WKB theory for dispersive waves is applied to magnetohydrodynamic shallow-water equations describing the dynamics of the solar tachocline, and the reduced dynamics of a resonant triad composed of MHD Rossby waves embedded in constant toroidal magnetic field is analyzed. In the conservative case, the wave amplitudes evolve periodically in time, with periods on the order of the dominant solar activity timescale (∼11 yr). In addition, the presence of linear forcings representative of either convection or instabilities of meridionally varying background states appears to be crucial in balancing dissipation and thus sustaining the periodic oscillations of wave amplitudes associated with resonant triad interactions. Examination of the linear theory of MHD Rossby waves embedded in a latitudinally varying mean flow demonstrates that MHD Rossby waves propagate toward the equator in a waveguide from –35° to 35° in latitude, showing a remarkable resemblance to the structure of the butterfly diagram of the solar activity. Therefore, we argue that resonant nonlinear magnetohydrodynamic Rossby wave interactions might significantly contribute to the observed cycles of magnetic solar activity.
The onset of the solar active cycle 22
International Nuclear Information System (INIS)
Ahluwalia, H.S.
1989-01-01
There is a great deal of interest in being able to predict the main characteristics of a solar activity cycle (SAC). One would like to know, for instance, how large the amplitude (R sub m) of a cycle is likely to be, i.e., the annual mean of the sunspot numbers at the maximum of SAC. Also, how long a cycle is likely to last, i.e., its period. It would also be interesting to be able to predict the details, like how steep the ascending phase of a cycle is likely to be. Questions like these are of practical importance to NASA in planning the launch schedule for the low altitude, expensive spacecrafts like the Hubble Space Telescope, the Space Station, etc. Also, one has to choose a proper orbit, so that once launched the threat of an atmospheric drag on the spacecraft is properly taken into account. Cosmic ray data seem to indicate that solar activity cycle 22 will surpass SAC 21 in activity. The value of R sub m for SAC 22 may approach that of SAC 19. It would be interesting to see whether this prediction is borne out. Researchers are greatly encouraged to proceed with the development of a comprehensive prediction model which includes information provided by cosmic ray data
The onset of the solar active cycle 22
Ahluwalia, H. S.
1989-01-01
There is a great deal of interest in being able to predict the main characteristics of a solar activity cycle (SAC). One would like to know, for instance, how large the amplitude (R sub m) of a cycle is likely to be, i.e., the annual mean of the sunspot numbers at the maximum of SAC. Also, how long a cycle is likely to last, i.e., its period. It would also be interesting to be able to predict the details, like how steep the ascending phase of a cycle is likely to be. Questions like these are of practical importance to NASA in planning the launch schedule for the low altitude, expensive spacecrafts like the Hubble Space Telescope, the Space Station, etc. Also, one has to choose a proper orbit, so that once launched the threat of an atmospheric drag on the spacecraft is properly taken into account. Cosmic ray data seem to indicate that solar activity cycle 22 will surpass SAC 21 in activity. The value of R sub m for SAC 22 may approach that of SAC 19. It would be interesting to see whether this prediction is borne out. Researchers are greatly encouraged to proceed with the development of a comprehensive prediction model which includes information provided by cosmic ray data.
North-South asymmetry of interplanetary plasma and solar parameters
International Nuclear Information System (INIS)
El-Borie, M. A.
2001-01-01
Data of interplanetary plasma (field magnitude, solar wind speed, ion plasma density and temperature) and solar parameters (sunspot number, solar radio flux, and geomagnetic index) over the period 1965-1991, have been used to examine the asymmetry between the solar field north and south of the heliospheric current sheet (HCS). The dependence of N-S asymmetry of field magnitude (B) upon the interplanetary solar polarities is statistically insignificant. There is no clear indication for the presence of N-S asymmetry in the grand-average field magnitude over the solar cycles. During the period 1981-89 (qA<0; negative solar polarity state), the solar plasma was more dense and cooler south of the HCS than north of it. The solar flux component of toward field vector is larger in magnitude than those of away field vector during the qA<0 epoch, and no asymmetry observed in the qA<0 epoch. Furthermore, the sign of the N-S asymmetry in the solar activity depends positively upon the solar polarity state. In addition, it was studied the N-S asymmetry of solar parameters near the HCS, throughout the periods of northern and southern hemispheres were more active than the other. Some asymmetries (with respect to the HCS) in plasma parameters existed during the periods of southern hemisphere predominance
Abundance variations in solar active regions
Strong, K. T.; Lemen, J. R.; Linford, G. A.
1991-01-01
The diversity in the published values of coronal abundances is unsettling, especially as the range of results seems to be beyond the quoted uncertainties. Measurements of the relative abundance of iron and neon derived from soft X-ray spectra of active regions are presented. From a data base of over 200 spectra taken by the Solar Maximum Mission Flat Crystal Spectrometer, it is found that the relative abundance can vary by as much as a factor of about 7 and can change on timescales of less than 1 h.
Adebesin, B. O.; Rabiu, A. B.; Obrou, O. K.; Adeniyi, J. O.
2018-03-01
The F2 layer peak electron density (NmF2) was investigated over Korhogo (Geomagnetic: 1.26°S, 67.38°E), a station near the magnetic equator in the African sector. Data for 1996 and 2000 were, respectively, categorized into low solar quiet and disturbed and high solar quiet and disturbed. NmF2 prenoon peak was higher than the postnoon peak during high solar activity irrespective of magnetic activity condition, while the postnoon peak was higher for low solar activity. Higher NmF2 peak amplitude characterizes disturbed magnetic activity than quiet magnetic condition for any solar activity. The maximum peaks appeared in equinox. June solstice noontime bite out lagged other seasons by 1-2 h. For any condition of solar and magnetic activities, the daytime NmF2 percentage variability (%VR) measured by the relative standard deviation maximizes/minimizes in June solstice/equinox. Daytime variability increases with increasing magnetic activity. The highest peak in the morning time NmF2 variability occurs in equinox, while the highest evening/nighttime variability appeared in June solstice for all solar/magnetic conditions. The nighttime annual variability amplitude is higher during disturbed than quiet condition regardless of solar activity period. At daytime, variability is similar for all conditions of solar activities. NmF2 at Korhogo is well represented on the International Reference Ionosphere-International Radio Consultative Committee (IRI-CCIR) option. The model/observation relationship performed best between local midnight and postmidnight period (00-08 LT). The noontime trough characteristics is not prominent in the IRI pattern during high solar activity but evident during low solar conditions when compared with Korhogo observations. The Nash-Sutcliffe coefficients revealed better model performance during disturbed activities.
Pietrella, M.; Pezzopane, M.; Fagundes, P. R.; de Jesus, R.; Supnithi, P.; Klinngam, S.; Ezquer, R. G.; Cabrera, M. A.
