WorldWideScience

Sample records for activated chey chey-n16-flim

  1. Structural studies of conformational changes of proteins upon phosphorylation: Structures of activated CheY, CheY-N16-FliM complex, and AAA {sup +} ATPase domain of NtrC1 in both inactive and active states

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Seok-Yong

    2003-04-10

    Protein phosphorylation is a general mechanism for signal transduction as well as regulation of cellular function. Unlike phosphorylation in eukaryotic systems that uses Ser/Thr for the sites of modification, two-component signal transduction systems, which are prevalent in bacteria, archea, and lower eukaryotes, use an aspartate as the site of phosphorylation. Two-component systems comprise a histidine kinase and a receiver domain. The conformational change of the receiver domain upon phosphorylation leads to signal transfer to the downstream target, a process that had not been understood well at the molecular level. The transient nature of the phospho-Asp bond had made structural studies difficult. The discovery of an excellent analogue for acylphosphate, BeF{sub 3}{sup -}, enabled structural study of activated receiver domains. The structure of activated Chemotaxis protein Y (CheY) was determined both by NMR spectroscopy and X-ray crystallography. These structures revealed the molecular basis of the conformational change that is coupled to phosphorylation. Phosphorylation of the conserved Asp residue in the active site allows hydrogen bonding of the T87 O{gamma} to phospho-aspartate, which in turn leads to the rotation of Y106 into the ''in'' position (termed Y-T coupling). The structure of activated CheY complexed with the 16 N-terminal residues of FliM (N16-FliM), its target, was also determined by X-ray crystallography and confirmed the proposed mechanism of activation (Y-T coupling). First, N16-FliM binds to the region on CheY that undergoes a significant conformational change. Second, the ''in'' position of Y106 presents a better binding surface for FliM because the sidechain of Y106 in the inactive form of CheY (''out'' position) sterically interferes with binding of N16-FliM. In addition to confirmation of Y-T coupling, the structure of the activated CheY-N16-FliM complex suggested that the N16

  2. Structural studies of conformational changes of proteins upon phosphorylation: Structures of activated CheY, CheY-N16-FliM complex, and AAA + ATPase domain of NtrC1 in both inactive and active states

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Seok-Yong [Univ. of California, Berkeley, CA (United States)

    2003-04-10

    Protein phosphorylation is a general mechanism for signal transduction as well as regulation of cellular function. Unlike phosphorylation in eukaryotic systems that uses Ser/Thr for the sites of modification, two-component signal transduction systems, which are prevalent in bacteria, archea, and lower eukaryotes, use an aspartate as the site of phosphorylation. Two-component systems comprise a histidine kinase and a receiver domain. The conformational change of the receiver domain upon phosphorylation leads to signal transfer to the downstream target, a process that had not been understood well at the molecular level. The transient nature of the phospho-Asp bond had made structural studies difficult. The discovery of an excellent analogue for acylphosphate, BeF3-, enabled structural study of activated receiver domains. The structure of activated Chemotaxis protein Y (CheY) was determined both by NMR spectroscopy and X-ray crystallography. These structures revealed the molecular basis of the conformational change that is coupled to phosphorylation. Phosphorylation of the conserved Asp residue in the active site allows hydrogen bonding of the T87 Oγ to phospho-aspartate, which in turn leads to the rotation of Y106 into the ''in'' position (termed Y-T coupling). The structure of activated CheY complexed with the 16 N-terminal residues of FliM (N16-FliM), its target, was also determined by X-ray crystallography and confirmed the proposed mechanism of activation (Y-T coupling). First, N16-FliM binds to the region on CheY that undergoes a significant conformational change. Second, the ''in'' position of Y106 presents a better binding surface for FliM because the sidechain of Y106 in the inactive form of CheY (''out'' position) sterically interferes with binding of N16-FliM. In addition to confirmation of Y-T coupling, the structure of the activated CheY-N16-FliM complex suggested that the

  3. Single-molecule imaging of electroporated dye-labelled CheY in live Escherichia coli

    Science.gov (United States)

    Di Paolo, Diana; Afanzar, Oshri; Armitage, Judith P.; Berry, Richard M.

    2016-01-01

    For the past two decades, the use of genetically fused fluorescent proteins (FPs) has greatly contributed to the study of chemotactic signalling in Escherichia coli including the activation of the response regulator protein CheY and its interaction with the flagellar motor. However, this approach suffers from a number of limitations, both biological and biophysical: for example, not all fusions are fully functional when fused to a bulky FP, which can have a similar molecular weight to its fused counterpart; they may interfere with the native interactions of the protein and the chromophores of FPs have low brightness and photostability and fast photobleaching rates. A recently developed technique for the electroporation of fluorescently labelled proteins in live bacteria has enabled us to bypass these limitations and study the in vivo behaviour of CheY at the single-molecule level. Here we show that purified CheY proteins labelled with organic dyes can be internalized into E. coli cells in controllable concentrations and imaged with video fluorescence microscopy. The use of this approach is illustrated by showing single CheY molecules diffusing within cells and interacting with the sensory clusters and the flagellar motors in real time. This article is part of the themed issue ‘The new bacteriology’. PMID:27672145

  4. Chemotactic Control of the Two Flagellar Systems of Rhodobacter sphaeroides Is Mediated by Different Sets of CheY and FliM Proteins▿ †

    Science.gov (United States)

    del Campo, Ana Martínez; Ballado, Teresa; de la Mora, Javier; Poggio, Sebastian; Camarena, Laura; Dreyfus, Georges

    2007-01-01

    Rhodobacter sphaeroides expresses two different flagellar systems, a subpolar flagellum (fla1) and multiple polar flagella (fla2). These structures are encoded by different sets of flagellar genes. The chemotactic control of the subpolar flagellum (fla1) is mediated by three of the six different CheY proteins (CheY6, CheY4, or CheY3). We show evidence that CheY1, CheY2, and CheY5 control the chemotactic behavior mediated by fla2 flagella and that RSP6099 encodes the fla2 FliM protein. PMID:17890312

  5. A predictive computational model of the kinetic mechanism of stimulus-induced transducer methylation and feedback regulation through CheY in archaeal phototaxis and chemotaxis

    Directory of Open Access Journals (Sweden)

    Oesterhelt Dieter

    2010-03-01

    Full Text Available Abstract Background Photo- and chemotaxis of the archaeon Halobacterium salinarum is based on the control of flagellar motor switching through stimulus-specific methyl-accepting transducer proteins that relay the sensory input signal to a two-component system. Certain members of the transducer family function as receptor proteins by directly sensing specific chemical or physical stimuli. Others interact with specific receptor proteins like the phototaxis photoreceptors sensory rhodopsin I and II, or require specific binding proteins as for example some chemotaxis transducers. Receptor activation by light or a change in receptor occupancy by chemical stimuli results in reversible methylation of glutamate residues of the transducer proteins. Both, methylation and demethylation reactions are involved in sensory adaptation and are modulated by the response regulator CheY. Results By mathematical modeling we infer the kinetic mechanisms of stimulus-induced transducer methylation and adaptation. The model (deterministic and in the form of ordinary differential equations correctly predicts experimentally observed transducer demethylation (as detected by released methanol in response to attractant and repellent stimuli of wildtype cells, a cheY deletion mutant, and a mutant in which the stimulated transducer species is methylation-deficient. Conclusions We provide a kinetic model for signal processing in photo- and chemotaxis in the archaeon H. salinarum suggesting an essential role of receptor cooperativity, antagonistic reversible methylation, and a CheY-dependent feedback on transducer demethylation.

  6. Atomistic structural ensemble refinement reveals non-native structure stabilizes a sub-millisecond folding intermediate of CheY

    Science.gov (United States)

    Shi, Jade; Nobrega, R. Paul; Schwantes, Christian; Kathuria, Sagar V.; Bilsel, Osman; Matthews, C. Robert; Lane, T. J.; Pande, Vijay S.

    2017-03-01

    The dynamics of globular proteins can be described in terms of transitions between a folded native state and less-populated intermediates, or excited states, which can play critical roles in both protein folding and function. Excited states are by definition transient species, and therefore are difficult to characterize using current experimental techniques. Here, we report an atomistic model of the excited state ensemble of a stabilized mutant of an extensively studied flavodoxin fold protein CheY. We employed a hybrid simulation and experimental approach in which an aggregate 42 milliseconds of all-atom molecular dynamics were used as an informative prior for the structure of the excited state ensemble. This prior was then refined against small-angle X-ray scattering (SAXS) data employing an established method (EROS). The most striking feature of the resulting excited state ensemble was an unstructured N-terminus stabilized by non-native contacts in a conformation that is topologically simpler than the native state. Using these results, we then predict incisive single molecule FRET experiments as a means of model validation. This study demonstrates the paradigm of uniting simulation and experiment in a statistical model to study the structure of protein excited states and rationally design validating experiments.

  7. Atomistic structural ensemble refinement reveals non-native structure stabilizes a sub-millisecond folding intermediate of CheY

    Science.gov (United States)

    Shi, Jade; Nobrega, R. Paul; Schwantes, Christian; Kathuria, Sagar V.; Bilsel, Osman; Matthews, C. Robert; Lane, T. J.; Pande, Vijay S.

    2017-01-01

    The dynamics of globular proteins can be described in terms of transitions between a folded native state and less-populated intermediates, or excited states, which can play critical roles in both protein folding and function. Excited states are by definition transient species, and therefore are difficult to characterize using current experimental techniques. Here, we report an atomistic model of the excited state ensemble of a stabilized mutant of an extensively studied flavodoxin fold protein CheY. We employed a hybrid simulation and experimental approach in which an aggregate 42 milliseconds of all-atom molecular dynamics were used as an informative prior for the structure of the excited state ensemble. This prior was then refined against small-angle X-ray scattering (SAXS) data employing an established method (EROS). The most striking feature of the resulting excited state ensemble was an unstructured N-terminus stabilized by non-native contacts in a conformation that is topologically simpler than the native state. Using these results, we then predict incisive single molecule FRET experiments as a means of model validation. This study demonstrates the paradigm of uniting simulation and experiment in a statistical model to study the structure of protein excited states and rationally design validating experiments. PMID:28272524

  8. The importance of the interaction of CheD with CheC and the chemoreceptors compared to its enzymatic activity during chemotaxis in Bacillus subtilis.

    Directory of Open Access Journals (Sweden)

    Wei Yuan

    Full Text Available Bacillus subtilis use three systems for adaptation during chemotaxis. One of these systems involves two interacting proteins, CheC and CheD. CheD binds to the receptors and increases their ability to activate the CheA kinase. CheD also binds CheC, and the strength of this interaction is increased by phosphorylated CheY. CheC is believed to control the binding of CheD to the receptors in response to the levels of phosphorylated CheY. In addition to their role in adaptation, CheC and CheD also have separate enzymatic functions. CheC is a CheY phosphatase and CheD is a receptor deamidase. Previously, we demonstrated that CheC's phosphatase activity plays a minor role in chemotaxis whereas its ability to bind CheD plays a major one. In the present study, we demonstrate that CheD's deamidase activity also plays a minor role in chemotaxis whereas its ability to bind CheC plays a major one. In addition, we quantified the interaction between CheC and CheD using surface plasmon resonance. These results suggest that the most important features of CheC and CheD are not their enzymatic activities but rather their roles in adaptation.

  9. Identical phosphatase mechanisms achieved through distinct modes of binding phosphoprotein substrate

    Energy Technology Data Exchange (ETDEWEB)

    Pazy, Y.; Motaleb, M.A.; Guarnieri, M.T.; Charon, N.W.; Zhao, R.; Silversmith, R.E. (WVU); (UNC); (Colorado); (EC Uni.)

    2010-04-05

    Two-component signal transduction systems are widespread in prokaryotes and control numerous cellular processes. Extensive investigation of sensor kinase and response regulator proteins from many two-component systems has established conserved sequence, structural, and mechanistic features within each family. In contrast, the phosphatases which catalyze hydrolysis of the response regulator phosphoryl group to terminate signal transduction are poorly understood. Here we present structural and functional characterization of a representative of the CheC/CheX/FliY phosphatase family. The X-ray crystal structure of Borrelia burgdorferi CheX complexed with its CheY3 substrate and the phosphoryl analogue BeF{sub 3}{sup -} reveals a binding orientation between a response regulator and an auxiliary protein different from that shared by every previously characterized example. The surface of CheY3 containing the phosphoryl group interacts directly with a long helix of CheX which bears the conserved (E - X{sub 2} - N) motif. Conserved CheX residues Glu96 and Asn99, separated by a single helical turn, insert into the CheY3 active site. Structural and functional data indicate that CheX Asn99 and CheY3 Thr81 orient a water molecule for hydrolytic attack. The catalytic residues of the CheX-CheY3 complex are virtually superimposable on those of the Escherichia coli CheZ phosphatase complexed with CheY, even though the active site helices of CheX and CheZ are oriented nearly perpendicular to one other. Thus, evolution has found two structural solutions to achieve the same catalytic mechanism through different helical spacing and side chain lengths of the conserved acid/amide residues in CheX and CheZ.

  10. Physical activity

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/article/001941.htm Physical activity To use the sharing features on this page, please enable JavaScript. Physical activity -- which includes an active lifestyle and routine exercise -- ...

  11. Activated Charcoal

    Science.gov (United States)

    Activated Carbon, Animal Charcoal, Carbo Vegetabilis, Carbon, Carbón Activado, Charbon Actif, Charbon Activé, Charbon Animal, Charbon Médicinal, Charbon Végétal, Charbon Végétal Activé, Charcoal, Gas Black, Lamp Black, Medicinal Charcoal, Noir de Gaz, ...

  12. Physical Activity

    DEFF Research Database (Denmark)

    Andersen, Lars Bo; Anderssen, Sigmund Alfred; Wisløff, Ulrik

    2014-01-01

    Andersen LB, Anderssen SA, Wisløff U, Hellénius M-L, Fogelholm M, Ekelund U. (Expert Group) Nordic Nutrition Recommendations 2012. Integrating nutrition and physical activity. Chapter: Physical Activity p. 195-217.Nordic Counsil of Ministers.......Andersen LB, Anderssen SA, Wisløff U, Hellénius M-L, Fogelholm M, Ekelund U. (Expert Group) Nordic Nutrition Recommendations 2012. Integrating nutrition and physical activity. Chapter: Physical Activity p. 195-217.Nordic Counsil of Ministers....

  13. Physical Activity

    DEFF Research Database (Denmark)

    Andersen, Lars Bo; Anderssen, Sigmund Alfred; Wisløff, Ulrik

    2014-01-01

    Andersen LB, Anderssen SA, Wisløff U, Hellénius M-L, Fogelholm M, Ekelund U. (Expert Group) Nordic Nutrition Recommendations 2012. Integrating nutrition and physical activity. Chapter: Physical Activity p. 195-217.Nordic Counsil of Ministers.......Andersen LB, Anderssen SA, Wisløff U, Hellénius M-L, Fogelholm M, Ekelund U. (Expert Group) Nordic Nutrition Recommendations 2012. Integrating nutrition and physical activity. Chapter: Physical Activity p. 195-217.Nordic Counsil of Ministers....

  14. Active matter

    Science.gov (United States)

    Ramaswamy, Sriram

    2017-05-01

    The study of systems with sustained energy uptake and dissipation at the scale of the constituent particles is an area of central interest in nonequilibrium statistical physics. Identifying such systems as a distinct category—Active matter—unifies our understanding of autonomous collective movement in the living world and in some surprising inanimate imitations. In this article I present the active matter framework, briefly recall some early work, review our recent results on single-particle and collective behaviour, including experiments on active granular monolayers, and discuss new directions for the future.

  15. Activity Theory.

    Science.gov (United States)

    Koschmann, Timothy; Roschelle, Jeremy; Nardi, Bonnie A.

    1998-01-01

    Includes three articles that discuss activity theory, based on "Context and Consciousness." Topics include human-computer interaction; computer interfaces; hierarchical structuring; mediation; contradictions and development; failure analysis; and designing educational technology. (LRW)

  16. Activating schoolyards

    DEFF Research Database (Denmark)

    Andersen, Henriette Bondo; Pawlowski, Charlotte Skau; Scheller, Hanne Bebendorf;

    2015-01-01

    BACKGROUND: The aim of the Activating Schoolyards Study is to develop, implement, document and assess a comprehensive schoolyard intervention to promote physical activity (PA) during school recess for primary school children (grade 4-8). The intervention is designed to implement organizational...... to objectively determine where and how active the students are in the schoolyard, before and after the intervention. This provides a type of data that, to our knowledge, has not been used before in schoolyard interventions. Exploring the change in behavior in relation to specific intervention elements...... as well as quantitative methods can be seen as a strength, as the different types of data complement each other and results of one part of the study informed the following parts. A unique aspect of our study is the use of accelerometers in combination with GPS and GIS in the effect evaluation...

  17. Active dependency.

    Science.gov (United States)

    Bornstein, R F

    1995-02-01

    Although dependency has long been associated with passivity, weakness, and submissiveness, a review of the empirical literature reveals that, in certain situations and settings, dependent persons actually exhibit a variety of active, assertive behaviors. In this article, I: a) trace the historical roots of the dependency-passivity link; b) review empirical studies from developmental, social, and clinical psychology which indicate that, in certain circumstances, dependency is associated with active, assertive behavior on the part of the dependent person; c) offer an alternative conceptual model of dependency that accounts for the entire range of behaviors-both passive and active-that are exhibited by the dependent person; and d) discuss the diagnostic and therapeutic implications of this alternative conceptual model of dependency.

  18. Identifying Activity

    CERN Document Server

    Lewis, Adrian S

    2009-01-01

    Identification of active constraints in constrained optimization is of interest from both practical and theoretical viewpoints, as it holds the promise of reducing an inequality-constrained problem to an equality-constrained problem, in a neighborhood of a solution. We study this issue in the more general setting of composite nonsmooth minimization, in which the objective is a composition of a smooth vector function c with a lower semicontinuous function h, typically nonsmooth but structured. In this setting, the graph of the generalized gradient of h can often be decomposed into a union (nondisjoint) of simpler subsets. "Identification" amounts to deciding which subsets of the graph are "active" in the criticality conditions at a given solution. We give conditions under which any convergent sequence of approximate critical points finitely identifies the activity. Prominent among these properties is a condition akin to the Mangasarian-Fromovitz constraint qualification, which ensures boundedness of the set of...

  19. Active Cytokinins

    Science.gov (United States)

    Mornet, René; Theiler, Jane B.; Leonard, Nelson J.; Schmitz, Ruth Y.; Moore, F. Hardy; Skoog, Folke

    1979-01-01

    Four series of azidopurines have been synthesized and tested for cytokinin activity in the tobacco callus bioassay: 2- and 8-azido-N6-benzyladenines, -N6-(Δ2-isopentenyl)adenines, and -zeatins, and N6-(2- and 4-azidobenzyl)adenines. The compounds having 2-azido substitution on the adenine ring are as active as the corresponding parent compounds, while those with 8-azido substitution are about 10 or more times as active. The 8-azidozeatin, which is the most active cytokinin observed, exhibited higher than minimal detectable activity at 1.2 × 10−5 micromolar, the lowest concentration tested. The shape of the growth curve indicates that even a concentration as low as 5 × 10−6 micromolar would probably be effective. By comparison, the lowest active concentration ever reported for zeatin has been 5 × 10−5 micromolar, representing a sensitivity rarely attained. All of the azido compounds have been submitted to photolysis in aqueous ethanol, and the photoproducts have been detected and identified by low and high resolution mass spectrometry. They are rationalized as products of abstraction and insertion reactions of the intermediate nitrenes. The potential of the major released products as cytokinins was also assessed by bioassay. 2-Azido-N6-(Δ2-isopentenyl)adenine competed with [14C]kinetin for the cytokinin-binding protein isolated from wheat germ. When the azido compound was photolysed in the presence of this protein, its attachment effectively blocked the binding of [14C]kinetin. PMID:16661017

  20. Get Active

    Science.gov (United States)

    ... Have fun with your family. If you have children, you can be a role model for making healthy choices. Encourage your whole family to get active outside . Go for a hike or organize a family soccer game. If someone you know has trouble making ...

  1. Active house

    DEFF Research Database (Denmark)

    Eriksen, Kurt Emil; Olesen, Gitte Gylling Hammershøj

    2010-01-01

    Formålet med dette abstrakt er at illustrere, at huse kan være konstrueret til at basere sig udelukkende på vedvarende energikilder og samtidig være CO2-neutrale og producere mere energi end de forbruger. Active House Visionen undersøger disse muligheder i otte demonstration huse i fem forskellige...

  2. Active learning

    CERN Document Server

    Settles, Burr

    2012-01-01

    The key idea behind active learning is that a machine learning algorithm can perform better with less training if it is allowed to choose the data from which it learns. An active learner may pose "queries," usually in the form of unlabeled data instances to be labeled by an "oracle" (e.g., a human annotator) that already understands the nature of the problem. This sort of approach is well-motivated in many modern machine learning and data mining applications, where unlabeled data may be abundant or easy to come by, but training labels are difficult, time-consuming, or expensive to obtain. This book is a general introduction to active learning. It outlines several scenarios in which queries might be formulated, and details many query selection algorithms which have been organized into four broad categories, or "query selection frameworks." We also touch on some of the theoretical foundations of active learning, and conclude with an overview of the strengths and weaknesses of these approaches in practice, inclu...

  3. Staying Active: Physical Activity and Exercise

    Science.gov (United States)

    ... Patients About ACOG Staying Active: Physical Activity and Exercise Home For Patients Search FAQs Staying Active: Physical ... 2016 PDF Format Staying Active: Physical Activity and Exercise Women's Health What are the benefits of physical ...

  4. Laboratory Activities

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Christopher F.; Serne, R. Jeffrey

    2008-01-17

    This chapter summarizes the laboratory activities performed by PNNL’s Vadose Zone Characterization Project in support of the Tank Farm Vadose Zone Program, led by CH2M HILL Hanford Group, Inc. The results of these studies are contained in numerous reports (Lindenmeier et al. 2002; Serne et al. 2002a, 2002b, 2002c, 2002d, 2002e; Lindenmeier et al. 2003; Serne et al. 2004a, 2004b; Brown et al. 2005, 2006a, 2007; Serne et al. 2007) and have generated much of the data reported in Chapter 22 (Geochemistry-Contaminant Movement), Appendix G (Geochemistry-Contaminant Movement), and Cantrell et al. (2007, SST WMA Geochemistry Data Package – in preparation). Sediment samples and characterization results from PNNL’s Vadose Zone Characterization Project are also shared with other science and technology (S&T) research projects, such as those summarized in Chapter 12 (Associated Science Activities).

  5. Active particles

    CERN Document Server

    Degond, Pierre; Tadmor, Eitan

    2017-01-01

    This volume collects ten surveys on the modeling, simulation, and applications of active particles using methods ranging from mathematical kinetic theory to nonequilibrium statistical mechanics. The contributing authors are leading experts working in this challenging field, and each of their chapters provides a review of the most recent results in their areas and looks ahead to future research directions. The approaches to studying active matter are presented here from many different perspectives, such as individual-based models, evolutionary games, Brownian motion, and continuum theories, as well as various combinations of these. Applications covered include biological network formation and network theory; opinion formation and social systems; control theory of sparse systems; theory and applications of mean field games; population learning; dynamics of flocking systems; vehicular traffic flow; and stochastic particles and mean field approximation. Mathematicians and other members of the scientific commu...

  6. Antimicrobial Activity.

    Science.gov (United States)

    2016-01-01

    Natural products of higher plants may possess a new source of antimicrobial agents with possibly novel mechanisms of action. They are effective in the treatment of infectious diseases while simultaneously mitigating many of the side effects that are often associated with conventional antimicrobials. A method using scanning electron microscope (SEM) to study the morphology of the bacterial and fungal microbes and thus determining antimicrobial activity is presented in the chapter.

  7. Activity report

    Energy Technology Data Exchange (ETDEWEB)

    Yu, S W

    2008-08-11

    This report is aimed to show the author's activities to support the LDRD. The title is 'Investigation of the Double-C Behavior in the Pu-Ga Time-Temperature-Transformation Diagram' The sections are: (1) Sample Holder Test; (2) Calculation of x-ray diffraction patterns; (3) Literature search and preparing publications; (4) Tasks Required for APS Experiments; and (5) Communications.

  8. Glucokinase activators.

    Science.gov (United States)

    Filipski, Kevin J; Futatsugi, Kentaro; Pfefferkorn, Jeffrey A; Stevens, Benjamin D

    2012-07-01

    In this review we highlight recently disclosed progress in the field of small-molecule activators of the human glucokinase enzyme. Several of the reported chemotypes possess structural features that diverge from known leads; some of these modifications appear to be specifically designed to modulate tissue selectivity or discrete parameters of enzyme function (e.g., S0.5 v Vmax). This review will inform the reader of the extent of continued effort being directed toward discovery of a first-in-class drug for Type II diabetes mellitus that functions through this target. Patents were selected from those published in December 2009 up to November 2011; foreign filings were translated where possible to understand the claims and biological techniques utilized to characterize the reported glucokinase activators. Overall, there appears to be a recent trend leading to reduced patent filings for small-molecule glucokinase activators. There are many possible explanations for this trend; however, it is likely that the field has reached maturity and that the downturn of new disclosures represents the transition of many of these programs to the clinic.

  9. Fumarase activity

    DEFF Research Database (Denmark)

    Nielsen, Per Mose; Eldirdiri, Abubakr; Bertelsen, Lotte Bonde

    2017-01-01

    ]fumarate conversion to [1,4-(13)C2]malate by fumarase has been proposed as a measure of necrosis in rat tumor models and in chemically induced AKI rats. Here we show that the degradation of cell membranes in connection with necrosis leads to elevated fumarase activity in plasma and urine and secondly...... that hyperpolarized [1,4-(13)C2]malate production 24 h after reperfusion correlates with renal necrosis in a 40-min unilateral ischemic rat model. Fumarase activity screening on bio-fluids can detect injury severity, in bilateral as well as unilateral AKI models, differentiating moderate and severe AKI as well...... as short- and long-term AKI. Furthermore after verification of renal injury by bio-fluid analysis the precise injury location can be monitored by in vivo measurements of the fumarase activity non-invasively by hyperpolarized [1,4-(13)C]fumarate MR imaging. The combined in vitro and in vivo biomarker of AKI...

  10. Intangible activities

    DEFF Research Database (Denmark)

    Hermansen, Jonathan

    2016-01-01

    ‘Informal helping’ is often associated with other types of prosocial behaviour such as formal voluntary work. Therefore, one could jump to the conclusion that it would be the same factors driving both types of activities. This article demonstrates that this is not the case. The study relies...... that it is necessary to separate the decision to help and the amount of hours that people help, a distinction that previous empirical studies on this topic fail to include. The results show that informal helping may not simply be compared to other instances of prosocial behaviour. In particular, the socio...

  11. Active packaging with antifungal activities.

    Science.gov (United States)

    Nguyen Van Long, N; Joly, Catherine; Dantigny, Philippe

    2016-03-01

    There have been many reviews concerned with antimicrobial food packaging, and with the use of antifungal compounds, but none provided an exhaustive picture of the applications of active packaging to control fungal spoilage. Very recently, many studies have been done in these fields, therefore it is timely to review this topic. This article examines the effects of essential oils, preservatives, natural products, chemical fungicides, nanoparticles coated to different films, and chitosan in vitro on the growth of moulds, but also in vivo on the mould free shelf-life of bread, cheese, and fresh fruits and vegetables. A short section is also dedicated to yeasts. All the applications are described from a microbiological point of view, and these were sorted depending on the name of the species. Methods and results obtained are discussed. Essential oils and preservatives were ranked by increased efficacy on mould growth. For all the tested molecules, Penicillium species were shown more sensitive than Aspergillus species. However, comparison between the results was difficult because it appeared that the efficiency of active packaging depended greatly on the environmental factors of food such as water activity, pH, temperature, NaCl concentration, the nature, the size, and the mode of application of the films, in addition to the fact that the amount of released antifungal compounds was not constant with time.

  12. BAM! Physical Activity

    Science.gov (United States)

    ... Smarts Links Fuel Up for Fun Power Packing Physical Activity Xpert Opinion Activity Calendar Activity Cards Ballet Baseball ... Disaster - Are You at Risk? Disaster - Helping Hands Physical Activity - Questions Physical Activity - Active or Not, Here it ...

  13. Halal Activism

    DEFF Research Database (Denmark)

    Fischer, Johan

    2016-01-01

    The purpose of this article is to further our understanding of contemporary Muslim consumer activism in Malaysia with a particular focus on halal (in Arabic, literally “permissible” or “lawful”) products and services. Muslim activists and organisations promote halal on a big scale in the interface...... zones between new forms of Islamic revivalism, the ethnicised state and Muslim consumer culture. Organisations such as the Muslim Consumers Association of Malaysia play an important role in pushing and protecting halal in Malaysia, that is, halal activists constantly call on the state to tighten halal...... in particular historical/national settings and that these issues should be explored in the interfaces between Islam, the state and market. More specifically, this article examines the above issues building on ethnography from fieldwork with three Muslim organisations in Malaysia....

  14. Active sharing

    CERN Multimedia

    2012-01-01

    The big news this week is, of course, the conclusions from the LHC performance workshop held in Chamonix from 6 to 10 February . The main recommendation, endorsed by CERN’s Machine Advisory Committee and adopted by the Management, is that the LHC will run at 4 TeV per beam this year. You can find all the details from Chamonix in the slides presented on Wednesday at the summary session, which leaves me free to talk about another important development coming up soon.   In ten days time, a new kind of gathering will be taking place in Geneva, bringing together two previously separate conferences, one driven by physics, the other by the medical community, but both looking to apply physics to the advancement of health. The merger of the International Conference for Translational Research in Radio-Oncology and CERN’s workshop on Physics for Health in Europe (ICTR-PHE) makes for a very eclectic mix. Presentations range from active shielding for interplanetary flight to the rather...

  15. DAVIC activities

    Science.gov (United States)

    Fujiwara, Hiroshi

    1995-12-01

    DAVIC (Digital Audio Visual Council) is the defacto standardization organization established in Mar. 1994, based on international consensus for digital audio visual services. After completion of MPEG2 standardization, the broadcasting industry, the communication industry, the computer industry, and consumer electronics industry have started development of concrete services and products. Especially the interactive digital audio visual services, such as Video On Demand (VOD) or Near Video On Demand (NVOD), have become hot topics all over the world. Such interactive digital audio visual services are combined technologies of multi-media coding, digital transmission and computer networking. Therefore more than 150 organizations from all industry sectors have participated in DAVIC and are contributing from their own industrial contexts. DAVIC's basic policy is to use the available technologies specified by the other standards bodies as much as possible. So DAVIC's standardization activities have close relationship with ISO IEC/JTC1/SC29, ITU-T SG 9, ATM-Forum, IETF, IMA, DVB, etc. DAVIC is trying to specify Applications, Reference Models, Security, Usage Information Control, and the interfaces and protocols among the Content Provider, the Server, the core network, the access network, and the Set Top Unit. DAVIC's first goal is to specify DAVIC1.0 based on CFP1 (Call for Proposal) and CFP2 by Dec. 1995, and the next direction is under preparation for further progress based on CFP3 and CFP4.

  16. IASS Activity

    Science.gov (United States)

    Hojaev, Alisher S.; Ibragimova, Elvira M.

    2015-08-01

    It’s well known, astronomy in Uzbekistan has ancient roots and traditions (e.g., Mirzo Ulugh Beg, Abū al-Rayhān al-Bīrūnī, Abū ‘Abdallāh al-Khwārizmī) and astronomical heritage carefully preserved. Nowadays uzbek astronomers play a key role in scientific research but also in OAD and Decadal Plan activity in the Central Asia region. International Aerospace School (IASS) is an amazing and wonderful event held annually about 30 years. IASS is unique project in the region, and at the beginning we spent the Summer and Winter Schools. At present in the summer camp we gather about 50 teenage and undergraduate students over the country and abroad (France, Malaysia, Turkey, Azerbaijan, Pakistan, Russia, etc.). They are selected on the basis of tests of astronomy and space issues. During two weeks of IASS camp the invited scientists, cosmonauts and astronauts as well as other specialists give lectures and engage in practical exercises with IASS students in astronomy, including daily observations of the Sun and night sky observations with meniscus telescope, space research and exploration, aerospace modelling, preparation and presentation of original projects. This is important that IASS gives not theoretical grounds only but also practically train the students and the hands-on training is the major aims of IASS. Lectures and practice in the field of astronomy carried out with the direct involvement and generous assistance of Uranoscope Association (Paris, France). The current 26-th IASS is planned to held in July 2015.

  17. Activation Energy

    Science.gov (United States)

    Gadeken, Owen

    2002-01-01

    Teaming is so common in today's project management environment that most of us assume it comes naturally. We further assume that when presented with meaningful and challenging work, project teams will naturally engage in productive activity to complete their tasks. This assumption is expressed in the simple (but false) equation: Team + Work = Teamwork. Although this equation appears simple and straightforward, it is far from true for most project organizations whose reality is a complex web of institutional norms based on individual achievement and rewards. This is illustrated by the very first successful team experience from my early Air Force career. As a young lieutenant, I was sent to Squadron Officer School, which was the first in the series of Air Force professional military education courses I was required to complete during my career. We were immediately formed into teams of twelve officers. Much of the course featured competition between these teams. As the most junior member of my team, I quickly observed the tremendous pressure to show individual leadership capability. At one point early in the course, almost everyone in our group was vying to become the team leader. This conflict was so intense that it caused us to fail miserably in our first outdoor team building exercise. We spent so much time fighting over leadership that we were unable to complete any of the events on the outdoor obstacle course. This complete lack of success was so disheartening to me that I gave our team little hope for future success. What followed was a very intense period of bickering, conflict, and even shouting matches as our dysfunctional team tried to cope with our early failures and find some way to succeed. British physician and researcher Wilfred Bion (Experiences in Groups, 1961) discovered that there are powerful psychological forces inherent in all groups that divert from accomplishing their primary tasks. To overcome these restraining forces and use the potential

  18. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... Physical Activity Basics Needs for Adults Needs for Children What Counts Needs for Older Adults Needs for ... Adding Physical Activity to Your Life Activities for Children Activities for Older Adults Overcoming Barriers Measuring Physical ...

  19. Benefits of Physical Activity

    Science.gov (United States)

    ... page from the NHLBI on Twitter. Benefits of Physical Activity Physical activity has many health benefits. These benefits ... of physical activity for your heart and lungs. Physical Activity Strengthens Your Heart and Improves Lung Function When ...

  20. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... Adults Needs for Children What Counts Needs for Older Adults Needs for Pregnant or Postpartum Women Physical Activity & ... to Your Life Activities for Children Activities for Older Adults Overcoming Barriers Measuring Physical Activity Intensity Target Heart ...

  1. Staying Active: Physical Activity and Exercise

    Science.gov (United States)

    ... Examples of muscle-strengthening activities include lifting weights, yoga, push-ups, and sit-ups. A “repetition” is one complete movement of an activity. To get health benefits, do muscle-strengthening activities until it is hard ...

  2. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... Needs for Pregnant or Postpartum Women Physical Activity & Health Adding Physical Activity to Your Life Activities for ... Obesity , National Center for Chronic Disease Prevention and Health Promotion Email Recommend Tweet YouTube Instagram Listen Watch ...

  3. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... Facts About Physical Activity Data, Trends and Maps Surveillance Systems Resources & Publications Reports Adults Need More Physical Activity MMWR Data Highlights State Indicator Report on Physical Activity, 2014 Recommendations & Guidelines ...

  4. Measuring Physical Activity Intensity

    Science.gov (United States)

    ... aerobic activity: relative intensity and absolute intensity. Relative Intensity The level of effort required by a person to do an activity. When using relative intensity, people pay attention to how physical activity affects ...

  5. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... aerobic activity: relative intensity and absolute intensity. Relative Intensity The level of effort required by a person to do an activity. When using relative intensity, people pay attention to how physical activity affects ...

  6. Physical Activity Assessment

    Science.gov (United States)

    Current evidence convincingly indicates that physical activity reduces the risk of colon and breast cancer. Physical activity may also reduce risk of prostate cancer. Scientists are also evaluating potential relationships between physical activity and other cancers.

  7. Physical Activity Basics

    Science.gov (United States)

    ... Weight Breastfeeding Micronutrient Malnutrition State and Local Programs Physical Activity Basics Recommend on Facebook Tweet Share Compartir How much physical activity do you need? Regular physical activity helps improve ...

  8. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... gov . Physical Activity Physical Activity Basics Needs for Adults Needs for Children What Counts Needs for Older Adults Needs for Pregnant or Postpartum Women Physical Activity & ...

  9. Physical activity and obesity

    National Research Council Canada - National Science Library

    Bouchard, Claude; Katzmarzyk, Peter T

    2010-01-01

    ... . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6 2 The Physical Activity and Exercise Continuum 7 Darren Warburton Definition of Health, Physical Activity, and Exercise . . . . . . . 7 The Continuum...

  10. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... Indicator Report on Physical Activity, 2014 Recommendations & Guidelines Fact Sheets & Infographics Social Media Tools Community Strategies Worksite Physical Activity Steps ...

  11. Immunizations: Active vs. Passive

    Science.gov (United States)

    ... Prevention > Immunizations > Immunizations: Active vs. Passive Safety & Prevention Listen Español Text Size Email Print Share Immunizations: Active vs. Passive Page Content Article Body Pediatricians can ...

  12. Active nematic gels as active relaxing solids

    OpenAIRE

    Turzi, Stefano S

    2017-01-01

    I put forward a continuum theory for active nematic gels, defined as fluids or suspensions of orientable rodlike objects endowed with active dynamics, that is based on symmetry arguments and compatibility with thermodynamics. The starting point is our recent theory that models (passive) nematic liquid crystals as relaxing nematic elastomers. The interplay between viscoelastic response and active dynamics of the microscopic constituents is naturally taken into account. By contrast with standar...

  13. Political activity for physical activity: health advocacy for active transport

    Directory of Open Access Journals (Sweden)

    Amun Qa-t-a

    2011-05-01

    Full Text Available Abstract Effective health advocacy is a priority for efforts to increase population participation in physical activity. Local councils are an important audience for this advocacy. The aim of the current study was to describe features of advocacy for active transport via submissions to city council annual plans in New Zealand, and the impact of an information sheet to encourage the health sector to be involved in this process. Written submissions to city council's annual consultation process were requested for 16 city councils over the period of three years (2007/08, 2008/09, and 2009/10. Submissions were reviewed and categories of responses were created. An advocacy information sheet encouraging health sector participation and summarising some of the evidence-base related to physical activity, active transport and health was released just prior to the 2009/10 submission time. Over the period of the study, city councils received 47,392 submissions, 17% of which were related to active transport. Most submissions came from city residents, with a small proportion (2% from the health sector. The largest category of submissions was in support of pedestrian and cycling infrastructure, design and maintenance of facilities and additional features to support use of these transport modes. Health arguments featured prominently in justifications for active transport initiatives, including concerns about injury risk, obesity, physical inactivity, personal safety and facilities for people with disabilities. There was evidence that the information sheet was utilised by some health sector submitters (12.5%, providing tentative support for initiatives of this nature. In conclusion, the study provides novel information about the current nature of health advocacy for active transport and informs future advocacy efforts about areas for emphasis, such as health benefits of active transport, and potential alliances with other sectors such as environmental

  14. Political activity for physical activity: health advocacy for active transport.

    Science.gov (United States)

    Richards, Rosalina; Murdoch, Linda; Reeder, Anthony I; Amun, Qa-t-a

    2011-05-29

    Effective health advocacy is a priority for efforts to increase population participation in physical activity. Local councils are an important audience for this advocacy. The aim of the current study was to describe features of advocacy for active transport via submissions to city council annual plans in New Zealand, and the impact of an information sheet to encourage the health sector to be involved in this process. Written submissions to city council's annual consultation process were requested for 16 city councils over the period of three years (2007/08, 2008/09, and 2009/10). Submissions were reviewed and categories of responses were created. An advocacy information sheet encouraging health sector participation and summarising some of the evidence-base related to physical activity, active transport and health was released just prior to the 2009/10 submission time. Over the period of the study, city councils received 47,392 submissions, 17% of which were related to active transport. Most submissions came from city residents, with a small proportion (2%) from the health sector. The largest category of submissions was in support of pedestrian and cycling infrastructure, design and maintenance of facilities and additional features to support use of these transport modes. Health arguments featured prominently in justifications for active transport initiatives, including concerns about injury risk, obesity, physical inactivity, personal safety and facilities for people with disabilities. There was evidence that the information sheet was utilised by some health sector submitters (12.5%), providing tentative support for initiatives of this nature. In conclusion, the study provides novel information about the current nature of health advocacy for active transport and informs future advocacy efforts about areas for emphasis, such as health benefits of active transport, and potential alliances with other sectors such as environmental sustainability, transport and urban

  15. Criminalisation of Activism

    DEFF Research Database (Denmark)

    Uldam, Julie

    Different forms of political participation involve different challenges. This paper focuses on challenges to radical activism and particularly the criminalisation of activism.......Different forms of political participation involve different challenges. This paper focuses on challenges to radical activism and particularly the criminalisation of activism....

  16. Active commuting to school

    Science.gov (United States)

    Declines in physical activity levels have coincided with increasing rates of obesity in children. This is problematic because physical activity has been shown to attenuate weight gain in children. Active commuting to school is one way of increasing children's physical activity. However, given the hi...

  17. Physical Activity During School

    DEFF Research Database (Denmark)

    Østergaard, Lars Domino

    It is important, not only on health grounds, to exercise and to be physically active. In school, physical activities have shown to improve the students’ academic behaviour resulting in improved attention and information processing as well as enhanced coping. To stimulate and motivate students...... to be even more active during school hours further enhancing their academic behaviour, it is important to know when, why and how they are active, and their attitude towards different types of physical activities. Therefore, the aim of this study was to categorize the physical activities attended by students...... during school hours and to elucidate their attitude towards the different types of activities. The data consisted of observations of lessons followed by group interviews. Analyses of the observations revealed six categories of physical activities, varying from mandatory physical activities, activities...

  18. Prediction of allosteric sites and mediating interactions through bond-to-bond propensities

    CERN Document Server

    Amor, Benjamin R C; Yaliraki, Sophia N; Barahona, Mauricio

    2016-01-01

    Allosteric regulation is central to many biochemical processes. Allosteric sites provide a target to fine-tune protein activity, yet we lack computational methods to predict them. Here, we present an efficient graph-theoretical approach for identifying allosteric sites and the mediating interactions that connect them to the active site. Using an atomistic graph with edges weighted by covalent and non-covalent bond energies, we obtain a bond-to-bond propensity that quantifies the effect of instantaneous bond fluctuations propagating through the protein. We use this propensity to detect the sites and communication pathways most strongly linked to the active site, assessing their significance through quantile regression and comparison against a reference set of 100 generic proteins. We exemplify our method in detail with three well-studied allosteric proteins: caspase-1, CheY, and h-Ras, correctly predicting the location of the allosteric site and identifying key allosteric interactions. Consistent prediction of...

  19. Accessibility, activity participation and location of activities

    DEFF Research Database (Denmark)

    Næss, Petter

    2006-01-01

    By investigating relationships between residential location and the availability of facilities, location of activities, trip distances, activity participation and trip frequencies, this paper seeks to contribute to a more detailed and nuanced understanding of the relationships between residential...... location and the amount of daily-life travel in an urban region. The empirical data are from a comprehensive study of residential location and travel in Copenhagen Metropolitan Area. Differences between inner- and outer-area residents in activity frequencies and trip frequencies are modest and partly...

  20. Cultural Activation of Consumers.

    Science.gov (United States)

    Siegel, Carole E; Reid-Rose, Lenora; Joseph, Adriana M; Hernandez, Jennifer C; Haugland, Gary

    2016-02-01

    This column discusses "cultural activation," defined as a consumer's recognition of the importance of providing cultural information to providers about cultural affiliations, challenges, views about, and attitudes toward behavioral health and general medical health care, as well as the consumer's confidence in his or her ability to provide this information. An aid to activation, "Cultural Activation Prompts," and a scale that measures a consumer's level of activation, the Cultural Activation Measurement Scale, are described. Suggestions are made about ways to introduce cultural activation as a component of usual care.

  1. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... Button Our Division About Us Nutrition Physical Activity Overweight & Obesity Healthy Weight Breastfeeding Micronutrient Malnutrition State and Local ... Button Our Division About Us Nutrition Physical Activity Overweight & Obesity Healthy Weight Breastfeeding Micronutrient Malnutrition State and Local ...

  2. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... for a breath. Absolute Intensity The amount of energy used by the body per minute of activity. ... or vigorous-intensity based upon the amount of energy used by the body while doing the activity. ...

  3. Italian active volcanoes

    Institute of Scientific and Technical Information of China (English)

    RobertoSantacroce; RenawCristofolini; LuigiLaVolpe; GiovanniOrsi; MauroRosi

    2003-01-01

    The eruptive histories, styles of activity and general modes of operation of the main active Italian volcanoes,Etna, Vulcano, Stromboli, Vesuvio, Campi Flegrei and Ischia, are described in a short summary.