2017-11-01
A comparative study aimed to investigate the equatorial and low-latitude spread-F occurrences for moderate solar activity (MSA) and high solar activity (HSA), was carried out considering concurrent observations made in some ionospheric stations, which identify three separate longitudinal sectors: Chiang Mai (CGM; 18.8° N, 98.9° E, mag. Lat. 13.2° N) and Chumphon (CPN; 10.7° N, 99.4° E, mag. Lat. 3.2° N), Thailand; Palmas (PAL; 10.2° S, 311.8° E, mag. Lat. 0.9° S) and São José dos Campos (SJC; 23.2° S, 314.1° E, mag. Lat. 14.0° S), Brazil; Tucumán (TUC; 26.9° S, 294.6° E, mag. Lat. 16.8° S), Argentina. Spread-F phenomena recorded during the equinoctial months of September and October 2010, March and April 2011, for MSA, March and April 2014, September and October 2014, for HSA, were classified in two different modes: range spread-F (RSF) and frequency spread-F (FSF). The satellite trace (ST) occurrence was also investigated as possible precursor of spread-F events. When comparing the results of equatorial (CPN and PAL) and low-latitude (CGM, SJC, and TUC) stations, some common features independently of the solar activity emerge: (1) a prevalence of RSF signatures is observed in the time interval 20:00-03:00 LT, while FSF occurrences prevail in the time interval 03:00-06:00 LT; (2) STs are confirmed to be a possible precursor of RSF occurrences. For HSA, at equatorial latitudes, spread-F occurrences in the Thai sector (CPN) are higher than those observed in the Brazilian sector (PAL). When comparing the results of low-latitude stations of CGM, SJC, and TUC some unusual aspects characterizing the morphology of spread-F occurrences emerge: (1) contrary to the Thai and Argentine sectors, in the Brazilian sector (SJC), RSF and FSF appearances in September, for HSA, are observed with relatively long persistence times between about 03:00-06:00 LT and 01:00-03:00 LT respectively, while balanced RSF and FSF occurrences with short persistence times are
Yang, Xu; Hang, Xiaomin; Tan, Jing; Yang, Hong
2015-06-01
Bifidobacteria are common inhabitants of the human gastrointestinal tract, and their application has increased dramatically in recent years due to their health-promoting effects. The ability of bifidobacteria to tolerate acidic environments is particularly important for their function as probiotics because they encounter such environments in food products and during passage through the gastrointestinal tract. In this study, we generated a derivative, Bifidobacterium breve BB8dpH, which displayed a stable, acid-resistant phenotype. To investigate the possible reasons for the higher acid tolerance of B. breve BB8dpH, as compared with its parental strain B. breve BB8, a combined transcriptome and physiological approach was used to characterize differences between the two strains. An analysis of the transcriptome by RNA-sequencing indicated that the expression of 121 genes was increased by more than 2-fold, while the expression of 146 genes was reduced more than 2-fold, in B. breve BB8dpH. Validation of the RNA-sequencing data using real-time quantitative PCR analysis demonstrated that the RNA-sequencing results were highly reliable. The comparison analysis, based on differentially expressed genes, suggested that the acid tolerance of B. breve BB8dpH was enhanced by regulating the expression of genes involved in carbohydrate transport and metabolism, energy production, synthesis of cell envelope components (peptidoglycan and exopolysaccharide), synthesis and transport of glutamate and glutamine, and histidine synthesis. Furthermore, an analysis of physiological data showed that B. breve BB8dpH displayed higher production of exopolysaccharide and lower H(+)-ATPase activity than B. breve BB8. The results presented here will improve our understanding of acid tolerance in bifidobacteria, and they will lead to the development of new strategies to enhance the acid tolerance of bifidobacterial strains. Copyright © 2015 Elsevier Ltd. All rights reserved.
Birthdates of patients affected by mental illness and solar activity: A study from Italy
Ventriglio, Antonio; Borelli, Albacenzina; Bellomo, Antonello; Lepore, Alberto
2011-04-01
PurposeThis epidemiologic study tested an hypothesized association between the year of birth of persons with major mental illnesses and solar activity over the past century. MethodsWe collected data on diagnoses and birthdates of psychiatric patients born between 1926 and 1975 (N = 1954) in south Italy for comparison to yearly solar activity as registered by the International Observatories. ResultsWe found a strong inverse correlation between high solar activity (HSA) and incidence of schizophrenia and bipolar disorder in a 20-year period whereas the incidence of non-affective/non-psychotic disorders was moderately associated with HSA in the same period. ConclusionsInterpretation of the observed correlations between HSA during years of birth and the incidence of mental illnesses remains unclear, but the findings encourage further study.
Data of evolutionary structure change: 1CG8B-2QU0A [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 0 A 2QU0A ence>DLHAHKLRVDP...0 A 2QU0A ence>YFPHF--DLSHG...1CG8B-2QU0A 1CG8 2QU0 B A VKLSEDQEHYIKGVWKDV--DHKQITAKALERVFVVYPW...> 1CG8 B 1CG8B ence>VWKDV--DHKQI...ine> ILE CA 383 2QU0 A 2QU
Solar Irradiance Variability is Caused by the Magnetic Activity on the Solar Surface.
Yeo, Kok Leng; Solanki, Sami K; Norris, Charlotte M; Beeck, Benjamin; Unruh, Yvonne C; Krivova, Natalie A
2017-09-01
The variation in the radiative output of the Sun, described in terms of solar irradiance, is important to climatology. A common assumption is that solar irradiance variability is driven by its surface magnetism. Verifying this assumption has, however, been hampered by the fact that models of solar irradiance variability based on solar surface magnetism have to be calibrated to observed variability. Making use of realistic three-dimensional magnetohydrodynamic simulations of the solar atmosphere and state-of-the-art solar magnetograms from the Solar Dynamics Observatory, we present a model of total solar irradiance (TSI) that does not require any such calibration. In doing so, the modeled irradiance variability is entirely independent of the observational record. (The absolute level is calibrated to the TSI record from the Total Irradiance Monitor.) The model replicates 95% of the observed variability between April 2010 and July 2016, leaving little scope for alternative drivers of solar irradiance variability at least over the time scales examined (days to years).