  4. USAID Activity Locations

    Data.gov (United States)

    US Agency for International Development — The USAID Activities dataset is a snapshot of activities supported by USAID including their geographical locations within countries at the time of the snapshot. The...

  5. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... Button Our Division About Us Nutrition Physical Activity Overweight & Obesity Healthy Weight Breastfeeding Micronutrient Malnutrition State and Local Programs Measuring Physical Activity Intensity Recommend on Facebook Tweet Share Compartir For ...

  6. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... What's this? Submit Button Our Division About Us Nutrition Physical Activity Overweight & Obesity Healthy Weight Breastfeeding Micronutrient ... What's this? Submit Button Our Division About Us Nutrition Physical Activity Overweight & Obesity Healthy Weight Breastfeeding Micronutrient ...

  7. Physical Activity (Exercise)

    Science.gov (United States)

    ... page Subscribe to ePublications email updates. Enter email address Submit Home > ePublications > Our ePublications > Physical activity (exercise) fact sheet ePublications Physical activity (exercise) ...

  8. Active magnetic regenerator

    Science.gov (United States)

    Barclay, John A.; Steyert, William A.

    1982-01-01

    The disclosure is directed to an active magnetic regenerator apparatus and method. Brayton, Stirling, Ericsson, and Carnot cycles and the like may be utilized in an active magnetic regenerator to provide efficient refrigeration over relatively large temperature ranges.

  9. ACS Community Activities Contests

    Science.gov (United States)

    Burgener, Marisa

    2007-08-01

    The Committee on Community Activities and the Office of Community Activities announce the winners of the Illustrated Haiku Contest, Earth Day 2007 and the Poster Contest, National Chemistry Week 2006.

  10. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... David, Age 65 Harold, Age 67 Data & Statistics Facts About Physical Activity Data, Trends and Maps Surveillance ... Indicator Report on Physical Activity, 2014 Recommendations & Guidelines Fact Sheets & Infographics Social Media Tools Community Strategies Worksite ...

  11. Obesity and physical activity.

    Science.gov (United States)

    Jakicic, John M; Davis, Kelliann K

    2011-12-01

    Physical activity seems to be an important component of lifestyle interventions for weight loss and maintenance. Although the effects of physical activity on weight loss may seem to be modest, there seems to be a dose-response relationship between physical activity and weight loss. Physical activity also seems to be a critically important behavior to promote long-term weight loss and the prevention of weight regain. The benefits of physical activity on weight loss are also observed in patients with severe obesity (BMI ≥ 35 kg/m²) and in patients who have undergone bariatric surgery. Moreover, independent of the effect of physical activity on body weight, engagement in physical activity that results in improved cardiorespiratory fitness can contribute to reductions in health risk in overweight and obese adults. Thus, progression of overweight and obese patients to an adequate dose of physical activity needs to be incorporated into clinical interventions for weight control.

  12. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... Compartir For more help with what counts as aerobic activity, watch this video: Windows Media Player, 4: ... ways to understand and measure the intensity of aerobic activity: relative intensity and absolute intensity. Relative Intensity ...

  13. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... Our Division About Us Nutrition Physical Activity Overweight & Obesity Healthy Weight Breastfeeding Micronutrient Malnutrition State and Local ... Our Division About Us Nutrition Physical Activity Overweight & Obesity Healthy Weight Breastfeeding Micronutrient Malnutrition State and Local ...

  14. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... Email Address What's this? Submit What's this? Submit Button Our Division About Us Nutrition Physical Activity Overweight & ... Email Address What's this? Submit What's this? Submit Button Our Division About Us Nutrition Physical Activity Overweight & ...

  15. Active Marine Station Metadata

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Active Marine Station Metadata is a daily metadata report for active marine bouy and C-MAN (Coastal Marine Automated Network) platforms from the National Data...

  16. Major operations and activities

    Energy Technology Data Exchange (ETDEWEB)

    Black, D.G.

    1995-06-01

    This section of the 1994 Hanford Site Environmental Report summarizes the major operations and activities on the site. These operations and activities include site management, waste management, environmental restoration and corrective actions, and research and technology development.

  17. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... Physical Activity, 2014 Recommendations & Guidelines Fact Sheets & Infographics Social Media Tools Community Strategies Worksite Physical Activity Steps ... file formats (PDF, DOC, PPT, MPEG) on this site? Adobe PDF file Microsoft PowerPoint file Microsoft Word ...

  18. Facts about Physical Activity

    Science.gov (United States)

    ... Nutrition Physical Activity Overweight & Obesity Healthy Weight Breastfeeding Micronutrient Malnutrition State and Local Programs Facts about Physical ... Nutrition Physical Activity Overweight & Obesity Healthy Weight Breastfeeding Micronutrient Malnutrition State and Local Programs File Formats Help: ...

  19. Family Activities for Fitness

    Science.gov (United States)

    Grosse, Susan J.

    2009-01-01

    This article discusses how families can increase family togetherness and improve physical fitness. The author provides easy ways to implement family friendly activities for improving and maintaining physical health. These activities include: walking, backyard games, and fitness challenges.

  20. Measurement of Physical Activity.

    Science.gov (United States)

    Dishman, Rod K.; Washburn, Richard A.; Schoeller, Dale A.

    2001-01-01

    Valid assessment of physical activity must be unobtrusive, practical to administer, and specific about physical activity type, frequency, duration, and intensity. Assessment methods can be categorized according to whether they provide direct or indirect (e.g., self-report) observation of physical activity, body motion, physiological response…

  1. Activity Theory and Ontology

    Science.gov (United States)

    Peim, Nick

    2009-01-01

    This paper seeks to re-examine Yrio Engestrom's activity theory as a technology of knowledge designed to enable positive transformations of specific practices. The paper focuses on a key paper where Engestrom defines the nature and present state of activity theory. Beginning with a brief account of the relations between activity theory and…

  2. Obesity and physical activity.

    NARCIS (Netherlands)

    Westerterp, K.R.

    1999-01-01

    Department of Human Biology, Maastricht University, The Netherlands. k.westerterp@hb.unimaas.nl OBJECTIVES: Three aspects of obesity and physical activity are reviewed: whether the obese are inactive; how the activity level can be increased; and which are the effects of an increase in physical activ

  3. Ras activation by SOS

    DEFF Research Database (Denmark)

    Iversen, Lars; Tu, Hsiung-Lin; Lin, Wan-Chen;

    2014-01-01

    Activation of the small guanosine triphosphatase H-Ras by the exchange factor Son of Sevenless (SOS) is an important hub for signal transduction. Multiple layers of regulation, through protein and membrane interactions, govern activity of SOS. We characterized the specific activity of individual ...

  4. Recurrent radio activity in active galactic nuclei

    Directory of Open Access Journals (Sweden)

    Jamrozy M.

    2012-12-01

    Full Text Available There has been a growing body of persuasive evidence to indicate that AGN activity, powered by mass accretion onto a supermassive black hole, can involve multiple episodes. Thus thinking of jet activity as occurring within a unique brief period in the life of a galaxy is no longer valid. The most striking examples of AGNs with recurrent jet activity are the double-double radio sources, which contain two or more pairs of distinct lobes on the opposite sides of a parent optical object. On the other hand, we have now conclusive arguments that galaxy mergers and interactions are principal triggers for AGNs. Quite a number of examples of powerful radio sources hosted by galaxies with peculiar optical morphologies (tails, shells, dust-lanes, etc. can be cited to support such a scenario. The structure and spectra of extended radio emission from radio galaxies, with sizes ranging up to a few Mpc, can provide a lot of information on the history of the central AGN activity, while the spectral and dynamical ages of these extended radio lobes could be used to constrain the time scales of recurrent AGN activity.

  5. Proteolytic activities in yeast.

    Science.gov (United States)

    Saheki, T; Holzer, H

    1975-03-28

    Studies on the mechanism and time course of the activation of proteinases A (EC 3.4.23.8), B (EC 3.4.22.9) and C (EC 3.4.12.--) in crude yeast extracts at pH 5.1 and 25 degrees C showed that the increase in proteinase B activity is paralleled with the disappearance of proteinase B inhibitor. Addition of purified proteinase A to fresh crude extracts accelerates the inactivation of the proteinase B inhibitor and the appearance of maximal activities of proteinases B and C. The decrease of proteinase B inhibitor activity and the increase of proteinase B activity are markedly retarded by the addition of pepstatin. Because 10-minus 7 M pepstatin completely inhibits proteinase A without affecting proteinase B activity, this is another indication for the role of proteinase A during the activation of proteinase B. Whereas extracts of yeast grown on minimal medium reached maximal activation of proteinases B and C after 20 h of incubation at pH 5.1 and 25 degrees C, extracts of yeast grown on complete medium had to be incubated for about 100 h. In the latter case, the addition of proteinas A results in maximal activation of proteinases B and C and disappearance of proteinase B inhibitor activity only after 10--20 h of incubation. With the optimal conditions, the maximal activities of proteinases A, B and C, as well as of the proteinase B inhibitor, were determined in crude extracts of yeast that had been grown batchwise for different lengths of time either on minimal or on complete medium. Upon incubation, all three proteinases were activated by several times their initial activity. This reflects the existence of proteolytically degradable inhibitors of the three proteinases and together with the above mentioned observations it demonstrates that the "activation" of yeast proteinases A, B and C upon incubation results from the proteolytic digestion of inhibitors rather than from activation of inactive zymogens by limited proteolysis.

  6. Active ageing technologies

    DEFF Research Database (Denmark)

    Lassen, Aske Juul

    the elderly. As part of this rearticulation of old age, many new technologies take form. This paper uses a wide concept of technologies (devices, regimes, strategies and ways of doing) and argues that technologies form active aging subjectivities, and on the other hand, that these subjectivities...... ‘sites of active aging’ in Denmark. By presenting three technologies of active aging (billiards at an activity center for elderly persons, dancing tiles for rehabilitation after falls and an online fitness community for elderly persons) the paper suggests that active aging is more than regimes...

  7. Accessibility, activity participation and location of activities

    DEFF Research Database (Denmark)

    Næss, Petter

    2006-01-01

    By investigating relationships between residential location and the availability of facilities, location of activities, trip distances, activity participation and trip frequencies, this paper seeks to contribute to a more detailed and nuanced understanding of the relationships between residential...... outweigh each other. However, differences in trip distances due to the location of the dwelling relative to concentrations of facilities translate into substantially longer total travelling distances among suburbanites than among inner-city residents....... location and the amount of daily-life travel in an urban region. The empirical data are from a comprehensive study of residential location and travel in Copenhagen Metropolitan Area. Differences between inner- and outer-area residents in activity frequencies and trip frequencies are modest and partly...

  8. Active knee joint flexibility and sports activity

    DEFF Research Database (Denmark)

    Hahn, Thomas; Foldspang, Anders; Vestergaard, E

    1999-01-01

    was significantly higher in women than in men and significantly positively associated with weekly hours of swimming and weekly hours of competitive gymnastics. Active knee flexion was significantly positively associated with participation in basketball, and significantly negatively associated with age and weekly...

  9. Marine Biology Activities. Ocean Related Curriculum Activities.

    Science.gov (United States)

    Pauls, John

    The ocean affects all of our lives. Therefore, awareness of and information about the interconnections between humans and oceans are prerequisites to making sound decisions for the future. Project ORCA (Ocean Related Curriculum Activities) has developed interdisciplinary curriculum materials designed to meet the needs of students and teachers…

  10. Trichomonas tenax proteolytic activity.

    Science.gov (United States)

    Segović, S; Buntak-Kobler, D; Galić, N; Katunarić, M

    1998-12-01

    In this study, proteolytic activity of Trichomonas tenax collected directly from patient's dentobacterial plaque was examined. Electrophoretic method involving polyacrylamide gels (Commassie Brilliant Blue R-250) and electrophoretic method involving gelatin-containing polyacrylamide gels, have been used to analyse Trichomonas tenax proteolytic activity. The most obvious and the fastest activities were obtained when gels were incubated in pH 4.6; followed by results of incubating in pH 5.6; while in pH 2.8 activity was less effective but still obvious. Proteolytic activities were the most effective in area of protein MW 36 kDa. Different activities of enzymes depending on pH of incubated media indicate the presence of different endopeptidases in cell lysates of protozoon Trichomonas tenax from dentobacterial plaque.

  11. Lupus Activity in Pregnancy

    OpenAIRE

    Clowse, Megan E. B.

    2007-01-01

    Pregnancy in a woman with Systemic Lupus Erythematosus (SLE) can be complicated by both lupus activity and pregnancy mishaps. The majority of recent studies demonstrate an increase in lupus activity during pregnancy, perhaps exacerbated by hormonal shifts required to maintain pregnancy. Increased lupus activity, in turn, prompts an elevated risk for poor pregnancy outcomes, including stillbirth, preterm birth, low birth weight, and preeclamspsia. Fortunately, the majority of pregnancies in wo...

  12. [Biomedical activity of biosurfactants].

    Science.gov (United States)

    Krasowska, Anna

    2010-07-23

    Biosurfactants, amphiphilic compounds, synthesized by microorganisms have surface, antimicrobial and antitumor properties. Biosurfactants prevent adhesion and biofilms formation by bacteria and fungi on various surfaces. For many years microbial surfactants are used as antibiotics with board spectrum of activity against microorganisms. Biosurfactants act as antiviral compounds and their antitumor activities are mediated through induction of apoptosis. This work presents the current state of knowledge related to biomedical activity of biosurfactants.

  13. CDBG Economic Development Activity

    Data.gov (United States)

    Department of Housing and Urban Development — CDBG activity related to economic development, including commercial or industrial rehab, commercial or industrial land acquisition, commercial or industrial...

  14. CDBG Housing Activity

    Data.gov (United States)

    Department of Housing and Urban Development — CDBG activity related to housing, including multifamily rehab, housing services, code enforcement, operation and repair of foreclosed property and public housing...

  15. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... Adults Overcoming Barriers Measuring Physical Activity Intensity Target Heart Rate & Estimated Maximum Heart Rate Perceived Exertion (Borg Rating of Perceived Exertion Scale) ...

  16. CDBG Public Services Activity

    Data.gov (United States)

    Department of Housing and Urban Development — CDBG activity related to public services, including senior services, legal services, youth services, employment training, health services, homebuyer counseling, food...

  17. Activities of the ILO.

    Science.gov (United States)

    Labour Education, 1984

    1984-01-01

    Seven articles on International Labour Organization (ILO) activities cover study groups at ILO headquarters, a Philippine rural workers seminar, women's participation in Central American union activities, worksite courses in India, and seminars and symposia in Cape Verde, Mauritius, and Sierra Leone. (SK)

  18. Obesity, Physical Activity - Children.

    Science.gov (United States)

    Gilliam, Thomas B.

    Childhood obesity starts at a very early age, and preventive measures taken early enough may retard the development of fat cells. It appears that physical activity plays an important role in reducing obesity. The activity program must start early, in preschool days. It is felt that screening children for obesity when they first enter school and…

  19. The Activity of Play

    DEFF Research Database (Denmark)

    Pichlmair, Martin

    2016-01-01

    This paper presents Activity Theory as a framework for understanding the action of playing games with the intention of building a foundation for the creation of new game design tools and methods. Activity Theory, an epistemological framework rooted in Soviet psychology of the first half of the 20...

  20. Choreography of AMPK activation.

    Science.gov (United States)

    Langendorf, Christopher G; Kemp, Bruce E

    2015-01-01

    A recent study published in Cell Research by Li and colleagues reports a detailed biophysical and structural study of AMPK's intra-molecular interactions during activation. By employing subunit tagging and proximity analysis with the aid of AlphaScreen instrumentation, Li et al. add to our understanding of the choreography of activation of AMPK by both nucleotides and phosphorylation.

  1. Emotionally Intense Science Activities

    Science.gov (United States)

    King, Donna; Ritchie, Stephen; Sandhu, Maryam; Henderson, Senka

    2015-01-01

    Science activities that evoke positive emotional responses make a difference to students' emotional experience of science. In this study, we explored 8th Grade students' discrete emotions expressed during science activities in a unit on Energy. Multiple data sources including classroom videos, interviews and emotion diaries completed at the end of…

  2. Reflections on Activity Theory

    Science.gov (United States)

    Bakhurst, David

    2009-01-01

    It is sometimes suggested that activity theory represents the most important legacy of Soviet philosophy and psychology. But what exactly "is" activity theory? The canonical account in the West is given by Engestrom, who identifies three stages in the theory's development: from Vygotsky's insights, through Leontiev's articulation of the…

  3. Respirometry in activated sludge

    NARCIS (Netherlands)

    Spanjers, H.

    1993-01-01

    The purpose of the study was (1) to develop a respiration meter capable of continuously measuring, using different procedures, the oxygen uptake rate of activated sludge and (2) to expand knowledge about respiration related characteristics of wastewater and activated sludge.

    A

  4. Activity Book: Ocean Ecology.

    Science.gov (United States)

    Learning, 1992

    1992-01-01

    Presents a collection of activities to help elementary students study ocean ecology. The activities have students investigate ocean inhabitants, analyze animal adaptations, examine how temperature and saltiness affect ocean creatures, and learn about safeguarding the sea. Student pages offer reproducible learning sheets. (SM)

  5. Global physical activity levels

    DEFF Research Database (Denmark)

    Hallal, Pedro C; Andersen, Lars Bo; Bull, Fiona C

    2012-01-01

    To implement effective non-communicable disease prevention programmes, policy makers need data for physical activity levels and trends. In this report, we describe physical activity levels worldwide with data for adults (15 years or older) from 122 countries and for adolescents (13-15-years-old) ...

  6. Peak Longevity Physical Activity

    Science.gov (United States)

    People who engage in three to five times the recommended minimum level of leisure-time physical activity derive the greatest benefit in terms of mortality reduction when compared with people who do not engage in leisure-time physical activity.

  7. Physical Activity Questionnaire

    Directory of Open Access Journals (Sweden)

    Kostencka Alicja

    2016-11-01

    Full Text Available Study aim: The aim of the study was to determine the weekly energy expenditure measuring MET/min/week based on data collected through the Canada Fitness Survey (CFS, according to the classification used in the International Physical Activity Questionnaire (IPAQ, and to verify the adopted method to assess the level of physical activity in students of physical education.

  8. Emotionally Intense Science Activities

    Science.gov (United States)

    King, Donna; Ritchie, Stephen; Sandhu, Maryam; Henderson, Senka

    2015-01-01

    Science activities that evoke positive emotional responses make a difference to students' emotional experience of science. In this study, we explored 8th Grade students' discrete emotions expressed during science activities in a unit on Energy. Multiple data sources including classroom videos, interviews and emotion diaries completed at the end of…

  9. Active at Any Size

    Science.gov (United States)

    ... go to the gym all the time to benefit from being active. To make physical activity more fun, try something you enjoy doing, such as dancing to the radio or taking a yoga class with friends. Many people find they start ...

  10. Active and Healthy Schools

    Science.gov (United States)

    Ball, Stephen; Kovarik, Jessica; Leidy, Heather

    2015-01-01

    The Active and Healthy School Program (AHS) can be used to alter the culture and environment of a school to help children make healthier choices. The purpose of this study was to determine the effectiveness of AHS to increase physical activity while decreasing total screen time, increase healthy food choices, and improve knowledge about physical…

  11. Reflections on Activity Theory

    Science.gov (United States)

    Bakhurst, David

    2009-01-01

    It is sometimes suggested that activity theory represents the most important legacy of Soviet philosophy and psychology. But what exactly "is" activity theory? The canonical account in the West is given by Engestrom, who identifies three stages in the theory's development: from Vygotsky's insights, through Leontiev's articulation of the…

  12. Tendinopathy and Doppler activity

    DEFF Research Database (Denmark)

    Boesen, M I; Koenig, M J; Torp-Pedersen, S

    2006-01-01

    Intratendinous Doppler activity has been interpreted as an equivalent of neovessels in the Achilles tendon and as a sign of tendinosis (AT).......Intratendinous Doppler activity has been interpreted as an equivalent of neovessels in the Achilles tendon and as a sign of tendinosis (AT)....

  13. Activating Event Knowledge

    Science.gov (United States)

    Hare, Mary; Jones, Michael; Thomson, Caroline; Kelly, Sarah; McRae, Ken

    2009-01-01

    An increasing number of results in sentence and discourse processing demonstrate that comprehension relies on rich pragmatic knowledge about real-world events, and that incoming words incrementally activate such knowledge. If so, then even outside of any larger context, nouns should activate knowledge of the generalized events that they denote or…

  14. Biomedical activity of biosurfactants

    OpenAIRE

    Anna Krasowska

    2010-01-01

    Biosurfactants, amphiphilic compounds, synthesized by microorganisms have surface, antimicrobial and antitumor properties. Biosurfactants prevent adhesion and biofilms formation by bacteria and fungi on various surfaces. For many years microbial surfactants are used as antibiotics with board spectrum of activity against microorganisms. Biosurfactants act as antiviral compounds and their antitumor activities are mediated through induction of apoptosis. This work presents the current state of k...

  15. Activity-based design

    DEFF Research Database (Denmark)

    Andersen, Peter Bøgh

    2006-01-01

    : what you can do depends upon where you are. Finally, human and automatic machinery alternate in filling certain roles in the activity: sometime the officer maintains the course, sometimes the autopilot. Such activities require us to rethink the traditional oppositions between communication...

  16. Determinants of Physical Activity in Active and Low-Active, Sixth Grade African-American Youth.

    Science.gov (United States)

    Trost, Stewart G.; Pate, Russell R.; Ward, Dianne S.; Saunders, Ruth; Riner, William

    1999-01-01

    Compared determinants of physical activity in active and low-active African-American sixth graders, surveying students and making objective assessments of physical activity over seven days. Results indicated that physical activity self-efficacy, beliefs about physical activity outcomes, involvement in community-based physical activity, perception…

  17. Intracellular light-activation of riboswitch activity.

    Science.gov (United States)

    Walsh, Steven; Gardner, Laura; Deiters, Alexander; Williams, Gavin J

    2014-06-16

    By combining a riboswitch with a cell-permeable photocaged small-molecule ligand, an optochemical gene control element was constructed that enabled spatial and temporal control of gene expression in bacterial cells. The simplicity of this strategy, coupled with the ability to create synthetic riboswitches with tailored ligand specificities and output in a variety of microorganisms, plants, and fungi might afford a general strategy to photocontrol gene expression in vivo. The ability to activate riboswitches by using light enables the interrogation and manipulation of a wide range of biological processes with high precision, and will have broad utility in the regulation of artificial genetic circuits.

  18. Active optical zoom system

    Science.gov (United States)

    Wick, David V.

    2005-12-20

    An active optical zoom system changes the magnification (or effective focal length) of an optical imaging system by utilizing two or more active optics in a conventional optical system. The system can create relatively large changes in system magnification with very small changes in the focal lengths of individual active elements by leveraging the optical power of the conventional optical elements (e.g., passive lenses and mirrors) surrounding the active optics. The active optics serve primarily as variable focal-length lenses or mirrors, although adding other aberrations enables increased utility. The active optics can either be LC SLMs, used in a transmissive optical zoom system, or DMs, used in a reflective optical zoom system. By appropriately designing the optical system, the variable focal-length lenses or mirrors can provide the flexibility necessary to change the overall system focal length (i.e., effective focal length), and therefore magnification, that is normally accomplished with mechanical motion in conventional zoom lenses. The active optics can provide additional flexibility by allowing magnification to occur anywhere within the FOV of the system, not just on-axis as in a conventional system.

  19. Emotionally Intense Science Activities

    Science.gov (United States)

    King, Donna; Ritchie, Stephen; Sandhu, Maryam; Henderson, Senka

    2015-08-01

    Science activities that evoke positive emotional responses make a difference to students' emotional experience of science. In this study, we explored 8th Grade students' discrete emotions expressed during science activities in a unit on Energy. Multiple data sources including classroom videos, interviews and emotion diaries completed at the end of each lesson were analysed to identify individual student's emotions. Results from two representative students are presented as case studies. Using a theoretical perspective drawn from theories of emotions founded in sociology, two assertions emerged. First, during the demonstration activity, students experienced the emotions of wonder and surprise; second, during a laboratory activity, students experienced the intense positive emotions of happiness/joy. Characteristics of these activities that contributed to students' positive experiences are highlighted. The study found that choosing activities that evoked strong positive emotional experiences, focused students' attention on the phenomenon they were learning, and the activities were recalled positively. Furthermore, such positive experiences may contribute to students' interest and engagement in science and longer term memorability. Finally, implications for science teachers and pre-service teacher education are suggested.

  20. Biological activities of alginate.

    Science.gov (United States)

    Ueno, Mikinori; Oda, Tatsuya

    2014-01-01

    To gain insight into the structure-activity relationship of alginate, we examined the effect of alginates with varying molecular weights and M/G ratio on murine macrophage cell line, RAW264.7 cells in terms of induction of tumor necrosis factor-α (TNF-α) secretion. Among the alginates tested, alginate with the highest molecular weight (MW 38,000, M/G 2.24) showed the most potent TNF-α-inducing activity. Alginates having higher M/G ratio tended to show higher activity. These results suggest that molecular size and M/G ratio are important structural parameters influencing the TNF-α-inducing activity. Interestingly, enzymatic depolymerization of alginate with bacterial alginate lyase resulted in dramatic increase in the TNF-α-inducing activity. The higher activity of enzymatically digested alginate oligomers to induce nitric oxide production from RAW264.7 cells than alginate polymer was also observed. On the other hand, alginate polymer and oligomer showed nearly equal hydroxyl radical scavenging activities.

  1. Active Packaging Coatings

    Directory of Open Access Journals (Sweden)

    Luis J. Bastarrachea

    2015-11-01

    Full Text Available Active food packaging involves the packaging of foods with materials that provide an enhanced functionality, such as antimicrobial, antioxidant or biocatalytic functions. This can be achieved through the incorporation of active compounds into the matrix of the commonly used packaging materials, or by the application of coatings with the corresponding functionality through surface modification. The latter option offers the advantage of preserving the packaging materials’ bulk properties nearly intact. Herein, different coating technologies like embedding for controlled release, immobilization, layer-by-layer deposition, and photografting are explained and their potential application for active food packaging is explored and discussed.

  2. Physics of solar activity

    Science.gov (United States)

    Sturrock, Peter A.

    1993-01-01

    The aim of the research activity was to increase our understanding of solar activity through data analysis, theoretical analysis, and computer modeling. Because the research subjects were diverse and many researchers were supported by this grant, a select few key areas of research are described in detail. Areas of research include: (1) energy storage and force-free magnetic field; (2) energy release and particle acceleration; (3) radiation by nonthermal electrons; (4) coronal loops; (5) flare classification; (6) longitude distributions of flares; (7) periodicities detected in the solar activity; (8) coronal heating and related problems; and (9) plasma processes.

  3. Active Directory cookbook

    CERN Document Server

    Hunter, Laura

    2008-01-01

    When you need practical hands-on support for Active Directory, the updated edition of this extremely popular Cookbook provides quick solutions to more than 300 common (and uncommon) problems you might encounter when deploying, administering, and automating Microsoft's network directory service. For the third edition, Active Directory expert Laura E. Hunter offers troubleshooting recipes based on valuable input from Windows administrators, in addition to her own experience. You'll find solutions for the Lightweight Directory Access Protocol (LDAP), ADAM (Active Directory Application Mode), m

  4. A universe of activities

    Science.gov (United States)

    Armentia, J.; Jáuregui, F.; Gordón, N.; Manzanal, R.

    Since its opening back in november 1993 the Planetarium of Pamplona has gone a long way creating activities related to teaching and communicating Astronomy, Science and other areas of what we call Culture. In this poster we present a summary of some of the most relevant activities that have had an special relevance throughout these years. We will refer to our “School of Stars” in which more than 400 000 students have already been involved and other activities that have been very appreciated by our visitors.

  5. China's Space Activities

    Institute of Scientific and Technical Information of China (English)

    China National Space Administration

    2004-01-01

    @@ Currently, space activities are very active around the world. Space technologies continuously expand to various areas of human activities, and space technology and applications are becoming an indispensable part of modern information society,while the development of space science brings a brand-new view to the development of science and technology. The development of space law is not only an important approach to improving people' s quality of lives, expanding the living space of human being, and exploiting new resources, but also an important symbol of the comprehensive strength and civilization of a nation.

  6. Creative activity and inclusion

    Directory of Open Access Journals (Sweden)

    Shemanov A.Yu.

    2013-09-01

    Full Text Available The aim of the article was to analyze the inclusion potential of art creative activity, namely of theatre performance, in people with disabilities. The article provides examples of disagreements in understanding the significance of these art activities for exercising the rights of people with disabilities to contribute to culture and art and some problems arising here. The conclusion is made that theatre art performed by people with disabilities is gradually changing its function: from being a means of self-affirmation to the determination of its specific place in overall theatre process. These changes confirm the inclusion potential of theatre art activity.

  7. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... updated: June 4, 2015 Content source: Division of Nutrition, Physical Activity, and Obesity , National Center for Chronic Disease Prevention and Health Promotion ... Services HHS/Open USA.gov Top

  8. MARIHUANA ACTIVITY OF CANNABINOL.

    Science.gov (United States)

    Loewe, S

    1945-12-14

    Cannabinol, generally believed to be an inert component of hemp oil, is shown to have marihuana activity. The significance of this observation with regard to the relationship between structure and mamactivity in the class of cannabinols is discussed.

  9. Physical activity: genes & health

    CERN Document Server

    2002-01-01

    Carl Johan SUNDBERG is an Associate Professor in Physiology and Licenced Physician. His research focus is Molecular mechanisms involved in the adaptation of human skeletal muscle to physical activity.

  10. PRCR Classes and Activities

    Data.gov (United States)

    Town of Cary, North Carolina — This data is specific to Parks and Recreation classes, workshops, and activities within the course catalog. It contains an entry for upcoming classes.*This data set...

  11. Effects of Activating Schoolyards

    DEFF Research Database (Denmark)

    Pawlowski, Charlotte Skau; Schipperijn, Jasper; Andersen, Henriette Bondo

    access to the renovated areas for older children and allowed them to leave the school area during recess. Furthermore, most of the children felt that the renewed schoolyard areas were far from their classrooms. CONCLUSIONS: Renewing the schoolyard is not enough to stimulate physical activity. Schools...... have to support the older children’s recess physical activity on an organisational level by encourage them to use the schoolyard and renewing schoolyard areas close to their classrooms. This follow-up study of children’s perception of the renewed schoolyards can aid development of future schoolyard......PURPOSE: There is no consistent evidence to guide schoolyard interventions promoting physical activity. The Activating Schoolyards Study is a quasi-experimental schoolyard intervention study aimed at investigating the impact of renewed schoolyards on 10-15-year-old children’s recess physical...

  12. OTI Activity Database

    Data.gov (United States)

    US Agency for International Development — OTI's worldwide activity database is a simple and effective information system that serves as a program management, tracking, and reporting tool. In each country,...

  13. Vessel Activity Record

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Vessel Activity Record is a bi-weekly spreadsheet that shows the status of fishing vessels. It records whether fishing vessels are fishing without an observer...

  14. Bax activation by Bim?

    National Research Council Canada - National Science Library

    Czabotar, P E; Colman, P M; Huang, D C S

    2009-01-01

    .... Although some data support a role for certain BH3-only proteins, such as Bim or tBid, to directly activate Bax, others have led to the conclusion that BH3-only proteins act indirectly by antagonizing...

  15. Math Lab Activities

    Science.gov (United States)

    Brumbaugh, Douglas K.; Hynes, Michael C.

    1974-01-01

    The goals, objects, materials and grade levels are specified in this description of a laboratory activity involving analytic geometry concepts. Students mark out bicycle gymkhana courses in which directions to participants are given by Cartesian coordinates. (JP)

  16. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... Older Adults Overcoming Barriers Measuring Physical Activity Intensity Target Heart Rate & Estimated Maximum Heart Rate Perceived Exertion ( ... a heavy backpack Other Methods of Measuring Intensity Target Heart Rate and Estimated Maximum Heart Rate Perceived ...

  17. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... on this page will be unavailable. For more information about this message, please visit this page: About CDC.gov . ... Resources & Publications Reports Adults Need More Physical Activity ...

  18. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... updated: June 4, 2015 Content source: Division of Nutrition, Physical Activity, and Obesity , National Center for Chronic Disease Prevention and Health Promotion Email Recommend Tweet YouTube Instagram Listen Watch ...

  19. Habitats, activities, and signs

    DEFF Research Database (Denmark)

    Andersen, Peter Bøgh; Brynskov, Martin

    2004-01-01

    Digital habitats is a framework for designing and modeling environments for activities that involve mobile and embedded computing systems. This paper 1) introduces the basic concepts of the framework, i.e. activity, thematic role, and the three ‘dimensions’ of a habitat: physical, informational, ......, and pragmatic, 2) proposes a notation, and 3) sketches a method and exemplifies areas of application using authentic cases from hospital work, primary school education, the maritime domain, and other areas......Digital habitats is a framework for designing and modeling environments for activities that involve mobile and embedded computing systems. This paper 1) introduces the basic concepts of the framework, i.e. activity, thematic role, and the three ‘dimensions’ of a habitat: physical, informational...

  20. Extravehicular activity technology discipline

    Science.gov (United States)

    Webbon, Bruce W.

    1990-01-01

    Viewgraphs on extravehicular activity technology discipline for Space Station Freedom are presented. Topics covered include: extravehicular mobility unit; airlock and EMU support equipment; tools, mobility aids, and workstations; and telerobotic work aids interfaces.

  1. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... energy used by the body while doing the activity. Top of Page Moderate Intensity Walking briskly (3 miles per hour or faster, but not race-walking) Water aerobics Bicycling slower than 10 miles per hour ...

  2. Active flows on trees

    CERN Document Server

    Forrow, Aden; Dunkel, Jörn

    2016-01-01

    Coherent, large scale dynamics in many nonequilibrium physical, biological, or information transport networks are driven by small-scale local energy input. We introduce and explore a generic model for compressible active flows on tree networks. In contrast to thermally-driven systems, active friction selects discrete states with only a small number of oscillation modes activated at distinct fixed amplitudes. This state selection interacts with graph topology to produce different localized dynamical time scales in separate regions of large networks. Using perturbation theory, we systematically predict the stationary states of noisy networks and find good agreement with a Bayesian state estimation based on a hidden Markov model applied to simulated time series data on binary trees. While the number of stable states per tree scales exponentially with the number of edges, the mean number of activated modes in each state averages $\\sim 1/4$ the number of edges. More broadly, these results suggest that the macrosco...

  3. Creating Art Appreciation Activities.

    Science.gov (United States)

    Heidt, Ann H.

    1986-01-01

    The experiences of college students enrolled as majors in elementary education in designing art appreciation activities for use in elementary classrooms are described. The college students had no art background. (RM)

  4. Tanzania - Kigoma Solar Activity

    Data.gov (United States)

    Millennium Challenge Corporation — The performance evaluation of the Kigoma solar activity was designed to answer questions about the implementation of the program and about outcomes that may have...

  5. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... 2015 Page last updated: June 4, 2015 Content source: Division of Nutrition, Physical Activity, and Obesity , National ... INFO U.S. Department of Health & Human Services HHS/Open USA.gov Top

  6. Interactive Design Activism

    Science.gov (United States)

    Goulev, Petar; Farrer, Joan

    The following sections are included: * Introduction * Computers and Human Well-being * To Fuzzy or Yes (No)! * Interactive Design Activism * Sensing the Sun * Personalised Public Health Advice * Modifying Human Behaviour * Transdisciplinarity, Knowledge Transfer and Multi-domain

  7. Homebuyer Activities Report

    Data.gov (United States)

    Department of Housing and Urban Development — This monthly report is an Excel spreadsheet. PJs can use this report to view homebuyer activities with the 2012 or 2013 program year in IDIS that are in final draw,...

  8. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... Sheets & Infographics Social Media Tools Community Strategies Worksite Physical Activity Steps to Wellness Walkability Audit Tool Sample Audit Glossary Selected References Discount Fitness Club Network Assessing Need and Interest Selecting a ...

  9. CDBG Public Improvements Activity

    Data.gov (United States)

    Department of Housing and Urban Development — CDBG activity related to public improvements, including senior centers, youth centers, parks, street improvements, water/sewer improvements, child care centers, fire...

  10. Active Fire Mapping Program

    Science.gov (United States)

    Active Fire Mapping Program Current Large Incidents (Home) New Large Incidents Fire Detection Maps MODIS Satellite Imagery VIIRS Satellite Imagery Fire Detection GIS Data Fire Data in Google Earth ...

  11. The Active Music Reception

    OpenAIRE

    Šulanová, Silvie

    2009-01-01

    Listening to music in the process of education is beneficial for a pupil only in case it is realized by means of active creativeness. To meet this requirement specific activities concerning music listening are applied in the framework of receptive music teaching. The dissertation proposes a so called dynamic model to function as an ideal solution to didactic transformation of music. The model enables to set up such classroom conditions in which pupils find it easier to observe elementary item...

  12. RAVEN Quality Assurance Activities

    Energy Technology Data Exchange (ETDEWEB)

    Cogliati, Joshua Joseph [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2015-09-01

    This report discusses the quality assurance activities needed to raise the Quality Level of Risk Analysis in a Virtual Environment (RAVEN) from Quality Level 3 to Quality Level 2. This report also describes the general RAVEN quality assurance activities. For improving the quality, reviews of code changes have been instituted, more parts of testing have been automated, and improved packaging has been created. For upgrading the quality level, requirements have been created and the workflow has been improved.

  13. TPR And TPR Activities

    Institute of Scientific and Technical Information of China (English)

    宋丽萍

    2008-01-01

    This paper presents the definition of Total Physical Response(TPR),elaborates the process and the principles of it 80 that more and more TPR activities can be created according to them.The use of TPR shows us an interesting and effective way of teaching and learning English.TPR activities are interesting,challenging and motivating that almost all the students enjoy them.

  14. Intercreativity: Mapping Online Activism

    Science.gov (United States)

    Meikle, Graham

    How do activists use the Internet? This article maps a wide range of activist practice and research by applying and developing Tim Berners-Lee's concept of ‘intercreativity' (1999). It identifies four dimensions of Net activism: intercreative texts, tactics, strategies and networks. It develops these through examples of manifestations of Net activism around one cluster of issues: support campaigns for refugees and asylum seekers.

  15. Toroidal optical activity

    CERN Document Server

    Raybould, T A; Papasimakis, N; Kuprov, I; Youngs, I; Chen, W T; Tsai, D P; Zheludev, N I

    2015-01-01

    Optical activity is ubiquitous across natural and artificial media and is conventionally understood in terms of scattering from electric and magnetic moments. Here we demonstrate experimentally and confirm numerically a type of optical activity that cannot be attributed to electric and magnetic multipoles. We show that our observations can only be accounted for by the inclusion of the toroidal dipole moment, the first term of the recently established peculiar family of toroidal multipoles.

  16. ACTIVITY - BASED COSTING DESIGNING

    OpenAIRE

    Wioletta Skibiñska; Marta Kad³ubek

    2010-01-01

    The traditional costing system sometimes does not give accurate information about the consumption of different resources and the activities of the organisation. The activity-based costing system is an information-rich costing system which is more and more necessary for the success of many European companies. Base of designing and implementation of an ABC system in the enterprises are presented in the article.

  17. Hypoglycemic Activity of Jatrorrhizine

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    The hypoglycemic activity and its mechanism of Jatrorrhizine (Jat) were studied. The normal mice and alloxan-induced hyperglycemic mice were given with different doses of Jat. Blood glucose and liver glycogen levels were determined by spectrophotometry with glucose-oxidase and iodine reagents respectively. The levels of blood lactic acid (LC) and liver lactate dehydrogenase (LDH) activity were measured to explore the effect of Jat on anaerobic glycolysis. Succinate dehydrogenase (SDH) activity in liver was measured to evaluate the effect of Jat on aerobic glycolysis in liver. It was found that Jat (50 mg/kg, 100 mg/kg) could significantly decrease blood glucose level in a dose- and time-dependent manner in both normal and alloxan-diabetic mice, increase the activity of SDH, but had no significant effects on the LC level and LDH activity. Jat could significantly reduce the content of liver glycogen in normal mice. Moreover, Jat could inhibit the platelet aggregation in rabbits in vitro in a dose-effect relationship. It was concluded that Jat induced the pronounced decrease in blood glucose in normal and hyperglycemic mice. The hypoglycemic activity of Jat may be attributed to the enhancement of aerobic glycolysis.

  18. Phytase activity in lichens.

    Science.gov (United States)

    Higgins, Niall F; Crittenden, Peter D

    2015-10-01

    Phytase activity was investigated in 13 lichen species using a novel assay method. The work tested the hypothesis that phytase is a component of the suite of surface-bound lichen enzymes that hydrolyse simple organic forms of phosphorus (P) and nitrogen (N) deposited onto the thallus surface. Hydrolysis of inositol hexaphosphate (InsP6 , the substrate for phytase) and appearance of lower-order inositol phosphates (InsP5 -InsP1 ), the hydrolysis products, were measured by ion chromatography. Phytase activity in Evernia prunastri was compared among locations with contrasting rates of N deposition. Phytase activity was readily measurable in epiphytic lichens (e.g. 11.3 μmol InsP6 hydrolysed g(-1)  h(-1) in Bryoria fuscescens) but low in two terricolous species tested (Cladonia portentosa and Peltigera membranacea). Phytase and phosphomonoesterase activities were positively correlated amongst species. In E. prunastri both enzyme activities were promoted by N enrichment and phytase activity was readily released into thallus washings. InsP6 was not detected in tree canopy throughfall but was present in pollen leachate. Capacity to hydrolyse InsP6 appears widespread amongst lichens potentially promoting P capture from atmospheric deposits and plant leachates, and P cycling in forest canopies. The enzyme assay used here might find wider application in studies on plant root-fungal-soil systems.

  19. Antimicrobial activity of flavonoids.

    Science.gov (United States)

    Cushnie, T P Tim; Lamb, Andrew J

    2005-11-01

    Flavonoids are ubiquitous in photosynthesising cells and are commonly found in fruit, vegetables, nuts, seeds, stems, flowers, tea, wine, propolis and honey. For centuries, preparations containing these compounds as the principal physiologically active constituents have been used to treat human diseases. Increasingly, this class of natural products is becoming the subject of anti-infective research, and many groups have isolated and identified the structures of flavonoids possessing antifungal, antiviral and antibacterial activity. Moreover, several groups have demonstrated synergy between active flavonoids as well as between flavonoids and existing chemotherapeutics. Reports of activity in the field of antibacterial flavonoid research are widely conflicting, probably owing to inter- and intra-assay variation in susceptibility testing. However, several high-quality investigations have examined the relationship between flavonoid structure and antibacterial activity and these are in close agreement. In addition, numerous research groups have sought to elucidate the antibacterial mechanisms of action of selected flavonoids. The activity of quercetin, for example, has been at least partially attributed to inhibition of DNA gyrase. It has also been proposed that sophoraflavone G and (-)-epigallocatechin gallate inhibit cytoplasmic membrane function, and that licochalcones A and C inhibit energy metabolism. Other flavonoids whose mechanisms of action have been investigated include robinetin, myricetin, apigenin, rutin, galangin, 2,4,2'-trihydroxy-5'-methylchalcone and lonchocarpol A. These compounds represent novel leads, and future studies may allow the development of a pharmacologically acceptable antimicrobial agent or class of agents.

  20. Who is actively denitrifying in activated sludge?

    DEFF Research Database (Denmark)

    Hansen, Aviaja Anna; Nielsen, Jeppe Lund

    transcripts came from Gammaproteobacteria. A clear taxonomic discrepancy was observed between the nirS and nirK expressing bacteria, which primarily belonged to Beta- and Alphaproteobacteria, respectively. The nosZ gene was expressed by both taxonomic groups and it was therefore surprising that the highest......-scale wastewater treatment plant the transcripts (mRNA) of the nirS, nirK and nosZ denitrification genes expressed under acetate or amino acid consumption were amplified, sequenced and identified. This revealed that the majority of the denitrifiers belonged to Alpha- and Betaproteobacteria, while only few...... genetic diversity was observed from the nirS transcripts and not the nosZ transcripts. Likewise, denitrifying cultures obtained from the activated sludge affiliated with the same Alpha- and Betaproteobacteria as detected with the denitrification genes, except one culture, which affiliated...

  1. Psychomotor activities with seniors

    Directory of Open Access Journals (Sweden)

    Jitka Kopřivová

    2015-07-01

    Full Text Available BACKGROUND: Given that the population all over the world is aging, it is necessary to fi nd ways to help maintain or improve the quality of life of seniors. The main goal of this paper is to show how appropriate physical activity programs contribute to the improvement of the functionality and psychosocial wellbeing of seniors. We are particularly interested in the possibilities of preserving self-suffi ciency and self-service, independence and the ability to perform everyday activities. One of the most eff ective forms of physical activity is psychomotr activity.OBJECTIVE: The aim of our paper is to present basic information concerning the meaning and the application of the psychomotr activities in intervention movement programmes in order to improve seniors’ life quality.METHODS: We defi ne the term psychomotr activities according to Adamírová (1995 and Novotná (2010. In this paper we present some results of research that stress the positive eff ect of psychomotor exercises and games on the life satisfaction of the elderly (Stará 2011; Stará & Kopřivová, 2011.DESCRIPTION: According to the results of our research and practical experience gained from working with the elderly it is strongly recommended to include suitable psychomotor exercises and games focusing on the development of manual dexterity in training programs in order to improve the balance abilities and the psychosocial area. In terms of prevention, because of the growing number of neurological disorders at an old age it is appropriate to include psychomotor exercises that encourage the development of cognitive functions in the physical interventions.CONCLUSION: We were able to positively infl uence the emotional aspect from performing physical activities, to enhance self-esteem of the exercising subjects and to create new social relationships. Motion programs, which also included psychomotor exercises and games, had a positive eff ect on the physical assessment of the

  2. Antimutagenic activity of spearmint.

    Science.gov (United States)

    Yu, Tian-Wei; Xu, Meirong; Dashwood, Roderick H

    2004-01-01

    The antimutagenic activity of spearmint (Mentha spicata), a popular food flavoring agent, was studied in the Salmonella assay. Spearmint leaves were brewed in hot water for 5 min at concentrations up to 5% (w/v), and the water extracts were tested against the direct-acting mutagens 4-nitro-1,2-phenylenediamine (NPD) and 2-hydroxyamino-3-methyl-3H-imidazo[4,5-f]quinoline (N-OH-IQ) using Salmonella typhimurium strain TA98. Nontoxic concentrations of spearmint extract inhibited the mutagenic activity of N-OH-IQ in a concentration-dependent fashion, but had no effect against NPD. These experiments by design focused on the water extract consumed commonly as an herbal tea, but chloroform and methanol extracts of spearmint also possessed antimutagenic activity against N-OH-IQ. Water extract of spearmint inhibited the mutagenic activity of the parent compound, 2-amino-3-methyl-3H-imidazo[4,5-f]quinoline (IQ), in the presence of rat liver S9; however, the concentration for 50% inhibition (IC50) against IQ was approximately 10-fold higher than in assays with N-OH-IQ minus S9. At concentrations similar to those used in the Salmonella assays, spearmint extract inhibited two of the major enzymes that play a role in the metabolic activation of IQ, namely, cytochromes P4501A1 and 1A2, based on ethoxyresorufin O-deethylase and methoxyresorufin O-demethylase assays in vitro. In vivo, rats were given spearmint water extract (2%; w/v) as the sole source of drinking fluid before, during, and after 2-week treatment with IQ; colonic aberrant crypt foci were inhibited significantly at 8 weeks (P < 0.05, compared with rats given IQ alone). Collectively, these findings suggest that spearmint tea protects against IQ and possibly other heterocyclic amines through inhibition of carcinogen activation and via direct effects on the activated metabolite(s).

  3. ACTIVATION ENERGY OF DESORPTION OF DIBENZOFURAN ON ACTIVATED CARBONS

    Institute of Scientific and Technical Information of China (English)

    LI Xiang; LI Zhong; XI Hongxia; LUO Lingai

    2004-01-01

    Three kinds of commercial activated carbons, such as Norit RB1, Monolith and Chemviron activated carbons, were used as adsorbents for adsorption of dibenzofuran. The average pore size and specific surface area of these activated carbons were measured. Temperature Programmed Desorption (TPD) experiments were conducted to measure the TPD curves of dibenzofuran on the activated carbons, and then the activation energy for desorption of dibenzofuran on the activated carbons was estimated. The results showed that the Chemviron and the Norit RB1 activated carbon maintained higher specific surface area and larger micropore pore volume in comparison with the Monolith activated carbon, and the activation energy for the desorption of dibenzofuran on these two activated carbons was higher than that on the Monolith activated carbon. The smaller the pore of the activated carbon was, the higher the activated energy of dibenzofuran desorption was.

  4. Youth physical activity resource use and activity measured by accelerometry.

    Science.gov (United States)

    Maslow, Andréa L; Colabianchi, Natalie

    2011-01-01

    To examine whether use of physical activity resources (eg, parks) was associated with daily physical activity measured by accelerometry. One hundred eleven adolescents completed a travel diary with concurrent accelerometry. The main exposure was self-reported use of a physical activity resource (none /1+ resources). The main outcomes were total minutes spent in daily (1) moderate-vigorous physical activity and (2) vigorous physical activity. Using a physical activity resource was significantly associated with total minutes in moderate-vigorous physical activity. African Americans and males had significantly greater moderate-vigorous physical activity. Results from this study support the development and use of physical activity resources.

  5. Youth Physical Activity Resources Use and Activity Measured by Accelerometry

    Science.gov (United States)

    Maslow, Andréa L.; Colabianchi, Natalie

    2014-01-01

    Objectives To examine whether utilization of physical activity resources (eg, parks) was associated with daily physical activity measured by accelerometry. Methods 111 adolescents completed a travel diary with concurrent accelerometry. The main exposure was self-reported utilization of a physical activity resource (none/1+ resources). The main outcomes were total minutes spent in daily 1) moderate-vigorous physical activity and 2) vigorous physical activity. Results Utilizing a physical activity resource was significantly associated with total minutes in moderate-vigorous physical activity. African-Americans and males had significantly greater moderate-vigorous physical activity. Conclusions Results from this study support the development and use of physical activity resources. PMID:21204684

  6. Active noise control primer

    CERN Document Server

    Snyder, Scott D

    2000-01-01

    Active noise control - the reduction of noise by generating an acoustic signal that actively interferes with the noise - has become an active area of basic research and engineering applications. The aim of this book is to present all of the basic knowledge one needs for assessing how useful active noise control will be for a given problem and then to provide some guidance for designing, setting up, and tuning an active noise-control system. Written for students who have no prior knowledge of acoustics, signal processing, or noise control but who do have a reasonable grasp of basic physics and mathematics, the book is short and descriptive. It leaves for more advanced texts or research monographs all mathematical details and proofs concerning vibrations, signal processing and the like. The book can thus be used in independent study, in a classroom with laboratories, or in conjunction with a kit for experiment or demonstration. Topics covered include: basic acoustics; human perception and sound; sound intensity...

  7. [Inflammasome: activation mechanisms].

    Science.gov (United States)

    Suárez, Raibel; Buelvas, Neudo

    2015-03-01

    Inflammation is a rapid biologic response of the immune system in vascular tissues, directed to eliminate stimuli capable of causing damage and begin the process of repair. The macromolecular complexes known as "inflammasomes" are formed by a receptor, either NOD (NLR) or ALR, the receptor absent in melanoma 2 (AIM2). In addition, the inflammasome is formed by the speck-like protein associated to apoptosis (ASC) and procaspase-1, that may be activated by variations in the ionic and intracellular and extracellular ATP concentrations; and the loss of stabilization of the fagolisosomme by internalization of insoluble crystals and redox mechanisms. As a result, there is activation of the molecular platform and the processing of inflammatory prointerleukins to their active forms. There are two modalities of activation of the inflammasome: canonical and non-canonical, both capable of generating effector responses. Recent data associate NLRP 3, IL-1β and IL-18 in the pathogenesis of a variety of diseases, including atherosclerosis, type II diabetes, hyperhomocysteinemia, gout, malaria and hypertension. The inflammasome cascade is emerging as a new chemotherapeutic target in these diseases. In this review we shall discuss the mechanisms of activation and regulation of the inflammasome that stimulate, modulate and resolve inflammation.

  8. Active flows on trees

    Science.gov (United States)

    Forrow, Aden; Woodhouse, Francis G.; Dunkel, Jörn

    2016-11-01

    Coherent, large scale dynamics in many nonequilibrium physical, biological, or information transport networks are driven by small-scale local energy input. We introduce and explore a generic model for compressible active flows on tree networks. In contrast to thermally-driven systems, active friction selects discrete states with only a small number of oscillation modes activated at distinct fixed amplitudes. This state selection can interact with graph topology to produce different localized dynamical time scales in separate regions of large networks. Using perturbation theory, we systematically predict the stationary states of noisy networks. Our analytical predictions agree well with a Bayesian state estimation based on a hidden Markov model applied to simulated time series data on binary trees. While the number of stable states per tree scales exponentially with the number of edges, the mean number of activated modes in each state averages 1 / 4 the number of edges. More broadly, these results suggest that the macroscopic response of active networks, from actin-myosin networks in cells to flow networks in Physarum polycephalum, can be dominated by a few select modes.

  9. Chromatin as active matter

    Science.gov (United States)

    Agrawal, Ankit; Ganai, Nirmalendu; Sengupta, Surajit; Menon, Gautam I.

    2017-01-01

    Active matter models describe a number of biophysical phenomena at the cell and tissue scale. Such models explore the macroscopic consequences of driving specific soft condensed matter systems of biological relevance out of equilibrium through ‘active’ processes. Here, we describe how active matter models can be used to study the large-scale properties of chromosomes contained within the nuclei of human cells in interphase. We show that polymer models for chromosomes that incorporate inhomogeneous activity reproduce many general, yet little understood, features of large-scale nuclear architecture. These include: (i) the spatial separation of gene-rich, low-density euchromatin, predominantly found towards the centre of the nucleus, vis a vis. gene-poor, denser heterochromatin, typically enriched in proximity to the nuclear periphery, (ii) the differential positioning of individual gene-rich and gene-poor chromosomes, (iii) the formation of chromosome territories, as well as (iv), the weak size-dependence of the positions of individual chromosome centres-of-mass relative to the nuclear centre that is seen in some cell types. Such structuring is induced purely by the combination of activity and confinement and is absent in thermal equilibrium. We systematically explore active matter models for chromosomes, discussing how our model can be generalized to study variations in chromosome positioning across different cell types. The approach and model we outline here represent a preliminary attempt towards a quantitative, first-principles description of the large-scale architecture of the cell nucleus.

  10. Software Activation Using Multithreading

    Directory of Open Access Journals (Sweden)

    Jianrui Zhang

    2012-11-01

    Full Text Available Software activation is an anti-piracy technology designed to verify that software products have been legitimately licensed. Activation should be quick and simple while simultaneously being secure and protecting customer privacy. The most common form of software activation is for the user to enter a legitimate product serial number. However, software activation based on serial numbers appears to be weak, since cracks for many programs are readily available on the Internet. Users can employ such cracks to bypass software activation.Serial number verification logic usually executes sequentially in a single thread. Such an approach is relatively easy to break since attackers can trace the code to understand how the logic works. In this paper, we develop a practical multi-threaded verification design. Our results show that by proper use of multi-threading, the amount of traceable code in a debugger can be reduced to a low percentage of the total and the traceable code in each run can differ as well. This makes it significantly more difficult for an attacker to reverse engineer the code as a means of bypassing a security check. Finally, we attempt to quantify the increased effort needed to break our verification logic.

  11. Interpreting EEG alpha activity.

    Science.gov (United States)

    Bazanova, O M; Vernon, D

    2014-07-01

    Exploring EEG alpha oscillations has generated considerable interest, in particular with regards to the role they play in cognitive, psychomotor, psycho-emotional and physiological aspects of human life. However, there is no clearly agreed upon definition of what constitutes 'alpha activity' or which of the many indices should be used to characterize it. To address these issues this review attempts to delineate EEG alpha-activity, its physical, molecular and morphological nature, and examine the following indices: (1) the individual alpha peak frequency; (2) activation magnitude, as measured by alpha amplitude suppression across the individual alpha bandwidth in response to eyes opening, and (3) alpha "auto-rhythmicity" indices: which include intra-spindle amplitude variability, spindle length and steepness. Throughout, the article offers a number of suggestions regarding the mechanism(s) of alpha activity related to inter and intra-individual variability. In addition, it provides some insights into the various psychophysiological indices of alpha activity and highlights their role in optimal functioning and behavior.

  12. Parsing Heterogeneous Striatal Activity

    Directory of Open Access Journals (Sweden)

    Kae Nakamura

    2017-05-01

    Full Text Available The striatum is an input channel of the basal ganglia and is well known to be involved in reward-based decision making and learning. At the macroscopic level, the striatum has been postulated to contain parallel functional modules, each of which includes neurons that perform similar computations to support selection of appropriate actions for different task contexts. At the single-neuron level, however, recent studies in monkeys and rodents have revealed heterogeneity in neuronal activity even within restricted modules of the striatum. Looking for generality in the complex striatal activity patterns, here we briefly survey several types of striatal activity, focusing on their usefulness for mediating behaviors. In particular, we focus on two types of behavioral tasks: reward-based tasks that use salient sensory cues and manipulate outcomes associated with the cues; and perceptual decision tasks that manipulate the quality of noisy sensory cues and associate all correct decisions with the same outcome. Guided by previous insights on the modular organization and general selection-related functions of the basal ganglia, we relate striatal activity patterns on these tasks to two types of computations: implementation of selection and evaluation. We suggest that a parsing with the selection/evaluation categories encourages a focus on the functional commonalities revealed by studies with different animal models and behavioral tasks, instead of a focus on aspects of striatal activity that may be specific to a particular task setting. We then highlight several questions in the selection-evaluation framework for future explorations.

  13. Active Elbow Orthosis

    Directory of Open Access Journals (Sweden)

    Tomas Ripel

    2014-09-01

    Full Text Available This paper presents a novel approach to the design of a motorized rehabilitation device – active elbow orthosis (AEO – inspired by the principles of robotic exoskeletons. The device is currently designed for the elbow joint, but can be easily modified for other joints as well. AEO determines the motion activity of the patient using a strain gauge and utilizes this measurement to control the actuator that drives the forearm part of the orthosis. Patient activity level is related to a free arm measurement obtained via a calibration procedure prior to the exercise. A high-level control module offers several types of exercises mimicking the physiotherapist. The device was successfully verified by tests on a number of patients, resulting in extended range of elbow-joint motion.

  14. Solar activity and earthquake

    Energy Technology Data Exchange (ETDEWEB)

    Yuan, J.

    1979-02-26

    Prolonged astronomical observations have discovered that the Sun, which is the nearest star to the Earth, is not calm and serene. On the solar surface, there are often windstorms, electrical lights, and sometimes large flame eruptions; and there are regularly black spots in patches which are also active. The Sun not only disperses light and heat, but also throws out large quantities of currents of charged particles to be scattered in space and to reach the Earth, sometimes, which are called by some solar winds. These activities in the Sun can induce many physical phenomena on earth, including magnetic storms, polar light, sudden disruption or attenuation of medium- and short-wave radio, and many atmospheric changes. Some scientists believe they are perhaps also related to the occurrence of earthquakes. This paper explains these solar activities and their possible relationship to earthquakes.

  15. Correlates of physical activity

    DEFF Research Database (Denmark)

    Bauman, Adrian E; Reis, Rodrigo S; Sallis, James F

    2012-01-01

    that age, sex, health status, self-efficacy, and motivation are associated with physical activity. Ecological models take a broad view of health behaviour causation, with the social and physical environment included as contributors to physical inactivity, particularly those outside the health sector......Physical inactivity is an important contributor to non-communicable diseases in countries of high income, and increasingly so in those of low and middle income. Understanding why people are physically active or inactive contributes to evidence-based planning of public health interventions, because......, such as urban planning, transportation systems, and parks and trails. New areas of determinants research have identified genetic factors contributing to the propensity to be physically active, and evolutionary factors and obesity that might predispose to inactivity, and have explored the longitudinal tracking...

  16. General human activity patterns

    CERN Document Server

    Mollgaard, Anders; Mathiesen, Joachim

    2016-01-01

    We investigate the dynamics and interplay between human communication, movement, and social proximity by analyzing data collected from smartphones distributed among 638 individuals. The main question we consider is: to what extent do individuals act according to patterns shared across an entire population? Based on statistics of the entire population, we successfully predict 71\\% of the activity and 85\\% of the inactivity involved in communication, movement, and social proximity. We find that individual level statistics only result in marginally better predictions, indicating a high degree of shared activity patterns across the population. Finally, we predict short-term activity patterns using a generalized linear model, which suggests that a simple linear description might be sufficient to explain a wide range of actions, whether they be of social or of physical character.

  17. Active Photonic Crystal Waveguides

    DEFF Research Database (Denmark)

    Ek, Sara

    This thesis deals with the fabrication and characterization of active photonic crystal waveguides, realized in III-V semiconductor material with embedded active layers. The platform offering active photonic crystal waveguides has many potential applications. One of these is a compact photonic...... crystal semiconductor optical amplier. As a step towards such a component, photonic crystal waveguides with a single quantum well, 10 quantum wells and three layers of quantum dots are fabricated and characterized. An experimental study of the amplied spontaneous emission and a implied transmission...... are presented in this thesis. A variation of photonic crystal design parameters are used leading to a spectral shift of the dispersion, it is veried that the observed effects shift accordingly. An enhancement of the amplified spontaneous emission was observed close to the band edge, where light is slowed down...

  18. Adapted Active Appearance Models

    Directory of Open Access Journals (Sweden)

    Renaud Séguier

    2009-01-01

    Full Text Available Active Appearance Models (AAMs are able to align efficiently known faces under duress, when face pose and illumination are controlled. We propose Adapted Active Appearance Models to align unknown faces in unknown poses and illuminations. Our proposal is based on the one hand on a specific transformation of the active model texture in an oriented map, which changes the AAM normalization process; on the other hand on the research made in a set of different precomputed models related to the most adapted AAM for an unknown face. Tests on public and private databases show the interest of our approach. It becomes possible to align unknown faces in real-time situations, in which light and pose are not controlled.

  19. Regulating prefrontal cortex activation

    DEFF Research Database (Denmark)

    Aznar, Susana; Klein, Anders Bue

    2013-01-01

    of emotion-based actions, such as addiction and other impulse-related behaviors. In this review, we give an overview of the 5-HT2A receptor distribution (neuronal, intracellular, and anatomical) along with its functional and physiological effect on PFC activation, and how that relates to more recent findings......The prefrontal cortex (PFC) is involved in mediating important higher-order cognitive processes such as decision making, prompting thereby our actions. At the same time, PFC activation is strongly influenced by emotional reactions through its functional interaction with the amygdala...... is highly expressed in the prefrontal cortex areas, playing an important role in modulating cortical activity and neural oscillations (brain waves). This makes it an interesting potential pharmacological target for the treatment of neuropsychiatric modes characterized by lack of inhibitory control...

  20. IHY activities in Brazil

    Science.gov (United States)

    Dal Lago, Alisson

    The International Heliophysical Year is a program of international scientific colaboration planned to be held in the period from 2007-2009. Many brazilian institutions have shown interest in participating in the IHY activities. All of them provided information about their instrumental facilities and contact person. A list of institutions and their information is shown in the Latin-American IHY webpage (http://www.alage.org/IHYLA/ihyla.html), hosted by the Latin American Association on Space Geophysics - ALAGE. IHY Brazilian activities are being conducted in close colaboration with Latin-American Institutions. Five Coordinated Investigation programs (CIPs) have been proposed by scientists from brazilian institutions. Recentely, in February 2008, there has been the Latin American IHY School in Sao Paulo (Brazil), with the participation of 80 students from Brazil, Argentina, Peru, Mexico and Cuba. In this work, a report on the brazilian activities will be presented.

  1. Antibacterial Activity of Grepafloxacin

    Directory of Open Access Journals (Sweden)

    B Wiedemann

    1998-01-01

    Full Text Available Grepafloxin has an extremely broad spectrum of activity. Its activity against Gram-positive bacteria exceeds that of currently available quinolones. Grepafloxacin-resistant mutants seem to occur less frequently than ciprofloxacin - or ofloxacin-resistant mutants, and the increase in minimum inhibitory concentration (MIC against the former mutants is less than that of the latter. This applies only to the relative differences (in dilution steps; the absolute values are similar. Grepafloxacin kills Gram-positive bacteria at concentrations little above the MIC. Its pharmacodynamic profile against pneumococci is promising, favouring use of this drug for respiratory tract infections.

  2. Measuring children's physical activity

    DEFF Research Database (Denmark)

    Schneller, Mikkel Bo; Bentsen, Peter; Nielsen, Glen

    2017-01-01

    INTRODUCTION: Accelerometer-based physical activity monitoring has become the method of choice in many large-scale physical activity (PA) studies. However, there is an ongoing debate regarding the placement of the device, the determination of device wear time, and how to solve a lack of participant...... on the thigh (n=903) and one on the lower back (n= 856), for up to ten consecutive days. Participants were instructed not to reattach an accelerometer should it fall off. Simple and multiple linear regression were used to determine associations between accelerometer wear time and age, sex, BMI percentiles...

  3. Lesion activity assessment

    DEFF Research Database (Denmark)

    Ekstrand, K R; Zero, D T; Martignon, S

    2009-01-01

    in response to cariogenic plaque as well as lesion arrest. Based on this understanding, different clinical scoring systems have been developed to assess the severity/depth and activity of lesions. A recent system has been devised by the International Caries Detection and Assessment System Committee...... the activity of primary coronal and root lesions reliably and accurately at one examination by using the combined information obtained from a range of indicators--such as visual appearance, location of the lesion, tactile sensation during probing and gingival health....

  4. SCOR announces new activities

    Science.gov (United States)

    Urban, Edward R., Jr.

    Roger Revelle had many good ideas during his long and productive career. One of them came to fruition in 1957 in the form of the Scientific Committee on Oceanic Research (SCOR), which the International Council for Science created as its first interdisciplinary body, to promote international activities in oceanography. Revelle served as SCOR's first president from 1957 to 1960. SCOR offers opportunities for scientists from different countries to cooperate in planning and executing international programs in ocean sciences. Over its 44 years in existence, SCOR has sponsored 120 working groups and has actively participated in many of the major international oceanographic projects. Thirty-six nations presently participate as SCOR members.

  5. Actively coupled optical waveguides

    OpenAIRE

    Alexeeva, N. V.; Barashenkov, I. V.; Rayanov, K.; Flach, S.

    2013-01-01

    We consider light propagation through a pair of nonlinear optical waveguides with absorption, placed in a medium with power gain. The active medium boosts the in-phase component of the overlapping evanescent fields of the guides, while the nonlinearity of the guides couples it to the damped out-of-phase component creating a feedback loop. As a result, the structure exhibits stable stationary and oscillatory regimes in a wide range of gain-loss ratios. We show that the pair of actively-coupled...

  6. Actively coupled optical waveguides

    Science.gov (United States)

    Alexeeva, N. V.; Barashenkov, I. V.; Rayanov, K.; Flach, S.

    2014-01-01

    We consider light propagation through a pair of nonlinear optical waveguides with absorption, placed in a medium with power gain. The active medium boosts the in-phase component of the overlapping evanescent fields of the guides, while the nonlinearity of the guides couples it to the damped out-of-phase component creating a feedback loop. As a result, the structure exhibits stable stationary and oscillatory regimes in a wide range of gain-loss ratios. We show that the pair of actively coupled (AC) waveguides can act as a stationary or integrate-and-fire comparator sensitive to tiny differences in their input powers.

  7. Physical Activity and Health: The Benefits of Physical Activity

    Science.gov (United States)

    ... Weight Breastfeeding Micronutrient Malnutrition State and Local Programs Physical Activity and Health Recommend on Facebook Tweet Share Compartir ... Your Chances of Living Longer The Benefits of Physical Activity Regular physical activity is one of the most ...

  8. Institutional investor activism : Introduction

    NARCIS (Netherlands)

    Mc Cahery, Joseph; Bratton, William; Bratton, William; McCahery, Joseph A.

    2015-01-01

    The increase in institutional ownership of recent decades has been accompanied by an enhanced role played by institutions in monitoring companies’ corporate governance behaviour. Activist hedge funds and private equity firms have achieved a degree of success in actively shaping the business plans of

  9. An electrochemical active valve

    NARCIS (Netherlands)

    Neagu, C.R.; Gardeniers, J.G.E.; Elwenspoek, M.; Kelly, J.J.

    1997-01-01

    A novel electrochemical microactuator was developed, which operates as an active valve. The microactuator consists of an electrochemical cell and a membrane that deflects because of the pressure of oxygen gas generated by electrolysis. Relatively large pressures (up to tens of bars) can be reached w

  10. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... Index MENU CDC A-Z SEARCH A B C D E F G H I J K ... aerobic activity, watch this video: Windows Media Player, 4:48 More videos Here are some ways to ... ePub file RIS file Page last reviewed: June 4, 2015 Page last updated: June 4, 2015 Content ...

  11. Grooming. Learning Activity Package.

    Science.gov (United States)

    Stark, Pamela

    This learning activity package on grooming for health workers is one of a series of 12 titles developed for use in health occupations education programs. Materials in the package include objectives, a list of materials needed, information sheets, reviews (self evaluations) of portions of the content, and answers to reviews. These topics are…

  12. Activated Sludge Rheology

    DEFF Research Database (Denmark)

    Ratkovich, Nicolas Rios; Horn, Willi; Helmus, Frank

    2013-01-01

    Rheological behaviour is an important fluid property that severely impacts its flow behaviour and many aspects related to this. In the case of activated sludge, the apparent viscosity has an influence on e.g. pumping, hydrodynamics, mass transfer rates, sludge-water separation (settling and filtr...

  13. Shark Tagging Activities.

    Science.gov (United States)

    Current: The Journal of Marine Education, 1998

    1998-01-01

    In this group activity, children learn about the purpose of tagging and how scientists tag a shark. Using a cut-out of a shark, students identify, measure, record data, read coordinates, and tag a shark. Includes introductory information about the purpose of tagging and the procedure, a data sheet showing original tagging data from Tampa Bay, and…

  14. CMMs Development Activities

    Institute of Scientific and Technical Information of China (English)

    HU Jun; HU Yefa; HUANG Anyi

    2006-01-01

    The coordinate measuring machine (CMM) has been an important role in the digital manufacturing. This paper reviews CMM early stage development history and current activities. The authors provide some ideas about the areas that academic research can help to the CMMs development.

  15. Sexual activity and aging.

    Science.gov (United States)

    Ni Lochlainn, Mary; Kenny, Rose Anne

    2013-08-01

    Sexuality is an important component of emotional and physical intimacy that men and women experience throughout their lives. Research suggesting that a high proportion of men and women remain sexually active well into later life refutes the prevailing myth that aging and sexual dysfunction are inexorably linked. Age-related physiological changes do not render a meaningful sexual relationship impossible or even necessarily difficult. Many of these physiological changes are modifiable. There are various therapeutic options available to patients to achieve maximum sexual capacity in old age. This article reviews the prevalence of sexual activity among older adults, the problems these adults encounter with sexual activity, and the role of the health care professional in addressing these problems. The physiological sex-related changes that occur as part of the normal aging process in men and women are reviewed, as well as the effect of age-related physical and psychological illness on sexual function. The attitudes and perceptions of the media and general public toward sexual activity and aging are summarized. An understanding of the sexual changes that accompany the aging process may help general practitioners and other doctors to give practical and useful advice on sexuality as well as refute the misconception that aging equates to celibacy. A thorough awareness of this aspect of older people's quality of life can raise meaningful expectations for aging patients.

  16. Elusive active galactic nuclei

    NARCIS (Netherlands)

    Maiolino, R; Comastri, A; Gilli, R; Nagar, NM; Bianchi, S; Boker, T; Colbert, E; Krabbe, A; Marconi, A; Matt, G; Salvati, M

    2003-01-01

    A fraction of active galactic nuclei do not show the classical Seyfert-type signatures in their optical spectra, i.e. they are optically 'elusive'. X-ray observations are an optimal tool to identify this class of objects. We combine new Chandra observations with archival X-ray data in order to obtai

  17. 'Active' Thin Sections

    NARCIS (Netherlands)

    De Rooij, M.R.; Bijen, J.M.J.M.

    1999-01-01

    Optical microscopy using thin sections has become more and more important over the last decade to study concrete. Unfortunately, this technique is not capable of studying actually hydrating cement paste. At Delft University of Technology a new technique has been developed using 'active' thin section

  18. Physical activity and health

    Directory of Open Access Journals (Sweden)

    Aleš Blinc

    2005-12-01

    Full Text Available Background. Due to technological development, the average level of physical activity is decreasing among residents of developed countries, which is an important factor in the epidemic of obesity and metabolic syndrome.Results (findings. Although excessive physical exertion disrupts hormonal balance, harms the immune system and somewhat increases the risk of sudden cardiac death, the overwhelming majority of adaptations to regular exercise comprise health benefits. Sensitivity to insulin is increased, metabolism of triglycerides and cholesterol is improved, and the basal tone of the sympathetic nervous system is decreased, which all reduces coronary atherothrombotic events and cardio-vascular mortality. Physical exercise is linked to reduced risk of colon carcinoma, breast cancer and endometrial carcinoma. Regular physical activity prolongs life on average by about two years in comparison with sedentary population, but even more importantly, it preserves endurance and power necessary for independent living well into in advanced age. Physical exercise reduces symptoms of depression and improves the perceived level of satisfaction.Conclusions. In order to achieve the metabolic and psychological benefits of exercise, it is necessary to engage in at least a half hour of moderately intense activity on most days of the week, but daily physical activity is even better.

  19. Seismology of active stars

    NARCIS (Netherlands)

    Hekker, S.; García, R.A.

    2012-01-01

    In this review we will discuss the current standing and open questions of seismology in active stars. With the longer photometric time series data that are, and will become, available from space-missions such as Kepler we foresee significant progress in our understanding of stellar internal structur

  20. Access and Fishing Activities

    DEFF Research Database (Denmark)

    Høst, Jeppe Engset

    2015-01-01

    In this chapter, I look at the implications of transferable quotas on the organization of production; that is, how fishing activities are structured around access to the individual and transferable quotas and how, in turn, the quotas structure the production. Therefore, this chapter will give...

  1. Activating Welfare States

    DEFF Research Database (Denmark)

    Kvist, Jon

    This paper investigates how welfare states may actively contribute to promote employment opportunities, i.e. participation in the labour market through various operations and policies. The principal operations concern in particular the de-familiarisation of caring tasks through social services...

  2. Activation force splines

    DEFF Research Database (Denmark)

    Engell-Nørregård, Morten Pol; Erleben, Kenny

    dimensional 2D/3D deformable model. Our activation splines are easy to set up and can be used for physics based animation of deformable models such as snake motion and locomotion of characters. Our approach generalises easily to both 2D and 3D simulations and is applicable in physics based games or animations...

  3. Asteroseismic stellar activity relations

    CERN Document Server

    Bonanno, A; Karoff, C

    2014-01-01

    In asteroseismology an important diagnostic of the evolutionary status of a star is the small frequency separation which is sensitive to the gradient of the mean molecular weight in the stellar interior. It is thus interesting to discuss the classical age-activity relations in terms of this quantity. Moreover, as the photospheric magnetic field tends to suppress the amplitudes of acoustic oscillations, it is important to quantify the importance of this effect by considering various activity indicators. We propose a new class of age-activity relations that connects the Mt. Wilson $S$ index and the average scatter in the light curve with the small frequency separation and the amplitude of the p-mode oscillations. We used a Bayesian inference to compute the posterior probability of various empirical laws for a sample of 19 solar-like active stars observed by the Kepler telescope. We demonstrate the presence of a clear correlation between the Mt. Wilson $S$ index and the relative age of the stars as indicated by ...

  4. Marketing coprovided activities.

    Science.gov (United States)

    Dickerson, Pamela S

    2014-05-01

    Coproviding is a wonderful way for two or more organizations to work together to provide continuing nursing education. To be transparent to the learners, marketing materials identify the parties involved and prominently note the name of the organization accountable for developing the activity and awarding the contact hours.

  5. Mechanism of charity activity

    Directory of Open Access Journals (Sweden)

    Roman B. Golovkin

    2015-12-01

    Full Text Available Objective to establish the essential properties of the mechanism of charitable activities and to formulate the concept of quotmechanism of charitable activityquot. Methods the objective of the study is achieved using the complex of methods which are based on the interaction of dialectical and metaphysical analysis the epistemological properties of which allowed to reveal various aspects of the charitable activities mechanism functioning taking into account the principles of comprehensiveness complexity specificity and objectivity of the research. Results the rules are stated of using the term quotmechanismquot to characterize actions of state and law the essence of the charity mechanism is defined the definition of quotthe mechanism of charitable activity quot is formulated. Scientific novelty for the first time at theoretical level in legal science the definition of quotthe mechanism of charitable activityquot is formulated and its essential properties are set. Practical significance the research will contribute to improving the legal regulation in the field of philanthropy as well as to improving the efficiency and quality of charitable activity in the Russian Federation. nbsp

  6. Holidays & Festivals: Activities.

    Science.gov (United States)

    Smith, Debbie

    There are many times throughout the year when change is celebrated. This elementary level, interdisciplinary resource gives background information and activities related to cross-cultural celebrations of change. Topics covered include: (1) "Charting Changes"; (2) "Special People"; (3) "Celebrating Light"; (4)…

  7. Regional Activities Division. Papers.

    Science.gov (United States)

    International Federation of Library Associations, The Hague (Netherlands).

    Papers on library network activities in Canada, the Third World, Japan, Malaysia, Brazil, and Sweden which were presented at the 1982 International Federation of Library Associations (IFLA) conference include: (1) "Canada: A Voluntary and Flexible Network," a review by Guy Sylvestre of the political, social, and economic structures…

  8. Low activity aluminum blanket

    Energy Technology Data Exchange (ETDEWEB)

    Benenati, R.; Tichler, P.; Powell, J.R.

    1976-03-01

    The basic design of the breeding blanket consists of cylindrical aluminium canisters filled with a ceramic bed of moderating, shielding, and breeding materials all suitably cooled. A technical analysis of the blanket for an EPR design is given. Activation studies are presented. The effect of pulsed magnetic fields on module structure is investigated. (MOW)

  9. Active surveillance: Oncologic outcome

    NARCIS (Netherlands)

    L.D.F. Venderbos (Lionne); L.P. Bokhorst (Leonard); C.H. Bangma (Chris); M.J. Roobol-Bouts (Monique)

    2013-01-01

    textabstractPURPOSE OF REVIEW: To give insight into recent literature (during the past 12-18 months) reporting on oncologic outcomes of men on active surveillance. RECENT FINDINGS: From recent published trials comparing radical prostatectomy vs. watchful waiting, we learn that radical treatment only

  10. Regional Activities Division. Papers.

    Science.gov (United States)

    International Federation of Library Associations, The Hague (Netherlands).

    Papers on library network activities in Canada, the Third World, Japan, Malaysia, Brazil, and Sweden which were presented at the 1982 International Federation of Library Associations (IFLA) conference include: (1) "Canada: A Voluntary and Flexible Network," a review by Guy Sylvestre of the political, social, and economic structures affecting…

  11. Active Learning Methods

    Science.gov (United States)

    Zayapragassarazan, Z.; Kumar, Santosh

    2012-01-01

    Present generation students are primarily active learners with varied learning experiences and lecture courses may not suit all their learning needs. Effective learning involves providing students with a sense of progress and control over their own learning. This requires creating a situation where learners have a chance to try out or test their…

  12. Bonus Activity Book.

    Science.gov (United States)

    Learning, 1993

    1993-01-01

    Elementary level activity book presents suggestions for teaching students about endangered and threatened species worldwide. Students learn about what is causing the rapid extinction rate and what needs to be done. They also discover the value of rainforests and why conservationists are fighting to save them. (SM)

  13. Atherosclerosis and Physical Activity

    OpenAIRE

    Al-Mamari, Ali

    2009-01-01

    Atherosclerosis and coronary heart disease have been considered as major health problem worldwide. Abnormalities in lipids and lipoprotein metabolism and impairment of endothelial function have been implicated as the main contributing factors in atherosclerosis and its progression. Physical activity has been recognized as a preventive measure for atherosclerosis.

  14. [Biological activity of Spirulina].

    Science.gov (United States)

    Blinkova, L P; Gorobets, O B; Baturo, A P

    2001-01-01

    In this review information of Spirulina platensis (SP), a blue-green alga (photosynthesizing cyanobacterium) having diverse biological activity is presented. Due to high content of highly valuable proteins, indispensable amino acids, vitamins, beta-carotene and other pigments, mineral substances, indispensable fatty acids and polysaccharides, PS has been found suitable for use as bioactive additive. SP produces an immunostimulating effect by enhancing the resistance of humans, mammals, chickens and fish to infections, the capacity of influencing hemopoiesis, stimulating the production of antibodies and cytokines. Under the influence of SP macrophages, T and B cells are activated. SP sulfolipids have proved to be effective against HIV. Preparations obtained from SP biomass have also been found active against herpesvirus, cytomegalovirus, influenza virus, etc. SP extracts are capable in inhibiting cancerogenesis. SP preparations are regarded as functional products contributing to the preservation of the resident intestinal microflora, especially lactic acid bacilli and bifidobacteria, and to a decrease in the level of Candida albicans. The biological activity of SP with respect to microorganisms holds good promise for using these microalgae as components of culture media.

  15. Antifungal activity of diethyldithiocarbamate.

    Science.gov (United States)

    Allerberger, F; Reisinger, E C; Söldner, B; Dierich, M P

    1989-10-01

    Sodium diethyldithiocarbamate (DTC) was evaluated for its ability to combat four different species of fungi in vitro. Using a microtiter-broth-dilution method we were able to demonstrate an antifungal activity against Candida albicans, Cryptococcus neoformans, Aspergillus fumigatus and Mucor mucedo in doses achievable by intravenous administration in man.

  16. Active Math Learning

    DEFF Research Database (Denmark)

    The presentation is concerned with general course planning philosophy and a specific case study (boomerang flight geometro-dynamics) for active learning of mathematics via computer assisted and hands-on unfolding of first principles - in this case the understanding of rotations and Eulers equatio...

  17. Nursing activities score

    NARCIS (Netherlands)

    Miranda, DR; Nap, R; de Rijk, A; Schaufeli, W; Lapichino, G

    Objectives. The instruments used for measuring nursing workload in the intensive care unit (e.g., Therapeutic Intervention Scoring System-28) are based on therapeutic interventions related to severity of illness. Many nursing activities are not necessarily related to severity of illness, and

  18. Physical activity and osteoarthritis

    DEFF Research Database (Denmark)

    Gates, L S; Leyland, K M; Sheard, S

    2017-01-01

    Physical activity (PA) is increasingly recognised as an important factor within studies of osteoarthritis (OA). However, subjective methods used to assess PA are highly variable and have not been developed for use within studies of OA, which creates difficulties when comparing and interpreting PA...

  19. Antimalarial activity of cedronin.

    Science.gov (United States)

    Moretti, C; Deharo, E; Sauvain, M; Jardel, C; David, P T; Gasquet, M

    1994-06-01

    Cedronin was isolated from Simaba cedron Planchon (Simaroubaceae), a species popularly believed in South America to have antimalarial properties. It was examined for in vitro and in vivo antimalarial activities and for cytotoxicity against KB cells. Experimental results showed that cedronin was active against chloroquine-sensitive and resistant strain, with an IC50 of 0.25 micrograms/ml (0.65 mumol/ml). It was also found to be active in vivo against Plasmodium vinkei with an IC50 of 1.8 mg/kg (4.7 nM/kg) in the classic 4-day test. Cedronin belongs to the small group of quassinoids with a C19 basic skeleton and shows a rather low cytotoxicity against KB cells (IC50 = 4 micrograms/ml, 10.4 microM) as compared with C20 biologically active quassinoids; however its toxic/therapeutic ratio (10/1.8) remains lower than chloroquine (10/0.5).

  20. Interdisciplinary Astronomy Activities

    Science.gov (United States)

    Nerantzis, Nikolaos; Mitrouda, Aikaterini; Reizopoulou, Ioanna; Sidiropoulou, Eirini; Hatzidimitriou, Antonios

    2016-04-01

    On November 9th, 2015, three didactical hours were dedicated to Interdisciplinary Astronomy Activities (http://wp.me/p6Hte2-1I). Our students and their teachers formed three groups and in rotation, were engaged with the following activities: (a) viewing unique images of the Cosmos in the mobile planetarium STARLAB (http://www.planitario.gr/tholos-starlab-classic-standard.html), (b) watching the following videos: Journey to the end of the universe (https://youtu.be/Ufl_Nwbl8xs), Rosetta update (https://youtu.be/nQ9ivd7wv30), The Solar System (https://youtu.be/d66dsagrTa0), Ambition the film (https://youtu.be/H08tGjXNHO4) in the school's library. Students and teachers were informed about our solar system, the Rosetta mission, the universe, etc. and (c) tactile activities such as Meet our home and Meet our neighbors (http://astroedu.iau.org, http://nuclio.org/astroneighbours/resources) and the creation of planets' 3D models (Geology-Geography A' Class Student's book, pg.15). With the activities above we had the pleasure to join the Cosmic Light Edu Kit / International Year of Light 2015 program. After our Interdisciplinary Astronomy Activities, we did a "small" research: our students had to fill an evaluation about their educational gains and the results can be found here http://wp.me/p6Hte2-2q. Moreover, we discussed about Big Ideas of Science (http://wp.me/p3oRiZ-dm) and through the "big" impact of the Rosetta mission & the infinity of our universe, we print posters with relevant topics and place them to the classrooms. We thank Rosa Doran (Nuclio - President of the Executive Council) for her continuous assistance and support on innovative science teaching proposals. She is an inspiration.

  1. Activities. Inductive and Deductive Reasoning.

    Science.gov (United States)

    O'Daffer, Phares G.; And Others

    1990-01-01

    Provided are the activity sheets for students and the teaching guide for this middle school geometry activity. Materials, prerequisites, objectives, and procedures are listed. Extension activities are suggested. An answer key is included. (CW)

  2. Physical Activity and Your Heart

    Science.gov (United States)

    ... page from the NHLBI on Twitter. What Is Physical Activity? Español Physical activity is any body movement that ... Rate This Content: NEXT >> Updated: June 22, 2016 Physical Activity and Your Heart in the News April 6, ...

  3. Is Enhanced Physical Activity Possible Using Active Videogames?

    OpenAIRE

    Baranowski, Tom; Baranowski, Janice; O'Connor, Teresia; Lu, Amy Shirong; Thompson, Debbe

    2012-01-01

    Our research indicated that 10–12-year-old children receiving two active Wii™ (Nintendo®; Nintendo of America, Inc., Redmond, WA) console videogames were no more physically active than children receiving two inactive videogames. Research is needed on how active videogames may increase physical activity.

  4. Is Enhanced Physical Activity Possible Using Active Videogames?

    Science.gov (United States)

    Baranowski, Tom; Baranowski, Janice; O'Connor, Teresia; Lu, Amy Shirong; Thompson, Debbe

    2012-06-01

    Our research indicated that 10-12-year-old children receiving two active Wii(™) (Nintendo(®); Nintendo of America, Inc., Redmond, WA) console videogames were no more physically active than children receiving two inactive videogames. Research is needed on how active videogames may increase physical activity.

  5. Integration of Active Video Games in Extracurricular Activity at Schools

    Science.gov (United States)

    Lee, Jung Eun; Huang, Charles; Pope, Zachary; Gao, Zan

    2015-01-01

    Active video games require players to be physically active. Dance Dance Revolution (DDR) is an interactive dancing game that requires fast-foot movement coordinated with energetic music and visuals. The Wii and Xbox Kinect games have also become good active video games for the promotion of physical activity participation. These games are much more…

  6. The Active Asteroids

    CERN Document Server

    Jewitt, Dave

    2011-01-01

    Some asteroids eject dust, unexpectedly producing transient, comet-like comae and tails. First ascribed to the sublimation of near-surface water ice, mass losing asteroids (also called "main-belt comets") can in fact be driven by a surprising diversity of mechanisms. In this paper, we consider eleven dynamical asteroids losing mass, in nine of which the ejected material is spatially resolved. We address mechanisms for producing mass loss including rotational instability, impact ejection, electrostatic repulsion, radiation pressure sweeping, dehydration stresses and thermal fracture, in addition to the sublimation of ice. In two objects (133P and 238P) the repetitive nature of the observed activity leaves ice sublimation as the only reasonable explanation while, in a third ((596) Scheila), a recent impact is the cause. Another impact may account for activity in P/2010 A2 but this tiny object can also be explained as having shed mass after reaching rotational instability. Mass loss from (3200) Phaethon is proba...

  7. Cisplatin triggers platelet activation.

    Science.gov (United States)

    Togna, G I; Togna, A R; Franconi, M; Caprino, L

    2000-09-01

    Clinical observations suggest that anticancer drugs could contribute to the thrombotic complications of malignancy in treated patients. Thrombotic microangiopathy, myocardial infarction, and cerebrovascular thrombotic events have been reported for cisplatin, a drug widely used in the treatment of many solid tumours. The aim of this study is to explore in vitro cisplatin effect on human platelet reactivity in order to define the potentially active role of platelets in the pathogenesis of cisplatin-induced thrombotic complications. Our results demonstrate that cisplatin increases human platelet reactivity (onset of platelet aggregation wave and thromboxane production) to non-aggregating concentrations of the agonists involving arachidonic acid metabolism. Direct or indirect activation of platelet phospholipase A(2) appears to be implicated. This finding contributes to a better understanding of the pathogenesis of thrombotic complications occurring during cisplatin-based chemotherapy.