International Nuclear Information System (INIS)
Shi Jianhui; Niu Yuhong; Ge Junbo; Xu Xiaoping; Cheng Wenying; Feng Xiao; Zhang Zongliang
2002-01-01
Objective: To explore effects of glucocorticoid on apoptosis and activation of NF-κB in P388 cells induced by radiation. Methods: Apoptosis in P388 cells induced by radiation treatment was detected by TUNEL assay. EMSA was used to detect the activation of NF-κB . Results: The apoptosis and activation of NF-κB in P388 cells could be induced by radiation. Dexamethasone (DXM) which could suppress activation of NF-κB of P388 cells increased significantly the apoptosis induced by radiation. Apoptosis rates in DXM-treated P388 cells after 2, 4, 6 and 8 Gy exposure increased by 60%, 100%, 129% and 67%, respectively. Activation rates of NF-κB in DXM-treated P388 cells after 2, 4, 6 and 8 Gy exposure decreased by 25%, 45%, 52% and 40%, respectively. Conclusion: Radiation induces apoptosis and activation of NF-κB in P388 cells simultaneously. Glucocorticoid enhances apoptosis in leukemic cells, which may be by means of suppressing activation of NF-κB
International Nuclear Information System (INIS)
Ye Shefang; Wu Yihui; Hou Zhenqing; Zhang Qiqing
2009-01-01
Carbon nanotubes (CNTs) have potential applications in biosensors, tissue engineering, and biomedical devices because of their unique physico-chemical, electronic and mechanical properties. However, there is limited literature data available concerning the biological properties and toxicity of CNTs. This study aimed to assess the toxicity exhibited by multi-walled CNTs (MWCNTs) and to elucidate possible molecular mechanisms underlying the biological effects of MWCNTs in A549 cells. Exposing A549 cells to MWCNTs led to cell death, changes in cell size and complexity, reactive oxygen species (ROS) production, interleukin-8 (IL-8) gene expression and nuclear factor (NF)-κB activation. Treatment of A549 cells with antioxidants prior to adding MWCNTs decreased ROS production and abrogated expression of IL-8 mRNA. Pretreatment of A549 cells with NF-κB inhibitors suppressed MWCNTs-induced IL-8 mRNA expression. These results indicate that MWCNTs are able to induce expression of IL-8 in A549 cells, at least in part, mediated by oxidative stress and NF-κB activation.
Directory of Open Access Journals (Sweden)
Ashidha Gopal
Full Text Available Shigella dysenteriae (S.dysenteriae the causative agent of bacillary dysentery invades the human colonic epithelium resulting in severe intestinal inflammatory response and epithelial destruction. However, the mechanism by which S.dysenteriae infection regulates proinflammatory cytokines during intestinal inflammation is still obscure. In this study, we evaluated whether the interaction of β-catenin and NF-κB regulates proinflammatory cytokines TNF-α and IL-8 by modulating GSK-3β activity during S.dysenteriae infection in rat ileal loop model. Here we demonstrated that S.dysenteriae infection stimulate β-catenin degradation which in turn decreased the association between NF-κB and β-catenin. Also, we showed that S.dysenteriae infection increased GSK-3β kinase activity which in turn phosphorylates β-catenin for its degradation by ubiquitination and upregulates IL-8 through NF-κB activation thereby leading to inflammation. Thus these findings revealed the role of β-catenin/ NF-κB and GSK-3β in modulating the inflammatory response during bacterial infection and also showed that β-catenin acts as a critical regulator of inflammation.
Sanjay Singh Baroniya; Sunita Kataria; Govind Prakash Pandey; Kadur N. Guruprasad
2014-01-01
A field experiment was conducted to study the impact of the exclusion of the solar UV components on growth, photosynthesis and nitrogen metabolism in soybean (Glycine max) varieties PK-472, Pusa-24, JS 71-05, JS-335, NRC-7 and Kalitur. The plants were grown in specially designed UV exclusion chambers wrapped with filters to exclude UV-B or UV-A/B and transmitted all UV. Exclusion of UV significantly enhanced the growth of the aerial parts as well as the growth of the below ground parts in all...
Directory of Open Access Journals (Sweden)
Göker Ü.D.
2017-01-01
Full Text Available A study of variations of solar spectral irradiance (SSI in the wave-length ranges 121.5 nm-300.5 nm for the period 1981-2009 is presented. We used various data for ultraviolet (UV spectral lines and international sunspot number (ISSN from interactive data centers such as SME (NSSDC, UARS (GDAAC, SORCE (LISIRD and SIDC, respectively. We reduced these data by using the MATLsoftware package. In this respect, we revealed negative correlations of intensities of UV (289.5 nm-300.5 nm spectral lines originating in the solar chromosphere with the ISSN index during the unusually prolonged minimum between the solar activity cycles (SACs 23 and 24. We also compared our results with the variations of solar activity indices obtained by the ground-based telescopes. Therefore, we found that plage regions decrease while facular areas are increasing in SAC 23. However, the decrease in plage regions is seen in small sunspot groups (SGs, contrary to this, these regions in large SGs are comparable to previous SACs or even larger as is also seen in facular areas. Nevertheless, negative correlations between ISSN and SSI data indicate that these variations are in close connection with the classes of sunspots/SGs, faculae and plage regions. Finally, we applied the time series analysis of spectral lines corresponding to the wavelengths 121.5 nm-300.5 nm and made comparisons with the ISSN data. We found an unexpected increase in the 298.5 nm line for the Fe II ion. The variability of Fe II ion 298.5 nm line is in close connection with the facular areas and plage regions, and the sizes of these solar surface indices play an important role for the SSI variability, as well. So, we compared the connection between the sizes of faculae and plage regions, sunspots/SGs, chemical elements and SSI variability. Our future work will be the theoretical study of this connection and developing of a corresponding model.
Solar irradiance assessment in insular areas using Himawari-8 satellite images
Liandrat, O.; Cros, S.; Turpin, M.; Pineau, J. F.
2016-12-01
The high amount of surface solar irradiance (SSI) in the tropics is an advantage for a profitable PV production. It will allow many tropical islands to pursue their economic growth with a clean, affordable and locally produced energy. However, the local meteorological conditions induce a very high variability which is problematic for a safe and gainful injection into the power grid. This issue is even more critical in non-interconnected territories where network stability is an absolute necessity. Therefore, the injection of PV power is legally limited in some European oversea territories. In this context, intraday irradiance forecasting (several hours ahead) is particularly useful to mitigate the production variability by reducing the cost of power storage management. At this time scale, cloud cover evolves with a stochastic behaviour not properly represented in numerical weather prediction (NWP) models. Analysing cloud motion using images from geostationary meteorological satellites is a well-known alternative to forecasting SSI up to 6 hours ahead with a better accuracy than NWP models. In this study, we present and apply our satellite-based solar irradiance forecasting methods over two measurement sites located in the field of view of the satellite Himawari-8: Cocos (Keeling) Islands (Australia) and New Caledonia (France). In particular, we converted 4 months of images from Himawari-8 visible channel into cloud index maps. Then, we applied an algorithm computing a cloud motion vector field from a short sequence of consecutive images. Comparisons between forecasted SSI at 1 hour of time horizon and collocated pyranometric measurements show a relative RMSE between 20 and 27%. Error sources related to the tropic insular context (coastal area heterogeneity, sub-pixel scale orographic cloud appearance, convective situation…) are discussed at every implementation step for the different methods.