  8. Apheresis activity in Venezuela.

    Science.gov (United States)

    Saltiel, Christiane

    2005-07-01

    Interest for apheresis activity has been growing in Venezuela. In 1976 there were only a few devices; in 2003, 80 apheresis machines performed 27,675 donor apheresis procedures and 547 therapeutic procedures countrywide. We report the activity at the Metropolitan Blood Bank (the largest one of the country) in the period 1999-2003: 597 therapeutic procedures were performed in 171 patients, during 212 crisis episodes. The average age was 38 +/- 16 years, 65% male and 35% female. Most of the therapeutic procedures were therapeutic plasma exchange for hematology diseases (mainly thrombotic thrombocitopenic purpura and hemophilia inhibitors), including 184 therapeutic procedures with the Autopheresis-C (Baxter Healthcare Corp., Deerfield, IL). Most common adverse effects (3.9%) were hypotension and allergic reactions to the plasma.

  9. Active optical clock

    Institute of Scientific and Technical Information of China (English)

    CHEN JingBiao

    2009-01-01

    This article presents the principles and techniques of active optical clock, a special laser combining the laser physics of one-atom laser, bad-cavity gas laser, super-cavity stabilized laser and optical atomic clock together. As a simple example, an active optical clock based on thermal strontium atomic beam shows a quantum-limited linewidth of 0.51 Hz, which is insensitive to laser cavity-length noise, and may surpass the recorded narrowest 6.7 Hz of Hg ion optical clock and 1.5 Hz of very recent optical lattice clock. The estimated 0.1 Hz one-second instability and 0.27 Hz uncertainty are limited only by the rela-tivistic Doppler effect, and can be improved by cold atoms.

  10. Techniques for active passivation

    Energy Technology Data Exchange (ETDEWEB)

    Roscioli, Joseph R.; Herndon, Scott C.; Nelson, Jr., David D.

    2016-12-20

    In one embodiment, active (continuous or intermittent) passivation may be employed to prevent interaction of sticky molecules with interfaces inside of an instrument (e.g., an infrared absorption spectrometer) and thereby improve response time. A passivation species may be continuously or intermittently applied to an inlet of the instrument while a sample gas stream is being applied. The passivation species may have a highly polar functional group that strongly binds to either water or polar groups of the interfaces, and once bound presents a non-polar group to the gas phase in order to prevent further binding of polar molecules. The instrument may be actively used to detect the sticky molecules while the passivation species is being applied.

  11. Active and passive euthanasia.

    Science.gov (United States)

    Rachels, J

    1975-01-09

    The traditional distinction between active and passive euthanasia requires critical analysis. The conventional doctrine is that there is such an important moral difference between the two that, although the latter is sometimes permissible, the former is always forbidden. This doctrine may be challenged for several reasons. First of all, active euthanasia is in many cases more humane than passive euthanasia, Secondly, the conventional doctrine leads to decisions concerning life and death on irrelevant grounds. Thirdly, the doctrine rests on a distinction between killing and letting die that itself has no moral importance. Fourthly, the most common arguments in favor of the doctrine are invalid. I therefore suggest that the American Medical Association policy statement that endorses this doctrine is unsound.

  12. Stellar Chromospheric Activity

    Directory of Open Access Journals (Sweden)

    Hall Jeffrey C.

    2008-03-01

    Full Text Available The Sun, stars similar to it, and many rather dissimilar to it, have chromospheres, regions classically viewed as lying above the brilliant photosphere and characterized by a positive temperature gradient and a marked departure from radiative equilibrium. Stellar chromospheres exhibit a wide range of phenomena collectively called activity, stemming largely from the time evolution of their magnetic fields and the mass flux and transfer of radiation through the complex magnetic topology and the increasingly optically thin plasma of the outer stellar atmosphere. In this review, I will (1 outline the development of our understanding of chromospheric structure from 1960 to the present, (2 discuss the major observational programs and theoretical lines of inquiry, (3 review the origin and nature of both solar and stellar chromospheric activity and its relationship to, and effect on, stellar parameters including total energy output, and (4 summarize the outstanding problems today.

  13. Active microchannel heat exchanger

    Science.gov (United States)

    Tonkovich, Anna Lee Y [Pasco, WA; Roberts, Gary L [West Richland, WA; Call, Charles J [Pasco, WA; Wegeng, Robert S [Richland, WA; Wang, Yong [Richland, WA

    2001-01-01

    The present invention is an active microchannel heat exchanger with an active heat source and with microchannel architecture. The microchannel heat exchanger has (a) an exothermic reaction chamber; (b) an exhaust chamber; and (c) a heat exchanger chamber in thermal contact with the exhaust chamber, wherein (d) heat from the exothermic reaction chamber is convected by an exothermic reaction exhaust through the exhaust chamber and by conduction through a containment wall to the working fluid in the heat exchanger chamber thereby raising a temperature of the working fluid. The invention is particularly useful as a liquid fuel vaporizer and/or a steam generator for fuel cell power systems, and as a heat source for sustaining endothermic chemical reactions and initiating exothermic reactions.

  14. Techniques for active passivation

    Science.gov (United States)

    Roscioli, Joseph R.; Herndon, Scott C.; Nelson, Jr., David D.

    2016-12-20

    In one embodiment, active (continuous or intermittent) passivation may be employed to prevent interaction of sticky molecules with interfaces inside of an instrument (e.g., an infrared absorption spectrometer) and thereby improve response time. A passivation species may be continuously or intermittently applied to an inlet of the instrument while a sample gas stream is being applied. The passivation species may have a highly polar functional group that strongly binds to either water or polar groups of the interfaces, and once bound presents a non-polar group to the gas phase in order to prevent further binding of polar molecules. The instrument may be actively used to detect the sticky molecules while the passivation species is being applied.

  15. Nematicidal activity of terpenoids.

    Science.gov (United States)

    Abdel-Rahman, Fawzia H; Alaniz, Nina M; Saleh, Mahmoud A

    2013-01-01

    Thirty four phytoterpenoids were evaluated for their nematicidal effect using the model nematode Caenorhabditis elegans. Nematicidal activities of the tested compounds at concentrations of 50 μg/mL showed wide variation in their effects ranging from no effect, weak, moderate and strong effects. Terpenoids exerting 50% or higher mortality at 50 μg/mL were further tested at five different concentrations to calculate the concentration that will kill 50% of the nematode population (LC(50)). Among the most effective terpenoids were carvacrol, thymol, nerolidol, α-terpinene, geraniol, citronellol, farnesol, limonene, pseudoionone and eugenol in a descending order. These compounds exhibited a dose-dependent effect. The results suggest that the selected monoterpenoids and essential oils with a high concentration of these compounds mayprovide potential natural nematicides and merit further study as botanical nematicides for the control of both plant and animal parasitic nematodes. In general, oxygenated terpenoids and phenolic terpenoids exhibited higher nematicidal activity than hydrocarbons terpenoids.

  16. Myofilament length dependent activation

    Energy Technology Data Exchange (ETDEWEB)

    de Tombe, Pieter P.; Mateja, Ryan D.; Tachampa, Kittipong; Mou, Younss Ait; Farman, Gerrie P.; Irving, Thomas C. (IIT); (Loyola)

    2010-05-25

    The Frank-Starling law of the heart describes the interrelationship between end-diastolic volume and cardiac ejection volume, a regulatory system that operates on a beat-to-beat basis. The main cellular mechanism that underlies this phenomenon is an increase in the responsiveness of cardiac myofilaments to activating Ca{sup 2+} ions at a longer sarcomere length, commonly referred to as myofilament length-dependent activation. This review focuses on what molecular mechanisms may underlie myofilament length dependency. Specifically, the roles of inter-filament spacing, thick and thin filament based regulation, as well as sarcomeric regulatory proteins are discussed. Although the 'Frank-Starling law of the heart' constitutes a fundamental cardiac property that has been appreciated for well over a century, it is still not known in muscle how the contractile apparatus transduces the information concerning sarcomere length to modulate ventricular pressure development.

  17. LANSCE Activity Report

    Energy Technology Data Exchange (ETDEWEB)

    Amy Robinson; Audrey Archuleta; Barbara Maes; Dan Strottman; Earl Hoffman; Garth Tietjen; Gene Farnum; Geoff Greene; Joyce Roberts; Ken Johnson; Paul Lewis; Roger Pynn; Stan Schriber; Steve Sterbenz; Steve Wender; Sue Harper

    1999-02-01

    The Los Alamos Neutron Science Center Activity Report describes scientific and technological progress and achievements in LANSCE Division during the period of 1995 to 1998. This report includes a message from the Division Director, an overview of LANSCE, sponsor overviews, research highlights, advanced projects and facility upgrades achievements, experimental and user program accomplishments, news and events, and a list of publications. The research highlights cover the areas of condensed-matter science and engineering, accelerator science, nuclear science, and radiography. This report also contains a compact disk that includes an overview, the Activity Report itself, LANSCE operations progress reports for 1996 and 1997, experiment reports from LANSCE users, as well as a search capability.

  18. Quality Of Construction Activity

    OpenAIRE

    LOREDANA VALENTINA HEDRE

    2010-01-01

    The problem of the quality works of building has a different importance because, as opposed to another activities of material productions here are not admitted bear of the quality in respect resistances, stability, durability, safeties in exploitation. The responsibility concerning assurance quality is not summed up just to the level of builders or beneficiaries, they became a national problem and last recently, European and even global issues. Implications are considered factors contributing...

  19. Current Research Activities.

    Science.gov (United States)

    1975-02-01

    Biological oceanography, marine food chain dynamics, carbon cycling in the ocean. Martin, Seelye,Ph.D., Johns Hopkins. Geophysical fluid dynamics...currently under investigation, (Ahmed, Packard) 8. Amylase studies An assay for amylase activity has been adapted to measure zooplankton grazing. This...as a function of available food and of the biomass of copepods, was prescribed by sixteen equations: five, corresponding to copepodite stages (I to V

  20. Diamond dipole active antenna

    OpenAIRE

    Bubnov, Igor N.; Falkovych, I. S.; Gridin, A. A.; Stanislavsky, A. A.; Reznik, A. P.

    2015-01-01

    Advantages of the diamond dipole antenna as an active antenna are presented. Such an antenna is like an inverted bow-tie antenna, but the former has some advantages over the ordinary bow-tie antenna. It is shown that the diamond dipole antenna may be an effective element of a new antenna array for low-frequency radio astronomy as well as a communication antenna.

  1. Active Brownian rods

    Science.gov (United States)

    Peruani, Fernando

    2016-11-01

    Bacteria, chemically-driven rods, and motility assays are examples of active (i.e. self-propelled) Brownian rods (ABR). The physics of ABR, despite their ubiquity in experimental systems, remains still poorly understood. Here, we review the large-scale properties of collections of ABR moving in a dissipative medium. We address the problem by presenting three different models, of decreasing complexity, which we refer to as model I, II, and III, respectively. Comparing model I, II, and III, we disentangle the role of activity and interactions. In particular, we learn that in two dimensions by ignoring steric or volume exclusion effects, large-scale nematic order seems to be possible, while steric interactions prevent the formation of orientational order at large scales. The macroscopic behavior of ABR results from the interplay between active stresses and local alignment. ABR exhibit, depending on where we locate ourselves in parameter space, a zoology of macroscopic patterns that ranges from polar and nematic bands to dynamic aggregates.

  2. Proteomics of Eosinophil Activation

    Directory of Open Access Journals (Sweden)

    Deane F. Mosher

    2017-09-01

    Full Text Available We recently identified and quantified >7,000 proteins in non-activated human peripheral blood eosinophils using liquid chromatography coupled to tandem mass spectrometry (LC–MS/MS and described phosphoproteomic changes that accompany acute activation of eosinophils by interleukin-5 (IL5 (1. These data comprise a treasure trove of information about eosinophils. We illustrate the power of label-free LC–MS/MS quantification by considering four examples: complexity of eosinophil STATs, contribution of immunoproteasome subunits to eosinophil proteasomes, complement of integrin subunits, and contribution of platelet proteins originating from platelet–eosinophil complexes to the overall proteome. We describe how isobaric labeling enables robust sample-to-sample comparisons and relate the 220 phosphosites that changed significantly upon treatment with IL5 to previous studies of eosinophil activation. Finally, we review previous attempts to leverage the power of mass spectrometry to discern differences between eosinophils of healthy subjects and those with eosinophil-associated conditions and point out features of label-free quantification and isobaric labeling that are important in planning future mass spectrometric studies.

  3. Amphoteric surface active agents

    Directory of Open Access Journals (Sweden)

    Eissa, A.M. F.

    1995-10-01

    Full Text Available 2-[trimethyl ammonium, triethyl ammonium, pyridinium and 2-amino pyridinium] alkanoates, four series of surface active agents containing carbon chain C12, C14, C16 and C18carbon atoms, were prepared. Their structures were characterized by microanalysis, infrared (IR and nuclear magnetic resonance (NMR. Surface and interfacial tension, Krafft point, wetting time, emulsification power, foaming height and critical micelle concentration (cmc were determined and a comparative study was made between their chemical structure and surface active properties. Antimicrobial activity of these surfactants was also determined.

    Se prepararon cuatro series de agentes tensioactivos del tipo 2-[trimetil amonio, trietil amonio, piridinio y 2-amino piridinio] alcanoatos, que contienen cadenas carbonadas con C12, C14, C16 y C18 átomos de carbono.
    Se determinaron la tensión superficial e interfacial, el punto de Krafft, el tiempo humectante, el poder de emulsionamiento, la altura espumante y la concentración critica de miscela (cmc y se hizo un estudio comparativo entre la estructura química y sus propiedades tensioactivas. Se determinó también la actividad antimicrobiana de estos tensioactivos. Estas estructuras se caracterizaron por microanálisis, infrarrojo (IR y resonancia magnética nuclear (RMN.

  4. Human neutrophil antimicrobial activity.

    Science.gov (United States)

    Thomas, E L; Lehrer, R I; Rest, R F

    1988-01-01

    Polymorphonuclear neutrophilic leukocytes (PMNs) take up opsonized microorganisms into phagosomes that fuse with secretory granules in the PMN cytoplasm to form phagolysosomes. Killing and digestion of microorganisms take place within phagolysosomes. Antimicrobial activities in phagolysosomes are divided into two classes. Oxygen (O2)-dependent mechanisms are expressed when PMNs undergo the "respiratory burst." An NADPH oxidase in the phagolysosome membrane is activated and reduces O2 to superoxide (O2-). O2 reduction is the first step in a series of reactions that produce toxic oxidants. For example, .O2- dismutases to hydrogen peroxide (H2O2), and the azurophil granule enzyme myeloperoxidase catalyzes the oxidation of Cl- by H2O2 to yield hypochlorous acid (HOCl). The reaction of HOCl with ammonia and amines modulates the toxicity of this oxidant. O2-independent antimicrobial mechanisms include the activities of lysosomal proteases, other hydrolytic enzymes, and proteins and peptides that bind to microorganisms and disrupt essential processes or structural components. For example, the bactericidal/permeability-increasing protein, cathepsin G, and the defensins are released into phagolysosomes from the azurophil granules. Proposed mechanisms of action of neutrophil antimicrobial agents, their range of microbial targets, and their possible interactions within phagolysosomes are discussed.

  5. Sesterterpenoids with Anticancer Activity.

    Science.gov (United States)

    Evidente, Antonio; Kornienko, Alexander; Lefranc, Florence; Cimmino, Alessio; Dasari, Ramesh; Evidente, Marco; Mathieu, Véronique; Kiss, Robert

    2015-01-01

    Terpenes have received a great deal of attention in the scientific literature due to complex, synthetically challenging structures and diverse biological activities associated with this class of natural products. Based on the number of C5 isoprene units they are generated from, terpenes are classified as hemi- (C5), mono- (C10), sesqui- (C15), di- (C20), sester- (C25), tri (C30), and tetraterpenes (C40). Among these, sesterterpenes and their derivatives known as sesterterpenoids, are ubiquitous secondary metabolites in fungi, marine organisms, and plants. Their structural diversity encompasses carbotricyclic ophiobolanes, polycyclic anthracenones, polycyclic furan-2-ones, polycyclic hydroquinones, among many other carbon skeletons. Furthermore, many of them possess promising biological activities including cytotoxicity and the associated potential as anticancer agents. This review discusses the natural sources that produce sesterterpenoids, provides sesterterpenoid names and their chemical structures, biological properties with the focus on anticancer activities and literature references associated with these metabolites. A critical summary of the potential of various sesterterpenoids as anticancer agents concludes the review.

  6. Protein (Cyanobacteria): 295669 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ZP_08427402.1 1117:5289 1150:2103 1155738:201 1155739:201 489825:201 two-component resp...onse regulator, CheY subfamily Moorea producens 3L MNYRNTIQRIEILLVEDNHRDVDLTKATLKNSNTRNNIQTFTNGKDAMAFLRRESP

  7. Thermal activity on Enceladus

    Science.gov (United States)

    Tobie, G.; Besserer, J.; Behounkova, M.; Cadek, O.; Choblet, G.; Sotin, C.

    2009-04-01

    Observations by Cassini have revealed that Enceladus' souh pole is highly active, with jets of icy particles and water vapour emanated from narrow tectonic ridges, called "tiger stripes". This jet activity is associated to a very high thermal emission mainly focused along the tectonic ridges. Heat power required to sustain such an activity is probably related to the dissipation of mechanical energy due to tidal forces exerted by Saturn. However, the dissipation process and its relation to the tectonic features are not clearly established. Both shear heating along the tectonic ridges and viscous dissipation in the convective part of the ice shell could contribute to the energy budget (Nimmo et al. 2007, Tobie et al. 2008). Tobie et al. (2008) pointed out that only interior models with a liquid water layer at depth, covering at least ~2/3 of the southern hemisphere, can explain the observed magnitude of dissipation and its particular location at the south pole. However, the long term stability of such a liquid reservoir remains problematic (Roberts and Nimmo 2007) and the possible link between the liquid reservoir and the surface activities is unknown. Concentration of tidal stresses along the tiger ridges have also been invoked as a mechanism to trigger the eruptive processes (Hurtford et al. 2007, Smith-Konter et al. 2008). However, those models do not take into account a realistic rheological structure for the ice shell when computing the fluctuating stress field. Moreover, the effect of the faults on the background tidal stress is neglected. In particular, low viscosity values are expected to be associated with the shear zone along the tiger stripes and may have a significant impact of the global tidal stress field. In order to self-consistently determine the tidal deformation and its impact on the thermal activity on Enceladus, we are currently developing a 3D model that combines a thermal convection code in spherical geometry (Choblet et al. 2007) and a

  8. Large-scale physical activity data reveal worldwide activity inequality.

    Science.gov (United States)

    Althoff, Tim; Sosič, Rok; Hicks, Jennifer L; King, Abby C; Delp, Scott L; Leskovec, Jure

    2017-07-20

    To be able to curb the global pandemic of physical inactivity and the associated 5.3 million deaths per year, we need to understand the basic principles that govern physical activity. However, there is a lack of large-scale measurements of physical activity patterns across free-living populations worldwide. Here we leverage the wide usage of smartphones with built-in accelerometry to measure physical activity at the global scale. We study a dataset consisting of 68 million days of physical activity for 717,527 people, giving us a window into activity in 111 countries across the globe. We find inequality in how activity is distributed within countries and that this inequality is a better predictor of obesity prevalence in the population than average activity volume. Reduced activity in females contributes to a large portion of the observed activity inequality. Aspects of the built environment, such as the walkability of a city, are associated with a smaller gender gap in activity and lower activity inequality. In more walkable cities, activity is greater throughout the day and throughout the week, across age, gender, and body mass index (BMI) groups, with the greatest increases in activity found for females. Our findings have implications for global public health policy and urban planning and highlight the role of activity inequality and the built environment in improving physical activity and health.

  9. Adaptable typologies for active roofs

    NARCIS (Netherlands)

    Quanjel, E.M.C.J.; Zeiler, W.

    2006-01-01

    The main objective of this part of the 6th framework Pan-European EUR-ACTIVE ROOF-er project is to improve the interaction between design participants of dynamic adaptable Active Roofs in product development and Active Roofs from an architects/ customers perspective. Improvements in Active Roof desi

  10. Spontaneous Plasticity of Multineuronal Activity Patterns in Activated Hippocampal Networks

    Directory of Open Access Journals (Sweden)

    Atsushi Usami

    2008-01-01

    Full Text Available Using functional multineuron imaging with single-cell resolution, we examined how hippocampal networks by themselves change the spatiotemporal patterns of spontaneous activity during the course of emitting spontaneous activity. When extracellular ionic concentrations were changed to those that mimicked in vivo conditions, spontaneous activity was increased in active cell number and activity frequency. When ionic compositions were restored to the control conditions, the activity level returned to baseline, but the weighted spatial dispersion of active cells, as assessed by entropy-based metrics, did not. Thus, the networks can modify themselves by altering the internal structure of their correlated activity, even though they as a whole maintained the same level of activity in space and time.

  11. Enzyme Activities in Waste Water and Activated Sludge

    DEFF Research Database (Denmark)

    Nybroe, Ole; Jørgensen, Per Elberg; Henze, Mogens

    1992-01-01

    The purpose of the present study was to evaluate the potential of selected enzyme activity assays to determine microbial abundance and heterotrophic activity in waste water and activated sludge. In waste water, esterase and dehydrogenase activities were found to correlate with microbial abundance...... measured as colony forming units of heterotrophic bacteria. A panel of four enzyme activity assays, α-glucosidase, alanine-aminopeptidase, esterase and dehydrogenase were used to characterize activated sludge and anaerobic hydrolysis sludge from a pilot scale plant. The enzymatic activity profiles were...... distinctly different, suggesting that microbial populations were different, or had different physiological properties, in the two types of sludge. Enzyme activity profiles in activated sludge from four full-scale plants seemed to be highly influenced by the composition of the inlet. Addition of hydrolysed...

  12. Advances in Activity Cliff Research.

    Science.gov (United States)

    Dimova, Dilyana; Bajorath, Jürgen

    2016-05-01

    Activity cliffs, i.e. similar compounds with large potency differences, are of interest from a chemical and informatics viewpoint; as a source of structure-activity relationship information, for compound optimization, and activity prediction. Herein, recent highlights of activity cliff research are discussed including studies that have further extended our understanding of activity cliffs, yielded unprecedented insights, or paved the way for practical applications.

  13. Topological Active Volumes

    Directory of Open Access Journals (Sweden)

    Barreira N

    2005-01-01

    Full Text Available The topological active volumes (TAVs model is a general model for 3D image segmentation. It is based on deformable models and integrates features of region-based and boundary-based segmentation techniques. Besides segmentation, it can also be used for surface reconstruction and topological analysis of the inside of detected objects. The TAV structure is flexible and allows topological changes in order to improve the adjustment to object's local characteristics, find several objects in the scene, and identify and delimit holes in detected structures. This paper describes the main features of the TAV model and shows its ability to segment volumes in an automated manner.

  14. AMS Prototyping Activities

    Science.gov (United States)

    Burleigh, Scott

    2008-01-01

    This slide presentation reviews the activity around the Asynchronous Message Service (AMS) prototype. An AMS reference implementation has been available since late 2005. It is aimed at supporting message exchange both in on-board environments and over space links. The implementation incoroporates all mandatory elements of the draft recommendation from July 2007: (1) MAMS, AMS, and RAMS protocols. (2) Failover, heartbeats, resync. (3) "Hooks" for security, but no cipher suites included in the distribution. The performance is reviewed, and a Benchmark latency test over VxWorks Message Queues is shown as histograms of a count vs microseconds per 1000-byte message

  15. Active galactic nuclei

    CERN Document Server

    Beckmann, Volker

    2012-01-01

    This AGN textbook includes phenomena based on new results in the X-Ray domain from new telescopes such as Chandra and XMM Newton not mentioned in any other book. Furthermore, it considers also the Fermi Gamma Ray Space Telescope with its revolutionary advances of unprecedented sensitivity, field of view and all-sky monitoring. Those and other new developments as well as simulations of AGN merging events and formations, enabled through latest super-computing capabilities. The book gives an overview on the current knowledge of the Active Galacitc Nuclei phenomenon. The spectral energy d

  16. Direct Activation Of Methane

    KAUST Repository

    Basset, Jean-Marie

    2013-07-15

    Heteropolyacids (HPAs) can activate methane at ambient temperature (e.g., 20.degree. C.) and atmospheric pressure, and transform methane to acetic acid, in the absence of any noble metal such as Pd). The HPAs can be, for example, those with Keggin structure: H.sub.4SiW.sub.12O.sub.40, H.sub.3PW.sub.12O.sub.40, H.sub.4SiMo.sub.12O.sub.40, or H.sub.3PMo.sub.12O.sub.40, can be when supported on silica.

  17. Miscarriage and occupational activity

    DEFF Research Database (Denmark)

    Bonde, Jens Peter; Jørgensen, Kristian Tore; Bonzini, Matteo

    2013-01-01

    . METHODS: A search in Medline and EMBASE 1966-2012 identified 30 primary papers reporting the relative risk (RR) of miscarriage according to ≥1 of 5 occupational activities of interest. Following an assessment of completeness of reporting, confounding, and bias, each risk estimate was characterized as more......, N=10). RR for working hours and standing became smaller when analyses were restricted to higher quality studies. CONCLUSIONS: These largely reassuring findings do not provide a strong case for mandatory restrictions in relation to shift work, long working hours, occupational lifting, standing...

  18. Physical activity in elderly

    Directory of Open Access Journals (Sweden)

    Jan Cvecka

    2015-08-01

    Full Text Available Aging is a multifactorial irreversible process associated with significant decline in muscle mass and neuromuscular functions. One of the most efficient methods to counteract age-related changes in muscle mass and function is physical exercise. An alternative effective intervention to improve muscle structure and performance is electrical stimulation. In the present work we present the positive effects of physical activity in elderly and a study where the effects of a 8-week period of functional electrical stimulation and strength training with proprioceptive stimulation in elderly are compared.

  19. Physical Activity in Elderly

    Science.gov (United States)

    Tirpakova, Veronika; Sedliak, Milan; Kern, Helmut; Mayr, Winfried; Hamar, Dušan

    2015-01-01

    Aging is a multifactorial irreversible process associated with significant decline in muscle mass and neuromuscular functions. One of the most efficient methods to counteract age-related changes in muscle mass and function is physical exercise. An alternative effective intervention to improve muscle structure and performance is electrical stimulation. In the present work we present the positive effects of physical activity in elderly and a study where the effects of a 8-week period of functional electrical stimulation and strength training with proprioceptive stimulation in elderly are compared. PMID:26913164

  20. MRI of active otosclerosis

    Energy Technology Data Exchange (ETDEWEB)

    Ziyeh, S. [Section of Neuroradiology, Universitaetsklinik Freiburg, Breisacherstrasse 64, D-79106 Freiburg (Germany); Berlis, A. [Section of Neuroradiology, Universitaetsklinik Freiburg, Breisacherstrasse 64, D-79106 Freiburg (Germany); Ross, U.H. [Department of Otolaryngology, Universitaetsklinik, Freiburg (Germany); Reinhardt, M.J. [Department of Nuclear Medicine, Universitaetsklinik, Freiburg (Germany); Schumacher, M. [Section of Neuroradiology, Universitaetsklinik Freiburg, Breisacherstrasse 64, D-79106 Freiburg (Germany)

    1997-06-01

    Our aim was to determine whether MRI reliably shows pathology in patients with active otosclerosis (otospongiosis). We studied five patients with clinical and audiometric signs of this disorder and positive findings on high-resolution CT and tympanocochlear scintigraphy. Contrast enhancement of otospongiotic lesions was found in all affected ears, and could be topographically related to demineralised otospongiotic foci on CT. In lesions in the lateral wall of the labyrinth MRI sometimes showed the pathology better than CT, where partial-volume effects could be troublesome. (orig.). With 3 figs., 1 tab.

  1. The Active Muon Shield

    CERN Document Server

    Bezshyiko, Iaroslava

    2016-01-01

    In the SHiP beam-dump of the order of 1011 muons will be produced per second. An active muon-shield is used to magnetically deflect these muons out of the acceptance of the spectrom- eter. This note describes how this shield is modelled and optimized. The SHiP spectrometer is being re-optimized using a conical decay-vessel, and utilizing the possibility to magnetize part of the beam-dump shielding iron. A shield adapted to these new conditions is presented which is significantly shorter and lighter than the shield used in the Technical Proposal (TP), while showing a similar performance.

  2. Active galactic nuclei

    CERN Document Server

    Blandford, RD; Woltjer, L

    1990-01-01

    Starting with this volume, the Lecture Notes of the renowned Advanced Courses of the Swiss Society for Astrophysics and Astronomy will be published annually. In each course, three extensive lectures given by leading experts in their respective fields cover different and essential aspects of the subject. The 20th course, held at Les Diablerets in April 1990, dealt with current research on active galactic nuclei; it represents the most up-to-date views on the subject, presented with particular regard for clarity. The previous courses considered a wide variety of subjects, beginning with ""Theory

  3. GPS Activities at SLAC

    Energy Technology Data Exchange (ETDEWEB)

    Behrend, Dirk

    2002-11-19

    The Alignment Engineering Group of the Stanford Linear Accelerator Center (SLAC) started to use RTK (real-time kinematic) GPS equipment in order to perform structure mapping and GIS-related tasks on the SLAC campus. In a first step a continuously observing GPS station (SLAC M40) was set up. This station serves as master control station for all differential GPS activities on site and its coordinates have been determined in the well-defined global geodetic datum ITRF2000 at a given reference epoch. Some trials have been performed to test the RTK method. The tests have proven RTK to be very fast and efficient.

  4. Crew Activity Analyzer

    Science.gov (United States)

    Murray, James; Kirillov, Alexander

    2008-01-01

    The crew activity analyzer (CAA) is a system of electronic hardware and software for automatically identifying patterns of group activity among crew members working together in an office, cockpit, workshop, laboratory, or other enclosed space. The CAA synchronously records multiple streams of data from digital video cameras, wireless microphones, and position sensors, then plays back and processes the data to identify activity patterns specified by human analysts. The processing greatly reduces the amount of time that the analysts must spend in examining large amounts of data, enabling the analysts to concentrate on subsets of data that represent activities of interest. The CAA has potential for use in a variety of governmental and commercial applications, including planning for crews for future long space flights, designing facilities wherein humans must work in proximity for long times, improving crew training and measuring crew performance in military settings, human-factors and safety assessment, development of team procedures, and behavioral and ethnographic research. The data-acquisition hardware of the CAA (see figure) includes two video cameras: an overhead one aimed upward at a paraboloidal mirror on the ceiling and one mounted on a wall aimed in a downward slant toward the crew area. As many as four wireless microphones can be worn by crew members. The audio signals received from the microphones are digitized, then compressed in preparation for storage. Approximate locations of as many as four crew members are measured by use of a Cricket indoor location system. [The Cricket indoor location system includes ultrasonic/radio beacon and listener units. A Cricket beacon (in this case, worn by a crew member) simultaneously transmits a pulse of ultrasound and a radio signal that contains identifying information. Each Cricket listener unit measures the difference between the times of reception of the ultrasound and radio signals from an identified beacon

  5. Physical Activity in Elderly.

    Science.gov (United States)

    Cvecka, Jan; Tirpakova, Veronika; Sedliak, Milan; Kern, Helmut; Mayr, Winfried; Hamar, Dušan

    2015-08-24

    Aging is a multifactorial irreversible process associated with significant decline in muscle mass and neuromuscular functions. One of the most efficient methods to counteract age-related changes in muscle mass and function is physical exercise. An alternative effective intervention to improve muscle structure and performance is electrical stimulation. In the present work we present the positive effects of physical activity in elderly and a study where the effects of a 8-week period of functional electrical stimulation and strength training with proprioceptive stimulation in elderly are compared.

  6. Reuse of activated alumina

    Energy Technology Data Exchange (ETDEWEB)

    Hobensack, J.E. [Martin Marietta Energy Systems, Inc., Piketon, OH (United States)

    1991-12-31

    Activated alumina is used as a trapping media to remove trace quantities of UF{sub 6} from process vent streams. The current uranium recovery method employs concentrated nitric acid which destroys the alumina pellets and forms a sludge which is a storage and disposal problem. A recently developed technique using a distilled water rinse followed by three dilute acid rinses removes on average 97% of the uranium, and leaves the pellets intact with crush strength and surface area values comparable with new material. Trapping tests confirm the effectiveness of the recycled alumina as UF{sub 6} trapping media.

  7. Athena: Assessment Phase Activities

    Science.gov (United States)

    Lumb, David; Ayre, Mark

    2015-09-01

    The Athena mission concept has been proposed by the community in response to science themes of the Hot and Energetic Universe. Unlike other, competitive, mission selection exercises this "Large" class observatory mission has essentially been pre-selected. Nevertheless it has to be demonstrated that Athena meets the programmatic constraints of 1Bn euro cost cap, and a readiness level appropriate for formal mission adoption by the end 2019. This should be confirmed through a Phase A study conducted with two parallel industry activities. We describe the technical and programmatic content of these and latest progress in space and ground segment definition.

  8. COMPANY ACTIVITY FINANCIAL RISK

    Directory of Open Access Journals (Sweden)

    Caruntu Genu Alexandru

    2012-12-01

    Full Text Available In economic and financial activity, risk is an inherent financial decisions, encountered in daily agenda of managers of companies. Unexpected changes in the price of a product development not only affect the financial results of a company, but can cause even bankruptcy. In fact, the nature of financial decisions involve uncertainty. Financial decisions are made based on cash flows under future contracts, which are par excellence incerte.Activitatea an enterprise that holds any weight in the industry is subject to risks, since it can not predict with certainty different components of its outcome (cost, quantity, price and operating cycle (purchase, processing, sales.

  9. System of Volcanic activity

    Directory of Open Access Journals (Sweden)

    P. HÉDERVARI

    1972-06-01

    Full Text Available A comparison is made among the systems of B. G.
    Escher (3, of R. W. van Bemmelen (1 and that of the author (4. In this
    connection, on the basis of Esclier's classification, the terms of "constructiv
    e " and "destructive" eruptions are introduced into the author's system and
    at the same time Escher's concept on the possible relation between the depth
    of magma-chamber and the measure of the gas-pressure is discussed briefly.
    Three complementary remarks to the first paper (4 011 the subject of system
    of volcanic activity are added.

  10. FY 1996 activity summary

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-04-01

    The US Department of Energy Office of Nuclear and Facility Safety provides nuclear safety policy, independent technical evaluation, and technical support. A summary of these activities is provided in this report. These include: (1) changing the mission of the former production facilities to storage and waste management; (2) stabilizing nuclear materials not recycled due to production cessation or interruptions; (3) reformulating the authorization basis for existing facilities to convert to a standards based approach for operations consistent with modern expectations; and (4) implementing a modern regulatory framework for nuclear facilities. Enforcement of the Price-Anderson Amendments Act is also reported.

  11. Active terahertz metamaterials

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Hou-tong [Los Alamos National Laboratory; O' Hara, John F [Los Alamos National Laboratory; Taylor, Antoinette J [Los Alamos National Laboratory

    2009-01-01

    In this paper we present an overview of research in our group in terahertz (THz) metamaterials and their applications. We have developed a series of planar metamaterials operating at THz frequencies, all of which exhibit a strong resonant response. By incorporating natural materials, e.g. semiconductors, as the substrates or as critical regions of metamaterial elements, we are able to effectively control the metamaterial resonance by the application of external stimuli, e.g., photoexcitation and electrical bias. Such actively controllable metamaterials provide novel functionalities for solid-state device applications with unprecedented performance, such as THz spectroscopy, imaging, and many others.

  12. Diagramming Complex Activities

    DEFF Research Database (Denmark)

    Andersen, Peter Bøgh

    2005-01-01

    We increasingly live in heterogeneous ever-changing webs of activities where human actions are intertwined with events created by automatic machines.  In order to make such webs understandable to its human participants, their structure should be represented by displays emphasizing their action as...... aspect. The paper suggests thematic roles as a semantics for actions, argues that a selection of well-known diagramming techniques can be defined within this theory, and uses the theory to discuss new issues related to process control and mobile technology....

  13. Rationales for regulatory activity

    Energy Technology Data Exchange (ETDEWEB)

    Perhac, R.M. [Univ. of Tennessee, Knoxville, TN (United States)

    1997-02-01

    The author provides an outline which touches on the types of concerns about risk evaluation which are addressed in the process of establishing regulatory guides. Broadly he says regulatory activity serves three broad constituents: (1) Paternalism (private risk); (2) Promotion of social welfare (public risks); (3) Protection of individual rights (public risks). He then discusses some of the major issues encountered in reaching a decision on what is an acceptable level of risk within each of these areas, and how one establishes such a level.

  14. Involvement in Physical Activity

    Directory of Open Access Journals (Sweden)

    James Gavin

    2013-04-01

    Full Text Available A total of 1,096 adolescents participated in 123 focus groups regarding the perceived outcomes of their involvement in sports and physical activity (PA. The groups, segmented by grade level, sex, and school types, were conducted in both public and private high schools in Montreal, Quebec. We sought to understand, through the participants’ own words, their perception of the outcome matrix of involvement in sports and PA. Focus group questions emphasized changes that adolescents associated with such engagement. In particular, participants were asked how sports and PA might influence behaviors, emotional states, personal characteristics, and other outcomes. Twelve themes were identified in the responses: Positive Health and Physical Changes (18.5%, Activity-Related Positive Emotions (15.6%, and Personal Learning (11.3% were most prevalent in the discussions. A cluster of deeper personal changes thematically described as Self-Identity, Autonomy, and Positive Character Development accounted for another 16.5% of the responses. Relatively few commentaries emphasized negative effects (7.1%. Converting the proportions of qualitative data into a quantitative index allowed us to analyze potential differences in emphasis according to sex, age, and school type. Though a few significant findings emerged, the larger pattern was of a uniform perceptual map across the variables for this adolescent sample. Implications drawn from this investigation highlight the need to clearly articulate concrete pathways to positive nonphysical changes (e.g., mood states, autonomy, positive character development from engagements in sports and PA.

  15. Active Astronomy Roadshow Haiti

    Science.gov (United States)

    Laycock, Silas; Oram, Kathleen; Alabre, Dayana; Douyon, Ralph; UMass Lowell Haiti Development Studies Center

    2016-01-01

    College-age Haitian students working with advisors and volunteers from UMass Lowell in 2015 developed and tested an activity-based K-8 curriculum in astronomy, space, and earth science. Our partner school is located in Les Cayes, Haiti a city where only 65% of children attend school, and only half of those will complete 6th grade. Astronomy provides an accessible and non-intimidating entry into science, and activity-based learning contrasts with the predominant traditional teaching techniques in use in Haiti, to reach and inspire a different cohort of learners. Teachers are predominantly women in Haiti, so part of the effort involves connecting them with scientists, engineers and teacher peers in the US. As a developing nation, it is vital for Haitian (as for all) children to grow up viewing women as leaders in science. Meanwhile in the US, few are aware of the reality of getting an education in a 3rd world nation (i.e. most of the world), so we also joined with teachers in Massachusetts to give US school children a peek at what daily life is like for their peers living in our vibrant but impoverished neighbor. Our Haitian partners are committed to helping their sister-schools with curriculum and educator workshops, so that the overall quality of education can rise, and not be limited to the very few schools with access to resources. We will describe the activites, motivation, and and the lessons learned from our first year of the project.

  16. Measuring children's physical activity

    DEFF Research Database (Denmark)

    Schneller, Mikkel Bo; Bentsen, Peter; Nielsen, Glen

    2017-01-01

    INTRODUCTION: Accelerometer-based physical activity monitoring has become the method of choice in many large-scale physical activity (PA) studies. However, there is an ongoing debate regarding the placement of the device, the determination of device wear time, and how to solve a lack of participant...... compliance. The aim of this study was to assess the compliance of Axivity AX3 accelerometers taped directly to the skin of 9-13-year-old children. METHODS: Children in 46 school classes (53.4% girls, age 11.0±1.0 years, BMI 17.7±2.8 kg*m) across Denmark wore two Axivity AX3 accelerometers, one taped...... on the thigh (n=903) and one on the lower back (n= 856), for up to ten consecutive days. Participants were instructed not to reattach an accelerometer should it fall off. Simple and multiple linear regression were used to determine associations between accelerometer wear time and age, sex, BMI percentiles...

  17. Leadership Development Activities

    Directory of Open Access Journals (Sweden)

    Malikeh Beheshtifar

    2012-07-01

    Full Text Available Nowadays, human resource development is considered as a developed concept in HR field. It is a process for helping personnel to conduct their duties better. Most organizations tend to leadership development as a separable subject and as areas of responsibility within organization. Whereas the leadership development plans have been unsuccessful. This article aim to draw attention to the fact that leadership development is crucial in organizations. A literature review was conducted by searching journal databases, textbooks, and relevant reports. A categorization of the evidence allowed informed discussions on the key themes surrounding leadership development activities. Leadership development is caused to employees' promotion and progress via nurture of new talents, stimulus in employees by persuade to do individual development, save time and cost, and increase customers' satisfaction by relations improvement. Accordingly, the development systems can cover a wide scope in organization. They are effective to career management, training and development, performance management, strategic human resource planning, recruitment and selection, and succession planning activities. Despite the need for further scientific and validated studies, organizations should be urged to devote sufficient resources and attention towards leadership development for promoting long-term survival and prosperity.

  18. The Active Solid Earth

    Science.gov (United States)

    Ebinger, Cynthia

    2016-04-01

    Dynamic processes in Earth's crust, mantle and core shape Earth's surface and magnetic field over time scales of seconds to millennia, and even longer time scales as recorded in the ca. 4 Ga rock record. Our focus is the earthquake-volcano deformation cycles that occur over human time scales, and their comparison with time-averaged deformation studies, with emphasis on mantle plume provinces where magma and volatile release and vertical tectonics are readily detectable. Active deformation processes at continental and oceanic rift and back arc zones provide critical constraints on mantle dynamics, the role of fluids (volatiles, magma, water), and plate rheology. For example, recent studies of the East African rift zone, which formed above one of Earth's largest mantle upwellings reveal that magma production and volatile release rates are comparable to those of magmatic arcs, the archetypal zones of continental crustal creation. Finite-length faults achieve some plate deformation, but magma intrusion in the form of dikes accommodates extension in continental, back-arc, and oceanic rifts, and intrusion as sills causes permanent uplift that modulates the local time-space scales of earthquakes and volcanoes. Volatile release from magma intrusion may reduce fault friction and permeability, facilitating aseismic slip and creating magma pathways. We explore the implications of active deformation studies to models of the time-averaged structure of plume and extensional provinces in continental and oceanic plate settings.

  19. Active Near Earth Asteroids

    Science.gov (United States)

    Jenniskens, Peter

    2015-08-01

    Past activity from Near Earth Asteroids is recorded in the meteoroid streams that cause our meteor showers. Automated meteoroid orbit surveys by photographic, low-light video, specular radar, and head-echo radar reflections are providing the first maps of meteor shower activity at different particle sizes. There are distinct differences in particle size distributions among streams. The underlaying mechanisms that created these streams are illuminated: fragmentation from spin-up or thermal stresses, meteoroid ejection by water vapor drag, and ejection of icy particles by CO and CO2 sublimation. The distribution of the meteoroid orbital elements probe the subsequent evolution by planetary perturbations and sample the range of dynamical processes to which Near Earth Asteroids are exposed. The non-stream "sporadic" meteors probe early stages in the evolution from meteoroid streams into the zodiacal dust cloud. We see that the lifetime of large meteoroids is generally not limited by collisions. Results obtained by the CAMS video survey of meteoroid orbits are compared to those from other orbit surveys. Since October 2010, over 200,000 meteoroid orbits have been measured. First results from an expansion into the southern hemisphere are also presented, as are first results from the measurement of main element compositions. Among the many streams detected so far, the Geminid and Sextantid showers stand out by having a relatively high particle density and derive from parent bodies that appear to have originated in the main belt.

  20. Microbiologically active nanocomposite media

    Science.gov (United States)

    Petranovskii, Vitalii; Panina, Lyudmila; Bogomolova, Eugenia; Belostotskaya, Galina

    2003-07-01

    The most recent approach to the development of novel antimicrobial and antifungal agents is based on the application of synthetic and natural zeolites, because zeolites are known to be the carrier and slow releaser of the heavy metals with olygodynamic properties. The microbiological activity of the ion-exchanged zeolites is attributed to the ionic state of the metal sreleased from the zeolites by ion re-exchange. In the present work we used low cost natural clinoptilolite (Cli) as a substrate for copper and silver in different states. The state of oxidation of the exchanged metal in zeolite with supported Cu and Ag species (in the form of cations, small clusters, sub-coloidal particles, large particles) in order to fit them to fulfill the following criteria: to demonstrate their high protective abilities against fungi and long-term stability. The study of structure of samples with XRD, UV-visible spectroscopy, FTIR, their stability with temperature and during storage was carried out for obtaining the correct correlation with microbiological activity.

  1. Active Optics in LAMOST

    Institute of Scientific and Technical Information of China (English)

    Ding-Qiang Su; Xiang-Qun Cui

    2004-01-01

    Large Sky Area Multi-Object Fiber Spectroscopic Telescope (LAMOST)is one of the major national projects under construction in China. Active optics is one of the most important technologies for new large telescopes. It is used for correcting telescope errors generated by gravitational and thermal changes. Here,however, we use this technology to realize the configuration of LAMOST, -a task that cannot be done in the traditional way. A comprehensive and intensive research on the active optics used in LAMOST is also reported, including an open-loop control method and an auxiliary closed-loop control method. Another important development is in our pre-calibration method of open-loop control, which is with some new features: simultaneous calculation of the forces and displacements of force actuators and displacement actuators; the profile of mirror can be arbitrary;the mirror surface shape is not expressed by a fitting polynomial, but is derived from the mirror surface shape formula which is highly accurate; a proof is given that the solution of the pre-calibration method is the same as the least squares solution.

  2. CBP Active Dumping and Active Countervailing (AD/CVD) Cases

    Data.gov (United States)

    Department of Homeland Security — The datasets provide information from CBP's reference files on active anti-dumping and active countervailing cases. This data includes associated case numbers (if...

  3. INFLUENCE OF SELECTED PHARMACEUTICALS ON ACTIVATED SLUDGE DEHYDROGENASE ACTIVITY

    Directory of Open Access Journals (Sweden)

    Agnieszka Tomska

    2016-06-01

    The aim of this work was to evaluate the effect of selected antibiotics - sulfanilamide and erythromycin on activated sludge dehydrogenase activity with use of trifenyltetrazolinum chloride (TTC test. Dehydrogenases activity is an indicator of biochemical activity of microorganisms present in activated sludge or the ability to degrade organic compounds in waste water. TTC test is particularly useful for the regularity of the course of treatment, in which the presence of inhibitors of biochemical reactions and toxic compounds are present. It was observed that the dehydrogenase activity decreases with the increase of a antibiotics concentration. The lowest value of the dehydrogenase activity equal to 32.4 μmol TF / gMLSS obtained at sulfanilamide concentration 150mg / l. For this sample, an inhibition of dehydrogenase activity was 31%.

  4. Sedentary activity associated with metabolic syndrome independent of physical activity

    DEFF Research Database (Denmark)

    Bankoski, Andrea; Harris, Tamara B; McClain, James J

    2011-01-01

    This study examined the association between objectively measured sedentary activity and metabolic syndrome among older adults.......This study examined the association between objectively measured sedentary activity and metabolic syndrome among older adults....

  5. The active video games' narrative impact on children's physical activities

    Science.gov (United States)

    Active video games (AVGs) capable of inducing physical activity offer an innovative approach to combating childhood obesity. Unfortunately, children's AVG game play decreases quickly, underscoring the need to identify novel methods for player engagement. Narratives have been demonstrated to influenc...

  6. Characterization and distribution of esterase activity in activated sludge

    NARCIS (Netherlands)

    Boczar, BA; Forney, LJ; Begley, WM; Larson, RJ; Federle, TW

    2001-01-01

    The location and activity of esterase enzymes in activated Sludge from three Municipal wastewater treatment plants were characterized using model Substrate, and denaturing and nondenaturing polyacrylamide gel electrophoresis (PAGE) Of particulate, freeze thaw (primarily periplasmic enzymes and those

  7. Active Magnetic Regenerative Liquefier

    Energy Technology Data Exchange (ETDEWEB)

    Barclay, John A. [Heracles Energy Corporation d.b.a. Prometheus Energy, Washington, DC (United States); Oseen-Send, Kathryn [Heracles Energy Corporation d.b.a. Prometheus Energy, Washington, DC (United States); Ferguson, Luke [Heracles Energy Corporation d.b.a. Prometheus Energy, Washington, DC (United States); Pouresfandiary, Jamshid [Heracles Energy Corporation d.b.a. Prometheus Energy, Washington, DC (United States); Cousins, Anand [Heracles Energy Corporation d.b.a. Prometheus Energy, Washington, DC (United States); Ralph, Heather [Heracles Energy Corporation d.b.a. Prometheus Energy, Washington, DC (United States); Hampto, Tom [Heracles Energy Corporation d.b.a. Prometheus Energy, Washington, DC (United States)

    2016-01-12

    This final report for the DOE Project entitled Active Magnetic Regenerative Liquefier (AMRL) funded under Grant DE-FG36-08GO18064 to Heracles Energy Corporation d.b.a. Prometheus Energy (Heracles/Prometheus) describes an active magnetic regenerative refrigerator (AMRR) prototype designed and built during the period from July 2008 through May 2011. The primary goal of this project was to make significant technical advances toward highly efficient liquefaction of hydrogen. Conventional hydrogen liquefiers at any scale have a maximum FOM of ~0.35 due primarily to the intrinsic difficulty of rapid, efficient compression of either hydrogen or helium working gases. Numerical simulation modeling of high performance AMRL designs indicates certain designs have promise to increase thermodynamic efficiency from a FOM of ~0.35 toward ~0.5 to ~0.6. The technical approach was the use of solid magnetic working refrigerants cycled in and out of high magnetic fields to build an efficient active regenerative magnetic refrigeration module providing cooling power for AMRL. A single-stage reciprocating AMRR with a design temperature span from ~290 K to ~120 K was built and tested with dual magnetic regenerators moving in and out of the conductively-cooled superconducting magnet subsystem. The heat transfer fluid (helium) was coupled to the process stream (refrigeration/liquefaction load) via high performance heat exchangers. In order to maximize AMRR efficiency a helium bypass loop with adjustable flow was incorporated in the design because the thermal mass of magnetic refrigerants is higher in low magnetic field than in high magnetic field. Heracles/Prometheus designed experiments to measure AMRR performance under a variety of different operational parameters such as cycle frequency, magnetic field strength, heat transfer fluid flow rate, amount of bypass flow of the heat transfer fluid while measuring work input, temperature span, cooling capability as a function of cold temperature

  8. How Active Are Older Americans?

    Directory of Open Access Journals (Sweden)

    Judy Kruger, PhD

    2007-07-01

    Full Text Available IntroductionRegular physical activity can reduce age-related functional decline, as well people’s risk for chronic diseases such as coronary heart disease, hypertension, colon cancer, and diabetes. The objective of this study was to estimate the level of participation in aerobic, muscle-strengthening, and flexibility activities among Americans aged 50 years or older.MethodsUsing population-based data from the 2001 National Health Interview Survey, we classified qualified respondents (N = 11,969 according to whether they met the activity criteria used in Healthy People 2010 goals for leisure-time participation in regular aerobic physical activity, vigorous-intensity aerobic activity, strength-training activity, and flexibility activity. We also classified respondents according to their level of aerobic activity (i.e., inactive, insufficiently active, and regularly active.ResultsWe estimated that 46.4% of older Americans engaged in no leisure-time aerobic activity; that 26.1% were regularly active (participated in light- to moderate-intensity aerobic activities at least 5 days per week for at least 30 minutes or vigorous-intensity activities at least 3 days per week for at least 20 minutes; that 16.2% participated in vigorous-intensity aerobic activities at least 3 days per week for at least 20 minutes; that 13.7% participated in strength-training activities at least 2 days per week; and that 24.5% participated in flexibility activities at least 1 day per week. Among the 26.1% of older Americans who were regularly active, 30.5% engaged in strengthen-training activities at least 2 days per week. Overall, only 8.2% of older Americans met the criteria for both aerobic and strength-training activity.ConclusionAs of 2001, the percentage of older Americans who met recommended activity levels of physical activity were well below the goals for U.S. adults in Healthy People 2010. Further efforts are needed to encourage older Americans to engage in

  9. SPORTS ACTIVITIES SPONSORSHIP

    Directory of Open Access Journals (Sweden)

    DURBĂCEA - BOLOVAN MARIAN

    2016-12-01

    Full Text Available Sports and economy have discovered each other, hoping to serve common interests. In view of transferring in a more efficient way the information about their products or services to consumers, the business operator finances sports activities for advertising purposes. A company involved in sports sponsorship can instantly transmit the message about its products to millions of potential buyers, thus increasing the market share and hence the profit that it generates. By sponsoring sport it is meant any agreement / convention, under which one party the sponsor makes available to the beneficiary the material resources, financial and / or other benefits in exchange for its association with a sport or sportsman and especially the promise to use this association with sport or sportsman for the purpose of advertising, especially TV advertising. The growing use of athletes as spokespersons for a product is largely due to the ability of athletes to attract public attention and the credibility they enjoy

  10. Respiratory active mitochondrial supercomplexes.

    Science.gov (United States)

    Acín-Pérez, Rebeca; Fernández-Silva, Patricio; Peleato, Maria Luisa; Pérez-Martos, Acisclo; Enriquez, Jose Antonio

    2008-11-21

    The structural organization of the mitochondrial respiratory complexes as four big independently moving entities connected by the mobile carriers CoQ and cytochrome c has been challenged recently. Blue native gel electrophoresis reveals the presence of high-molecular-weight bands containing several respiratory complexes and suggesting an in vivo assembly status of these structures (respirasomes). However, no functional evidence of the activity of supercomplexes as true respirasomes has been provided yet. We have observed that (1) supercomplexes are not formed when one of their component complexes is absent; (2) there is a temporal gap between the formation of the individual complexes and that of the supercomplexes; (3) some putative respirasomes contain CoQ and cytochrome c; (4) isolated respirasomes can transfer electrons from NADH to O(2), that is, they respire. Therefore, we have demonstrated the existence of a functional respirasome and propose a structural organization model that accommodates these findings.

  11. Active Flow Control

    Science.gov (United States)

    FFOWCS WILLIAMS, J. E.

    2001-01-01

    This paper considers the two-dimensional problem of a plane vortex sheet disturbed by an impulsive line source. A previous incorrect treatment of this problem is examined in detail. Instabilities of the vortex sheet are triggered by the source and grow exponentially in space and time. The Green function is constructed for the problem and it is shown that a point source properly positioned and delayed will induce a field that cancels the unstable growing modes. The resulting displacement of the vortex sheet is expressed in simple terms. The instabilities are checked by the anti-source which combines with the field of the primary source into a vortex sheet response which decays with time at large time. This paper is a contribution to the study of active control of shear layer instabilities, the main contribution being to clear up a previous paper with peculiar results that are, in fact, wrong.

  12. The sound of activism.

    Science.gov (United States)

    Sandstrom, B; Vetter, C

    2001-01-01

    ABSTRACT A longtime advocate for female empowerment and equality, Boden Sandstrom has worked for political change in many arenas. In the 1960s, she began a career as a librarian, but soon made activism her full-time job, working for feminist, leftist and socialist causes. In the 1970s, she found a way to turn her lifelong passion for music into a career as a sound engineer. Once established in that profession, she began donating her services to political events, marches, demonstrations, and rallies. After thirteen years of running her own company, called Woman Sound,Inc. (later City Sound Productions,Inc.), she turned to the study of ethnomusicology. She is now Program Manager and Lecturer for the Ethnomusicology Program at the University of Maryland, where she is also working on her doctorate in that subject. She continues to freelance as a sound engineer and serve as a technical producer for major events.

  13. Flipped Classroom, active Learning?

    DEFF Research Database (Denmark)

    Andersen, Thomas Dyreborg; Levinsen, Henrik; Philipps, Morten

    2015-01-01

    Action research is conducted in three physics classes over a period of eighteen weeks with the aim of studying the effect of flipped classroom on the pupils agency and learning processes. The hypothesis is that flipped classroom teaching will potentially allocate more time to work actively...... with the teaching subject compared to more traditional teaching, where introductions and theoretical monologs conducted by the teacher prevail. In addition it is assumed that the pupils learning processes move towards more independency and metacognitive thinking.   During the study period interventions...... didactic workshop with the involved teachers. One of the demands of the didactic design is to include a video embedded in a formative evaluation sheet produced in Google Drive by the teachers themselves. The didactic analysis of the collected audio and video recordings will be presented at the NOFA 5...

  14. Actively stressed marginal networks

    CERN Document Server

    Sheinman, M; MacKintosh, F C

    2012-01-01

    We study the effects of motor-generated stresses in disordered three dimensional fiber networks using a combination of a mean-field, effective medium theory, scaling analysis and a computational model. We find that motor activity controls the elasticity in an anomalous fashion close to the point of marginal stability by coupling to critical network fluctuations. We also show that motor stresses can stabilize initially floppy networks, extending the range of critical behavior to a broad regime of network connectivities below the marginal point. Away from this regime, or at high stress, motors give rise to a linear increase in stiffness with stress. Finally, we demonstrate that our results are captured by a simple, constitutive scaling relation highlighting the important role of non-affine strain fluctuations as a susceptibility to motor stress.

  15. Actively stressed marginal networks.

    Science.gov (United States)

    Sheinman, M; Broedersz, C P; MacKintosh, F C

    2012-12-07

    We study the effects of motor-generated stresses in disordered three-dimensional fiber networks using a combination of a mean-field theory, scaling analysis, and a computational model. We find that motor activity controls the elasticity in an anomalous fashion close to the point of marginal stability by coupling to critical network fluctuations. We also show that motor stresses can stabilize initially floppy networks, extending the range of critical behavior to a broad regime of network connectivities below the marginal point. Away from this regime, or at high stress, motors give rise to a linear increase in stiffness with stress. Finally, we demonstrate that our results are captured by a simple, constitutive scaling relation highlighting the important role of nonaffine strain fluctuations as a susceptibility to motor stress.

  16. [Lymphohistiocytic activation syndrome (LHAS)].

    Science.gov (United States)

    Berrady, R; Bono, W

    2014-01-01

    Lymphohistiocytic activation syndrome (LHAS) is related to inappropriate stimulation of macrophage cells in bone marrow and lymphoid system. LHAS combines the non-specific clinical signs (fever, poor general condition, hepatosplenomegaly, lymphadenopathy) and suggestive biological elements (bi-or pancytopenia, abnormal liver function, coagulopathy, increased LDH, ferritin and triglycerides). The diagnosis of SALH remains an emergency every clinician should discuss before any febrile cytopenia. The etiology of LHAS is still obscure, but recent advances in the genetic study of familial forms provide some essential elements in understanding. Copyright © 2013 Société française d’anesthésie et de réanimation (Sfar). Published by Elsevier SAS. All rights reserved.

  17. Active Ageing: An Analysis

    Directory of Open Access Journals (Sweden)

    Alina-Cristina Nuta

    2011-10-01

    Full Text Available The problem of ageing is a highly topical for Romania and for European Union. In this framework, to create and implement some strategies for active ageing is an important objective. The international and regional forums set (supported by official statistics that the number of older people growing rapidly. Romania needs some programmes (with labour, social, economic, health care aspects to deal with the demographic changes, programs that will reform the existing working life structures and legislation. Despite the actual pension reform, which tries to close the opportunity of early retirement (by penalizing the total pension flows, or increasing the retirement age, etc., the labour system does not sets some important targets for this area.

  18. DPAL activities in Japan

    Science.gov (United States)

    Endo, Masamori; Wani, Fumio

    2015-02-01

    Activities on diode pumped alkali laser (DPAL) in Japan is reviewed. We have started alkali laser works in 2011, and currently, we are the only players in Japan. Our interests are application oriented, and it is not only defense but also industrial. DPAL is a good candidate as a source of remote laser machining, thanks to its scalability and extremely good beam quality. We are studying on scientific and engineering problems of Cs DPAL with a small-scale apparatus. A commercial diode laser with volume Bragg grating outcoupler is used to pump the gain cell longitudinally. A 6.5 W continuous-wave output with optical to optical efficiency of 56% (based on the absorbed power) has been achieved. Numerical simulation codes are developed to understand the physics of DPAL and to help future developments.

  19. Plasminogen activation and cancer

    DEFF Research Database (Denmark)

    Danø, Keld; Behrendt, N.; Hoyer-Hansen, G.

    2005-01-01

    Breakdown of the extracellular matrix is crucial for cancer invasion and metastasis. It is accomplished by the concerted action of several proteases, including the serine protease plasmin and a number of matrix metalloproteases.The activity of each of these proteases is regulated by an array......, the regulation of extracellular proteolysis in cancer involves a complex interplay between cancer cells and non-malignant stromal cells in the expression of the molecular components involved. For some types of cancer, this cellular interplay mimics that observed in the tissue of ori- gin during non......-neoplastic tissue remodelling processes.We propose that cancer invasion can be considered as uncontrolled tissue remodelling. Inhibition of extracellular proteases is an attractive approach to cancer therapy. Because proteases have many different functions in the normal organism, efficient inhibition will have...

  20. Physical activity among adolescents

    DEFF Research Database (Denmark)

    Henriksen, P W; Ingholt, L; Rasmussen, M

    2016-01-01

    The objectives of this study were (a) to examine the association between various kinds of parental social support and adolescents' physical activity (PA) and (b) to examine whether various kinds of social support from mothers and fathers were differently associated with boys' and girls' PA. Data...... during leisure time. We used logistic regression analyses to estimate the associations for girls and boys separately, adjusted by age group, parents' occupational social class, family structure, and migration status. There were significant and graded associations between adolescents' PA and all four...... dimensions of parental support for PA. The association patterns were similar for mothers' and fathers' social support and similar for girls and boys. Social processes in the family are important for adolescents' participation in PA. It is important to continue to explore these social processes in order...

  1. Examining Activism in Practice: A Qualitative Study of Archival Activism

    Science.gov (United States)

    Novak, Joy Rainbow

    2013-01-01

    While archival literature has increasingly discussed activism in the context of archives, there has been little examination of the extent to which archivists in the field have accepted or incorporated archival activism into practice. Scholarship that has explored the practical application of archival activism has predominately focused on case…

  2. Examining Activism in Practice: A Qualitative Study of Archival Activism

    Science.gov (United States)

    Novak, Joy Rainbow

    2013-01-01

    While archival literature has increasingly discussed activism in the context of archives, there has been little examination of the extent to which archivists in the field have accepted or incorporated archival activism into practice. Scholarship that has explored the practical application of archival activism has predominately focused on case…

  3. Youth Physical Activity Resource Use and Activity Measured by Accelerometry

    Science.gov (United States)

    Maslow, Andra L.; Colabianchi, Natalie

    2011-01-01

    Objectives: To examine whether use of physical activity resources (e.g., parks) was associated with daily physical activity measured by accelerometry. Methods: One hundred eleven adolescents completed a travel diary with concurrent accelerometry. The main exposure was self-reported use of a physical activity resource (none /1 resources). The main…

  4. Existing chemicals: international activities.

    Science.gov (United States)

    Purchase, J F

    1989-01-01

    The standards of care used in the protection of the health and safety of people exposed to chemicals has increased dramatically in the last decade. Standards imposed by regulation and those adopted by industry have required a greater level of knowledge about the hazards of chemicals. In the E.E.C., the 6th amendment of the dangerous substances directive imposed the requirement that al new chemicals should be tested according to prescribed programme before introduction on to the market. The development of a European inventory of existing chemicals was an integral part of the 6th amendment. It has now become clear that increased standards of care referred to above must be applied to the chemicals on the inventory list. There is, however, a considerable amount of activity already under way in various international agencies. The OECD Chemicals Programme has been involved in considering the problem of existing chemicals for some time, and is producing a priority list and action programme. The International Programme on Chemical Safety produces international chemical safety cards, health and safety guides and environmental health criteria documents. The international register of potentially toxic compounds (part of UNEP) has prepared chemical data profiles on 990 compounds. The International Agency for Research on Cancer prepared monographs on the carcinogenic risk of chemicals to man. So far 42 volumes have been prepared covering about 900 substances. IARC and IPCS also prepare periodic reports on ongoing research on carcinogenicity or toxicity (respectively) of chemicals. The chemical industry through ECETOC (the European Chemical Industry Ecology and Toxicology Centre) has mounted a major initiative on existing chemicals. Comprehensive reviews of the toxicity of selected chemicals are published (Joint Assessment of Commodity Chemicals). In its technical report no. 30 ECETOC lists reviews and evaluations by major national and international organisations, which provides

  5. Project origami activities for exploring mathematics

    CERN Document Server

    Hull, Thomas

    2012-01-01

    IntroductionActivity 1 Folding Equilateral Triangles in a Square Activity 2 Origami Trigonometry Activity 3 Dividing a Length into Equal Nths: Fujimoto Approximation Activity 4 Dividing a Length into Equal Nths Exactly Activity 5 Origami Helix Activity 6 Folding a Parabola Activity 7 Can Origami Trisect an Angle?Activity 8 Solving Cubic Equations Activity 9 Lill's Method Activity 10 Folding Strips into Knots Activity 11 Haga's ""Origamics"" Activity 12 Modular Star Ring Activity 13 Folding a Butterfly Bomb Activity 14 Molly's Hexahedron Activity 15 Business Card Modulars Activity 16 Five Inter

  6. Consolidated Human Activities Database (CHAD)

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Consolidated Human Activity Database (CHAD) contains data obtained from human activity studies that were collected at city, state, and national levels. CHAD is...

  7. Physical activity extends life expectancy

    Science.gov (United States)

    Leisure-time physical activity is associated with longer life expectancy, even at relatively low levels of activity and regardless of body weight, according to a study by a team of researchers led by the NCI.

  8. Scenarios and activities (Chapter 1)

    CSIR Research Space (South Africa)

    Burns, Mike

    2016-01-01

    Full Text Available The description and quantification of the shale gas-related activities presented in this Chapter informs the assessment of ecological and social risk addressed in other Chapters. For the Exploration Only scenario, activities that will manifest...

  9. Physical activity - preventive medicine (image)

    Science.gov (United States)

    Physical activity contributes to health by reducing the heart rate, decreasing the risk for cardiovascular disease, and reducing ... loss that is associated with age and osteoporosis. Physical activity also helps the body use calories more efficiently, ...

  10. Motivating Kids to Be Active

    Science.gov (United States)

    ... set healthy patterns that will last into adulthood. Benefits of Being Active When kids are active, their ... school sports to after-school interests, such as yoga or skateboarding. It's important to remember that physical ...

  11. Advanced Active Acoustics Lab (AAAL)

    Data.gov (United States)

    Federal Laboratory Consortium — The Advanced Active Acoustics Lab (AAAL) is a state-of-the-art Undersea Warfare (USW) acoustic data analysis facility capable of both active and passive underwater...

  12. Automated activity-aware prompting for activity initiation.

    Science.gov (United States)

    Holder, Lawrence B; Cook, Diane J

    2013-01-01

    Performing daily activities without assistance is important to maintaining an independent functional lifestyle. As a result, automated activity prompting systems can potentially extend the period of time that adults can age in place. In this paper we introduce AP, an algorithm to automate activity prompting based on smart home technology. AP learns prompt rules based on the time when activities are typically performed as well as the relationship between activities that normally occur in a sequence. We evaluate the AP algorithm based on smart home datasets and demonstrate its ability to operate within a physical smart environment.

  13. Physical active rest in education of active personality of students

    Directory of Open Access Journals (Sweden)

    Zaycev V.P.

    2010-10-01

    Full Text Available Meaningfulness of physical recreation is rotined in education of active personality of students. Research material is literary sources on this issue. Factors which influence on an educate function of personality of students are considered. Application of physical recreation is grounded for education of active personality of students. It is marked that physical recreation in pedagogical process decides educate, educational, health and social tasks. It positively influences on education of active personality of students. It is rotined that in education of active personality of students an important role is played by their research activity.

  14. Writing clear animal activity proposals.

    Science.gov (United States)

    Pinson, David M

    2011-06-01

    Although IACUC-related topics are frequently discussed in the literature, there is little published information about how to write animal activity proposals. In this article, the author discusses key considerations in the writing and review of animal activity proposals. The author then describes a framework for developing and writing clear animal activity proposals that highlight animal welfare concerns. Though these recommendations are aimed at individuals writing and reviewing research proposals, the framework can be modified for other types of animal activity proposals.

  15. Danish Labour Market Activation Policies

    DEFF Research Database (Denmark)

    Kvist, Jon; Pedersen, LIsbeth

    2007-01-01

    transformation over the past fifteen years. From the initial curbing of unemployment among the insured unemployed through standard activation offers, the aim today is also to increase labour supply among non-economic active groups using individually tailored programmes. Danish activation policies this embrace...

  16. Assessing and Increasing Physical Activity

    Science.gov (United States)

    Van Camp, Carole M.; Hayes, Lynda B.

    2012-01-01

    Increasing physical activity is a crucial component of any comprehensive approach to combat the growing obesity epidemic. This review summarizes recent behavioral research on the measurement of physical activity and interventions aimed at increasing physical activity and provides directions for future research.

  17. Proteasome Activation by Small Molecules

    NARCIS (Netherlands)

    Leestemaker, Yves; de Jong, Annemieke; Witting, Katharina F; Penning, Renske; Schuurman, Karianne; Rodenko, Boris; Zaal, Esther A|info:eu-repo/dai/nl/371570905; van de Kooij, Bert; Laufer, Stefan; Heck, Albert J R|info:eu-repo/dai/nl/105189332; Borst, Jannie; Scheper, Wiep; Berkers, Celia R|info:eu-repo/dai/nl/329510916; Ovaa, Huib

    2017-01-01

    Drugs that increase 26S proteasome activity have potential therapeutic applications in the treatment of neurodegenerative diseases. A chemical genetics screen of over 2,750 compounds using a proteasome activity probe as a readout in a high-throughput live-cell fluorescence-activated cell

  18. Hospitality Services. Student Activity Book.

    Science.gov (United States)

    Texas Tech Univ., Lubbock. Home Economics Curriculum Center.

    This student activity book contains pencil-and-paper activities for use in a hospitality services course focusing on the food and lodging segments of the hospitality and tourism industry. The activities are organized into 29 chapters on the following topics: hospitality services industry; professional ethics; organization/management structures in…

  19. Activated sludge model No. 3

    DEFF Research Database (Denmark)

    Gujer, W.; Henze, M.; Mino, T.

    1999-01-01

    The Activated Sludge Model No. 3 (ASM3) can predict oxygen consumption, sludge production, nitrification and denitrification of activated sludge systems. It relates to the Activated Sludge Model No. 1 (ASM1) and corrects for some defects of ASM I. In addition to ASM1, ASM3 includes storage...

  20. Antibacterial activity of Pterocarpus indicus.

    Science.gov (United States)

    Khan, M R; Omoloso, A D

    2003-09-01

    The leaves, root and stem barks of Pterocarpus indicus were successively partitioned with petrol, dichloromethane, ethyl acetate, butanol and methanol. All the fractions exhibited a wide spectrum of antibacterial activity. The activity was more pronounced in the butanol and methanol fractions. None were active against the moulds.

  1. Water-Related Teaching Activities.

    Science.gov (United States)

    Coon, Herbert L.; Price, Charles L.

    This publication is designed to provide interested teachers with teaching activities for all grade levels and subject areas that can be used to help students learn about water resources. For each activity, the purpose, level, subject, and concept are given. Activities are organized by grade level. Most of these water related learning activities…

  2. Assessing and Increasing Physical Activity

    Science.gov (United States)

    Van Camp, Carole M.; Hayes, Lynda B.

    2012-01-01

    Increasing physical activity is a crucial component of any comprehensive approach to combat the growing obesity epidemic. This review summarizes recent behavioral research on the measurement of physical activity and interventions aimed at increasing physical activity and provides directions for future research.

  3. Elusive Active Galactic Nuclei

    CERN Document Server

    Maiolino, R; Gilli, R; Nagar, N M; Bianchi, S; Böker, T; Colbert, E; Krabbe, A; Marconi, A; Matt, G; Salvati, M

    2003-01-01

    A fraction of active galactic nuclei do not show the classical Seyfert-type signatures in their optical spectra, i.e. they are optically "elusive". X-ray observations are an optimal tool to identify this class of objects. We combine new Chandra observations with archival X-ray data in order to obtain a first estimate of the fraction of elusive AGN in local galaxies and to constrain their nature. Our results suggest that elusive AGN have a local density comparable to or even higher than optically classified Seyfert nuclei. Most elusive AGN are heavily absorbed in the X-rays, with gas column densities exceeding 10^24 cm^-2, suggesting that their peculiar nature is associated with obscuration. It is likely that in elusive AGN, the nuclear UV source is completely embedded and the ionizing photons cannot escape, which prevents the formation of a classical Narrow Line Region. Elusive AGN may contribute significantly to the 30 keV bump of the X-ray background.

  4. Surface Active Components: Review

    Directory of Open Access Journals (Sweden)

    Z. Shafiei

    2014-03-01

    Full Text Available Biosurfactant or surface active components are produced by many different microorganisms. Biosurfactants are amphiphilic molecules with both hydrophilic and hydrophobic (generally hydrocarbon moieties that partition preferentially a within the interface between fluid phases with some other degrees of polarity and hydrogen bonding including oil/water or air/water interfaces. These properties render surfactants able to reducing surface and interfacial tension and forming microemulsion where hydrocarbons can solubilize in water or where water can solubilize in hydrocarbons, the majority of surfactants have gained importance in the fields of enhanced oil recovery, environmental bioremediation, food processing and pharmaceuticals. However, large-scale production of these molecules has not been realized as a result of low yields in production processes and high recovery and purification costs. This review article represents a classification of biosurfactant in addition to their microbial origin and effect of some nutrition and environmental factor for high production of biosurfactant. The nitrogen, carbon sources and environmental factors can make a difference key to the regulating biosurfactants synthesis Fascination with microbial surfactants have been steadily increasing recently because of advantages over the chemical surfactants for example environmentally friendly nature, lower toxicity, higher biodegradability, higher selectivity and specific gravity at extreme temperature, pH and salinity. For this reason the demand of biosurfactant are increasing day by day.

  5. Active Target Simulation

    Science.gov (United States)

    Smith, Nathan; Draznik, Peter; Frank, Nathan

    2012-10-01

    We have simulated an existing experimental design to determine the resolution improvement upon energy measurements of neutron unbound nuclei. A number of experiments of this type have been performed at the National Superconducting Cyclotron Laboratory (NSCL), located at Michigan State University. An excited nucleus is typically produced with a radioactive beam interacting with a passive Beryllium target. Many different nuclei are produced in experiment, each of which immediately decays into a charged particle and neutron. The charged particles are detected and the neutrons interact in scintillation detectors such as the Modular Neutron Array (MoNA) and Large Multi-Institutional Scintillation Array (LISA). In our simulation, we have constructed an active target that provides additional information such that the point of nuclear interaction within the target may be determined. This information improves the resolution in decay energy measurements of neutron unbound isotopes. This presentation will cover some aspects of the simulation process, as well as showing some of the results that demonstrate the simulated improvement over a passive target.

  6. [Active management of labor].

    Science.gov (United States)

    Ruiz Ortiz, E; Villalobos Román, M; Flores Murrieta, G; Sotomayor Alvarado, L

    1991-01-01

    Eighty three primigravidae patients at the end of latency labor, erased cervix, 3 cm dilation, vertex presentation and adequate pelvis, were studied. Two groups were formed: 53 patients in the study group, who received active management of labor, and 30 patients in the control group, treated in the traditional way. In all the patients a graphic recording of labor, was carried out; it included all the events, and as labor advanced, a signoidal curve of cervical dilatation, was registered, as well as the hyperbolic one for presentation descent. The study group received the method in a systematized manner, as follows: 1. Peridular block. 2. Amniotomy. 3. IV oxytocin one hour after amniotomy. 4. FCR monitoring. 5. Detection of dystocia origin. Materno-fetal morbidity was registered in both groups, as well as cesarean section rate, instrumental delivery and its indications, labor duration, and time of stay in labor room. Diminution of above intems and opportune detection of dystocia, were determined. It was concluded that a constructive action plan, starting at hospital admission in most healthy women, allows a normal delivery of brief duration.

  7. Optically active quantum dots

    Science.gov (United States)

    Gerard, Valerie; Govan, Joseph; Loudon, Alexander; Baranov, Alexander V.; Fedorov, Anatoly V.; Gun'ko, Yurii K.

    2015-10-01

    The main goal of our research is to develop new types of technologically important optically active quantum dot (QD) based materials, study their properties and explore their biological applications. For the first time chiral II-VI QDs have been prepared by us using microwave induced heating with the racemic (Rac), D- and L-enantiomeric forms of penicillamine as stabilisers. Circular dichroism (CD) studies of these QDs have shown that D- and L-penicillamine stabilised particles produced mirror image CD spectra, while the particles prepared with a Rac mixture showed only a weak signal. It was also demonstrated that these QDs show very broad emission bands between 400 and 700 nm due to defects or trap states on the surfaces of the nanocrystals. These QDs have demonstrated highly specific chiral recognition of various biological species including aminoacids. The utilisation of chiral stabilisers also allowed the preparation of new water soluble white emitting CdS nano-tetrapods, which demonstrated circular dichroism in the band-edge region of the spectrum. Biological testing of chiral CdS nanotetrapods displayed a chiral bias for an uptake of the D- penicillamine stabilised nano-tetrapods by cancer cells. It is expected that this research will open new horizons in the chemistry of chiral nanomaterials and their application in nanobiotechnology, medicine and optical chemo- and bio-sensing.

  8. ADASY (Active Daylighting System)

    Science.gov (United States)

    Vázquez-Moliní, Daniel; González-Montes, Mario; Fernández-Balbuena, Antonio Á.; Bernabéu, Eusebio; García-Botella, Ángel; García-Rodríguez, Lucas; Pohl, Wilfried

    2009-08-01

    The main objective of ADASY (Active Daylighting System) work is to design a façade static daylighting system oriented to office applications, mainly. The goal of the project is to save energy by guiding daylight into a building for lighting purpose. With this approach we can reduce the electrical load for artificial lighting, completing it with sustainable energy. The collector of the system is integrated on a vertical façade and its distribution guide is always horizontal inside of the false ceiling. ADASY is designed with a specific patent pending caption system, a modular light-guide and light extractor luminaire system. Special care has been put on the final cost of the system and its building integration purpose. The current ADASY configuration is able to illuminate 40 m2 area with a 300lx-400lx level in the mid time work hours; furthermore it has a good enough spatial uniformity distribution and a controlled glare. The data presented in this study are the result of simulation models and have been confirmed by a physical scaled prototype. ADASY's main advantages over regular illumination systems are: -Low maintenance; it has not mobile pieces and therefore it lasts for a long time and require little attention once installed. - No energy consumption; solar light continue working even if there has been a power outage. - High quality of light: the colour rendering of light is very high - Psychological benefits: People working with daylight get less stress and more comfort, increasing productivity. - Health benefits

  9. Social activity and healthy aging

    DEFF Research Database (Denmark)

    McGue, Matt; Christensen, Kaare

    2007-01-01

    with late-life physical functioning, cognitive functioning, and depression symptomatology using data from 1112 pairs of like-sex twins who participated in the Longitudinal Study of Aging Danish Twins. Consistent with previous research, we found that social activity was significantly correlated with overall...... activity did not predict change in functioning and in monozygotic twin pairs discordant on level of social activity, the more socially active twin was not less susceptible to age decreases in physical and cognitive functioning and increases in depression symptomatology than the less socially active twin...

  10. Perspectives in active liquid crystals.

    Science.gov (United States)

    Majumdar, Apala; Cristina, Marchetti M; Virga, Epifanio G

    2014-11-28

    Active soft matter is a young, growing field, with potential applications to a wide variety of systems. This Theme Issue explores this emerging new field by highlighting active liquid crystals. The collected contributions bridge theory to experiment, mathematical theories of passive and active nematics, spontaneous flows to defect dynamics, microscopic to continuum levels of description, spontaneous activity to biological activation. While the perspectives offered here only span a small part of this rapidly evolving field, we trust that they might provide the interested reader with a taste for this new class of non-equilibrium systems and their rich behaviour.

  11. Global optogenetic activation of inhibitory interneurons during epileptiform activity.

    Science.gov (United States)

    Ledri, Marco; Madsen, Marita Grønning; Nikitidou, Litsa; Kirik, Deniz; Kokaia, Merab

    2014-02-26

    Optogenetic techniques provide powerful tools for bidirectional control of neuronal activity and investigating alterations occurring in excitability disorders, such as epilepsy. In particular, the possibility to specifically activate by light-determined interneuron populations expressing channelrhodopsin-2 provides an unprecedented opportunity of exploring their contribution to physiological and pathological network activity. There are several subclasses of interneurons in cortical areas with different functional connectivity to the principal neurons (e.g., targeting their perisomatic or dendritic compartments). Therefore, one could optogenetically activate specific or a mixed population of interneurons and dissect their selective or concerted inhibitory action on principal cells. We chose to explore a conceptually novel strategy involving simultaneous activation of mixed populations of interneurons by optogenetics and study their impact on ongoing epileptiform activity in mouse acute hippocampal slices. Here we demonstrate that such approach results in a brief initial action potential discharge in CA3 pyramidal neurons, followed by prolonged suppression of ongoing epileptiform activity during light exposure. Such sequence of events was caused by massive light-induced release of GABA from ChR2-expressing interneurons. The inhibition of epileptiform activity was less pronounced if only parvalbumin- or somatostatin-expressing interneurons were activated by light. Our data suggest that global optogenetic activation of mixed interneuron populations is a more effective approach for development of novel therapeutic strategies for epilepsy, but the initial action potential generation in principal neurons needs to be taken in consideration.

  12. In vivo imaging of protease activity by Probody therapeutic activation.

    Science.gov (United States)

    Wong, Kenneth R; Menendez, Elizabeth; Craik, Charles S; Kavanaugh, W Michael; Vasiljeva, Olga

    2016-03-01

    Probody™ therapeutics are recombinant, proteolytically-activated antibody prodrugs, engineered to remain inert until activated locally by tumor-associated proteases. Probody therapeutics exploit the fundamental dysregulation of extracellular protease activity that exists in tumors relative to healthy tissue. Leveraging the ability of a Probody therapeutic to bind its target at the site of disease after proteolytic cleavage, we developed a novel method for profiling protease activity in living animals. Using NIR optical imaging, we demonstrated that a non-labeled anti-EGFR Probody therapeutic can become activated and compete for binding to tumor cells in vivo with a labeled anti-EGFR monoclonal antibody. Furthermore, by inhibiting matriptase activity in vivo with a blocking-matriptase antibody, we show that the ability of the Probody therapeutic to bind EGFR in vivo was dependent on protease activity. These results demonstrate that in vivo imaging of Probody therapeutic activation can be used for screening and characterization of protease activity in living animals, and provide a method that avoids some of the limitations of prior methods. This approach can improve our understanding of the activity of proteases in disease models and help to develop efficient strategies for cancer diagnosis and treatment.

  13. Evaluating Active U: an internet-mediated physical activity program

    Directory of Open Access Journals (Sweden)

    Goodrich David E

    2009-09-01

    Full Text Available Abstract Background Engaging in regular physical activity can be challenging, particularly during the winter months. To promote physical activity at the University of Michigan during the winter months, an eight-week Internet-mediated program (Active U was developed providing participants with an online physical activity log, goal setting, motivational emails, and optional team participation and competition. Methods This study is a program evaluation of Active U. Approximately 47,000 faculty, staff, and graduate students were invited to participate in the online Active U intervention in the winter of 2007. Participants were assigned a physical activity goal and were asked to record each physical activity episode into the activity log for eight weeks. Statistics for program reach, effectiveness, adoption, and implementation were calculated using the Re-Aim framework. Multilevel regression analyses were used to assess the decline in rates of data entry and goal attainment during the program, to assess the likelihood of joining a team by demographic characteristics, to test the association between various predictors and the number of weeks an individual met his or her goal, and to analyze server load. Results Overall, 7,483 individuals registered with the Active U website (≈16% of eligible, and 79% participated in the program by logging valid data at least once. Staff members, older participants, and those with a BMI P Conclusion Internet-mediated physical activity interventions that focus on physical activity logging and goal setting while incorporating team competition may help a significant percentage of the target population maintain their physical activity during the winter months.

  14. Resources Management in Active Networks

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    In an active network, users can insert customized active codes into active nodes to execute. Thus it needs more resources than those required by conventional networks, and these resources must be effectively monitored and managed. Management policies in existing OSs are too complicated to apply to simple active packets. In this paper, we present new resources management policies that are mainly adoped to manage CPU, storage and transmission bandwidth. Namely, we use SPF algorithm to schedule and process active packets, and import an interval queue method to allocate transmission bandwidth, and use feedback mechanism to control congestion. At the same time, we design some experiments on prototype systems with and without resources management policies respectively. The experiments results show that management policies presented by us can effectively manage resources in active nodes and can improve the performance of active networks.

  15. Teaching Movement Activities as Performativity

    DEFF Research Database (Denmark)

    Jensen, Jens-Ole

    2017-01-01

    subjects the teaching style should be characterized by more variation and motivate the pupils. Research has shown that there is a correlation between physical activity and intellectual capital (e.g. educational attainment and academic performance), physical capital (e.g. physical fitness and reduction...... of the risk for diseases and risk factors) and emotional capital (e.g. fun, enjoyment and self-esteem) (Bailey, Hillman, Arent, & Petitpas, 2013). The school reform prescribes that all pupils from grade 1-9 must have at least 45 minutes of movement activities in average every day.Next to the well-known PE-teaching...... the movement activities must be integrated in the academic and creative subjects as active teaching and brain breaks etc. or as organized activities during the extended school day. Movement activities has become a part of all subjects and all teachers’ professional task. Since these movement activities...

  16. Activity cliffs and activity cliff generators based on chemotype-related activity landscapes.

    Science.gov (United States)

    Pérez-Villanueva, Jaime; Méndez-Lucio, Oscar; Soria-Arteche, Olivia; Medina-Franco, José L

    2015-11-01

    Activity cliffs have large impact in drug discovery; therefore, their detection and quantification are of major importance. This work introduces the metric activity cliff enrichment factor and expands the previously reported activity cliff generator concept by adding chemotype information to representations of the activity landscape. To exemplify these concepts, three molecular databases with multiple biological activities were characterized. Compounds in each database were grouped into chemotype classes. Then, pairwise comparisons of structure similarities and activity differences were calculated for each compound and used to construct chemotype-based structure-activity similarity (SAS) maps. Different landscape distributions among four major regions of the SAS maps were observed for different subsets of molecules grouped in chemotypes. Based on this observation, the activity cliff enrichment factor was calculated to numerically detect chemotypes enriched in activity cliffs. Several chemotype classes were detected having major proportion of activity cliffs than the entire database. In addition, some chemotype classes comprising compounds with smooth structure activity relationships (SAR) were detected. Finally, the activity cliff generator concept was applied to compounds grouped in chemotypes to extract valuable SAR information.

  17. Atmospheric neutrino data Active-Active x Active-Sterile oscillations

    CERN Document Server

    Peres, O L G

    1998-01-01

    I summarize here the results of a global fit to the full data set corresponding to 33.0 kt-yr of data of the Super-Kamiokande experiment as well as to all other experiments in order to compare the active-active and active-sterile neutrinos oscillation channels to the atmospheric neutrino anomaly.

  18. Active Beam Spectroscopy

    Science.gov (United States)

    von Hellermann, M. G.; Delabie, E.; Jaspers, R. J. E.; Biel, W.; Marchuk, O.; Summers, H. P.; Whiteford, A.; Giroud, C.; Hawkes, N. C.; Zastrow, K. D.

    2008-03-01

    Charge eXchange Recombination Spectroscopy (CXRS) plays a pivotal role in the diagnostics of hot fusion plasmas and is implemented currently in most of the operating devices. In the present report the main features of CXRS are summarized and supporting software packages encompassing "Spectral Analysis Code CXSFIT", "Charge Exchange Analysis Package CHEAP", and finally "Forward Prediction of Spectral Features" are described. Beam Emission Spectroscopy (BES) is proposed as indispensable cross-calibration tool for absolute local impurity density measurements and also for the continuous monitoring of the neutral beam power deposition profile. Finally, a full exploitation of the `Motional Stark Effect' pattern is proposed to deduce local pitch angles, total magnetic fields and possibly radial electric fields. For the proposed active beam spectroscopy diagnostic on ITER comprehensive performance studies have been carried out. Estimates of expected spectral signal-to-noise ratios are based on atomic modelling of neutral beam stopping and emissivities for CXRS, BES and background continuum radiation as well as extrapolations from present CXRS diagnostic systems on JET, Tore Supra, TEXTOR and ASDEX-UG. Supplementary to thermal features a further promising application of CXRS has been proposed recently for ITER, that is a study of slowing-down alpha particles in the energy range up to 2 MeV making use of the 100 keV/amu DNB (Diagnostic Neutral Beam) and the 500 keV/amu HNB (Heating Neutral Beam). Synthetic Fast Ion Slowing-Down spectra are evaluated in terms of source rates and slowing-down parameters

  19. Genotoxic activity of praziquantel.

    Science.gov (United States)

    Montero, R; Ostrosky, P

    1997-12-01

    Praziquantel is a synthetic drug with a remarkable activity against parasites, particularly treamatodes and cestodes. Initial genotoxicity tests used a spectrum of endpoints including tests in bacteria, yeasts, mammalian cells and Drosophila and each one gave negative results. Effects on reproductive cells of mice were negative as well. However, host mediated studies in mice and humans were contradictory and a comutagenic effect with several mutagens and carcinogens was found. Later studies, including monitoring in humans and pigs have shown that Praziquantel induces a greater frequency of hyperploid lymphocytes as well as structural chromosomal aberrations, but not in all the individuals treated. In vitro studies have demonstrated that Praziquantel can induce micronuclei in syrian hamster embryonic (SHE) cells and in lymphocytes of some individuals. The same was found about structural chromosomal aberrations. Fetal death and fetal resorption were found when Praziquantel was administered in high doses to pregnant rats between the 6th and 10th day of gestation. Due to its efficiency as a parasiticide, Praziquantel is in use in Latin-American, Asiatic, African and East-European countries where infections by trematodes and cestodes are frequent. However, the extensive use of Praziquantel in multiple reinfections, in non-infected and non-diagnosed individuals for prevention, in higher doses or repeated doses for cysticercosis treatment and in individuals exposed to environmental mutagens, in conjunction with new findings about its metabolism and genotoxic properties, make it necessary to further evaluate the potential of this drug not only to be mutagenic per se, but to contribute in the development of neoplasm.