Standard physics solution to the solar neutrino problem?
Energy Technology Data Exchange (ETDEWEB)
Dar, A [Technion-Israel Inst. of Tech., Haifa (Israel). Dept. of Physics
1996-11-01
The {sup 8}B solar neutrino flux predicted by the standard solar model (SSM) is consistent within the theoretical and experimental uncertainties with that at Kamiokande. The Gallium and Chlorine solar neutrino experiments, however, seem to imply that the {sup 7}Be solar neutrino flux is strongly suppressed compared with that predicted by the SSM. If the {sup 7}Be solar neutrino flux is suppressed, still it can be due to astrophysical effects not included in the simplistic SSM. Such effects include short term fluctuations or periodic variation of the temperature in the solar core, rotational mixing of {sup 3}He in the solar core, and dense plasma effects which may strongly enhance p-capture by {sup 7}Be relative to e-capture. The new generation of solar observations which already look non stop deep into the sun, like Superkamiokande through neutrinos, and SOHO and GONG through acoustic waves, may point at the correct solution. Only Superkamiokande and/or future solar neutrino experiments, such as SNO, BOREXINO and HELLAZ, will be able to find out whether the solar neutrino problem is caused by neutrino properties beyond the minimal standard electroweak model or whether it is just a problem of the too simplistic standard solar model. (author) 1 fig., 3 tabs., refs.
Morusin induces apoptosis and suppresses NF-κB activity in human colorectal cancer HT-29 cells
International Nuclear Information System (INIS)
Lee, J.-C.; Won, S.-J.; Chao, C.-L.; Wu, F.-L.; Liu, H.-S.; Ling Pin; Lin, C.-N.; Su, C.-L.
2008-01-01
Morusin is a pure compound isolated from root bark of Morusaustralis (Moraceae). In this study, we demonstrated that morusin significantly inhibited the growth and clonogenicity of human colorectal cancer HT-29 cells. Apoptosis induced by morusin was characterized by accumulation of cells at the sub-G 1 phase, fragmentation of DNA, and condensation of chromatin. Morusin also inhibited the phosphorylation of IKK-α, IKK-β and IκB-α, increased expression of IκB-α, and suppressed nuclear translocation of NF-κB and its DNA binding activity. Dephosphorylation of NF-κB upstream regulators PI3K, Akt and PDK1 was also displayed. In addition, activation of caspase-8, change of mitochondrial membrane potential, release of cytochrome c and Smac/DIABLO, and activation of caspase-9 and -3 were observed at the early time point. Downregulation in the expression of Ku70 and XIAP was exhibited afterward. Caspase-8 or wide-ranging caspase inhibitor suppressed morusin-induced apoptosis. Therefore, the antitumor mechanism of morusin in HT-29 cells may be via activation of caspases and inhibition of NF-κB
Prediction of solar activity from solar background magnetic field variations in cycles 21-23
International Nuclear Information System (INIS)
Shepherd, Simon J.; Zharkov, Sergei I.; Zharkova, Valentina V.
2014-01-01
A comprehensive spectral analysis of both the solar background magnetic field (SBMF) in cycles 21-23 and the sunspot magnetic field in cycle 23 reported in our recent paper showed the presence of two principal components (PCs) of SBMF having opposite polarity, e.g., originating in the northern and southern hemispheres, respectively. Over a duration of one solar cycle, both waves are found to travel with an increasing phase shift toward the northern hemisphere in odd cycles 21 and 23 and to the southern hemisphere in even cycle 22. These waves were linked to solar dynamo waves assumed to form in different layers of the solar interior. In this paper, for the first time, the PCs of SBMF in cycles 21-23 are analyzed with the symbolic regression technique using Hamiltonian principles, allowing us to uncover the underlying mathematical laws governing these complex waves in the SBMF presented by PCs and to extrapolate these PCs to cycles 24-26. The PCs predicted for cycle 24 very closely fit (with an accuracy better than 98%) the PCs derived from the SBMF observations in this cycle. This approach also predicts a strong reduction of the SBMF in cycles 25 and 26 and, thus, a reduction of the resulting solar activity. This decrease is accompanied by an increasing phase shift between the two predicted PCs (magnetic waves) in cycle 25 leading to their full separation into the opposite hemispheres in cycle 26. The variations of the modulus summary of the two PCs in SBMF reveals a remarkable resemblance to the average number of sunspots in cycles 21-24 and to predictions of reduced sunspot numbers compared to cycle 24: 80% in cycle 25 and 40% in cycle 26.
Coulomb dissociation of {sup 8}B at 254 A MeV
Energy Technology Data Exchange (ETDEWEB)
Suemmerer, K; Boue, F; Baumann, T; Geissel, H; Hellstroem, M; Koczon, P; Schwab, E; Schwab, W; Senger, P; Surowiecz, A [Gesellschaft fuer Schwerionenforschung (GSI), Darmstadt (Germany); Iwasa, N; Ozawa, A [Gesellschaft fuer Schwerionenforschung (GSI), Darmstadt (Germany); [RIKEN Institute of Physical and Chemical Research, Saitama (Japan); Surowka, G [Gesellschaft fuer Schwerionenforschung (GSI), Darmstadt (Germany); [Jagiellonian Univ., Krakow (Poland). Inst. of Physics; Blank, B; Czajkowski, S; Marchand, C; Pravikoff, M S [Centre d` Etudes Nucleaires de Bordeaux-Gradignan, 33 (France); Foerster, A; Lauer, F; Oeschler, H; Speer, J; Sturm, C; Uhlig, F; Wagner, A [Technische Univ. Darmstadt (Germany); Gai, M [Connecticut Univ., Storrs, CT (United States). Dept. of Physics; Grosse, E [Inst. fuer Kern- und Hadronenphysik, Forschungszentrum Rossendorf, Dresden (Germany); Kohlmeyer, B [Philipps Univ., Marburg (Germany). Fachbereich Physik; Kulessa, R; Walus, W [Jagiellonian Univ., Krakow (Poland). Inst. of Physics; Motobayashi, T [Rikkyo Univ., Tokyo (Japan). Dept. of Physics; Teranishi, T [RIKEN Institute of Physical and Chemical Research, Saitama (Japan)
1998-06-01
As an alternative method for determining the astrophysical S-factor for the {sup 7}Be(p,{gamma}){sup 8}B reaction we have measured the Coulomb dissociation of {sup 8}B at 254 A MeV. From our preliminary results, we obtain good agreement with both the accepted direct-reaction measurements and the low-energy Coulomb dissociation study of Iwasa et al. performed at about 50 A MeV. (orig.)
Willson, Robert F.
1991-01-01
Very Large Array observations at 20 cm wavelength can detect the hot coronal plasma previously observed at soft x ray wavelengths. Thermal cyclotron line emission was detected at the apex of coronal loops where the magnetic field strength is relatively constant. Detailed comparison of simultaneous Solar Maximum Mission (SMM) Satellite and VLA data indicate that physical parameters such as electron temperature, electron density, and magnetic field strength can be obtained, but that some coronal loops remain invisible in either spectral domain. The unprecedent spatial resolution of the VLA at 20 cm wavelength showed that the precursor, impulsive, and post-flare components of solar bursts originate in nearby, but separate loops or systems of loops.. In some cases preburst heating and magnetic changes are observed from loops tens of minutes prior to the impulsive phase. Comparisons with soft x ray images and spectra and with hard x ray data specify the magnetic field strength and emission mechanism of flaring coronal loops. At the longer 91 cm wavelength, the VLA detected extensive emission interpreted as a hot 10(exp 5) K interface between cool, dense H alpha filaments and the surrounding hotter, rarefield corona. Observations at 91 cm also provide evidence for time-correlated bursts in active regions on opposite sides of the solar equator; they are attributed to flare triggering by relativistic particles that move along large-scale, otherwise-invisible, magnetic conduits that link active regions in opposite hemispheres of the Sun.
MAGNETIC PROPERTIES OF SOLAR ACTIVE REGIONS THAT GOVERN LARGE SOLAR FLARES AND ERUPTIONS
Energy Technology Data Exchange (ETDEWEB)
Toriumi, Shin [National Astronomical Observatory of Japan, 2-21-1 Osawa, Mitaka, Tokyo 181-8588 (Japan); Schrijver, Carolus J. [Lockheed Martin Advanced Technology Center, 3251 Hanover Street, Palo Alto, CA 94304 (United States); Harra, Louise K. [UCL-Mullard Space Science Laboratory, Holmbury St Mary, Dorking, Surrey, RH5 6NT (United Kingdom); Hudson, Hugh [SUPA School of Physics and Astronomy, University of Glasgow (United Kingdom); Nagashima, Kaori, E-mail: shin.toriumi@nao.ac.jp [Max-Planck-Institut für Sonnensystemforschung, Justus-von-Liebig-Weg 3, D-37077 Göttingen (Germany)
2017-01-01
Solar flares and coronal mass ejections (CMEs), especially the larger ones, emanate from active regions (ARs). With the aim of understanding the magnetic properties that govern such flares and eruptions, we systematically survey all flare events with Geostationary Orbiting Environmental Satellite levels of ≥M5.0 within 45° from disk center between 2010 May and 2016 April. These criteria lead to a total of 51 flares from 29 ARs, for which we analyze the observational data obtained by the Solar Dynamics Observatory . More than 80% of the 29 ARs are found to exhibit δ -sunspots, and at least three ARs violate Hale’s polarity rule. The flare durations are approximately proportional to the distance between the two flare ribbons, to the total magnetic flux inside the ribbons, and to the ribbon area. From our study, one of the parameters that clearly determine whether a given flare event is CME-eruptive or not is the ribbon area normalized by the sunspot area, which may indicate that the structural relationship between the flaring region and the entire AR controls CME productivity. AR characterization shows that even X-class events do not require δ -sunspots or strong-field, high-gradient polarity inversion lines. An investigation of historical observational data suggests the possibility that the largest solar ARs, with magnetic flux of 2 × 10{sup 23} Mx, might be able to produce “superflares” with energies of the order of 10{sup 34} erg. The proportionality between the flare durations and magnetic energies is consistent with stellar flare observations, suggesting a common physical background for solar and stellar flares.
Solar thermal barometer. More than 2 million m2 installed in 2005
International Nuclear Information System (INIS)
Anon.
2006-01-01
With 22,8% growth, the european union solar thermal market (glazed, vacuum and unglazed collectors) has passed the 2 million m 2 benchmark corresponding to installed capacity of approximately 1450 MWth. This growth can be explained by the very good performance of the three leading EU solar thermal markets: Germany, Austria and Greece and the increase in importance of the French and Spanish markets. Statistical data are provided for the european union on the annually installed surfaces, breakdown by technologies of the solar thermal market, the solar thermal capacity in operation, the representative companies of the thermal solar sector and a comparison of current trend with the white book objectives. (A.L.B.)
Nuclear effects in {sup 8}B dissociation
Energy Technology Data Exchange (ETDEWEB)
Kido, Toshihiko [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment
1998-07-01
The break-up reaction of the nucleus on proton drip-line is investigated. A time-dependent Schroedinger equation for the relative motion between a weakly bound proton and core nucleus is numerically solved by treating the Coulomb+nuclear fields of a target as an external field. The theory is applied to the break-up reaction {sup 8}B + {sup 208}Pb {yields} {sup 7}Be + p + {sup 208}Pb. (author)
Energy Technology Data Exchange (ETDEWEB)
Qiu, Bocheng; Zhu, Qiaohong; Du, Mengmeng; Fan, Linggang; Xing, Mingyang; Zhang, Jinlong [Key Lab. for Advanced Materials and Inst. of Fine Chemicals, School of Chemistry and Molecular Engineering, East China Univ. of Science and Technology, Shanghai (China)
2017-03-01
Hollow structures with an efficient light harvesting and tunable interior component offer great advantages for constructing a Z-scheme system. Controlled design of hollow cobalt sulfide (Co{sub 9}S{sub 8}) cubes embedded with cadmium sulfide quantum dots (QDs) is described, using hollow Co(OH){sub 2} as the template and a one-pot hydrothermal strategy. The hollow CdS/Co{sub 9}S{sub 8} cubes utilize multiple reflections of light in the cubic structure to achieve enhanced photocatalytic activity. Importantly, the photoexcited charge carriers can be effectively separated by the construction of a redox-mediator-free Z-scheme system. The hydrogen evolution rate over hollow CdS/Co{sub 9}S{sub 8} is 134 and 9.1 times higher than that of pure hollow Co{sub 9}S{sub 8} and CdS QDs under simulated solar light irradiation, respectively. Moreover, this is the first report describing construction of a hollow Co{sub 9}S{sub 8} based Z-scheme system for photocatalytic water splitting, which gives full play to the advantages of light-harvesting and charges separation. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)
Chianese, Giuseppina; Scala, Fernando; Calcinai, Barbara; Cerrano, Carlo; Dien, Henny A.; Kaiser, Marcel; Tasdemir, Deniz; Taglialatela-Scafati, Orazio
2013-01-01
Chemical analysis of the Indonesian sponge Plakortis cfr. lita afforded two new analogues of the potent trypanocidal agent manadoperoxide B (1), namely 12-isomanadoperoxide B (2) and manadoperoxidic acid B (3). These compounds were isolated along with a new short chain dicarboxylate monoester (4), bearing some interesting relationships with the polyketide endoperoxides found in this sponge. Some semi-synthetic analogues of manadoperoxide B (6–8) were prepared and evaluated for antitrypanosomal activity and cytotoxicity. These studies revealed crucial structure–activity relationships that should be taken into account in the design of optimized and simplified endoperoxyketal trypanocidal agents. PMID:23989650
Directory of Open Access Journals (Sweden)
Orazio Taglialatela-Scafati
2013-08-01
Full Text Available Chemical analysis of the Indonesian sponge Plakortis cfr. lita afforded two new analogues of the potent trypanocidal agent manadoperoxide B (1, namely 12-isomanadoperoxide B (2 and manadoperoxidic acid B (3. These compounds were isolated along with a new short chain dicarboxylate monoester (4, bearing some interesting relationships with the polyketide endoperoxides found in this sponge. Some semi-synthetic analogues of manadoperoxide B (6–8 were prepared and evaluated for antitrypanosomal activity and cytotoxicity. These studies revealed crucial structure–activity relationships that should be taken into account in the design of optimized and simplified endoperoxyketal trypanocidal agents.