  20. Strategy as active waiting.

    Science.gov (United States)

    Sull, Donald N

    2005-09-01

    Successful executives who cut their teeth in stable industries or in developed countries often stumble when they face more volatile markets. They falter, in part, because they assume they can gaze deep into the future and develop a long-term strategy that will confer a sustainable competitive advantage. But visibility into the future of volatile markets is sharply limited because so many different variables are in play. Factors such as technological innovation, customers' evolving needs, government policy, and changes in the capital markets interact with one another to create unexpected outcomes. Over the past six years, Donald Sull, an associate professor at London Business School, has led a research project examining some of the world's most volatile markets, from national markets like China and Brazil to industries like enterprise software, telecommunications, and airlines. One of the most striking findings from this research is the importance of taking action during comparative lulls in the storm. Huge business opportunities are relatively rare; they come along only once or twice in a decade. And, for the most part, companies can't manufacture those opportunities; changes in the external environment converge to make them happen. What managers can do is prepare for these golden opportunities by managing smart during the comparative calm of business as usual. During these periods of active waiting, leaders must probe the future and remain alert to anomalies that signal potential threats or opportunities; exercise restraint to preserve their war chests; and maintain discipline to keep the troops battle ready. When a golden opportunity or"sudden death"threat emerges, managers must have the courage to declare the main effort and concentrate resources to seize the moment.

  1. UV activity indicators

    Science.gov (United States)

    Buccino, A. P.; Mauas, P. J. D.

    In Order to continue the work displayed in Buccino & Mauas(2003) and Buccino (2003), we have calculated the index Mg II (Xhk) on 1640 high resolution IUE spectra of 269 main sequence stars of spectral classes F, G and K. From this set of observations, we found an exponential relation between the continuum UV flux and the color (B-V). Contrary to Schrijver et al (1989), who assumed that the continuum UV flux depended on the color following the relation found by Rutten (1984) for the visible one, i.e. the logarithm of the flux is proportional to a polynomial of third order with the color. Nevertheless, the exponential relation flux in the continuous UV and the color (B-V) fits far better to our data that the given one by Rutten (1984). Obtained this dependency for the ultraviolet continuum flux, the index Xhk can be obtained from the single flux in the lines core, allowing to calculate the index of Mg II for those spectra where the continuum is very dark and so the relation signal noise is very low. As it were already reported in previous works (Rutten (1991), Schrijver (1992)), we found a minimum basal flux in the Mg II h and k lines core due to the cromospheric heating by disipation of acustics waves. From this minimum flux, we calculated minimum index of activity that satisfactorily fits to the minimum values of the indexes calculated on the 1640 spectra like quotient between the flux in the line core and the continuous one.

  2. Fluidization and Active Thinning by Molecular Kinetics in Active Gels.

    Science.gov (United States)

    Oriola, David; Alert, Ricard; Casademunt, Jaume

    2017-02-24

    We derive the constitutive equations of an active polar gel from a model for the dynamics of elastic molecules that link polar elements. Molecular binding kinetics induces the fluidization of the material, giving rise to Maxwell viscoelasticity and, provided that detailed balance is broken, to the generation of active stresses. We give explicit expressions for the transport coefficients of active gels in terms of molecular properties, including nonlinear contributions on the departure from equilibrium. In particular, when activity favors linker unbinding, we predict a decrease of viscosity with activity-active thinning-of kinetic origin, which could explain some experimental results on the cell cortex. By bridging the molecular and hydrodynamic scales, our results could help understand the interplay between molecular perturbations and the mechanics of cells and tissues.

  3. IDENTIFICATION AND ECOPHYSIOLOGY OF ACTIVE DENITRIFIERS IN ACTIVATED SLUDGE

    DEFF Research Database (Denmark)

    Hansen, Aviaja Anna; Le-Quy, Vang; Nielsen, Kåre Lehmann;

    and when external carbon sources were supplemented to the activated sludge the composition of the denitrifying communities was significantly affected. Transcriptome profiling provided detailed insight in the metabolic pathways in several of the active denitrifiers in activated sludge. In conclusion...... reactor studies. To obtain better identification of active denitrifying communities in full-scale wastewater treatment plants (WWTPs) we applied DNA-SIP with 13C-labelled substrates, and RT-PCR of expressed denitrification genes (nirS, nirK and nosZ) upon various substrate-inductions. To come around...... were determined with quantitative FISH, while their active metabolic pathways were investigated directly in activated sludge with a tag-based metatranscriptomic approach under acetate-utilizing and denitrifying conditions. The different methods revealed a majority of denitrifiers in all WWTPs belonging...

  4. Activity is strength: More active systems are stronger glass formers

    CERN Document Server

    Nandi, Saroj Kumar

    2016-01-01

    Interplay between activity and passive transport processes in an active system may lead to complex spatio-temporal dynamics offering a rich and fascinating phenomenology compared to their passive counterparts. Understanding the properties of an active system in the dense limit is important both from biological as well as physical point of view. Here, we extend an immensely successful microscopic theory for the glassy dynamics of passive systems in their dense low-temperature limit, namely the Random First-Order Transition (RFOT) theory, for an active system generalizing and unifying the findings of recent simulations on such systems. The qualitative picture of glassy dynamics for a passive system survives when activity is introduced, however, a number interesting properties emerge. For example, activity changes the typical length scale and relaxation times, pushes the thermodynamic and dynamic glass transition points towards higher density or lower temperature and the fragility of the system changes as a func...

  5. Gamma band activity in the reticular activating system (RAS

    Directory of Open Access Journals (Sweden)

    Francisco J Urbano

    2012-01-01

    Full Text Available This review considers recent evidence showing that cells in three regions of the reticular activating system (RAS exhibit gamma band activity, and describes the mechanisms behind such manifestation. Specifically, we discuss how cells in the mesopontine pedunculopontine nucleus (PPN, intralaminar parafascicular nucleus (Pf, and pontine Subcoeruleus nucleus dorsalis (SubCD all fire in the beta/gamma band range when maximally activated, but no higher. The mechanisms behind this ceiling effect have been recently elucidated. We describe recent findings showing that every cell in the PPN have high threshold, voltage-dependent P/Q-type calcium channels that are essential, while N-type calcium channels are permissive, to gamma band activity. Every cell in the Pf also showed that P/Q-type and N-type calcium channels are responsible for this activity. On the other hand, every SubCD cell exhibited sodium-dependent subthreshold oscillations. A novel mechanism for sleep-wake control based on well-known transmitter interactions, electrical coupling, and gamma band activity is described. The data presented here on inherent gamma band activity demonstrates the global nature of sleep-wake oscillation that is orchestrated by brainstem-thalamic mechanism, and questions the undue importance given to the hypothalamus for regulation of sleep-wakefulness. The discovery of gamma band activity in the RAS follows recent reports of such activity in other subcortical regions like the hippocampus and cerebellum. We hypothesize that, rather than participating in the temporal binding of sensory events as seen in the cortex, gamma band activity manifested in the RAS may help stabilize coherence related to arousal, providing a stable activation state during waking and paradoxical sleep. Most of our thoughts and actions are driven by preconscious processes. We speculate that continuous sensory input will induce gamma band activity in the RAS that could participate in the

  6. Being active when you have heart disease

    Science.gov (United States)

    Heart disease - activity; CAD - activity; Coronary artery disease - activity; Angina - activity ... Getting regular exercise when you have heart disease is ... It may also help you be more active without chest pain or other ...

  7. Production and characterization of granular activated carbon from activated sludge

    Directory of Open Access Journals (Sweden)

    Z. Al-Qodah

    2009-03-01

    Full Text Available In this study, activated sludge was used as a precursor to prepare activated carbon using sulfuric acid as a chemical activation agent. The effect of preparation conditions on the produced activated carbon characteristics as an adsorbent was investigated. The results indicate that the produced activated carbon has a highly porous structure and a specific surface area of 580 m²/g. The FT-IR analysis depicts the presence of a variety of functional groups which explain its improved adsorption behavior against pesticides. The XRD analysis reveals that the produced activated carbon has low content of inorganic constituents compared with the precursor. The adsorption isotherm data were fitted to three adsorption isotherm models and found to closely fit the BET model with R² equal 0.948 at pH 3, indicating a multilayer of pesticide adsorption. The maximum loading capacity of the produced activated carbon was 110 mg pesticides/g adsorbent and was obtained at this pH value. This maximum loading was found experimentally to steeply decrease as the solution pH increases. The obtained results show that activated sludge is a promising low cost precursor for the production of activated carbon.

  8. Activated coconut shell charcoal carbon using chemical-physical activation

    Science.gov (United States)

    Budi, Esmar; Umiatin, Nasbey, Hadi; Bintoro, Ridho Akbar; Wulandari, Futri; Erlina

    2016-02-01

    The use of activated carbon from natural material such as coconut shell charcoal as metal absorbance of the wastewater is a new trend. The activation of coconut shell charcoal carbon by using chemical-physical activation has been investigated. Coconut shell was pyrolized in kiln at temperature about 75 - 150 °C for about 6 hours in producing charcoal. The charcoal as the sample was shieved into milimeter sized granule particle and chemically activated by immersing in various concentration of HCl, H3PO4, KOH and NaOH solutions. The samples then was physically activated using horizontal furnace at 400°C for 1 hours in argon gas environment with flow rate of 200 kg/m3. The surface morphology and carbon content of activated carbon were characterized by using SEM/EDS. The result shows that the pores of activated carbon are openned wider as the chemical activator concentration is increased due to an excessive chemical attack. However, the pores tend to be closed as further increasing in chemical activator concentration due to carbon collapsing.

  9. Negotiating active ageing at a Danish activity centre

    DEFF Research Database (Denmark)

    Lassen, Aske Juul

    and practices active ageing. The paper uses an activity centre in Copenhagen as its site of negotiation. Methods: These questions have been explored with the use of ethnographic fieldwork and through a documentary study. The ethnographic fieldwork has been conducted at an activity centre with 4 months...... of participatory observation in 2011 and 2012, as well as 11 semi-structured, in-depth interviews with users of the centre. 4 of these users have been followed around during everyday activities such as doing groceries, picking up grandchildren, etc. The documentary study consists of documents and statements...

  10. Silicon active photonic devices

    Science.gov (United States)

    Dimitropoulos, Dimitrios

    Active photonic devices utilizing the optical nonlinearities of silicon have emerged in the last 5 years and the effort for commercial photonic devices in the material that has been the workhorse of electronics has been building up since. This dissertation presents the theory for some of these devices. We are concerned herein with CW lasers, amplifiers and wavelength converters that are based on the Raman effect. There have already been cursory experimental demonstrations of these devices and some of their limitations are already apparent. Most of the limitations observed are because of the appearance of effects that are competing with stimulated Raman scattering. Under the high optical powers that are necessary for the Raman effect (tens to hundrends of mW's) the process of optical two-photon (TPA) absorption occurs. The absorption of optical power that it causes itself is weak but in the process electrons and holes are generated which can further absorb light through the free-carrier absorption effect (FCA). The effective "lifetime" that these carriers have determines the magnitude of the FCA loss. We present a model for the carrier lifetime in Silicon-On-Insulator (SOI) waveguides and numerical simulations to understand how this critical parameter varies and how it can be controlled. A p-i-n junction built along SOI waveguides can help achieve lifetime of the order of 20--100 ps but the price one has to pay is on-chip electrical power consumption on the order of 100's of mWs. We model CW Raman lasers and we find that the carrier lifetime reduces the output power. If the carrier lifetime exceeds a certain "critical" value optical losses become overwhelming and lasing is impossible. As we show, in amplifiers, the nonlinear loss does not only result in diminished gain, but also in a higher noise figure. Finally the effect of Coherent anti-Stokes Raman scattering (CARS) is examined. The effect is important because with a pump frequency at 1434nm coherent power

  11. Permanent active longitudes and activity cycles on RS CVn stars

    Science.gov (United States)

    Berdyugina, Svetlana V.; Tuominen, Ilkka

    1998-08-01

    A new analysis of the published long-term photometric observations has revealed permanent active-longitude structures in four RS CVn stars: EI Eri, II Peg, sigma Gem, and HR 7275. Two active longitudes separated by half of the period are found to dominate on the surface during all available seasons. The positions of the longitudes on three stars (EI Eri, II Peg, HR 7275) are migrating in the orbital reference frame, and there is no preferred orientation with respect to the line of centres in the binaries. The rate of migration is approximately constant. In case of sigma Gem the active longitude migration is synchronized with the orbital motion in the direction of the line of centres in the binary. The active region lifetimes can be longer than the time span of the observations (>=15 yr). The periods of the active longitude rotation are determined: for EI Eri 1fd 9510, for II Peg 6fd 7066, for sigma Gem 19fd 604, for HR 7275 28fd 263. Long-term activity cycles of the stars are discovered from the analysis of the relative contribution of the two longitudes to the photometric variability. One longitude is found to be usually more active than the other at a given moment, and the change of the activity level between the longitudes is cyclic with periods of years. The switch of the activity takes a much shorter time, about a few months, similar to the ``flip-flop'' phenomenon found for FK Com stars. Moments of switching are regarded as new tracers of the activity, and total cycles, which return activity to the same longitude, are found to be for EI Eri 9.0 yr, for II Peg 9.3 yr, for sigma Gem 14.9 yr, for HR 7275 17.5 yr.

  12. Tyrosine phosphorylation of NEDD4 activates its ubiquitin ligase activity.

    Science.gov (United States)

    Persaud, Avinash; Alberts, Philipp; Mari, Sara; Tong, Jiefei; Murchie, Ryan; Maspero, Elena; Safi, Frozan; Moran, Michael F; Polo, Simona; Rotin, Daniela

    2014-10-07

    Ligand binding to the receptor tyrosine kinase fibroblast growth factor (FGF) receptor 1 (FGFR1) causes dimerization and activation by transphosphorylation of tyrosine residues in the kinase domain. FGFR1 is ubiquitylated by the E3 ligase NEDD4 (also known as NEDD4-1), which promotes FGFR1 internalization and degradation. Although phosphorylation of FGFR1 is required for NEDD4-dependent endocytosis, NEDD4 directly binds to a nonphosphorylated region of FGFR1. We found that activation of FGFR1 led to activation of c-Src kinase-dependent tyrosine phosphorylation of NEDD4, enhancing the ubiquitin ligase activity of NEDD4. Using mass spectrometry, we identified several FGF-dependent phosphorylated tyrosines in NEDD4, including Tyr(43) in the C2 domain and Tyr(585) in the HECT domain. Mutating these tyrosines to phenylalanine to prevent phosphorylation inhibited FGF-dependent NEDD4 activity and FGFR1 endocytosis and enhanced cell proliferation. Mutating the tyrosines to glutamic acid to mimic phosphorylation enhanced NEDD4 activity. Moreover, the NEDD4 C2 domain bound the HECT domain, and the presence of phosphomimetic mutations inhibited this interaction, suggesting that phosphorylation of NEDD4 relieves an inhibitory intra- or intermolecular interaction. Accordingly, activation of FGFR1 was not required for activation of NEDD4 that lacked its C2 domain. Activation of c-Src by epidermal growth factor (EGF) also promoted tyrosine phosphorylation and enhanced the activity of NEDD4. Thus, we identified a feedback mechanism by which receptor tyrosine kinases promote catalytic activation of NEDD4 and that may represent a mechanism of receptor crosstalk.

  13. Prescribing physical activity through primary care: does activity intensity matter?

    Science.gov (United States)

    Knight, Emily; Stuckey, Melanie I; Petrella, Robert J

    2014-09-01

    Physical activity guidelines recommend engaging in moderate- and vigorous-intensity physical activity to elicit health benefits. Similarly, these higher intensity ranges for activity are typically targeted in healthy living interventions (ie, exercise prescription). Comparatively less attention has been focused on changing lower intensity physical activity (ie, sedentary activity) behaviors. The purpose of this study was to explore the effects of prescribing changes to physical activity of various intensities (ie, sedentary through exercise) through the primary care setting. Sixty older adults (aged 55-75 years; mean age 63 = 5 years) volunteered to participate, and were randomly assigned to 4 groups: 3 receiving an activity prescription intervention targeting a specific intensity of physical activity (exercise, sedentary, or both), and 1 control group. During the 12-week intervention period participants followed personalized activity programs at home. Basic clinical measures (anthropometrics, blood pressure, aerobic fitness) and blood panel for assessing cardiometabolic risk (glucose, lipid profile) were conducted at baseline (week 0) and follow-up (week 12) in a primary care office. There were no differences between groups at baseline (P > 0.05). The intervention changed clinical (F₅,₅₀ = 20.458, P = 0.000, ηP² = 0.672) and blood panel measures (F₅,₅₀ = 4.576, P = 0.002, ηP² = 0.314) of cardiometabolic health. Post hoc analyses indicted no differences between groups (P > 0.05). Physical activity prescription of various intensities through the primary care setting improved cardiometabolic health status. To our knowledge, this is the first report of sedentary behavior prescription (alone, or combined with exercise) in primary care. The findings support the ongoing practice of fitness assessment and physical activity prescription for chronic disease management and prevention.

  14. Enhanced NIF neutron activation diagnostics.

    Science.gov (United States)

    Yeamans, C B; Bleuel, D L; Bernstein, L A

    2012-10-01

    The NIF neutron activation diagnostic suite relies on removable activation samples, leading to operational inefficiencies and a fundamental lower limit on the half-life of the activated product that can be observed. A neutron diagnostic system measuring activation of permanently installed samples could remove these limitations and significantly enhance overall neutron diagnostic capabilities. The physics and engineering aspects of two proposed systems are considered: one measuring the (89)Zr/(89 m)Zr isomer ratio in the existing Zr activation medium and the other using potassium zirconate as the activation medium. Both proposed systems could improve the signal-to-noise ratio of the current system by at least a factor of 5 and would allow independent measurement of fusion core velocity and fuel areal density.

  15. CDPK Activation in PRR Signaling.

    Science.gov (United States)

    Seybold, Heike; Boudsocq, Marie; Romeis, Tina

    2017-01-01

    Calcium-dependent protein kinases undergo a rapid biochemical activation in response to an intracellular Ca increase induced by the PRR-dependent perception of a pathogen-related stimulus. Based on SDS gel resolution, the in-gel kinase assay allows the analysis of multiple in vivo protein samples in parallel, combining the advantage of protein separation according to molecular mass with the activity read-out of a protein kinase assay. It thus enables to follow the transient CDPK activation and inactivation in response to in vivo elicitation with a time-wise resolution. In addition, changes of CDPK phosphorylation activity often correlate with slight shifts in the enzyme's apparent molecular mass, indicating posttranslational modifications and a conformational change of the active enzyme compared to its inactive resting form. These band shifts can be detected by a simple immunoblotting to monitor CDPK activation.

  16. Catalytic activity of Au nanoparticles

    DEFF Research Database (Denmark)

    Larsen, Britt Hvolbæk; Janssens, Ton V.W.; Clausen, Bjerne

    2007-01-01

    Au is usually viewed as an inert metal, but surprisingly it has been found that Au nanoparticles less than 3–5 nm in diameter are catalytically active for several chemical reactions. We discuss the origin of this effect, focusing on the way in which the chemical activity of Au may change with par......Au is usually viewed as an inert metal, but surprisingly it has been found that Au nanoparticles less than 3–5 nm in diameter are catalytically active for several chemical reactions. We discuss the origin of this effect, focusing on the way in which the chemical activity of Au may change...... with particle size. We find that the fraction of low-coordinated Au atoms scales approximately with the catalytic activity, suggesting that atoms on the corners and edges of Au nanoparticles are the active sites. This effect is explained using density functional calculations....

  17. Laser treatments of active acne.

    Science.gov (United States)

    Wiznia, Lauren E; Stevenson, Mary L; Nagler, Arielle R

    2017-08-04

    The utility of laser therapy is increasingly being recognized in the treatment of active acne vulgaris. We aimed to perform a narrative review of the medical literature on the use of laser therapy for the treatment of active acne vulgaris. We performed a PubMed literature search on September 1, 2016 using the search terms "active acne," "acne," "laser therapy," and "laser surgery." Case reports, case series, cohort, and controlled trials were included. Studies of lasers in the treatment of acne, including erbium glass, Nd:YAG, pulse dye laser (PDL), potassium titanyl phosphate (KTP) laser, and laser-based photodynamic therapy, have been published. While treatment of active acne with lasers has been successful, many studies are limited by small patient number and lack of control populations and comparison to standard therapies for active acne. Laser therapies are increasingly becoming part of or an adjunct to the medical treatment of active acne and are a useful treatment modality.

  18. Swim pressure of active matter

    Science.gov (United States)

    Takatori, Sho; Yan, Wen; Brady, John; Caltech Team

    2014-11-01

    Through their self-motion, all active matter systems generate a unique ``swim pressure'' that is entirely athermal in origin. This new source for the active stress exists at all scales in both living and nonliving active systems, and also applies to larger organisms where inertia is important (i.e., the Stokes number is not small). Here we explain the origin of the swim stress and develop a simple thermodynamic model to study the self-assembly and phase separation in active soft matter. Our new swim stress perspective can help analyze and exploit a wide class of active soft matter, from swimming bacteria and catalytic nanobots, schools of fish and birds, and molecular motors that activate the cellular cytoskeleton.

  19. Activated sludge inhibition capacity index

    Directory of Open Access Journals (Sweden)

    V. Surerus

    2014-06-01

    Full Text Available Toxic compounds in sewage or industrial wastewater may inhibit the biological activity of activated sludge impairing the treatment process. This paper evaluates the Inhibition Capacity Index (ICI for the assessment of activated sludge in the presence of toxicants. In this study, activated sludge was obtained from industrial treatment plants and was also synthetically produced. Continuous respirometric measurements were carried out in a reactor, and the oxygen uptake rate profile obtained was used to evaluate the impact of inhibiting toxicants, such as dissolved copper, phenol, sodium alkylbenzene sulfonate and amoxicillin, on activated sludge. The results indicate that ICI is an efficient tool to quantify the intoxication capacity. The activated sludge from the pharmaceutical industry showed higher resistance than the sludge from other sources, since toxicants are widely discharged in the biological treatment system. The ICI range was from 58 to 81% when compared to the synthetic effluent with no toxic substances.

  20. Biological Activities of Hydrazone Derivatives

    Directory of Open Access Journals (Sweden)

    S. Güniz Küçükgüzel

    2007-08-01

    Full Text Available There has been considerable interest in the development of novel compounds with anticonvulsant, antidepressant, analgesic, antiinflammatory, antiplatelet, antimalarial, antimicrobial, antimycobacterial, antitumoral, vasodilator, antiviral and antischistosomiasis activities. Hydrazones possessing an azometine -NHN=CH- proton constitute an important class of compounds for new drug development. Therefore, many researchers have synthesized these compounds as target structures and evaluated their biological activities. These observations have been guiding for the development of new hydrazones that possess varied biological activities.

  1. Architectural Design Activities for JAS

    CERN Document Server

    Khaled, Lena

    2009-01-01

    The critical part for building any software system is its architecture. Architectural design is a design at a higher level of abstraction. A good architecture ensures that software will satisfy its requirement. This paper defines the most important activities of architectural design that used through building any software; also it applies these activities on one type of Electronic Commerce (EC) applications that is Job Agency System(JAS) to show how these activities can work through these types of applications.

  2. Japanese activities in refrigeration technology

    Science.gov (United States)

    Fujita, T.; Ohtsuka, T.; Ishizaki, Y.

    This paper reviews recent activities in refrigeration technology in Japan. The projects described are stimulated by growing industrial needs or form part of large national projects. The JNR project on the MAGLEV train is currently the most powerful activity and it demands knowledge in all the different disciplines of cryogenics in particular on various scales of refrigeration. Research activities are also directed towards the development of Stirling cycle and magnetic refrigerators for applications in a wider area.

  3. Activity Recognition in Social Media

    Science.gov (United States)

    2015-12-29

    activity is splitting. 6 Crowd video classification Ability to identify crowd behavior enables crowd management systems to design and manage public...characterize group activities . We then showed the effectiveness of group level features in crowd video classification . 9 List of Publications 1. N. Bhargava, S...AFRL-AFOSR-JP-TR-2016-0044 Activity Recognition in Social Media Subhasis Chaudhuri INDIAN INSTITUTE OF TECHNOLOGY BOMBAY Final Report 05/09/2016

  4. Activating Teaching for Quality Learning

    DEFF Research Database (Denmark)

    Zhurbenko, Vitaliy

    2013-01-01

    Activating teaching is an educational concept which is based on active participation of students in the study process. It is becoming an alternative to more typical approach where the teacher will just lecture and the students will take notes. The study described in this paper considers student...... activating teaching methods focusing on those based on knowledge dissemination. The practical aspects of the implemented teaching method are considered, and employed assessment methods and tools are discussed....

  5. Spanish Young Generation (JJNN) Activities

    Energy Technology Data Exchange (ETDEWEB)

    Millan, Miguel [INITEC Nuclear- Westinghouse, Padilla 17, 28006 Madrid (Spain)

    2008-07-01

    Spanish Young Generation has been very active during 2006-2008. JJNN have mainly focused on communication activities, as conferences at universities, schools and nuclear companies. Lately, becoming in referent of the young politics, journalist and the young people in Nuclear Subjects is the new and most challenging target of the Spanish Young Generation. In order to accomplish with their objects and commitments with their members, JJNN are developing all kinds of activities focused in the young people and the JJNN members. (authors)

  6. INNOVATIONS AND TOURISTIC ACTIVITY EVOLUTION

    Directory of Open Access Journals (Sweden)

    V. S. Novikov

    2012-01-01

    Full Text Available Fundamental and applied innovations impact activities in the tourist industry and evolution thereof. More and more sophisticated technologies and communication techniques are practically used to serve tourists. Basically, innovative tourist activity development concept represents innovation of values and in particular means that tourist’s impression is taken into account to higher extent and tourist product personification changes the products’ consumer value. Discussed in the article are tourist activity, tourist cluster, destination and glocalization development prospects.

  7. L3 Study Team Activities

    Science.gov (United States)

    Shoemaker, David; L3ST Team

    2017-01-01

    The NASA-Chartered L3 Study Team is working to develop the US community participation and to support NASA's contribution to the ESA-led LISA mission to observe gravitational waves via space-based detectors. The present activities of the L3ST will be described, and the next steps for the Study Team will also be given. NASA supports travel activities and support for the Study Team activities.

  8. Transplantation activities in Iran.

    Science.gov (United States)

    Broumand, Behrooz

    2005-06-01

    Iran is a tropical country with a land area of 1,648,000 square kilometers and a population of 68,100,000. Iran has a recorded history that dates back 2553 years. Its earliest medical school was Pasargad. Jondi Chapour University was founded 1753 years ago during the Sassanid dynasty as a center for higher education in medicine, philosophy, and pharmacology. Indeed, the idea of xenotransplantation dates back to days of Achaemenidae (Achaemenian dynasty), as evidenced by engravings of many mythologic chimeras still present in Persepolis. Avicenna (980-1037 AD), the great Iranian physician, performed the first nerve repair. Transplantation progress in Iran follows roughly the same pattern as that of the rest of the world, with some 10-20 years' delay. Modern organ transplantation dates back to 1935, when the first cornea transplant was performed at Farabi Hospital in Tehran, Iran. The first living-related kidney transplantation performed at Shiraz University Hospital dates back to 1968. The first bone marrow transplant was performed at Dr. Shariaati's Hospital in Tehran. The first heart transplant was performed 1993 in Tabriz, Iran. The first liver transplant was performed in 1993 in Shiraz. The first lung transplant was performed in 2001, and the first heart and lung transplants were performed in 2002, both at Tehran. In late 1985, the renal transplantation program was officially started in a major university hospital in Tehran and was poised to carry out 2 to 4 transplantations each week. Soon, another large center initiated a similar program. Both of these centers accepted surgical, medical, and nursing teams from other academic medical centers for training in kidney transplantation. Since 2002, Iran has grown to include 23 active renal, 68 cornea, 2 liver, 4 heart, 2 lung, and 2 bone marrow transplantation centers in different cities. In June 2000, the Organ Transplantation Brain Death Act was approved by the Parliament, followed by the establishment of the

  9. Physical activity and human health

    Directory of Open Access Journals (Sweden)

    Paulina Wojciechowska

    2015-01-01

    Full Text Available Introduction: The dynamic development of the automotive industry, transport, and the media means that human life has become much easier. At the same time, the comfortable living conditions have decreased physical activity. Biologically conditioned, the need of activity has been minimised by the ever-increasing pace of life. As a result, it may lead to the loss of physical and mental health. Active recreation is not only an excellent source of activity, but also a source of satisfaction. Youths and adults should therefore spend their free time primarily on various forms of physical activity. Aim of the research : To evaluate the physical fitness of students who regularly practice physical exercise, those who occasionally practice, and those not practicing any form of physical activity. Material and methods : In the research we used a questionnaire of the Ruffier test and an orthostatic test. The study involved a group of 15 people aged 20–25 years. Participation in the study was entirely voluntary and anonymous. The study group consisted only of women. Results obtained from the questionnaire survey were fully reflected during exercise tests performed. Results and conclusions: Only regularly practiced physical activity has an effect on our body. Regular exercise increases our body’s physical capacity. Activity is the best means of prevention of lifestyle diseases. Youths and adults should spend their free time mainly doing various forms of physical activity.

  10. Active Gas Regenerative Liquefier Project

    Data.gov (United States)

    National Aeronautics and Space Administration — We offer a novel liquefier that has the potential to simultaneously increase thermodynamic efficiency and significantly reduce complexity. The ?active gas...

  11. CDBG Activity Funding by Tract

    Data.gov (United States)

    Department of Housing and Urban Development — All CDBG activities in the categories of acquisition, economic development, housing, public improvements, public services, and other summarized by Census Tract.

  12. International Activities Related to Pesticides

    Science.gov (United States)

    Regulating pesticides involves many international issues and working with our regulatory partners in other countries. Learn about EPA's activities, upcoming meetings and workshops, and various regulatory issues.

  13. Methods for testing antioxidant activity.

    Science.gov (United States)

    Antolovich, Michael; Prenzler, Paul D; Patsalides, Emilios; McDonald, Suzanne; Robards, Kevin

    2002-01-01

    Antioxidant activity has been assessed in many ways. The limitation of many newer methods is the frequent lack of an actual substrate in the procedure. The combination of all approaches with the many test methods available explains the large variety of ways in which results of antioxidant testing are reported. The measurement of antioxidant activities, especially of antioxidants that are mixtures, multifunctional or are acting in complex multiphase systems, cannot be evaluated satisfactorily by a simple antioxidant test without due regard to the many variables influencing the results. Several test procedures may be required to evaluate such antioxidant activities. A general method of reporting antioxidant activity independent of the test procedure is proposed.

  14. THERMAL ACTIVATION OF IMMOBILIZED PAPAIN

    Institute of Scientific and Technical Information of China (English)

    1998-01-01

    Papain (Papainase, EC 3.4.22.2) was immobilized on porous silica beads by cross linking with glutaraldehyde. The thermal activation of this immobilized papain in aqueous system was found at a temperature range from 50 to 90℃. The higher the temperature, the more active the immobilized papain will possess. At the same time,the durability of the immobilized papain on heating was greatly improved. The effect of additives and salts on the activity of the immobilized papain were also studied. The results showed that the additives and some of the salts studied could markedly enhance the activity of the immobilized papain at elevated temperature.

  15. Active Combustion Control Valve Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Over the past decade, research into active combustion control has yielded impressive results in suppressing thermoacoustic instabilities and widening the...

  16. Active Combustion Control Valve Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Over the past decade, research into active combustion control has yielded impressive results in suppressing thermoacoustic instabilities and widening the operational...

  17. Physical Activity and Cancer Survivorship

    Science.gov (United States)

    Garcia, David O.; Thomson, Cynthia A.

    2015-01-01

    There has been an increase in the cancer survivor population in the United States over the past several decades primarily due to improvements in early detection of first malignancies and effective treatment modalities. A wealth of evidence has demonstrated that regular physical activity is associated with a lower risk of death, all-cause mortality, cancer recurrence, and several chronic diseases, including type 2 diabetes and cardiovascular disease, common comorbid conditions in people who have survived cancer. Physical activity also is a central component of weight management. Methods This review summarizes the current physical activity recommendations and the evidence linking physical activity to improvements in weight management, physiological effects, and psychological health outcomes for cancer survivors. Results The available literature suggests physical activity is safe and is positively associated with weight management, cardiorespiratory fitness, muscular strength and endurance, quality of life, fatigue, and other psychosocial factors in cancer survivors. Yet relationships related to specific cancer diagnoses, treatments, and underlying cardiometabolic mechanisms associated with survival have not been thoroughly examined in randomized controlled trials. Furthermore, factors that influence adherence to physical activity behaviors must be identified to develop effective exercise programs. The use of objective measures of physical activity and the standardization of reporting outcome measures within intervention trials are needed to complement this effort. Conclusions Healthcare providers should consider individual differences among cancer survivors and tailor physical activity programs to meet the individual needs of the patient to assist in the adoption and maintenance of a physically active lifestyle. PMID:25335787

  18. Studies in geophysics: Active tectonics

    Science.gov (United States)

    1986-01-01

    Active tectonics is defined within the study as tectonic movements that are expected to occur within a future time span of concern to society. Such movements and their associated hazards include earthquakes, volcanic eruptions, and land subsidence and emergence. The entire range of geology, geophysics, and geodesy is, to some extent, pertinent to this topic. The needs for useful forecasts of tectonic activity, so that actions may be taken to mitigate hazards, call for special attention to ongoing tectonic activity. Further progress in understanding active tectonics depends on continued research. Particularly important is improvement in the accuracy of dating techniques for recent geologic materials.

  19. Brain activation associated with active and passive lower limb stepping

    Directory of Open Access Journals (Sweden)

    Lukas eJaeger

    2014-10-01

    Full Text Available Reports about standardized and repeatable experimental procedures investigating supraspinal activation in patients with gait disorders are scarce in current neuro-imaging literature. Well-designed and executed tasks are important to gain insight into the effects of gait-rehabilitation on sensorimotor centers of the brain. The present study aims to demonstrate the feasibility of a novel imaging paradigm, combining the magnetic resonance (MR-compatible stepping robot (MARCOS with sparse sampling functional magnetic resonance imaging (fMRI to measure task-related BOLD signal changes and to delineate the supraspinal contribution specific to active and passive stepping. Twenty-four healthy participants underwent fMRI during active and passive, periodic, bilateral, multi-joint, lower limb flexion and extension akin to human gait. Active and passive stepping engaged several cortical and subcortical areas of the sensorimotor network, with higher relative activation of those areas during active movement. Our results indicate that the combination of MARCOS and sparse sampling fMRI is feasible for the detection of lower limb motor related supraspinal activation. Activation of the anterior cingulate and medial frontal areas suggests motor response inhibition during passive movement in healthy participants. Our results are of relevance for understanding the neural mechanisms underlying gait in the healthy.

  20. Active Directory Designing, Deploying, and Running Active Directory

    CERN Document Server

    Desmond, Brian

    2008-01-01

    By giving you a thorough grounding in Active Directory, this bestselling book teaches you how to design, manage, and maintain an AD infrastructure, whether it's for a small business network or a multinational enterprise with thousands of resources, services, and users. The fourth edition covers Active Directory from Windows 2000 through Windows Server 2008 in an easy-to-understand narrative style.

  1. Is active sitting as active as we think?

    Science.gov (United States)

    Grooten, Wilhelmus J A; Conradsson, David; Äng, Björn O; Franzén, Erika

    2013-01-01

    The aim of this study was to compare the biomechanical characteristics of sitting on a stool without a backrest (so as to encourage active sitting), sitting on a conventional office chair and standing in healthy participants. Thirteen healthy participants performed a keyboard-writing task during four (stable and unstable) sitting conditions and standing. Body segment positions and posture, postural sway and muscle activity of neck and trunk muscles were assessed with a motion capture system, a force plate and surface electromyography. The results showed that body segment positions, postural sway and trunk muscle activity were relatively similar for the stools without backrests compared with standing. All sitting conditions showed lower vertical upper body alignment, less anterior pelvic tilt and larger hip angles, compared with standing (p = 0.000). Unexpectedly, the muscle activity levels and total postural sway, sway velocity and sway in M/L and A/P directions were lower (p = 0.000) for the conditions that encouraged active sitting and standing, compared with the conventional office chair conditions. Thirteen healthy participants performed a keyboard-writing task during different sitting conditions and standing and were analysed regarding posture, postural sway and trunk muscle activity. Surprisingly, less postural sway and less muscle activity were observed during the conditions that encourage active sitting, compared with sitting on a conventional office chair.

  2. Stated Uptake of Physical Activity Rewards Programmes Among Active and Insufficiently Active Full-Time Employees.

    Science.gov (United States)

    Ozdemir, Semra; Bilger, Marcel; Finkelstein, Eric A

    2017-04-22

    Employers are increasingly relying on rewards programmes in an effort to promote greater levels of activity among employees; however, if enrolment in these programmes is dominated by active employees, then they are unlikely to be a good use of resources. This study uses a stated-preference survey to better understand who participates in rewards-based physical activity programmes, and to quantify stated uptake by active and insufficiently active employees. The survey was fielded to a national sample of 950 full-time employees in Singapore between 2012 and 2013. Participants were asked to choose between hypothetical rewards programmes that varied along key dimensions and whether or not they would join their preferred programme if given the opportunity. A mixed logit model was used to analyse the data and estimate predicted uptake for specific programmes. We then simulated employer payments based on predictions for the percentage of each type of employee likely to meet the activity goal. Stated uptake ranged from 31 to 67% of employees, depending on programme features. For each programme, approximately two-thirds of those likely to enrol were insufficiently active. Results showed that insufficiently active employees, who represent the majority, are attracted to rewards-based physical activity programmes, and at approximately the same rate as active employees, even when enrolment fees are required. This suggests that a programme with generous rewards and a modest enrolment fee may have strong employee support and be within the range of what employers may be willing to spend.

  3. Incorporation of Socio-scientific Content into Active Learning Activities

    Science.gov (United States)

    King, D. B.; Lewis, J. E.; Anderson, K.; Latch, D.; Sutheimer, S.; Webster, G.; Moog, R.

    2014-12-01

    Active learning has gained increasing support as an effective pedagogical technique to improve student learning. One way to promote active learning in the classroom is the use of in-class activities in place of lecturing. As part of an NSF-funded project, a set of in-class activities have been created that use climate change topics to teach chemistry content. These activities use the Process Oriented Guided Inquiry Learning (POGIL) methodology. In this pedagogical approach a set of models and a series of critical thinking questions are used to guide students through the introduction to or application of course content. Students complete the activities in their groups, with the faculty member as a facilitator of learning. Through assigned group roles and intentionally designed activity structure, process skills, such as teamwork, communication, and information processing, are developed during completion of the activity. Each of these climate change activities contains a socio-scientific component, e.g., social, ethical and economic data. In one activity, greenhouse gases are used to explain the concept of dipole moment. Data about natural and anthropogenic production rates, global warming potential and atmospheric lifetimes for a list of greenhouse gases are presented. The students are asked to identify which greenhouse gas they would regulate, with a corresponding explanation for their choice. They are also asked to identify the disadvantages of regulating the gas they chose in the previous question. In another activity, where carbon sequestration is used to demonstrate the utility of a phase diagram, students use economic and environmental data to choose the best location for sequestration. Too often discussions about climate change (both in and outside the classroom) consist of purely emotional responses. These activities force students to use data to support their arguments and hypothesize about what other data could be used in the corresponding discussion to

  4. Component activities in the autoregressive activity of physiological systems.

    Science.gov (United States)

    Sato, K; Ono, K; Chiba, G; Fukata, K

    1977-01-01

    The higher-order autoregressive (AR) activity of a physiological system (Sato 1975a,b; Sato et al., 1977) was decomposed into first- and second-order activities. The former time-pattern displays a fast rise and an exponential decay, while the latter exhibits a damped sine wave. Application of this component analysis to EEG showed the first-order activity to coincide with the nonoscillatory delta component. The frequency distribution of the natural, damped and resonance frequencies of the second-order activities was found to show one, two or three modes in each frequency range of the delta, theta and beta rhythms in ninety normal adult EEGs. Hence, the second-order activities agree with the oscillatory delta, theta, alpha and beta rhythms. Some changes were induced not only in the frequency of theta and beta rhythms but also in that of alpha rhythm by over-breathing for about three minutes.

  5. Active vibration and noise control by hybrid active acoustic panels

    Energy Technology Data Exchange (ETDEWEB)

    Stoebener, U.; Gaul, L. [Stuttgart Univ. (Germany). Inst. A fuer Mechanik

    2001-07-01

    In the present paper a hybrid passive and active treatment for vibration and noise reduction of plate type structures is proposed. The treatment is manufactured as sandwich structure and is called hybrid active acoustic panel. The passive component is used to reduce the vibration and sound radiation for high frequencies whereas the active part of the system is designed for the low frequency range. By selecting the thickness of the passive damping layer a certain frequency limit is defined, which divides the high and low frequency range. The actuator and sensor layout of the active component is evaluated by using the mode shapes of the low frequency range. According to the evaluated layout a hybrid active acoustic panel is manufactured and experimentally tested. The experimental results validate the proposed concept. (orig.)

  6. Acute activation, desensitization and smoldering activation of human acetylcholine receptors.

    Directory of Open Access Journals (Sweden)

    Barbara G Campling

    Full Text Available The behavioral effects of nicotine and other nicotinic agonists are mediated by AChRs in the brain. The relative contribution of acute activation versus chronic desensitization of AChRs is unknown. Sustained "smoldering activation" occurs over a range of agonist concentrations at which activated and desensitized AChRs are present in equilibrium. We used a fluorescent dye sensitive to changes in membrane potential to examine the effects of acute activation and chronic desensitization by nicotinic AChR agonists on cell lines expressing human α4β2, α3β4 and α7 AChRs. We examined the effects of acute and prolonged application of nicotine and the partial agonists varenicline, cytisine and sazetidine-A on these AChRs. The range of concentrations over which nicotine causes smoldering activation of α4β2 AChRs was centered at 0.13 µM, a level found in smokers. However, nicotine produced smoldering activation of α3β4 and α7 AChRs at concentrations well above levels found in smokers. The α4β2 expressing cell line contains a mixture of two stoichiometries, namely (α4β22β2 and (α4β22α4. The (α4β22β2 stoichiometry is more sensitive to activation by nicotine. Sazetidine-A activates and desensitizes only this stoichiometry. Varenicline, cytisine and sazetidine-A were partial agonists on this mixture of α4β2 AChRs, but full agonists on α3β4 and α7 AChRs. It has been reported that cytisine and varenicline are most efficacious on the (α4β22α4 stoichiometry. In this study, we distinguish the dual effects of activation and desensitization of AChRs by these nicotinic agonists and define the range of concentrations over which smoldering activation can be sustained.

  7. Protease activities of rumen protozoa.

    Science.gov (United States)

    Forsberg, C W; Lovelock, L K; Krumholz, L; Buchanan-Smith, J G

    1984-01-01

    Intact, metabolically active rumen protozoa prepared by gravity sedimentation and washing in a mineral solution at 10 to 15 degrees C had comparatively low proteolytic activity on azocasein and low endogenous proteolytic activity. Protozoa washed in 0.1 M potassium phosphate buffer (pH 6.8) at 4 degrees C and stored on ice autolysed when they were warmed to 39 degrees C. They also exhibited low proteolytic activity on azocasein, but they had a high endogenous proteolytic activity with a pH optimum of 5.8. The endogenous proteolytic activity was inhibited by cysteine proteinase inhibitors, for example, iodoacetate (63.1%) and the aspartic proteinase inhibitor, pepstatin (43.9%). Inhibitors specific for serine proteinases and metalloproteinases were without effect. The serine and cysteine proteinase inhibitors of microbial origin, including antipain, chymostatin, and leupeptin, caused up to 67% inhibition of endogenous proteolysis. Hydrolysis of casein by protozoa autolysates was also inhibited by cysteine proteinase inhibitors. Some of the inhibitors decreased endogenous deamination, in particular, phosphoramidon, which had little inhibitory effect on proteolysis. Protozoal and bacterial preparations exhibited low hydrolytic activities on synthetic proteinase and carboxypeptidase substrates, although the protozoa had 10 to 78 times greater hydrolytic activity (per milligram of protein) than bacteria on the synthetic aminopeptidase substrates L-leucine-p-nitroanilide, L-leucine-beta-naphthylamide, and L-leucinamide. The aminopeptidase activity was partially inhibited by bestatin. It was concluded that cysteine proteinases and, to a lesser extent, aspartic proteinases are primarily responsible for proteolysis in autolysates of rumen protozoa. The protozoal autolysates had high aminopeptidase activity; low deaminase activity was observed on endogenous amino acids. PMID:6364968

  8. NSLS 2009 Activity Report

    Energy Technology Data Exchange (ETDEWEB)

    Nasta K.; Mona R.