Nhiem, Nguyen Xuan; Yen, Pham Hai; Ngan, Nguyen Thi Thanh; Quang, Tran Hong; Kiem, Phan Van; Minh, Chau Van; Tai, Bui Huu; Cuong, Nguyen Xuan; Song, Seok Bean
2012-01-01
Abstract Momordica charantia: is used to treat various diseases, including inflammatory conditions. Previous reports indicated that the extract of this plant inhibits activation of nuclear transcription factor-κB (NF-κB) but activates peroxisome proliferator-activated receptor (PPAR). Additionally, cucurbitane-type triterpene glycosides are the main bioactive components of the fruit of M. charantia. Therefore, we investigated the anti-inflammatory activity of 17 cucurbitane-type triterpene glycosides (1–17) isolated from this plant. Their inhibition of NF-κB and activation of PPAR activities in HepG2 cells were measured using luciferase reporter and PPAR subtype transactivation assays. Compounds 6 and 8 were found to inhibit NF-κB activation stimulated by tumor necrosis factor-α (TNFα) in a dose-dependent manner. With 50% inhibition concentration (IC50) values of 0.4 μM, compounds 6 and 8 were more potent inhibitors than the positive control, sulfasalazine (IC50=0.9 μM). Compounds 4, 6, and 8 also inhibited TNFα-induced expressions of inducible nitric oxide synthase and cyclooxygenase-2 mRNA. However, only compound 13 significantly increased PPARγ transactivation. PMID:22248180
Foothills Parkway Section 8B Final Environmental Report, Volume 4, Appendices E-I
Energy Technology Data Exchange (ETDEWEB)
Blasing, T.J.; Cada, G.F.; Carer, M.; Chin, S.M.; Dickerman, J.A.; Etnier, D.A.; Gibson, R.; Harvey, M.; Hatcher, B.; Lietzske, D.; Mann, L.K.; Mulholland, P.J.; Petrich, C.H.; Pounds, L.; Ranney, J.; Reed, R.M.; Ryan, P.F.; Schweitzer, M.; Smith, D.; Thomason, P.; Wade, M.C.
1999-07-01
In 1994, Oak Ridge National Laboratory (ORNL) was tasked by the National Park Service (NPS) to prepare an Environmental Report (ER) for Section 8B of the Foothills Parkway in the Great Smoky Mountains National Park (GSMNP). Section 8B represents 27.7 km (14.2 miles) of a total of 115 km (72 miles) of the planned Foothills Parkway and would connect the Cosby community on the east to the incorporated town of Pittman Center to the west. The major deliverables for the project are listed. From August 1995 through October 1996, NPS, GSMNP, and ORNL staff interacted with Federal Highway Administration staff to develop a conceptual design plan for Section 8B with the intent of protecting critical, resources identified during the ER process to the extent possible. In addition, ORNL arranged for bioengineering experts to discuss techniques that might be employed on Section 8B with NPS, GSMNP, and ORNL staff during September 1996. For the purposes of this ER, there are two basic alternatives under consideration: (1) a build alternative and (2) a no-build alternative. Within the build alternative are a number of options including constructing Section 8B with no interchanges, constructing Section 8B with an interchange at SR 416 or U.S. 321, constructing Section 8B with a spur road on Webb Mountain, and considering operation of Section 8B both before and after the operation of Section 8C. The no-build alternative is considered the no-action alternative and is not to construct Section 8B. This volume of the ER consists of Appendices E through I (all ecological survey reports), which are summarized individually in the sections that follow. The following conclusions result from the completion of these surveys and the ER impact analysis: (1) Forest clearing should be limited as much as possible; (2) Disturbed areas should be replanted with native trees; (3) Drainages should be bridged rather than leveled with cut and fill; (4) For areas of steep slopes and potential erosion
Colors of Outer Solar System Objects Measured with VATT
Romanishin, William; Tegler, S. C.; Consolmagno, G. J.
2010-10-01
Over the past 7 years, we have measured optical B-V and V-R colors for about 40 minor outer solar system objects using the 1.8-m Vatican Advanced Technology Telescope (VATT) located on Mt. Graham in southeast Arizona. We will present these colors and use them to update the discussion of colors of minor bodies in the outer solar system. We gratefully acknowledge funding from the NASA Planetary Astronomy Program to Northern Arizona University and the U. of Oklahoma which helped support this work.
High mortality of Red Sea zooplankton under ambient solar radiation.
Al-Aidaroos, Ali M; El-Sherbiny, Mohsen M O; Satheesh, Sathianeson; Mantha, Gopikrishna; Agustī, Susana; Carreja, Beatriz; Duarte, Carlos M
2014-01-01
High solar radiation along with extreme transparency leads to high penetration of solar radiation in the Red Sea, potentially harmful to biota inhabiting the upper water column, including zooplankton. Here we show, based on experimental assessments of solar radiation dose-mortality curves on eight common taxa, the mortality of zooplankton in the oligotrophic waters of the Red Sea to increase steeply with ambient levels of solar radiation in the Red Sea. Responses curves linking solar radiation doses with zooplankton mortality were evaluated by exposing organisms, enclosed in quartz bottles, allowing all the wavelengths of solar radiation to penetrate, to five different levels of ambient solar radiation (100%, 21.6%, 7.2%, 3.2% and 0% of solar radiation). The maximum mortality rates under ambient solar radiation levels averaged (±standard error of the mean, SEM) 18.4±5.8% h(-1), five-fold greater than the average mortality in the dark for the eight taxa tested. The UV-B radiation required for mortality rates to reach ½ of maximum values averaged (±SEM) 12±5.6 h(-1)% of incident UVB radiation, equivalent to the UV-B dose at 19.2±2.7 m depth in open coastal Red Sea waters. These results confirm that Red Sea zooplankton are highly vulnerable to ambient solar radiation, as a consequence of the combination of high incident radiation and high water transparency allowing deep penetration of damaging UV-B radiation. These results provide evidence of the significance of ambient solar radiation levels as a stressor of marine zooplankton communities in tropical, oligotrophic waters. Because the oligotrophic ocean extends across 70% of the ocean surface, solar radiation can be a globally-significant stressor for the ocean ecosystem, by constraining zooplankton use of the upper levels of the water column and, therefore, the efficiency of food transfer up the food web in the oligotrophic ocean.