    2009-05-01

    2009 was an incredibly exciting year for light sources at Brookhaven. The National Synchrotron Light Source (NSLS) hosted more than 2,200 visiting researchers, who, along with the about 50 members of our scientific staff, produced a total of 957 publications - about 20 percent of which appeared in premier journals. Covering topics ranging from Alzheimer's disease detection to ethanol-powered fuel cells, a sampling of these findings can be found in this Activity Report. We've also seen the resurfacing of some of our long-time users hard work. I was very proud to hear that two of the three recipients of the 2009 Nobel Prize in Chemistry have ties to the NSLS. Venki Ramakrishnan, a former employee in Brookhaven's biology department and long-time user of the NSLS, now at Cambridge University, and Thomas A. Steitz of Yale University, also a long-time NSLS user, shared the prize with Ada E. Yonath of the Weizmann Institute of Science for their work on the structure and function of the ribosome. In the late 1990s, Ramakrishnan and Steitz used protein crystallography at the NSLS to gather atomic-level images of two ribosome subunits: 30S (Ramakrishnan) and 50S (Steitz). Both laureates solved the high-resolution structures for these subunits based on this data. After struggling with a rough budget for several years, we received excellent funding, and then some, this year. In addition to NSLS operations funding, we received $3 million in funds from the American Recovery and Reinvestment Act (ARRA). We used that additional money for two exciting projects: construction of a full-field x-ray microscope and acquisition of several advanced x-ray detectors. The x-ray microscope will be able to image objects with a targeted spatial resolution of 30 nanometers. This capability will be particularly important for new initiatives in energy research and will prepare our users for the projected 1-nanometer resolution benchmark at the National Synchrotron Light Source II

  9. NSLS 2009 Activity Report

    Energy Technology Data Exchange (ETDEWEB)

    Nasta K.; Mona R.

    2009-05-01

    2009 was an incredibly exciting year for light sources at Brookhaven. The National Synchrotron Light Source (NSLS) hosted more than 2,200 visiting researchers, who, along with the about 50 members of our scientific staff, produced a total of 957 publications - about 20 percent of which appeared in premier journals. Covering topics ranging from Alzheimer's disease detection to ethanol-powered fuel cells, a sampling of these findings can be found in this Activity Report. We've also seen the resurfacing of some of our long-time users hard work. I was very proud to hear that two of the three recipients of the 2009 Nobel Prize in Chemistry have ties to the NSLS. Venki Ramakrishnan, a former employee in Brookhaven's biology department and long-time user of the NSLS, now at Cambridge University, and Thomas A. Steitz of Yale University, also a long-time NSLS user, shared the prize with Ada E. Yonath of the Weizmann Institute of Science for their work on the structure and function of the ribosome. In the late 1990s, Ramakrishnan and Steitz used protein crystallography at the NSLS to gather atomic-level images of two ribosome subunits: 30S (Ramakrishnan) and 50S (Steitz). Both laureates solved the high-resolution structures for these subunits based on this data. After struggling with a rough budget for several years, we received excellent funding, and then some, this year. In addition to NSLS operations funding, we received $3 million in funds from the American Recovery and Reinvestment Act (ARRA). We used that additional money for two exciting projects: construction of a full-field x-ray microscope and acquisition of several advanced x-ray detectors. The x-ray microscope will be able to image objects with a targeted spatial resolution of 30 nanometers. This capability will be particularly important for new initiatives in energy research and will prepare our users for the projected 1-nanometer resolution benchmark at the National Synchrotron Light Source II

  10. Leisure activities, time and environment

    DEFF Research Database (Denmark)

    Røpke, Inge; Godskesen, Mirjam Irene

    2007-01-01

    The intention of this paper is to explore the relationships between leisure activities and the environment. Most research on leisure is unrelated to environmental issues, but when this research is “read” through environmental “glasses”, it provides relevant inputs for environmental studies...... use and activities rather than various categories of consumer spending....

  11. Interdisciplinarity in Adapted Physical Activity

    Science.gov (United States)

    Bouffard, Marcel; Spencer-Cavaliere, Nancy

    2016-01-01

    It is commonly accepted that inquiry in adapted physical activity involves the use of different disciplines to address questions. It is often advanced today that complex problems of the kind frequently encountered in adapted physical activity require a combination of disciplines for their solution. At the present time, individual research…

  12. Kinesthetic Activities for the Classroom

    Science.gov (United States)

    Mylott, Elliot; Dunlap, Justin; Lampert, Lester; Widenhorn, Ralf

    2014-01-01

    Educators have found that kinesthetic involvement in an experiment or demonstration can engage students in a powerful way. With that as our goal, we developed three activities that allow students to connect with and quantitatively explore key physics principles from mechanics with three fun physical challenges. By presenting these activities as…

  13. Event-Based Activity Modeling

    DEFF Research Database (Denmark)

    Bækgaard, Lars

    2004-01-01

    We present and discuss a modeling approach that supports event-based modeling of information and activity in information systems. Interacting human actors and IT-actors may carry out such activity. We use events to create meaningful relations between information structures and the related activit...

  14. Generic active appearance models revisited

    NARCIS (Netherlands)

    Tzimiropoulos, Georgios; Alabort-i-Medina, Joan; Zafeiriou, Stefanos; Pantic, Maja

    2012-01-01

    The proposed Active Orientation Models (AOMs) are gen- erative models of facial shape and appearance. Their main dierences with the well-known paradigm of Active Appearance Models (AAMs) are (i) they use a dierent statistical model of appearance, (ii) they are accompanied by a robust algorithm for m

  15. Interdisciplinarity in Adapted Physical Activity

    Science.gov (United States)

    Bouffard, Marcel; Spencer-Cavaliere, Nancy

    2016-01-01

    It is commonly accepted that inquiry in adapted physical activity involves the use of different disciplines to address questions. It is often advanced today that complex problems of the kind frequently encountered in adapted physical activity require a combination of disciplines for their solution. At the present time, individual research…

  16. An Application of Activity Theory

    Science.gov (United States)

    Marken, James A.

    2006-01-01

    Activity Theory has often been used in workplace settings to gain new theoretical understandings about work and the humans who engage in work, but rarely has there been sufficient detail in the literature to allow HPT practitioners to do their own activity analysis. The detail presented in this case is sufficient for HPT practitioners to begin to…

  17. Physical Activity and Academic Achievement

    Centers for Disease Control (CDC) Podcasts

    2014-12-09

    This podcast highlights the evidence that supports the link between physical activity and improved academic achievement. It also identifies a few actions to support a comprehensive school physical activity program to improve academic achievement.  Created: 12/9/2014 by National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP).   Date Released: 12/9/2014.

  18. Developing Internal Controls through Activities

    Science.gov (United States)

    Barnes, F. Herbert

    2009-01-01

    Life events can include the Tuesday afternoon cooking class with the group worker or the Saturday afternoon football game, but in the sense that Fritz Redl thought of them, these activities are only threads in a fabric of living that includes all the elements of daily life: playing, working, school-based learning, learning through activities,…

  19. Simultaneous tracking and activity recognition

    DEFF Research Database (Denmark)

    Manfredotti, Cristina Elena; Fleet, David J.; Hamilton, Howard J.

    2011-01-01

    Many tracking problems involve several distinct objects interacting with each other. We develop a framework that takes into account interactions between objects allowing the recognition of complex activities. In contrast to classic approaches that consider distinct phases of tracking and activity...

  20. Designing active objects in DEGAS

    NARCIS (Netherlands)

    J.F.P. van den Akker; A.P.J.M. Siebes (Arno)

    1997-01-01

    textabstractThis report discusses application design for active databases, in particular for the active object-based database programming language DEGAS. In DEGAS one modularisation principle, the object, is applied to all elements of the application, including rules. We discuss a design process

  1. Developing Internal Controls through Activities

    Science.gov (United States)

    Barnes, F. Herbert

    2009-01-01

    Life events can include the Tuesday afternoon cooking class with the group worker or the Saturday afternoon football game, but in the sense that Fritz Redl thought of them, these activities are only threads in a fabric of living that includes all the elements of daily life: playing, working, school-based learning, learning through activities,…

  2. Making Behavioral Activation More Behavioral

    Science.gov (United States)

    Kanter, Jonathan W.; Manos, Rachel C.; Busch, Andrew M.; Rusch, Laura C.

    2008-01-01

    Behavioral Activation, an efficacious treatment for depression, presents a behavioral theory of depression--emphasizing the need for clients to contact positive reinforcement--and a set of therapeutic techniques--emphasizing provision of instructions rather than therapeutic provision of reinforcement. An integration of Behavioral Activation with…

  3. An enzyme with rhamnogalacturonase activity.

    NARCIS (Netherlands)

    Kovod, L.V.; Dalboge, H.; Andersen, L.N.; Kauppinen, M.; Christgan, S.; Heldt-Hansen, H.P.; Christophersen, C.; Nielsen, P.M.; Voragen, A.G.J.; Schols, H.A.

    1994-01-01

    An enzyme exhibiting rhamnogalacturonase activity, which enzyme: a) is encoded by the DNA sequence shown in SEQ ID No. 1 or a sequence homologous thereto encoding a polypeptide with RGase activity, b) has the amino acid sequence shown in SEQ ID No. 2 or an analogue thereof, c) is reactive with an

  4. Coal Activities for Secondary Students.

    Science.gov (United States)

    American Coal Foundation, Washington, DC.

    This collection of lesson plans designed for teachers of 4th- through 12th-grade students utilizes an assortment of teaching strategies for topics related to coal and the coal industry. Activities cover the following topics: coal formation; coal identification; "the geologist's dilemma" (a supply and demand activity); geologic time and the…

  5. MNC Headquarters as Activity Systems

    DEFF Research Database (Denmark)

    Nell, Phillip C.; Larsen, Marcus M.

    Recent literature has questioned why multinational corporations (MNC) relocate their headquarters activities overseas. In this paper, we investigate the consequences of this phenomenon. To do this, we conceptualize the MNC headquarters activities as an interdependent system, and develop a set of ...

  6. MNC Headquarters as Activity Systems

    DEFF Research Database (Denmark)

    Nell, Phillip C.; Møller Larsen, Marcus

    2012-01-01

    Recent literature has questioned why multinational corporations (MNC) relocate their headquarters activities overseas. In this paper, we investigate the consequences of this phenomenon. To do this, we conceptualize the MNC headquarters activities as an interdependent system, and develop a set of ...

  7. Cancer, Physical Activity, and Exercise

    Science.gov (United States)

    Brown, Justin C.; Winters-Stone, Kerri; Lee, Augustine; Schmitz, Kathryn H.

    2014-01-01

    This review examines the relationship between physical activity and cancer along the cancer continuum, and serves as a synthesis of systematic and meta-analytic reviews conducted to date. There exists a large body of epidemiologic evidence that conclude those who participate in higher levels of physical activity have a reduced likelihood of developing a variety of cancers compared to those who engage in lower levels of physical activity. Despite this observational evidence, the causal pathway underling the association between participation in physical activity and cancer risk reduction remains unclear. Physical activity is also a useful adjunct to improve the deleterious sequelae experienced during cancer treatment. These deleterious sequelae may include fatigue, muscular weakness, deteriorated functional capacity, including many others. The benefits of physical activity during cancer treatment are similar to those experienced after treatment. Despite the growing volume of literature examining physical activity and cancer across the cancer continuum, a number of research gaps exist. There is little evidence on the safety of physical activity among all cancer survivors, as most trials have selectively recruited participants. It is also unclear the specific dose of exercise needed that is optimal for primary cancer prevention or symptom control during and after cancer treatment. PMID:23720265

  8. Antimicrobial activity of Securidaca longipedunculata.

    Science.gov (United States)

    Ajali, U; Chukwurah, B K C

    2004-11-01

    The folk herbal uses of Securidaca longipedunculata in the treatment of diarrhea, boils, gonorrhea, and cough prompted phytochemical analyses and antimicrobial activity screening of extracts of the root. Some flavonoids isolated showed activity against many micro-organisms. These flavonoids were isolated using chromatographic methods.

  9. [Active euthanasia, or assisted suicide?

    Science.gov (United States)

    Julesz, Máté

    2016-10-01

    Both active euthanasia and assisted suicide are legal in The Netherlands, Belgium, Luxemburg and, most recently, in Canada. Examination of national legislations of countries where both active euthanasia and assisted suicide are legal. The number of accomplished active euthanasia cases and that of assisted suicide cases. Analysis of national statistical data. Comparison of statistical data before and after 2010. Comparison of the related practices in the surveyed countries. The number of active euthanasia cases markedly predominates over the number of assisted suicide cases. Cancer is a main reason for active euthanasia, or assisted suicide. In countries with a larger population, the number of active euthanasia cases is higher than that in countries with a smaller population. Regarding the fact that the applicants for active euthanasia withdraw their requests in a smaller number than the applicants for assisted suicide, patients prefer the choice of active euthanasia. Since the related legislative product is too recent in Canada at present, it may be only presumed that a certain preference will also develop in the related practices in Canada. Orv. Hetil., 2016, 157(40), 1595-1600.

  10. FORECASTING NEED IN ORGANIZATION ACTIVITY

    Directory of Open Access Journals (Sweden)

    Luminiţa Danciu

    2012-12-01

    Full Text Available Inside a company activity planning is made according to estimates. This means that estimates are very important. If estimates are wrong the company's activity will be on the wrong way. In the management zone in order to focus on general objectives achievement there are used estimates and forecasting methods.

  11. Designing active objects in DEGAS

    NARCIS (Netherlands)

    Akker, J.F.P. van den; Siebes, A.P.J.M.

    1997-01-01

    This report discusses application design for active databases, in particular for the active object-based database programming language DEGAS. In DEGAS one modularisation principle, the object, is applied to all elements of the application, including rules. We discuss a design process consisting of f

  12. Physical Activity in the Classroom

    DEFF Research Database (Denmark)

    Réol, Lise Andersen

    2016-01-01

    activities in school enhance positive emotions and support an inclusive and safe learning environment. Thought it does also point to the fact, that it is indeed not that simple. Teachers’ sport-specific educational competences, their own experience of well-being and fun related to physical activities...

  13. Physical Activity and Renal Transplantation

    Directory of Open Access Journals (Sweden)

    Vincenzo Bellizzi

    2014-07-01

    Full Text Available Renal transplantation is burdened by high cardiovascular risk because of increased prevalence of traditional and disease-specific cardiovascular risk factors and, consequently, patients are affected by greater morbidity and mortality. In renal transplanted patients, healthy lifestyle and physical activity are recommended to improve overall morbidity and cardiovascular outcomes. According to METs (Metabolic Equivalent Task; i.e. the amount of energy consumed while sitting at rest, physical activities are classified as sedentary (<3.0 METs, of moderate-(3.0 to 5.9 METs or vigorous-intensity (≥6.0 METs. Guidelines suggest for patients with chronic kidney disease an amount of physical activity of at least 30 minutes of moderate-intensity activity five times per week (min 450 MET-minutes/week. Data on physical activity in renal transplanted patients, however, are limited and have been mainly obtained by mean of non-objective methods. Available data suggest that physical activity is low either at the start or during renal transplantation and this may be associated with poor patient and graft outcomes. Therefore, in renal transplanted patients more data on physical activity obtained with objective, accelerometer-based methods are needed. In the meanwhile, physical activity have to be considered as an essential part of the medical care for renal transplanted recipients.

  14. Active Chemical Thermodynamics promoted by activity of cortical actin

    Science.gov (United States)

    Bhattacharya, Bhaswati; Chaudhuri, Abhishek; Gowrishankar, Kripa; Rao, Madan

    2011-03-01

    The spatial distribution and dynamics of formation and breakup of the nanoclusters of cell surface proteins is controlled by the active remodeling dynamics of the underlying cortical actin. To explain these observations, we have proposed a novel mechanism of nanoclustering, involving the transient binding to and advection along constitutively occuring ``asters'' of cortical actin. We study the consequences of such active actin-based clustering, in the context of chemical reactions involving conformational changes of cell surface proteins. We find that the active remodeling of cortical actin, can give rise to a dramatic increase in efficiency and extent of conformational spread, even at low levels of expression at the cell surface. We define a activity temperature (τa) arising due to actin activities which can be used to describe chemical thermodynamics of the system. We plot TTT (time-temparature-transformation) curves and compute the Arrhenius factors which depend on τa . With this, the active asters can be treated as enzymes whose enzymatic reaction rate can be related to the activity.

  15. 50 CFR 401.4 - Activities prohibited.

    Science.gov (United States)

    2010-10-01

    ..., DEVELOPMENT AND ENHANCEMENT § 401.4 Activities prohibited. Law enforcement, public relations, harvesting, marketing and processing activities, construction of fisherman use facilities, and activities concerned...

  16. Antioxidant activity of Citrus fruits.

    Science.gov (United States)

    Zou, Zhuo; Xi, Wanpeng; Hu, Yan; Nie, Chao; Zhou, Zhiqin

    2016-04-01

    Citrus is well-known for its nutrition and health-promotion values. This reputation is derived from the studies on the biological functions of phytochemicals in Citrus fruits and their derived products in the past decades. In recent years, the antioxidant activity of Citrus fruits and their roles in the prevention and treatment of various human chronic and degenerative diseases have attracted more and more attention. Citrus fruits are suggested to be a good source of dietary antioxidants. To have a better understanding of the mechanism underlying the antioxidant activity of Citrus fruits, we reviewed a study on the antioxidant activity of the phytochemicals in Citrus fruits, introduced methods for antioxidant activity evaluation, discussed the factors which influence the antioxidant activity of Citrus fruits, and summarized the underlying mechanism of action. Some suggestions for future study were also presented.

  17. Improved Active Vibration Isolation Systems

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    The control force, feedback gain, and actuator stroke of several active vibration isolation systems were analyzed based on a single-layer active vibration isolation system. The analysis shows that the feedback gain and actuator stroke cannot be selected independently and the active isolation system design must make a compromise between the feedback gain and actuator stroke. The performance of active isolation systems can be improved by the joint vibration reduction using an active vibration isolation system with an adaptive dynamic vibration absorber. The results show that the joint vibration reduction method can successfully avoid the compromise between the feedback gain and actuator stroke. The control force and the object vibration amplitude are also greatly reduced.

  18. Active properties of neuronal dendrites.

    Science.gov (United States)

    Johnston, D; Magee, J C; Colbert, C M; Cristie, B R

    1996-01-01

    Dendrites of neurons in the central nervous system are the principal sites for excitatory synaptic input. Although little is known about their function, two disparate perspectives have arisen to describe the activity patterns inherent to these diverse tree-like structures. Dendrites are thus considered either passive or active in their role in integrating synaptic inputs. This review follows the history of dendritic research from before the turn of the century to the present, with a primary focus on the hippocampus. A number of recent techniques, including high-speed fluorescence imaging and dendritic patch clamping, have provided new information and perspectives about the active properties of dendrites. The results support previous notions about the dendritic propagation of action potentials and also indicate which types of voltage-gated sodium and calcium channels are expressed and functionally active in dendrites. Possible roles for the active properties of dendrites in synaptic plasticity and integration are also discussed.

  19. Structural basis of transcription activation.

    Science.gov (United States)

    Feng, Yu; Zhang, Yu; Ebright, Richard H

    2016-06-10

    Class II transcription activators function by binding to a DNA site overlapping a core promoter and stimulating isomerization of an initial RNA polymerase (RNAP)-promoter closed complex into a catalytically competent RNAP-promoter open complex. Here, we report a 4.4 angstrom crystal structure of an intact bacterial class II transcription activation complex. The structure comprises Thermus thermophilus transcription activator protein TTHB099 (TAP) [homolog of Escherichia coli catabolite activator protein (CAP)], T. thermophilus RNAP σ(A) holoenzyme, a class II TAP-dependent promoter, and a ribotetranucleotide primer. The structure reveals the interactions between RNAP holoenzyme and DNA responsible for transcription initiation and reveals the interactions between TAP and RNAP holoenzyme responsible for transcription activation. The structure indicates that TAP stimulates isomerization through simple, adhesive, stabilizing protein-protein interactions with RNAP holoenzyme. Copyright © 2016, American Association for the Advancement of Science.

  20. Electrical measurement of sweat activity.

    Science.gov (United States)

    Tronstad, Christian; Gjein, Gaute E; Grimnes, Sverre; Martinsen, Ørjan G; Krogstad, Anne-Lene; Fosse, Erik

    2008-06-01

    A multichannel logger for long-term measurements of sweat activity is presented. The logger uses skin surface electrodes for unipolar admittance measurements in the stratum corneum. The logger is developed with emphasis on clinical use. The portability of the logger enables recording of sweat activity under circumstances such as daily errands, exercise and sleep. Measurements have been done on 24 healthy volunteers during relaxation and exercise with heart rate monitoring. Recordings of sweat activity during sleep have been done on two healthy subjects. Early results show good agreement with the literature on sweating physiology and electrodermal activity. Results are presented showing measurements related to physical exercise, dermatomes, distribution of sweat glands and sympathetic activity. This study examines the normal sweating patterns for the healthy population, and we present results with the first 24 healthy volunteers. Comparing these results with similar measurements on hyperhidrosis patients will make it possible to find the most useful parameters for diagnosis and treatment evaluation.

  1. Antiprotozoal activity of Senna racemosa.

    Science.gov (United States)

    Moo-Puc, Rosa E; Mena-Rejon, Gonzalo J; Quijano, Leovigildo; Cedillo-Rivera, Roberto

    2007-06-13

    Methanol extracts of leaves, roots and bark of Senna racemosa (Mill.) H.S. Irwin & Barneby (syn. Cassia racemosa Mill.) were tested for antiprotozooal activity against Giardia intestinalis and Entamoeba histolytica. All of the tested extracts showed good activity against both protozoa species. Extracts from stem bark and leaves were most active, with an IC(50) of 2.10 microg/mL for Giardia intestinalis and 3.87 microg/mL for Entamoeba histolytica. Of the previously isolated compounds from Senna racemosa, the piperidine alkaloid cassine had greater activity against Giardia intestinalis with an IC(50) of 3.28 microg/mL and chrysophanol, a 1,8-dihydroxy-anthraquinone, was the most active agent against Entamoeba histolytica, with an IC(50) of 6.21 microg/mL.

  2. Human activity recognition and prediction

    CERN Document Server

    2016-01-01

    This book provides a unique view of human activity recognition, especially fine-grained human activity structure learning, human-interaction recognition, RGB-D data based action recognition, temporal decomposition, and causality learning in unconstrained human activity videos. The techniques discussed give readers tools that provide a significant improvement over existing methodologies of video content understanding by taking advantage of activity recognition. It links multiple popular research fields in computer vision, machine learning, human-centered computing, human-computer interaction, image classification, and pattern recognition. In addition, the book includes several key chapters covering multiple emerging topics in the field. Contributed by top experts and practitioners, the chapters present key topics from different angles and blend both methodology and application, composing a solid overview of the human activity recognition techniques. .

  3. Advances on Active Tectonics Research

    Institute of Scientific and Technical Information of China (English)

    Chen Yong; Chen Qifu; Li Juan

    2001-01-01

    The tectonic movement at human scale has not been fully understood yet, especially for active tectonics, although it is the basis to study natural hazards and environmental variations. Many national and international scientific plans related closely to active tectonics research have been made in the past ten years. This paper briefly summarized the background of the undertaking of active tectonics research, its advances and existing problems, and the key points in its future studies are also pointed out. The emerging of new technologies like the Earth Observing Sys tem, Digital Seismology and so on provides unusual opportunities for tectonic research. It is emphasized, however, that careful analyses and building up of new theoretical frame are sill the key problems for studies of active tectonics, especially for active tectonics in China' s conti nent.

  4. Active matter, then and now.

    Science.gov (United States)

    Keller, Evelyn Fox

    2016-09-01

    Historically, living was divided from dead, inert matter by its autonomous activity. Today, a number of materials not themselves alive are characterized as having inherent activity, and this activity has become the subject of a hot new field of physics, "Active Matter", or "Soft matter become alive." For active matter scientists, the relation of physics to biology is guaranteed in one direction by the assertion that the cell is a material, and hence its study can be considered a branch of material science, and in the other direction, by the claim that the physical dynamics of this material IS what brings the cell to life, and therefore its study is a proper branch of biology. I will examine these claims in relation to the concerns of nineteenth century scientists on the one hand, and on the other, in relation to future prospects of the division between animate and inanimate.

  5. Crystal activation experiment MA-151

    Science.gov (United States)

    Trombka, J. I.; Eller, E. L.; Schmadebeck, R. L.; Dyer, C. S.; Reedy, R. C.; Barr, D. W.; Gilmore, J. S.; Prestwood, R. J.; Bayhurst, B. P.; Perry, D. G.

    1976-01-01

    The crystal activation experiment consisted of two sample packages that were flown in the command module and returned to earth for analysis of the radioactivity induced in them during the flight. The objective of the experiment was to define the background caused by detector activation that interferes when gamma radiation is measured in the 0.02- to 10-megaelectronvolt range from earth orbit. Preliminary results show that the activation of the NaI(Tl) crystal was a factor of 3 below that from a similar measurement on Apollo 17. The identification of certain species and the level of activation observed show an important contribution from the interactions of thermal and energetic neutrons produced as secondaries in the spacecraft. That the activation was reduced by only a factor of 3 compared with the Apollo 17 experiment, despite the geomagnetically shielded orbit, possibly indicates more efficient secondary neutron production by the more energetic cosmic rays.

  6. Berberine acutely activates the glucose transport activity of GLUT1.

    Science.gov (United States)

    Cok, Alexandra; Plaisier, Christina; Salie, Matthew J; Oram, Daniel S; Chenge, Jude; Louters, Larry L

    2011-07-01

    Berberine, which has a long history of use in Chinese medicine, has recently been shown to have efficacy in the treatment of diabetes. While the hypoglycemic effect of berberine has been clearly documented in animal and cell line models, such as 3T3-L1 adipocytes and L6 myotube cells, the mechanism of action appears complex with data implicating activation of the insulin signaling pathway as well as activation of the exercise or AMP kinase-mediated pathway. There have been no reports of the acute affects of berberine on the transport activity of the insulin-insensitive glucose transporter, GLUT1. Therefore, we examined the acute effects of berberine on glucose uptake in L929 fibroblast cells, a cell line that express only GLUT1. Berberine- activated glucose uptake reaching maximum stimulation of five-fold at >40 μM. Significant activation (P berberine effect was not additive to the maximal stimulation by other known stimulants, azide, methylene blue or glucose deprivation, suggesting shared steps between berberine and these stimulants. Berberine significantly reduced the K(m) of glucose uptake from 6.7 ± 1.9 mM to 0.55 ± 0.08 mM, but had no effect on the V(max) of uptake. Compound C, an inhibitor of AMP kinase, did not affect berberine-stimulated glucose uptake, but inhibitors of downstream kinases partially blocked berberine stimulation. SB203580 (inhibitor of p38 MAP kinase) did not affect submaximal berberine activation, but did lower maximal berberine stimulation by 26%, while PD98059 (inhibitor of ERK kinase) completely blocked submaximal berberine activation and decreased the maximal stimulation by 55%. It appears from this study that a portion of the hypoglycemic effects of berberine can be attributed to its acute activation of the transport activity of GLUT1.

  7. Activated and non-activated dephasing in a spin bath

    Science.gov (United States)

    Torrontegui, E.; Kosloff, R.

    2016-09-01

    We analyze different decoherence processes in a system coupled to a bath. Apart from the well known standard dephasing mechanism which is temperature dependent an alternative mechanism is presented, the spin-swap dephasing which does not need initial bath activation and is temperature independent. We show that for dipole interaction in the weak coupling regime the separation of time scales between system and bath can not produce pure dephasing, the process being accompanied by dissipation. Activated and non-activated dephasing processes are analyzed in a diamond nitrogen-vacancy center.

  8. pedometer-measured physical activity, self-reported physical activity ...

    African Journals Online (AJOL)

    as a direct/objective measure of ambulatory physical activity.[8-10]. Furthermore, such ..... that 100 steps/minute is a reasonable heuristic value indicative of ... funding this project: Durban University of Technology (DUT) and the. National ...

  9. Activity Cycle of Solar Filaments

    Indian Academy of Sciences (India)

    K. J. Li; Q. X. Li; P. X. Gao; J. Mu; H. D. Chen; T. W. Su

    2007-06-01

    Long-term variation in the distribution of the solar filaments observed at the Observatorie de Paris, Section de Meudon from March 1919 to December 1989 is presented to compare with sunspot cycle and to study the periodicity in the filament activity, namely the periods of the coronal activity with the Morlet wavelet used. It is inferred that the activity cycle of solar filaments should have the same cycle length as sunspot cycle, but the cycle behavior of solar filaments is globally similar in profile with, but different in detail from, that of sunspot cycles. The amplitude of solar magnetic activity should not keep in phase with the complexity of solar magnetic activity. The possible periods in the filament activity are about 10.44 and 19.20 years. The wavelet local power spectrum of the period 10.44 years is statistically significant during the whole consideration time. The wavelet local power spectrum of the period 19.20 years is under the 95% confidence spectrum during the whole consideration time, but over the mean red-noise spectrum of = 0.72 before approximate Carrington rotation number 1500, and after that the filament activity does not statistically show the period. Wavelet reconstruction indicates that the early data of the filament archive (in and before cycle 16) are more noiseful than the later (in and after cycle 17).

  10. Sry is a transcriptional activator.

    Science.gov (United States)

    Dubin, R A; Ostrer, H

    1994-09-01

    The SRY gene functions as a genetic switch in gonadal ridge initiating testis determination. The mouse Sry and human SRY open reading frames (ORFs) share a conserved DNA-binding domain (the HMG-box) yet exhibit no additional homology outside this region. As judged by the accumulation of lacZ-SRY hybrid proteins in the nucleus, both the human and mouse SRY ORFs contain a nuclear localization signal. The mouse Sry HMG-box domain selectively binds the sequence NACAAT in vitro when challenged with a random pool of oligonucleotides and binds AACAAT with the highest affinity. When put under the control of a heterologous promotor, the mouse Sry gene activated transcription of a reporter gene containing multiple copies of the AACAAT binding site. Activation was likewise observed for a GAL4-responsive reporter gene, when the mouse Sry gene was linked to the DNA-binding domain of GAL4. Using this system, the activation function was mapped to a glutamine/histidine-rich domain. In addition, LexA-mouse Sry fusion genes activated a LexA-responsive reporter gene in yeast. In contrast, a GAL4-human SRY fusion gene did not cause transcriptional activation. These studies suggest that both the human and the mouse SRY ORFs encode nuclear, DNA-binding proteins and that the mouse Sry ORF can function as a transcriptional activator with separable DNA-binding and activator domains.

  11. Energy Balance and Physical Activity

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    The prevalence of obesity is increasing in most parts of theworld and becoming one of the major global public health problems. Although the components of energy balance have not been adequately estimated over time, available evidence suggests that the increase in obesity is the result of reduced physical activity. Increases in physical activity have been shown to be strongly associated with improving physical fitness and body composition, with probably a positive effect on resting metabolic rate. The Surgeon General's Report on Physical Activity and Health advocates that 30 min of regular, moderate-intensity physical activity is associated with decreases in the risk of chronic diseases and may contribute to quality of life. However, the small changes that contribute 10 min for 3 times a day for aerobic training, or one set instead of three sets of repetitions on resistance training will provide individuals with health benefits. Indeed, nutrition and physical activity should be considered an integral part of fitness and good health, and should be encouraged in all age groups, particularly early in life. The question is no longer centered around the health benefit of increasing physical activity, but rather creating self awareness and behavior changes in individuals. Hence, effective intervention programs are needed that foster long term changes in physical activity. Among various interventions, the Nutrifit program was recently conducted in Thailand and found to improve health related fitness in children. The development of more effective interventions and approaches is a major challenge in this field today.

  12. Voluntary control of electrogastric activity.

    Science.gov (United States)

    Walker, B B; Lawton, C A; Sandman, C A

    1978-12-01

    The tonic component of the electrogastrogram (EGG) has been shown to differentiate duodenal ulcer patients from healthy individuals (15). It has therefore been of considerable interest to investigate the possibility that individuals can learn to modify electrogastric activity. Using a discriminative conditioning paradigm with analogue feedback (Experiment I), subjects were generally unsuccessful at controlling tonic EGG activity. However, when the conditioning paradigm was altered (Experiment II) it was clear that subjects were able to modify specific electrogastric changes. In addition to EGG, heart rate, respiration, abdominal muscle activity, and digital blood flow were measured in order to assess the physiological concomitants of learned control of gastrointestinal activity. Subjects who evidenced discriminative control also showed the least amount of abdominal muscle activity and reported being the most relaxed. The results of these studies suggest that exploration of the physiological processes underlying the electrical activity of the gastrointestinal system and the ability of individuals to modify this activity may lead to significant clinical and theoretical advances.

  13. Antimicrobial activities of squalamine mimics.

    Science.gov (United States)

    Kikuchi, K; Bernard, E M; Sadownik, A; Regen, S L; Armstrong, D

    1997-07-01

    We investigated the antimicrobial properties of compounds with structural features that were designed to mimic those of squalamine, an antibiotic isolated from the stomach of the dogfish shark. The mimics, like squalamine, are sterol-polyamine conjugates. Unlike squalamine, the mimics were simple to prepare, at high yield, from readily available starting materials. Several squalamine mimics showed activity against gram-negative rods, gram-positive cocci including methicillin-resistant Staphylococcus aureus, vancomycin-resistant Enterococcus faecium, and fungi. Some had little or no hemolytic activity. The hydrophobicity of the sterol backbone and the length and the cationic charge of the side chains appeared to be critical determinants of activity. One of the squalamine mimics, SM-7, was bactericidal against Escherichia coli, Pseudomonas aeruginosa, and S. aureus; its activity was decreased by divalent or monovalent cations and by bovine serum albumin. Subinhibitory concentrations of SM-7 markedly enhanced the antimicrobial activity of rifampin against gram-negative rods. These results suggest that the compounds may disrupt an outer membrane of gram-negative rods. Squalamine mimics are a new class of broad-spectrum antimicrobial agents. The antagonism of their activity by serum and albumin and their hemolytic properties may limit their use as systemic agents. The squalamine mimics, because of their potencies, broad spectra of antimicrobial activity, and potential for systemic toxicity, appear to be good candidates for development as topical antimicrobial agents.

  14. Separating proteins with activated carbon.

    Science.gov (United States)

    Stone, Matthew T; Kozlov, Mikhail

    2014-07-15

    Activated carbon is applied to separate proteins based on differences in their size and effective charge. Three guidelines are suggested for the efficient separation of proteins with activated carbon. (1) Activated carbon can be used to efficiently remove smaller proteinaceous impurities from larger proteins. (2) Smaller proteinaceous impurities are most efficiently removed at a solution pH close to the impurity's isoelectric point, where they have a minimal effective charge. (3) The most efficient recovery of a small protein from activated carbon occurs at a solution pH further away from the protein's isoelectric point, where it is strongly charged. Studies measuring the binding capacities of individual polymers and proteins were used to develop these three guidelines, and they were then applied to the separation of several different protein mixtures. The ability of activated carbon to separate proteins was demonstrated to be broadly applicable with three different types of activated carbon by both static treatment and by flowing through a packed column of activated carbon.

  15. Activation and proteolytic activity of the Treponema pallidum metalloprotease, pallilysin.

    Science.gov (United States)

    Houston, Simon; Hof, Rebecca; Honeyman, Lisa; Hassler, Julia; Cameron, Caroline E

    2012-01-01

    Treponema pallidum is a highly invasive pathogen that undergoes rapid dissemination to establish widespread infection. Previous investigations identified the T. pallidum adhesin, pallilysin, as an HEXXH-containing metalloprotease that undergoes autocatalytic cleavage and degrades laminin and fibrinogen. In the current study we characterized pallilysin's active site, activation requirements, cellular location, and fibrin clot degradation capacity through both in vitro assays and heterologous treponemal expression and degradation studies. Site-directed mutagenesis showed the pallilysin HEXXH motif comprises at least part of the active site, as introduction of three independent mutations (AEXXH [H¹⁹⁸A], HAXXH [E¹⁹⁹A], and HEXXA [H²⁰²A]) abolished pallilysin-mediated fibrinogenolysis but did not adversely affect host component binding. Attainment of full pallilysin proteolytic activity was dependent upon autocatalytic cleavage of an N-terminal pro-domain, a process which could not occur in the HEXXH mutants. Pallilysin was shown to possess a thrombin cleavage site within its N-terminal pro-domain, and in vitro studies confirmed cleavage of pallilysin with thrombin generates a truncated pallilysin fragment that has enhanced proteolytic activity, suggesting pallilysin can also exploit the host coagulation process to facilitate protease activation. Opsonophagocytosis assays performed with viable T. pallidum demonstrated pallilysin is a target of opsonic antibodies, consistent with a host component-interacting, surface-exposed cellular location. Wild-type pallilysin, but not the HEXXA mutant, degraded fibrin clots, and similarly heterologous expression of pallilysin in the non-invasive spirochete Treponema phagedenis facilitated fibrin clot degradation. Collectively these results identify pallilysin as a surface-exposed metalloprotease within T. pallidum that possesses an HEXXH active site motif and requires autocatalytic or host-mediated cleavage of a pro

  16. Measuring physical activity during pregnancy

    Directory of Open Access Journals (Sweden)

    Teede Helena J

    2011-03-01

    Full Text Available Abstract Background Currently, little is known about physical activity patterns in pregnancy with prior estimates predominantly based on subjective assessment measures that are prone to error. Given the increasing obesity rates and the importance of physical activity in pregnancy, we evaluated the relationship and agreement between subjective and objective physical activity assessment tools to inform researchers and clinicians on optimal assessment of physical activity in pregnancy. Methods 48 pregnant women between 26-28 weeks gestation were recruited. The Yamax pedometer and Actigraph accelerometer were worn for 5-7 days under free living conditions and thereafter the International Physical Activity Questionnaire (IPAQ was completed. IPAQ and pedometer estimates of activity were compared to the more robust and accurate accelerometer data. Results Of 48 women recruited, 30 women completed the study (mean age: 33.6 ± 4.7 years; mean BMI: 31.2 ± 5.1 kg/m2 and 18 were excluded (failure to wear [n = 8] and incomplete data [n = 10]. The accelerometer and pedometer correlated significantly on estimation of daily steps (ρ = 0.69, p -1 day-1 were not significantly correlated and there was poor absolute agreement. Relative to the accelerometer, the IPAQ under predicted daily total METs (105.76 ± 259.13 min-1 day-1 and light METs (255.55 ± 128.41 min-1 day-1 and over predicted moderate METs (-112.25 ± 166.41 min-1 day-1. Conclusion Compared with the accelerometer, the pedometer appears to provide a reliable estimate of physical activity in pregnancy, whereas the subjective IPAQ measure performed less accurately in this setting. Future research measuring activity in pregnancy should optimally encompass objective measures of physical activity. Trial Registration Australian New Zealand Clinical Trial Registry Number: ACTRN12608000233325. Registered 7/5/2008.

  17. Commercial Product Activation Using RFID

    Science.gov (United States)

    Jedrey, Thomas

    2008-01-01

    Radio-frequency identification (RFID) would be used for commercial product activation, according to a proposal. What is new here is the concept of combining RFID with activation - more specifically, using RFID for activating commercial products (principally, electronic ones) and for performing such ancillary functions as tracking individual product units on production lines, tracking shipments, and updating inventories. According to the proposal, an RFID chip would be embedded in each product. The information encoded in the chip would include a unique number for identifying the product. An RFID reader at the point of sale would record the number of the product and would write digital information to the RFID chip for either immediate activation of the product or for later interrogation and processing. To be practical, an RFID product-activation system should satisfy a number of key requirements: the system should be designed to be integrable into the inventory-tracking and the data-processing and -communication infrastructures of businesses along the entire supply chain from manufacture to retail; the system should be resistant to sophisticated hacking; activation codes should be made sufficiently complexity to minimize the probability of activating stolen products; RFID activation equipment at points of sale must be capable to two-way RF communication for the purposes of reading information from, and writing information to, embedded RFID chips; the equipment at points of sale should be easily operable by sales clerks with little or no training; the point-of-sale equipment should verify activation and provide visible and/or audible signals indicating verification or lack thereof; and, the system should be able to handle millions of products per year with minimal human intervention, among other requirements.

  18. Physical Activity for a Healthy Weight

    Science.gov (United States)

    ... Weight Breastfeeding Micronutrient Malnutrition State and Local Programs Physical Activity for a Healthy Weight Language: English Español (Spanish) ... calories are used in typical activities? Why is physical activity important? Regular physical activity is important for good ...

  19. Organelle morphogenesis by active remodeling

    CERN Document Server

    Ramakrishnan, N; Rao, Madan; Kumar, P B Sunil

    2014-01-01

    Intracellular organelles are subject to a steady flux of lipids and proteins through active, energy consuming transport processes. Active fission and fusion are promoted by GTPases, e.g., Arf-Coatamer and the Rab-Snare complexes, which both sense and generate local membrane curvature. Here we investigate through Dynamical Triangulation Monte Carlo simulations, the role that these active processes play in determining the morphology and compositional segregation in closed membranes. Our results suggest that the ramified morphologies of organelles observed in-vivo are a consequence of driven nonequilibrium processes rather than equilibrium forces.

  20. The Leadership Challenge Activities Book

    CERN Document Server

    Kouzes, James M; Biech, Elaine

    2010-01-01

    ACTIVE Learning for Exemplary Leaders. The best leaders are the best learners. This evidence-based truth has been a foundational principle of The Leadership Challenge since it was first published nearly twenty-five years ago. In this new work, bestselling Leadership Challenge authors Jim Kouzes and Barry Posner team up with experiential learning expert Elaine Biech to bring today's leaders over 100 engaging activities designed to expand and accelerate their leadership development efforts. Grounded in The Five Practices of Exemplary Leadership® model, The Leadership Challenge Activities Book in

  1. FRAUDULENT ACTIVITIES USING VIRTUAL MEETINGS

    Directory of Open Access Journals (Sweden)

    Anne James

    2013-05-01

    Full Text Available This paper investigates fraudulent and illegal activities that take place through virtual meeting systems. The first section gives an introduction to the problem. Section two describes some cases of fraudulent activity using virtual meeting systems. Section three explores some means of capturing such fraudulent activities so thatcriminals can be brought to justice. Section four provides a solution for capturing virtual meeting conversations in a way that could be admissible in court. Section five discusses tell-tale signs that indicates that a conversation maybe fraudulent. Section six discusses Artificial Intelligence (AI techniques that might be used to detectvirtual meeting crime. Section seven discusses the conclusion to the paper.

  2. Induced activation in accelerator components

    Directory of Open Access Journals (Sweden)

    Cristian Bungau

    2014-08-01

    Full Text Available The residual activity induced in particle accelerators is a serious issue from the point of view of radiation safety as the long-lived radionuclides produced by fast or moderated neutrons and impact protons cause problems of radiation exposure for staff involved in the maintenance work and when decommissioning the facility. This paper presents activation studies of the magnets and collimators in the High Energy Beam Transport line of the European Spallation Source due to the backscattered neutrons from the target and also due to the direct proton interactions and their secondaries. An estimate of the radionuclide inventory and induced activation are predicted using the GEANT4 code.

  3. Stresslets induced by active swimmers

    CERN Document Server

    Lauga, Eric

    2016-01-01

    Active particles disturb the fluid around them as force dipoles, or stresslets, which govern their collective dynamics. Unlike swimming speeds, the stresslets of active particles are rarely determined due to the lack of a suitable theoretical framework for arbitrary geometry. We propose a general method, based on the reciprocal theorem of Stokes flows, to compute stresslets as integrals of the velocities on the particle's surface, which we illustrate for spheroidal chemically-active particles. Our method will allow tuning the stresslet of artificial swimmers and tailoring their collective motion in complex environments.

  4. Enzymatic activity of myccorrhizal fungi

    Directory of Open Access Journals (Sweden)

    Roman Pachlewski

    2014-11-01

    Full Text Available The investigations included assays of enzymatic activity of ectomycorrhizal fungi from the genera: Amanita, Cenococcum, Coltricia, Hebeloma, Lactarius, Rhizopogon, Russula, Suillus, Tricholoma and the pine ectendomycorrhizal strain MrgX. Among the 22 investigated strains of fungi 18 could decompose starch, 14 urea, 11 asparagine, 7 protein, 6 pectin and 3 ce1lulose. The most varied enzyme activities were found in Amanita muscaria, A. verna, Hebeloma, mesophaeum, ectendomycorrhizal isolate MrgX, Rhizopogon luteolus and Suillus bovinus, the highest cellolotytic activity was shown by the ectendomycorrhizal strain.