High mortality of Red Sea zooplankton under ambient solar radiation.
Directory of Open Access Journals (Sweden)
Ali M Al-Aidaroos
Full Text Available High solar radiation along with extreme transparency leads to high penetration of solar radiation in the Red Sea, potentially harmful to biota inhabiting the upper water column, including zooplankton. Here we show, based on experimental assessments of solar radiation dose-mortality curves on eight common taxa, the mortality of zooplankton in the oligotrophic waters of the Red Sea to increase steeply with ambient levels of solar radiation in the Red Sea. Responses curves linking solar radiation doses with zooplankton mortality were evaluated by exposing organisms, enclosed in quartz bottles, allowing all the wavelengths of solar radiation to penetrate, to five different levels of ambient solar radiation (100%, 21.6%, 7.2%, 3.2% and 0% of solar radiation. The maximum mortality rates under ambient solar radiation levels averaged (±standard error of the mean, SEM 18.4±5.8% h(-1, five-fold greater than the average mortality in the dark for the eight taxa tested. The UV-B radiation required for mortality rates to reach ½ of maximum values averaged (±SEM 12±5.6 h(-1% of incident UVB radiation, equivalent to the UV-B dose at 19.2±2.7 m depth in open coastal Red Sea waters. These results confirm that Red Sea zooplankton are highly vulnerable to ambient solar radiation, as a consequence of the combination of high incident radiation and high water transparency allowing deep penetration of damaging UV-B radiation. These results provide evidence of the significance of ambient solar radiation levels as a stressor of marine zooplankton communities in tropical, oligotrophic waters. Because the oligotrophic ocean extends across 70% of the ocean surface, solar radiation can be a globally-significant stressor for the ocean ecosystem, by constraining zooplankton use of the upper levels of the water column and, therefore, the efficiency of food transfer up the food web in the oligotrophic ocean.
Data of evolutionary structure change: 1EP8B-1FAAA [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 1EP8B-1FAAA 1EP8 1FAA B A -------------GGSVIVIDSKAAWDAQLAKGKEEHKP...IVVAFTATWCGPCKMIAPLFETLSNDYAGKVIFLKVDVD-AVAAVAEAAGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAAA LELALGT.../pdbChain> 1FAAA KLDCNQENKTL EEE HHH 1 1FAA A 1FAAA
Flat-plate solar array project. Volume 8: Project analysis and integration
Mcguire, P.; Henry, P.
1986-01-01
Project Analysis and Integration (PA&I) performed planning and integration activities to support management of the various Flat-Plate Solar Array (FSA) Project R&D activities. Technical and economic goals were established by PA&I for each R&D task within the project to coordinate the thrust toward the National Photovoltaic Program goals. A sophisticated computer modeling capability was developed to assess technical progress toward meeting the economic goals. These models included a manufacturing facility simulation, a photovoltaic power station simulation and a decision aid model incorporating uncertainty. This family of analysis tools was used to track the progress of the technology and to explore the effects of alternative technical paths. Numerous studies conducted by PA&I signaled the achievement of milestones or were the foundation of major FSA project and national program decisions. The most important PA&I activities during the project history are summarized. The PA&I planning function is discussed and how it relates to project direction and important analytical models developed by PA&I for its analytical and assessment activities are reviewed.
Solar Indices - Solar Radio Flux
National Oceanic and Atmospheric Administration, Department of Commerce — Collection includes a variety of indices related to solar activity contributed by a number of national and private solar observatories located worldwide. This...
Imaging x-ray spectrometer to study solar activity in conjunction with the SCADM program
International Nuclear Information System (INIS)
Blake, R.L.
1979-01-01
An experiment is proposed to study solar active region dynamics and evolution. It will greatly extend the range of capabilities provided by the Solar Maximum Mission. The larger volume and weight capacity of a shuttle launch make possible an experiment with enough sensitivity to study the fastest known solar phenomena with high spatial and spectral resolution. It will be possible to use high spectral resolving power to image events on a small scale in short time intervals, and it will be possible to use this tremendous diagnostic power from the instant of event onset. Similar sensitivity will be available for the study of active region morphology and evolution
Streaming of interstellar grains in the solar system
Gustafson, B. A. S.; Misconi, N. Y.
1979-01-01
Results of a theoretical study of the interactions between interstellar grains streaming through the solar system and the solar wind are presented. It is shown that although elongated core-mantle interstellar particles of a characteristic radius of about 0.12 microns are subject to a greater force due to radiation pressure than to gravitational attraction, they are still able to penetrate deep inside the solar system. Calculations of particle trajectories within the solar system indicate substantial effects of the solar activity cycle as reflected in the interplanetary magnetic field on the distribution of 0.12- and 0.0005-micron interstellar grains streaming through the solar system, leading to a 50-fold increase in interstellar grain densities 3 to 4 AU ahead of the sun during years 8 to 17 of the solar cycle. It is noted that during the Solar Polar Mission, concentrations are expected which will offer the opportunity of detecting interstellar grains in the solar system.
Robson, T Matthew; Hartikainen, Saara M; Aphalo, Pedro J
2015-05-01
We hypothesized that solar ultraviolet (UV) radiation would protect silver birch seedlings from the detrimental effects of water stress through a coordinated suite of trait responses, including morphological acclimation, improved control of water loss through gas exchange and hydraulic sufficiency. To better understand how this synergetic interaction works, plants were grown in an experiment under nine treatment combinations attenuating ultraviolet-A and ultraviolet-B (UVB) from solar radiation together with differential watering to create water-deficit conditions. In seedlings under water deficit, UV attenuation reduced height growth, leaf production and leaf length compared with seedlings receiving the full spectrum of solar radiation, whereas the growth and morphology of well-watered seedlings was largely unaffected by UV attenuation. There was an interactive effect of the treatment combination on water relations, which was more apparent as a change in the water potential at which leaves wilted or plants died than through differences in gas exchange. This suggests that changes occur in the cell wall elastic modulus or accumulation of osmolites in cells under UVB. Overall, the strong negative effects of water deficit are partially ameliorated by solar UV radiation, whereas well-watered silver birch seedlings are slightly disadvantaged by the solar UV radiation they receive. © 2014 John Wiley & Sons Ltd.