  5. Active Control of Suspension Bridges

    DEFF Research Database (Denmark)

    Thoft-Christensen, Palle

    In this paper some recent research on active control of very long suspension bridges, is presented. The presentation is based on research work at Aalborg University, Denmark. The active control system is based on movable flaps attached to the bridge girder. Wind load on bridges with or without...... flaps attached to the girder is briefly presented. A simple active control system is discussed. Results from wind tunnel experiments with a bridge section show that flaps can be used effectively to control bridge girder vibrations. Flutter conditions for suspension bridges with and without flaps...

  6. Activated protein C modulates the proinflammatory activity of dendritic cells

    Directory of Open Access Journals (Sweden)

    Matsumoto T

    2015-05-01

    Full Text Available Takahiro Matsumoto,1,2* Yuki Matsushima,1* Masaaki Toda,1 Ziaurahman Roeen,1 Corina N D'Alessandro-Gabazza,1,5 Josephine A Hinneh,1 Etsuko Harada,1,3 Taro Yasuma,4 Yutaka Yano,4 Masahito Urawa,1,5 Tetsu Kobayashi,5 Osamu Taguchi,5 Esteban C Gabazza1 1Department of Immunology, Mie University Graduate School of Medicine, Tsu, Mie Prefecture, 2BONAC Corporation, BIO Factory 4F, Fukuoka, 3Iwade Research Institute of Mycology, 4Department of Endocrinology, Diabetes and Metabolism, 5Department of Pulmonary and Critical Care Medicine, Mie University Graduate School of Medicine, Tsu, Mie Prefecture, Japan *These authors contributed equally to this work Background: Previous studies have demonstrated the beneficial activity of activated protein C in allergic diseases including bronchial asthma and rhinitis. However, the exact mechanism of action of activated protein C in allergies is unclear. In this study, we hypothesized that pharmacological doses of activated protein C can modulate allergic inflammation by inhibiting dendritic cells. Materials and methods: Dendritic cells were prepared using murine bone marrow progenitor cells and human peripheral monocytes. Bronchial asthma was induced in mice that received intratracheal instillation of ovalbumin-pulsed dendritic cells. Results: Activated protein C significantly increased the differentiation of tolerogenic plasmacytoid dendritic cells and the secretion of type I interferons, but it significantly reduced lipopolysaccharide-mediated maturation and the secretion of inflammatory cytokines in myeloid dendritic cells. Activated protein C also inhibited maturation and the secretion of inflammatory cytokines in monocyte-derived dendritic cells. Activated protein C-treated dendritic cells were less effective when differentiating naïve CD4 T-cells from Th1 or Th2 cells, and the cellular effect of activated protein C was mediated by its receptors. Mice that received adoptive transfer of activated protein C

  7. Reporting C-14 activities and concentrations

    NARCIS (Netherlands)

    Mook, WG; van der Plicht, J

    1999-01-01

    Three modes of reporting C-14 activities are in use, in part analogous to the internationally accepted (IAEA) conventions for stable isotopes: (1) absolute activity, the specific activity of C-14 or the activity per gram of carbon; (2) activity ratio, the ratio between the absolute activities of a s

  8. HUD Initiated Activity Cancellation Reports

    Data.gov (United States)

    Department of Housing and Urban Development — This monthly report displays all HOME activities automatically cancelled by IDIS. Effective January 1, 2011, and the beginning of every month thereafter, committed...

  9. Work activities within sustainable development

    Directory of Open Access Journals (Sweden)

    Francisco Duarte

    2015-06-01

    Full Text Available This paper presents the main results of a Franco-Brazilian Research project entitled "Work, Innovation and Development". The aim is to conceptually consider work activity within sustainable development, and to contribute methodologically towards developing strategies for designing sustainable work systems. After a brief description of the factors and the dimensions that have contributed to the creation of ideas on sustainable development, we will put forward two main approaches for understanding work activity within the context of sustainability, these being: the durability of work activity and the development of work activities for sustainable development. Both approaches are presented and examples are given. This is followed by a discussion of the design of sustainable work systems that focuses particularly on the political and technical dimensions of project management.

  10. Low-Activity Radioactive Wastes

    Science.gov (United States)

    In 2003 EPA published an Advance Notice of Proposed Rulemaking (ANPR) to collect public comment on alternatives for disposal of waste containing low concentrations of radioactive material ('low-activity' waste).

  11. Healthy Active Kids South Africa

    African Journals Online (AJOL)

    on Physical Activity and Obesity in Children in Toronto, Canada, and witnessed ... government reports. e uptake this time was more promising, and the focus of ... right buttons, with promising signs that national, regional and local government ...

  12. 2012 Robotics Activities at JPL

    Science.gov (United States)

    Volpe, Richard

    2012-01-01

    The Robotics Section of the Jet Propulsion Laboratory (JPL), California Institute of Technology, is engaged in a full spectrum of flight project and research activities. This paper will provide an overview of these efforts, and discuss the recent accomplishments and future directions of them. Specific activities will be high- lighted based on their level of accomplishment, impact on the community, maturity, or novelty. Robotics activities on flight projects are a significant subset of the full effort for these large missions. Complementing flight activities is a diverse set of research efforts for NASA and other U.S. Government agencies. Future directions will be motivated by NASA and other sponsor objectives, as well as success experienced in these current endeavours.

  13. Sustainability of natural movement activity

    Directory of Open Access Journals (Sweden)

    Matthew Metzgar

    2012-08-01

    Full Text Available In recent years, there has been a focus on reducing energy consumption in commercial buildings as a means of increasing their sustainability. As part of this trend, various health clubs and fitness centers have been designed to lower consumption of resources such as electricity and water. However, energy consumption is just one part of sustainability, with human health and economic health also paramount. When all components of sustainability are analyzed, other forms of physical activity may possess higher levels of sustainability than traditional gym exercise. Natural movement activity consists of outdoor activity that replicates movements performed by ancient humans during the Paleolithic era. A full analysis of sustainability shows that natural movement activity consumes fewer resources and provides unique psychological and physical benefits compared with traditional indoor exercise.

  14. Active spectral imaging and mapping

    Science.gov (United States)

    Steinvall, Ove

    2014-04-01

    Active imaging and mapping using lasers as illumination sources have been of increasing interest during the last decades. Applications range from defense and security, remote sensing, medicine, robotics, and others. So far, these laser systems have mostly been based on a fix wavelength laser. Recent advances in lasers enable emission of tunable, multiline, or broadband emission, which together with the development of array detectors will extend the capabilities of active imaging and mapping. This paper will review some of the recent work on active imaging mainly for defense and security and remote sensing applications. A short survey of basic lidar relations and present fix wavelength laser systems is followed by a review of the benefits of adding the spectral dimension to active and/or passive electro-optical systems.

  15. Barriers for recess physical activity

    DEFF Research Database (Denmark)

    Pawlowski, Charlotte Skau; Tjørnhøj-Thomsen, Tine; Schipperijn, Jasper

    2014-01-01

    they would like to have more secluded areas added to the school playground, even in large schoolyards where lack of space was not a barrier. This aligned with girls' requests for more "hanging-out" facilities, whereas boys primarily wanted activity promoting facilities. CONCLUSION: Based on the results from......BACKGROUND: Many children, in particular girls, do not reach the recommended amount of daily physical activity. School recess provides an opportunity for both boys and girls to be physically active, but barriers to recess physical activity are not well understood. This study explores gender....... This was verified by a thematic analysis of transcripts from the open discussions and go-along interviews. RESULTS: The most frequently identified barriers for both boys and girls were weather, conflicts, lack of space, lack of play facilities and a newly-found barrier, use of electronic devices. While boys...

  16. Student-Centered Reading Activities.

    Science.gov (United States)

    Moffett, James; Wagner, Betty Jane

    1991-01-01

    Offers student-centered reading activities designed to bring students to reading maturity and involvement in literature. Discusses partner reading, dramatizing and performing texts, transforming texts, journal writing, discussion, and writing. (PRA)

  17. Towards physical activity support community

    NARCIS (Netherlands)

    Elloumi, Lamia; van Beijnum, Bernhard J.F.; Hermens, Hermanus J.

    Nowadays it is recognized that physical activity, besides other lifestyles, has indisputable beneficial affects on cardiovascular diseases prevention and treatment. Additionally the social support is important and has a valuable impact on the outcomes in cardiovascular disease patients. To provide

  18. Lobbying Semi-Annual Activity

    Data.gov (United States)

    Montgomery County of Maryland — This dataset contains Registration and Activity Reporting information lobbyists have provided. The dollar figures in the far right columns are the total of expenses...

  19. From Lurker to Active Participant

    NARCIS (Netherlands)

    Sloep, Peter; Kester, Liesbeth

    2009-01-01

    The original publication is available from www.springerlink.com. Sloep, P. B., & Kester, L. (2009). From Lurker to Active Participant. In R. Koper (Ed)., Learning Network Services for Professional Development (pp. 17-26). Berlin, Germany: Springer Verlag.

  20. Active Learning with Multiple Views

    CERN Document Server

    Knoblock, C A; Muslea, I; 10.1613/jair.2005

    2011-01-01

    Active learners alleviate the burden of labeling large amounts of data by detecting and asking the user to label only the most informative examples in the domain. We focus here on active learning for multi-view domains, in which there are several disjoint subsets of features (views), each of which is sufficient to learn the target concept. In this paper we make several contributions. First, we introduce Co-Testing, which is the first approach to multi-view active learning. Second, we extend the multi-view learning framework by also exploiting weak views, which are adequate only for learning a concept that is more general/specific than the target concept. Finally, we empirically show that Co-Testing outperforms existing active learners on a variety of real world domains such as wrapper induction, Web page classification, advertisement removal, and discourse tree parsing.

  1. Active vs. inactive muscle (image)

    Science.gov (United States)

    ... may lose 20 to 40 percent of their muscle -- and, along with it, their strength -- as they ... have found that a major reason people lose muscle is because they stop doing everyday activities that ...

  2. Dynamics of Minor Solar Activity \

    Science.gov (United States)

    Cauzzi, G.; Vial, J. C.; Falciani, R.; Falchi, A.; Smaldone, L. A.

    We present a program for coordinated observations between ground based observatories, mainly NSO/Sacramento Peak, and several instruments onboard SOHO (primarily SUMER). The scientific goal is the study of small activity phenomena, at high spatial and temporal resolution.

  3. The Communes and Cultural Activities

    Science.gov (United States)

    Koski, Heikki; Seikkula, Ari

    1973-01-01

    Discusses Finland's system of cultural services provided for communes that includes adult education, art activities, entertainment and physical culture. Article outlines the scope of the available and planned programs. (GB)

  4. Response to work activity guidance

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This memorandum is concerning the request from the FY95 Platte-Kansas Rivers Ecosystem Work Activity Guidance for refuge managers to review the purposes of refuges...

  5. Exploring neuronal activity with photons

    Science.gov (United States)

    Bourdieu, Laurent; Léger, Jean-François

    2015-10-01

    The following sections are included: * Introduction * Information coding * Optical recordings of neuronal activity * Functional organization of the cortex at the level of a cortical column * Microarchitecture of a cortical column * Dynamics of neuronal populations * Outlook * Bibliography

  6. Antileishmanial activity of lapachol analogues

    Directory of Open Access Journals (Sweden)

    Nadja MF Lima

    2004-11-01

    Full Text Available The antileishmanial activity of lapachol, isolapachol, and dihydrolapachol, along with soluble derivatives (potassium salt and acetate was obtained. All the compounds were assayed against metacyclic promastigotes of two different species of Leishmania associated to tegumentar leishmaniasis: L. amazonensis and L. braziliensis. All compounds presented significant activity, being isolapachol acetate the most active against promastigotes, with IC50/24h = 1.6 ± 0.0 µg/ml and 3.4 ± 0.5 µg/ml for, respectively, L. amazonensis and L. braziliensis. This compound was also assayed in vivo against L. amazonensis and showed to be active. Its toxicity in vitro was also established, and at concentration similar to the IC50, no toxicity was evidenced. In all experiments, pentamidine isethionate was used as a reference drug. The present results reinforce the potential use of substituted hydroxyquinones and derivatives as promising antileishmanial drugs and suggest a continuing study within this class of compounds.

  7. Nonisothermal activation: nonlinear transport theory

    NARCIS (Netherlands)

    Dekker, H.; Maassen van den Brink, A.

    1998-01-01

    We present the statistical mechanical foundation of nonisothermal stochastic processes, thereby generalizing Kramers' Fokker-Planck model for thermal activation and providing a microscopic context for Rolf Landauer's original ideas on state-dependent diffusion. By applying projection operator method

  8. Be active – eat well

    CERN Multimedia

    2009-01-01

    The campaign was held from 25 to 29 May 2009, and was organised by the Medical Service jointly with the Restaurants Supervisory Committee, CERN Management, the Staff Association and CHIS, with the active support of CERN restaurants.

  9. Autocatalytic activation of influenza hemagglutinin.

    Science.gov (United States)

    Lee, Jeong H; Goulian, Mark; Boder, Eric T

    2006-12-01

    Enveloped viruses contain surface proteins that mediate fusion between the viral and target cell membranes following an activating stimulus. Acidic pH induces the influenza virus fusion protein hemagglutinin (HA) via irreversible refolding of a trimeric conformational state leading to exposure of hydrophobic fusion peptides on each trimer subunit. Herein, we show that cells expressing fowl plague virus HA demonstrate discrete switching behavior with respect to the HA conformational change. Partially activated states do not exist at the scale of the cell, activation of HA leads to aggregation of cell surface trimers, and newly synthesized HA refold spontaneously in the presence of previously activated HA. These observations imply a feedback mechanism involving self-catalyzed refolding of HA and thus suggest a mechanism similar to the autocatalytic refolding and aggregation of prions.

  10. Active Interrogation for Spent Fuel

    Energy Technology Data Exchange (ETDEWEB)

    Swinhoe, Martyn Thomas [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Dougan, Arden [National Nuclear Security Administration (NNSA), Washington, DC (United States)

    2015-11-05

    The DDA instrument for nuclear safeguards is a fast, non-destructive assay, active neutron interrogation technique using an external 14 MeV DT neutron generator for characterization and verification of spent nuclear fuel assemblies.

  11. Anthelmintic activity of Pongamia glabra

    Directory of Open Access Journals (Sweden)

    R.B. Laware

    2007-05-01

    Full Text Available Leaves, wood, seed, bark and pericarp of the fruit of Pongamia glabra were separately dried, powdered and extracted with methanol in Soxhlet extractor. Anthelmintic activity of these various extracts was evaluatedon Indian adult earthworms, Pherentima posthuma. Results showed that the seed part of P. glabra took less time to cause paralysis and death of the earthworms; therefore, seeds were extracted successively withpetroleum ether, ethyl acetate and methanol in Soxhlet extractor. Again these extracts were screened for anthelmintic activity. Results showed that the ethyl acetate extract of seeds of P. glabra was most potentfollowed by petroleum ether extract. It can be concluded that anthelmintic activity of the seed of P. glabra is due to the active principles present mostly in the ethyl acetate and petroleum ether extracts.

  12. Active Interrogation for Spent Fuel

    Energy Technology Data Exchange (ETDEWEB)

    Swinhoe, Martyn Thomas [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Dougan, Arden [National Nuclear Security Administration (NNSA), Washington, DC (United States)

    2015-11-05

    The DDA instrument for nuclear safeguards is a fast, non-destructive assay, active neutron interrogation technique using an external 14 MeV DT neutron generator for characterization and verification of spent nuclear fuel assemblies.

  13. Antioxidant activity of polyaniline nanofibers

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Well-confined uniform polyaniline (PANT) nanofibers were synthesized by using photo-assisted chemical oxidative polymerization of aniline in the presence of different dopant acids, and the radical scavenging ability of the produced PANI nanofibers was determined by the DPPH assay. It was found that the antioxidant activity of PANI nanofibers was higher than conventional PANI,and increased with decreasing of averaged diameter of the nanofibers. The enhanced antioxidant activity was concerned with increased surface area of PANI nanofibers.

  14. Optimal constructions for active diagnosis

    OpenAIRE

    Haar, Stefan; Haddad, Serge; Melliti, Tarek; Schwoon, Stefan

    2017-01-01

    International audience; Diagnosis is the task of detecting fault occurrences in a partially observed system. Depending on the possible observations, a discrete-event system may be diagnosable or not. Active diagnosis aims at controlling the system to render it diagnosable. Past research has proposed solutions for this problem, but their complexity remains to be improved. Here, we solve the decision and synthesis problems for active diagnosability, proving that (1) our procedures are optimal w...

  15. Thermally activated technologies: Technology Roadmap

    Energy Technology Data Exchange (ETDEWEB)

    None, None

    2003-05-01

    The purpose of this Technology Roadmap is to outline a set of actions for government and industry to develop thermally activated technologies for converting America’s wasted heat resources into a reservoir of pollution-free energy for electric power, heating, cooling, refrigeration, and humidity control. Fuel flexibility is important. The actions also cover thermally activated technologies that use fossil fuels, biomass, and ultimately hydrogen, along with waste heat.

  16. Complement Activation Alters Platelet Function

    Science.gov (United States)

    2015-12-01

    Award Number: W81XWH-12-1-0523 TITLE: Complement Activation Alters Platelet Function PRINCIPAL INVESTIGATOR: George Tsokos, M.D. CONTRACTING...Activation Alters Platelet Function 5a. CONTRACT NUMBER 5b. GRANT NUMBER W81XWH-12-1-0523 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR(S) George Tsokos, M.D...a decreased level of disease. Further studies will expand upon these observations better outlining the function of platelets in the injury associated

  17. Antimalarial Activity of Azadipeptide Nitriles

    OpenAIRE

    Löser, Reik; Gut, Jiri; ROSENTHAL, Philip J.; Frizler, Maxim; Gütschow, Michael; Andrews, Katherine T.

    2009-01-01

    Azadipeptide nitriles – novel cysteine protease inhibitors – display structure-dependent antimalarial activity against both chloroquine-sensitive and chloroquine-resistant lines of cultured Plasmodium falciparum malaria parasites. Inhibition of parasite’s haemoglobin-degrading cysteine proteases was also investigated, revealing the azadipeptide nitriles as potent inhibitors of falcipain-2 and -3. A correlation between the cysteine protease-inhibiting activity and the antimalarial potential of...

  18. Anticandidal Activity of Asparagus racemosus

    OpenAIRE

    B. Uma; Prabhakar, K.; Rajendran, S.

    2009-01-01

    The in vitro anticandidal activity of Asparagus racemosus roots and tubers extract was investigated against Candida albicans, Candida tropicalis, Candida krusei, Candida guillermondii, Candida parapsilosis and Candida stellatoida, which are isolated from vaginal thrush patients. The extract of Asparagus racemosus showed high degree of activity against all the Candida strains. The inhibitory effect of the extract against all the Candida tested was found comparable with that of standard antibio...

  19. Antithrombin Activity of Erythrocyte Microvesicles.

    Science.gov (United States)

    Levin, G Ya; Sukhareva, E G

    2017-04-01

    Coagulation and optical (based on chromogenic substrate) methods were employed to examine antithrombin activity of erythrocytes and erythrocyte-derived microvesicles isolated days 7, 14, 21, and 28 on erythrocyte storage. The erythrocyte-derived microvesicles decelerated fibrin clot formation from fibrinogen in the presence of exogenous thrombin both with and without heparin. Microvesicles reduced optical density of chromogenic substrate. These data suggest that erythrocyte-derived microvesicles display a prominent antithrombin activity, which significantly increases during erythrocyte storage.

  20. Rheology of Active Filament Solutions

    OpenAIRE

    Liverpool, T. B.; Marchetti, M. Cristina

    2006-01-01

    We study the viscoelasticity of an active solution of polar biofilaments and motor proteins. Using a molecular model, we derive the constitutive equations for the stress tensor in the isotropic phase and in phases with liquid crystalline order. The stress relaxation in the various phases is discussed. Contractile activity is responsible for a spectacular difference in the viscoelastic properties on opposite sides of the order-disorder transition.

  1. Social Activity in the Internet

    Directory of Open Access Journals (Sweden)

    M D Zavgorodniy

    2012-06-01

    Full Text Available The article reviews the definitions of social activity, existing in the scientific literature, and the author attempts to formulate his own definition so that subsequently, having described the specific nature of the virtual space on the basis of the latest studies of its Russian segment, it would be possible to propose a variant of the definition of social activity suitable for the analysis of the phenomena of interaction and communication in the Internet computer network.

  2. Thermally activated technologies: Technology Roadmap

    Energy Technology Data Exchange (ETDEWEB)

    None, None

    2003-05-01

    The purpose of this Technology Roadmap is to outline a set of actions for government and industry to develop thermally activated technologies for converting America’s wasted heat resources into a reservoir of pollution-free energy for electric power, heating, cooling, refrigeration, and humidity control. Fuel flexibility is important. The actions also cover thermally activated technologies that use fossil fuels, biomass, and ultimately hydrogen, along with waste heat.

  3. Face activated neurodynamic cortical networks.

    Science.gov (United States)

    Susac, Ana; Ilmoniemi, Risto J; Ranken, Doug; Supek, Selma

    2011-05-01

    Previous neuroimaging studies have shown that complex visual stimuli, such as faces, activate multiple brain regions, yet little is known on the dynamics and complexity of the activated cortical networks during the entire measurable evoked response. In this study, we used simulated and face-evoked empirical MEG data from an oddball study to investigate the feasibility of accurate, efficient, and reliable spatio-temporal tracking of cortical pathways over prolonged time intervals. We applied a data-driven, semiautomated approach to spatio-temporal source localization with no prior assumptions on active cortical regions to explore non-invasively face-processing dynamics and their modulation by task. Simulations demonstrated that the use of multi-start downhill simplex and data-driven selections of time intervals submitted to the Calibrated Start Spatio-Temporal (CSST) algorithm resulted in improved accuracy of the source localization and the estimation of the onset of their activity. Locations and dynamics of the identified sources indicated a distributed cortical network involved in face processing whose complexity was task dependent. This MEG study provided the first non-invasive demonstration, agreeing with intracranial recordings, of an early onset of the activity in the fusiform face gyrus (FFG), and that frontal activation preceded parietal for responses elicited by target faces.

  4. SOCIAL ACTIVITY OF STUDENT YOUTH

    Directory of Open Access Journals (Sweden)

    Anzhela I. BALOG

    2015-01-01

    Full Text Available The article is devoted to disclosure of features of social activity of modern student's youth. At the beginning of the article different classifications of social activity forms are described, that proves their great diversity. To identify specifics of social activity of modern student's youth we used the results of the survey conducted among university students in Kirov. We analyzed the readiness of students to participate in social activities; the popularity of various social organizations in the student environment; the expectations related to social activity and subjective self-determination of the level of social activity of student's youth. It should be noted that to date, indeed public youth organizations are well represented in our country. As for the student youth, then, of course, the most common of the non-governmental organizations in this environment are the bodies of the student government. They are represented by student councils, trade unions, student scientific society, student centers and personnel agencies, councils of dormitories and other organizations. The majority of respondents to impose requirements youth organizations develop their leadership and managerial qualities as well as promote selforganization of young people. This proves the need for the development of youth public organizations of competent state youth policy. 

  5. Cystamine preparations exhibit anticoagulant activity.

    Science.gov (United States)

    Aleman, Maria M; Holle, Lori A; Stember, Katherine G; Devette, Christa I; Monroe, Dougald M; Wolberg, Alisa S

    2015-01-01

    Transglutaminases are a superfamily of isoenzymes found in cells and plasma. These enzymes catalyze the formation of ε-N-(γ-glutamyl)-lysyl crosslinks between proteins. Cystamine blocks transglutaminase activity and is used in vitro in human samples and in vivo in mice and rats in studies of coagulation, immune dysfunction, and inflammatory disease. These studies have suggested cystamine blocks fibrin crosslinking and has anti-inflammatory effects, implicating transglutaminase activity in the pathogenesis of several diseases. We measured the effects of cystamine on fibrin crosslinking, tissue factor-triggered plasma clot formation and thrombin generation, and coagulation factor enzymatic activity. At concentrations that blocked fibrin crosslinking, cystamine also inhibited plasma clot formation and reduced thrombin generation. Cystamine inhibited the amidolytic activity of coagulation factor XI and thrombin towards chromogenic substrates. These findings demonstrate that cystamine exhibits anticoagulant activity during coagulation. Given the close relationship between coagulation and inflammation, these findings suggest prior studies that used cystamine to implicate transglutaminase activity in disease pathogenesis warrant re-examination.

  6. Cystamine preparations exhibit anticoagulant activity.

    Directory of Open Access Journals (Sweden)

    Maria M Aleman

    Full Text Available Transglutaminases are a superfamily of isoenzymes found in cells and plasma. These enzymes catalyze the formation of ε-N-(γ-glutamyl-lysyl crosslinks between proteins. Cystamine blocks transglutaminase activity and is used in vitro in human samples and in vivo in mice and rats in studies of coagulation, immune dysfunction, and inflammatory disease. These studies have suggested cystamine blocks fibrin crosslinking and has anti-inflammatory effects, implicating transglutaminase activity in the pathogenesis of several diseases. We measured the effects of cystamine on fibrin crosslinking, tissue factor-triggered plasma clot formation and thrombin generation, and coagulation factor enzymatic activity. At concentrations that blocked fibrin crosslinking, cystamine also inhibited plasma clot formation and reduced thrombin generation. Cystamine inhibited the amidolytic activity of coagulation factor XI and thrombin towards chromogenic substrates. These findings demonstrate that cystamine exhibits anticoagulant activity during coagulation. Given the close relationship between coagulation and inflammation, these findings suggest prior studies that used cystamine to implicate transglutaminase activity in disease pathogenesis warrant re-examination.

  7. Antileishmanial activity of polycyclic derivatives

    Directory of Open Access Journals (Sweden)

    Sarciron M.E.

    2005-09-01

    Full Text Available 33 polycyclic derivatives have been studied and tested on Leishmania donovani and L. major promastigotes. Their antileishmanial activity was assessed in vitro and an assay of their cytotoxicity was realized on human myelomonocytic cell line. The reference molecules used in the assays were amphotericin B and pentamidine. Among the compounds tested, 29 possess an antileishmanial activity; 25 of those were more active against L. donovani than amphotericin B, and nine were as effective as amphotericin B against L. major. Many synthesized derivatives were more active against L.donovani than against L. major. The cytotoxicity studies have shown that among the thirty-three derivatives tested, 12 molecules have an IC50 towards THP-1 cells about equal than that reference drugs, the 21 other derivatives are much less toxic. A 3D QSAR study was undertaken and has permitted to predict activity against L. donovani and L. major and to highlight critical area to optimize activity against the two species.

  8. Antimicrobial Activity of Resveratrol Analogues

    Directory of Open Access Journals (Sweden)

    Malik Chalal

    2014-06-01

    Full Text Available Stilbenes, especially resveratrol and its derivatives, have become famous for their positive effects on a wide range of medical disorders, as indicated by a huge number of published studies. A less investigated area of research is their antimicrobial properties. A series of 13 trans-resveratrol analogues was synthesized via Wittig or Heck reactions, and their antimicrobial activity assessed on two different grapevine pathogens responsible for severe diseases in the vineyard. The entire series, together with resveratrol, was first evaluated on the zoospore mobility and sporulation level of Plasmopara viticola (the oomycete responsible for downy mildew. Stilbenes displayed a spectrum of activity ranging from low to high. Six of them, including the most active ones, were subsequently tested on the development of Botrytis cinerea (fungus responsible for grey mold. The results obtained allowed us to identify the most active stilbenes against both grapevine pathogens, to compare the antimicrobial activity of the evaluated series of stilbenes, and to discuss the relationship between their chemical structure (number and position of methoxy and hydroxy groups and antimicrobial activity.

  9. Pedometer-determined physical activity and active transport in girls

    Directory of Open Access Journals (Sweden)

    Schofield Grant

    2008-01-01

    Full Text Available Abstract Background It is well established that the risk of insufficient physical activity is greater in girls than in boys, especially during the adolescent years. The promotion of active transport (AT to and from school has been posited as a practical and convenient solution for increasing girls' total daily activity. However, there is limited information describing the associations between AT choices and girls' physical activity across a range of age, ethnic, and socioeconomic groups. The objectives of this study were to (1 investigate physical activity patterns in a large multiethnic sample of female children and adolescents, and to (2 estimate the physical activity associated with AT to and from school. Methods A total of 1,513 girls aged 5–16 years wore sealed multiday memory (MDM pedometers for three weekdays and two weekend days. The ethnic composition of this sample was 637 European (42.1%, 272 Pacific Island (18.0%, 207 East Asian (13.7%, 179 Maori (11.8%, 142 South Asian (9.4%, and 76 from other ethnic groups (5%. Pedometer compliance and school-related AT were assessed by questionnaire. Results Mean weekday step counts (12,597 ± 3,630 were higher and less variable than mean weekend steps (9,528 ± 4,407. A consistent decline in daily step counts was observed with age: after adjustment for ethnicity and SES, girls in school years 9–10 achieved 2,469 (weekday and 4,011 (weekend fewer steps than girls in years 1–2. Daily step counts also varied by ethnicity, with Maori girls the most active and South Asian girls the least active. Overall, 44.9% of participants used AT for school-related travel. Girls who used AT to and from school averaged 1,052 more weekday steps than those who did not use AT. However, the increases in steps associated with AT were significant only in older girls (school years 5–10 and in those of Maori or European descent. Conclusion Our data suggest that adolescent-aged girls and girls of Asian descent are

  10. Choleretic Activity of Turmeric and its Active Ingredients.

    Science.gov (United States)

    Wang, Yonglu; Wang, Liyao; Zhu, Xinyi; Wang, Dong; Li, Xueming

    2016-07-01

    Turmeric, a rhizome of Curcumin longa L. is widely used as both a spice and an herbal medicine. The traditional use of turmeric in gastroenterology is mainly based on its choleretic activity. The aim of this study is to determine the effects of turmeric on bile flow (BF) and total bile acids (TBAs) excretion in a bile fistula rat model after acute duodenal administration. A significant dose-dependent enhancement in both BF and TBAs was detected after treatment with the turmeric decoctions which suggested the choleretic activity was bile acid-dependent secretion. In order to direct the active group of compounds, aqueous (AE), ethyl acetate (EtOAc), and petroleum ether (PE) extracts were investigated. The EtOAc and PE extracts showing high effects were purified to locate the active ingredients. Three curcuminoids (curcumin, demethoxycurcumin, and bisdemethoxycurcumin) and 2 sesquiterpenes (bisacurone B and ar-turmerone) were isolated. It was found Bisacurone B was the most potent choleretic ingredient followed by ar-turmerone, bisdemethoxycurcumin demethoxycurcumin, and then curcumin. The amounts of the active ingredients were quantitatively analyzed by high-performance liquid chromatography. The EtOAc and PE extracts had high sesquiterpenes and curcuminoids content, while the AE extract had poor content of sesquiterpenes and curcuminoids which affected neither BF nor TBAs. Based on the results of multiple linear regression analysis, the content of BIS and TUR were dominant factors (P < 0.01) of controlling BL and TBAs in EtOAC and PE extracts.

  11. Low intensity ultrasound stimulates biological activity of aerobic activated sludge

    Institute of Scientific and Technical Information of China (English)

    LIU Hong; YAN Yixin; WANG Wenyan; YU Yongyong

    2007-01-01

    This work aims to explore a procedure to improve biological wastewater treatment efficiency using low intensity ultrasound.The aerobic activated sludge from a municipal wastewater treatment plant was used as the experimental material.Oxygen uptake rate(OUR)of the activated sludge (AS)was determined to indicate the changes of AS activity stimulated by ultrasound at 35 kHZ for 0-40 min with ultrasonic intensities of 0-1.2 W/cm2.The highest OUR was observed at the ultrasonic intensity of 0.3 W/cm2 and an irradiation period of 10 min;more than 15% increase was achieved immediately after sonication.More significantly,the AS activity stimulated by ultrasound could last 24 h after sonication,and the AS activity achieved its peak value within 8 h after sonication.or nearly 100% higher than the initial level after sonication.Therefore,to improve the wastewater treatment efficiency of bioreactors,ultrasound with an intensity of 0.3 W/cm2 could be employed to irradiate a part of the AS in the bioreactor for 10 min every 8 h.

  12. Activate Omaha: the journey to an active living environment.

    Science.gov (United States)

    Huberty, Jennifer L; Dodge, Tammie; Peterson, Kerri; Balluff, Mary

    2009-12-01

    Omaha, an urban Nebraska community, represents 26% of the state's population. Activate Omaha, formed in 2003, addressed the obesity epidemic caused by physical inactivity and poor infrastructure to support active living in the community. Activate Omaha's efforts focused on a strategic social-marketing campaign, using baseline and annual data for guidance. Complementary programming was implemented parallel to the marketing campaigns. Safe Routes to School infrastructure projects were federally funded, and 20 miles of on-street bicycle facilities were funded privately. The mayor's Bicycle Pedestrian Advisory Committee was formed, including directors from city planning and public works. The initiative became recognized by the community as the lead resource promoting physical activity. This enabled the initiative to be instrumental in infrastructure changes and programming targeting the underserved. The initiative leveraged an additional $1,475,000 over 5 years. These funds created opportunities to invest in shared community resources such as providing bicycles for underserved youth, building infrastructure through Safe Routes to School initiatives, and successful worksite programming. Partners should be utilized in a strategic manner, where they are engaged purposefully and serve a role in assuring successful outcomes. Community readiness should determine the focus on policy, physical projects, and promotional and programmatic strategies, as well as the integration of these strategies. Activate Omaha grew into a credible organization moving public policy and leveraging new public-private relationships through multilevel strategies. This approach ultimately led to sustainable changes in the community infrastructure and the behavior of its citizens.

  13. Intrinsic Patterns of Human Activity

    Science.gov (United States)

    Hu, Kun; Ivanov, Plamen Ch.; Chen, Zhi; Hilton, Michael; Stanley, H. Eugene; Shea, Steven

    2003-03-01

    Activity is one of the defining features of life. Control of human activity is complex, being influenced by many factors both extrinsic and intrinsic to the body. The most obvious extrinsic factors that affect activity are the daily schedule of planned events, such as work and recreation, as well as reactions to unforeseen or random events. These extrinsic factors may account for the apparently random fluctuations in human motion observed over short time scales. The most obvious intrinsic factors are the body clocks including the circadian pacemaker that influences our sleep/wake cycle and ultradian oscillators with shorter time scales [2, 3]. These intrinsic rhythms may account for the underlying regularity in average activity level over longer periods of up to 24 h. Here we ask if the known extrinsic and intrinsic factors fully account for all complex features observed in recordings of human activity. To this end, we measure activity over two weeks from forearm motion in subjects undergoing their regular daily routine. Utilizing concepts from statistical physics, we demonstrate that during wakefulness human activity possesses previously unrecognized complex dynamic patterns. These patterns of activity are characterized by robust fractal and nonlinear dynamics including a universal probability distribution and long-range power-law correlations that are stable over a wide range of time scales (from minutes to hours). Surprisingly, we find that these dynamic patterns are unaffected by changes in the average activity level that occur within individual subjects throughout the day and on different days of the week, and between subjects. Moreover, we find that these patterns persist when the same subjects undergo time-isolation laboratory experiments designed to account for the phase of the circadian pacemaker, and control the known extrinsic factors by restricting behaviors and manipulating scheduled events including the sleep/wake cycle. We attribute these newly

  14. IDENTIFICATION AND ECOPHYSIOLOGY OF ACTIVE DENITRIFIERS IN ACTIVATED SLUDGE

    DEFF Research Database (Denmark)

    Hansen, Aviaja Anna; Le-Quy, Vang; Nielsen, Kåre Lehmann

    reactor studies. To obtain better identification of active denitrifying communities in full-scale wastewater treatment plants (WWTPs) we applied DNA-SIP with 13C-labelled substrates, and RT-PCR of expressed denitrification genes (nirS, nirK and nosZ) upon various substrate-inductions. To come around...... the bias of horizontal gene transfer, the identities were verified by microautoradiography (MAR) combined with fluorescence in situ hybridization (FISH) with incorporation of radio-labelled substrates under denitrifying conditions. The in situ abundances of the identified denitrifiers in different WWTPs...... were determined with quantitative FISH, while their active metabolic pathways were investigated directly in activated sludge with a tag-based metatranscriptomic approach under acetate-utilizing and denitrifying conditions. The different methods revealed a majority of denitrifiers in all WWTPs belonging...

  15. Foundations of Active Control - Active Noise Reduction Helmets

    DEFF Research Database (Denmark)

    Elmkjær, Torsten Haaber Leth

    2008-01-01

    This Ph.D. thesis includes fundamental considerations about topologies, algorithms, implementations, methods etc., that can enter in the next generation of active control (AC) systems. Specifically, a new variant of feedforward control referred to as confined feedforward active control (CFFAC......-output (MIMO) system that facilitates both feedforward and feedback control. The general system is then referred to as hybrid MIMO confined-feedforward feedback (HMIMOCFFFB) active noise reduction (ANR) system. The investigation of a multi-channel ANR system with hybrid feedforward and feedback topologies...... be computational intensive takes place at an even slower sampling rate hereby relaxing the requirements on a high bandwidth. It is demonstrated that computational savings as high as 40% can be achieved in a 192, 24, 3 kHz triple-rate system as compared with a 24 kHz single-rate system without sacrificing the ANR...

  16. Antibacterial activity of epidural infusions.

    Science.gov (United States)

    Coghlan, M W; Davies, M J; Hoyt, C; Joyce, L; Kilner, R; Waters, M J

    2009-01-01

    The incidence of epidural abscess following epidural catheterisation appears to be increasing, being recently reported as one in 1000 among surgical patients. This study was designed to investigate the antibacterial activity of various local anaesthetics and additives, used in epidural infusions, against a range of micro-organisms associated with epidural abscess. The aim was to determine which, if any, epidural infusion solution has the greatest antibacterial activity. Bupivacaine, ropivacaine and levobupivacaine crystals were dissolved and added to Mueller-Hinton Agar in concentrations of 0.06%, 0.125%, 0.2%, 0.25%, 0.5% and 1%. Fentanyl, adrenaline and clonidine were also mixed with agar in isolation and in combination with the local anaesthetics. Using a reference agar dilution method, the minimum inhibitory concentrations were determined for a range of bacteria. Bupivacaine showed antibacterial activity against Staphylococcus aureus, Enterococcus faecalis and Escherichia coli with minimum inhibitory concentrations between 0.125% and 0.25%. It did not inhibit the growth of Pseudomonas aeruginosa at any of the concentrations tested. Levobupivacaine and ropivacaine showed no activity against Staphylococcus aureus, Enterococcus faecalis and Pseudomonas aeruginosa, even at the highest concentrations tested, and minimal activity against Escherichia coli (minimum inhibitory concentrations 0.5% and 1% respectively). The presence of fentanyl, adrenaline and clonidine had no additional effect on the antibacterial activity of any of the local anaesthetic agents. The low concentrations of local anaesthetic usually used in epidural infusions have minimal antibacterial activity. While the clinical implications of this in vitro study are not known, consideration should be given to increasing the concentration of bupivacaine in an epidural infusion or to administering a daily bolus of 0.25% bupivacaine to reduce the risk of epidural bacterial growth.

  17. Energy Balance and Physical Activity

    Institute of Scientific and Technical Information of China (English)

    KALLAYAKIJBOONCHOO

    2001-01-01

    The prevalence of obesity is increasing in most parts of the world and becoming one of the major global public health problems.Although the components of energy balance have not been adequately estimated over time,available evidence suggests that the increase in obesity is the result of reduced physical activity.Increases in physical activity have been showen to be strongly associated with improving physical fitness and body composition,with probably a positive effect on resting metabolic rate.The Surgeon General's Report on physical Activity and Health advocates that 30 min of regular,moderate-intensity physical activity is associated with decreases in the risk of chronic diseases and may contribute to quality of life.However,the small changes that contribute 10 min for 3 times a day for 3 times a day for aerobic training,or one set instead of three sets of repetitions on resistance training will provide individuals training,or one set instead of three sets of repetitions on resistance training will provide individuals with health benefits.Indeed,nutrition and physical activity should be considered an integral part of fitness and good health,and should be encouraged in all age groups,particularly early in life,The question is no longer centerd around the health benefit of increasing physical activity,but rather creating self awareness and behavior changes in individuals,Hence,effective intervention programs are needed that foster long term changes in physical activity.Among various interventions,the Nutrifit program was recently conducted in Thailand and found to improve health related fitness in children,The development of more effective interventions and approaches is a major challege in this field today.

  18. Activities as a research resource

    Directory of Open Access Journals (Sweden)

    Carla Regina Silva

    2013-12-01

    Full Text Available Activities play a guiding central role in occupational therapy, articulating to its utilization, the understanding and assessment of its capabilities in numerous and different interventions arising from this field. In this study, we aim to present the use of activities as a research methodology resource. Considering the pathways studied in a master’s research followed by a PhD work, some applications of this resource are reported as a powerful strategy of investigation for the occupational therapy researcher. It is about structuring, systematizing, and analyzing the activities proposed in professional practice by the theoretical and methodological rigor used in the research works. It emphasizes how the use of these activities can be considered important data, records, instruments and sources for different research methods, especially for qualitative analyses. Workshop activities were offered in the above mentioned studies; they were used as communication instruments and expressions of personal and collective experiences, supplying data to understand the actions of subjects and collectives. Furthermore, this strategy was applied as spaces of experimentation, learning and expression, where each participant was conceived as an active being of the process, in a way that the proposal could result in democratic experiences that reflected greater interest and participation, and a more complex presentation of the research data. It is worth mentioning that other methodological procedures, which substantiated the analyses and interpretation of the data collected, were also used. It was possible to conclude that activities, mainly as a qualitative research resource, constituted materialities in different languages and expressions that enriched the analyses arising from micro-realities, producing a repertoire of information that supported the interpretations required for the investigative processes.

  19. Activity assessment of eosinophilic esophagitis.

    Science.gov (United States)

    Schoepfer, Alain; Safroneeva, Ekaterina

    2014-01-01

    The activity of eosinophilic esophagitis (EoE) can be assessed with patient-reported outcomes and biologic measures. Patient-reported outcomes include symptoms and quality of life, whereas biologic measures refer to endoscopic, histologic, and biochemical activity (e.g. blood biomarkers). So far, a validated tool to assess EoE activity in the above-mentioned dimensions is lacking. Given the lack of a standardized way to assess EoE activity in the various dimensions, the results of different clinical trials may be difficult to compare. For symptom assessment in adult patients, the symptom 'dysphagia' should be evaluated according to different standardized food consistencies. Furthermore, symptom assessment should take into account the following items: avoidance of specific food categories, food modification, and time to eat a regular meal. A distinct symptom recall period (e.g. 2 weeks) has to be defined for symptom assessment. Performing an 'esophageal stress test' with ingestion of a standardized meal to measure symptom severity bears the potential risk of acute food bolus impaction and should therefore be avoided. The description of endoscopic findings in EoE has meanwhile been standardized. Histologic evaluation of EoE activity should report either the size of the high-power field used or count the eosinophils per mm(2). There is a current lack of blood biomarkers demonstrating a good correlation with histologic activity in esophageal biopsies. The development and validation of an adult and pediatric EoE activity index is urgently needed not only for clinical trials and observational studies, but also for daily practice.

  20. Pollen indicators of human activity

    Institute of Scientific and Technical Information of China (English)

    LI YiYin; ZHOU LiPing; CUI HaiTing

    2008-01-01

    The study of past human activities and their environmental effect is high in the agenda of global change research. A record of pollen assemblages is one of the most common proxies employed for detecting the impact of human activities on the landscape. In this review, we provide a summary and discussion on the recent progress on the use of pollen as indicators of human activity. For most of the studies related to human impact, the following features have been focused on: (1) decline of certain tree pollen; (2) flourishing of pioneer plant pollen; (3) concomitant occurrence of cereal-type pollen and cropland weed pollen; (4) abrupt changes in pollen concentration and richness; and (5) occurrence of nitrophilous plants and pastoral weed. Pollen of anthropogenic plants (weeds and cereal-type plants) is ideal indicators of human activities. Different types of human activities will result in different pollen assem-blages. Patterns of human-impacted pollen spectra would vary between forested areas and grassland. In the study of human impact with pollen data, high resolution in both time and space must be consid-ered. High resolution in space will help to inform the complexity of the landscape. More importantly, it can help to reveal the interference of human activities on the landscape, hence avoiding the bias cre-ated by the limited data points. Fine resolution in time will make accurate recording of short-lived events possible, hence avoiding the exclusion of events related to human activities. The combination of palynology with other proxies will help to decipher more accurately landscape changes through time. Charcoal is a particularly useful proxy for recording the disturbance of humans on vegetation. Its peak values usually occur with pronounced drop of tree pollen and significant rise of anthropogenic pollen.