In order to identify amino acid residues crucial for the enzymatic activity of ^8-sphingolipid desaturases, a sequence comparison was performed among ^8-sphingolipid desaturases and ^6-fatty acid desaturase from various plants. In addition to the known conserved cytb5 (cytochrome b5) HPGG motif and...
Zhao, Kun; Erb, Ulrike; Hackert, Thilo; Zöller, Margot; Yue, Shijing
2018-02-01
The tetraspanin Tspan8 supports via associated integrins and proteases tumor progression and angiogenesis. To shed light on its activities in non-transformed cells, we generated a Tspan8 knockout (ko) mouse, comparing leukocyte migration, angiogenesis, wound healing and tumor growth with wild type, CD151ko and Tspan8/CD151ko (dbko) mice. CD151ko mice were included as CD151 activities resemble that of Tspan8, and dbko mice to exclude mutual substitution. Tspan8ko and dbko mice show no pathological phenotype. However, delayed type hypersensitivity reactions are mitigated in Tspan8ko mice, angiogenesis is severely impaired in Tspan8ko, CD151ko and dbko mice, with Tspan8 mostly affecting lymphangiogenesis. Distinct contributions of CD151 and Tspan8 to skin wound healing rely on preferentially CD151 anchoring basal keratinocytes and Tspan8 promoting motility. Proliferation of wounded skin keratinocytes is not affected. Metastasis formation of a melanoma and a Tspan8-expressing pancreatic cancer line was impaired in Tspan8ko and dbko mice, pointing towards a contribution of host Tspan8 to tumor progression. In line with the importance of tetraspanins in exosome-mediated intercellular communication, defects became mitigated by Tspan8/CD151-competent serum exosomes, which offers a most promising therapeutic option for chronic wounds and arteriosclerosis. Copyright © 2017 Elsevier B.V. All rights reserved.
The Young Solar Analogs Project: Initial Photometric Results
Saken, Jon M.; Gray, R. O.; Corbally, C. J.
2013-06-01
Since 2007 we have been conducting spectroscopic monitoring of the Ca II H & K lines and G-band for a sample of 31 YSAs in order to better understand their activity cycles and variations, as well as the effects of young stars on their solar systems. The targets cover the spectral range of stars most likely to contain Earth analogs, F8-K2, and a broad enough range of ages, 0.3 Gyr - 1.5 Gyr, to investigate how activity level changes with stellar age. These studies are already showing possible evidence for activity cycles, large variations in starspot activity, and flaring events. In order to obtain a more complete picture of the nature of the stars' activity and examine the correlations between stellar brightness and chromospheric activity, we have started a complimentary campaign of photometric monitoring of these targets in Johnson B, V, and R, Stromgren v and H-alpha, with the use of a small robotic telescope dedicated to this project. This poster will present some results from the first year of photometric monitoring, focusing on the correlations between the photometric bands, and between the photometric and spectroscopic data, as well as an investigation of short-term (1-2 minutes) spectroscopic variations using data obtained earlier this year on the 1.8 m Vatican Advanced Technology Telescope (VATT).
Characterization and improved solar light activity of vanadium doped TiO2/diatomite hybrid catalysts
International Nuclear Information System (INIS)
Wang, Bin; Zhang, Guangxin; Leng, Xue; Sun, Zhiming; Zheng, Shuilin
2015-01-01
Highlights: • V-doped TiO 2 /diatomite composite photocatalyst was synthesized. • The physiochemical property and solar light photoactivity were characterized. • The presence and influence of V ions in TiO 2 matrix was systematically analyzed. • The photocatalysis for Rhodamine B were studied under solar light illumination. - Abstract: V-doped TiO 2 /diatomite composite photocatalysts with different vanadium concentrations were synthesized by a modified sol–gel method. The diatomite was responsible for the well dispersion of TiO 2 nanoparticles on the matrix and consequently inhibited the agglomeration. V-TiO 2 /diatomite hybrids showed red shift in TiO 2 absorption edge with enhanced absorption intensity. Most importantly, the dopant energy levels were formed in the TiO 2 bandgap due to V 4+ ions substituted to Ti 4+ sites. The 0.5% V-TiO 2 /diatomite photocatalyst displayed narrower bandgap (2.95 eV) compared to undoped sample (3.13 eV) and other doped samples (3.05 eV) with higher doping concentration. The photocatalytic activities of V doped TiO 2 /diatomite samples for the degradation of Rhodamine B under stimulated solar light illumination were significantly improved compared with the undoped sample. In our case, V 4+ ions incorporated in TiO 2 lattice were responsible for increased visible-light absorption and electron transfer to oxygen molecules adsorbed on the surface of TiO 2 to produce superoxide radicals ·O 2 – , while V 5+ species presented on the surface of TiO 2 particles in the form of V 2 O 5 contributed to e – –h + separation. In addition, due to the combination of diatomite as support, this hybrid photocatalyst could be separated from solution quickly by natural settlement and exhibited good reusability
Data of evolutionary structure change: 1CG8B-2ZLWD [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 1CG8B-2ZLWD 1CG8 2ZLW B D VKLSEDQEHYIKGVWKDVDHKQITAKALERVFVVYPWTT.../seq1> VQLSGEEKAAVLALWDKVNEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSELHCDK... GLY CA 249 2ZLW D 2ZLWD...2ZLW D 2ZLWD ELHCDKLHVDP
Collecting Solar Energy. Solar Energy Education Project.
O'Brien, Alexander
This solar energy learning module for use with junior high school students offers a list of activities, a pre-post test, job titles, basic solar energy vocabulary, and diagrams of solar energy collectors and installations. The purpose is to familiarize students with applications of solar energy and titles of jobs where this knowledge could be…
Solar '80s: A Teacher's Handbook for Solar Energy Education.
LaHart, David E.
This guide is intended to assist the teacher in exploring energy issues and the technology of solar energy conversion and associated technologies. Sections of the guide include: (1) Rationale; (2) Technology Overview; (3) Sun Day Suggestions for School; (4) Backyard Solar Water Heater; (5) Solar Tea; (6) Biogas; (7) Solar Cells; (8) Economics; (9)…
An evaluation of solar energy for heating a highway maintenance headquarters building.
1985-01-01
A highway maintenance area headquarters building having overall dimensions of 64 ft - 8 in by 42 ft - 0 in was equipped with an active solar heating system to assist in heating space and domestic hot water. The solar system was instrumented and its o...